F493306

General Info

Members Datasets Scaffolds Average Seq Length
1358 373 2716 322

Family's Representative Sequence

Representative Sequence 3300025935|Ga0207709_10247618|Ga0207709_102476181
Length 370
Sequence MSQAVQVSLLVPAKDEAENLPEFVRLCAEALTAAPFSFEVVIVDDGSRDDSASLLARLRAEHPFLRVVTHRRQRGIADALRSASEAATGDILVFYPADLQYLPSDIPALVAPILSGEADIVTGTKQGRYEKAFVSGVYNALCRRLFGVKVEDLNSVKAWRAEITRNVSLRPDWHRYMVVIAAVDGFRLDSRPVPLHPRKHGVSKFNWRRIPVGVIDLISVWFQIRFGRKPMLFFGVAGAVLFLIGLLAGIIALVLRFGXXXXFRPLLNLVETMVICGVVLFGFGFVGELIAGMREEQRELLRFLPPPSELSAREAEVLRLVAEGLSDGEIAARLIVSPHTVHRHVANIRTKLGQPSRAAAAADATRRGLI

Samples

Sample ID Description Type Environment
1 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
83 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
84 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
100 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
115 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
116 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
117 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
118 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
119 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
126 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
199 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
200 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
201 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
202 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
203 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
204 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
205 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
206 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
207 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
208 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
209 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
210 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
211 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
212 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
213 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
214 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
215 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
216 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
217 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
218 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
219 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
220 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
221 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
222 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
223 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
224 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
225 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
226 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
227 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
228 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
229 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
230 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
231 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
232 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
233 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
236 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
237 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
238 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
239 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
240 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
241 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
242 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
243 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
244 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
245 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
246 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
247 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
248 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
249 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
250 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
251 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
252 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
253 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
254 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
255 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
256 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
257 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
258 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
259 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
260 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
261 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
262 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
263 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
264 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
265 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
266 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
267 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
268 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
269 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
270 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
271 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
272 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
273 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
274 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
275 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
276 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
277 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
278 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
279 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
280 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
281 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
282 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
283 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
284 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
285 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
286 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
287 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
288 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
289 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
290 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
291 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
292 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
293 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
294 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
295 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
296 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
297 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
298 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
299 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
300 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
301 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
302 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
303 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
304 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
305 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
306 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
307 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
308 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
309 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
310 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
311 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
312 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
313 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
314 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
315 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
316 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
317 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
318 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
319 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
334 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
335 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
336 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
337 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
338 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
339 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
340 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
341 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
342 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
343 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
344 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
345 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
346 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
347 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
348 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
349 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
350 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
351 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
352 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
353 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
356 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
357 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
358 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
359 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
360 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
361 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
362 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
363 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
364 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
365 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
366 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
367 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
368 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
369 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
370 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
371 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
372 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
373 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.85
Metatranscriptomes 0.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.31
Rhizosphere 96.54
Stem 0
Stem Tuber 0
Unclassified 4.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207709_10247618 3300025935 Bacteria 1300
2 MBSR1b_contig_3324880 2162886012 Bacteria 2228
3 JGI24752J21851_1011504 3300001976 Bacteria 1158
4 JGI24737J22298_10035544 3300001990 Unclassified 1541
5 Ga0058863_10002510 3300004799 Bacteria 3768
6 Ga0065712_10091947 3300005290 Bacteria 2348
7 Ga0065715_10108757 3300005293 Bacteria 2702
8 Ga0065715_10139884 3300005293 Unclassified 1870
9 Ga0070658_10001114 3300005327 Bacteria 22934
10 Ga0070658_10006876 3300005327 Bacteria 9194
11 Ga0070658_10008230 3300005327 Bacteria 8386
12 Ga0070658_10088574 3300005327 Bacteria 2548
13 Ga0070658_10136562 3300005327 Bacteria 2046
14 Ga0070658_10187659 3300005327 Bacteria 1742
15 Ga0070676_10121088 3300005328 Bacteria 1642
16 Ga0070683_100000998 3300005329 Bacteria 21199
17 Ga0070683_100013221 3300005329 Bacteria 7191
18 Ga0070683_100014484 3300005329 Bacteria 6900
19 Ga0070683_100019132 3300005329 Bacteria 6078
20 Ga0070683_100019244 3300005329 Bacteria 6064
21 Ga0070683_100029690 3300005329 Bacteria 4954
22 Ga0070683_100051215 3300005329 Unclassified 3822
23 Ga0070683_100085545 3300005329 Bacteria 2956
24 Ga0070683_100087340 3300005329 Bacteria 2925
25 Ga0070683_100087887 3300005329 Bacteria 2915
26 Ga0070683_100127782 3300005329 Bacteria 2404
27 Ga0070683_100204198 3300005329 Bacteria 1877
28 Ga0070683_100337900 3300005329 Bacteria 1434
29 Ga0070690_100030384 3300005330 Bacteria 3357
30 Ga0070690_100151977 3300005330 Bacteria 1580
31 Ga0070670_100000545 3300005331 Bacteria 29977
32 Ga0070670_100005337 3300005331 Bacteria 10836
33 Ga0070677_10002094 3300005333 Bacteria 6357
34 Ga0068869_100007637 3300005334 Bacteria 6923
35 Ga0068869_100047898 3300005334 Bacteria 3089
36 Ga0068869_100292290 3300005334 Bacteria 1313
37 Ga0070666_10032300 3300005335 Bacteria 3457
38 Ga0070666_10039426 3300005335 Bacteria 3149
39 Ga0070680_100000074 3300005336 Bacteria 53742
40 Ga0070680_100000413 3300005336 Bacteria 29124
41 Ga0070680_100003658 3300005336 Bacteria 11490
42 Ga0070680_100003960 3300005336 Bacteria 11077
43 Ga0070680_100004433 3300005336 Bacteria 10569
44 Ga0070680_100005930 3300005336 Bacteria 9271
45 Ga0070680_100012040 3300005336 Bacteria 6712
46 Ga0070680_100013319 3300005336 Bacteria 6405
47 Ga0070680_100054875 3300005336 Bacteria 3255
48 Ga0070680_100069126 3300005336 Bacteria 2900
49 Ga0070680_100073879 3300005336 Bacteria 2804
50 Ga0070680_100090146 3300005336 Bacteria 2538
51 Ga0070680_100167821 3300005336 Bacteria 1846
52 Ga0070682_100004414 3300005337 Bacteria 7804
53 Ga0070682_100163464 3300005337 Bacteria 1540
54 Ga0070682_100212709 3300005337 Bacteria 1371
55 Ga0068868_100005889 3300005338 Bacteria 8645
56 Ga0070660_100001958 3300005339 Bacteria 14198
57 Ga0070660_100025383 3300005339 Bacteria 4405
58 Ga0070660_100048150 3300005339 Bacteria 3273
59 Ga0070660_100078566 3300005339 Bacteria 2587
60 Ga0070660_100201138 3300005339 Bacteria 1616
61 Ga0070660_100266243 3300005339 Bacteria 1400
62 Ga0070689_100015702 3300005340 Bacteria 5528
63 Ga0070689_100164365 3300005340 Bacteria 1796
64 Ga0070689_100182749 3300005340 Unclassified 1704
65 Ga0070691_10001670 3300005341 Bacteria 9618
66 Ga0070691_10007813 3300005341 Bacteria 4895
67 Ga0070691_10013212 3300005341 Bacteria 3783
68 Ga0070687_100102100 3300005343 Bacteria 1608
69 Ga0070661_100005342 3300005344 Bacteria 8862
70 Ga0070661_100006352 3300005344 Bacteria 8151
71 Ga0070661_100006568 3300005344 Bacteria 8020
72 Ga0070661_100009437 3300005344 Bacteria 6752
73 Ga0070661_100015646 3300005344 Bacteria 5354
74 Ga0070661_100282636 3300005344 Bacteria 1288
75 Ga0070692_10056741 3300005345 Bacteria 2052
76 Ga0070692_10074155 3300005345 Bacteria 1819
77 Ga0070692_10107852 3300005345 Bacteria 1536
78 Ga0070668_100001979 3300005347 Bacteria 14966
79 Ga0070668_100007235 3300005347 Bacteria 8230
80 Ga0070668_100016181 3300005347 Bacteria 5580
81 Ga0070669_100015410 3300005353 Bacteria 5447
82 Ga0070669_100153597 3300005353 Bacteria 1783
83 Ga0070675_100000777 3300005354 Bacteria 22314
84 Ga0070675_100003949 3300005354 Bacteria 11241
85 Ga0070675_100176653 3300005354 Bacteria 1844
86 Ga0070675_100214230 3300005354 Bacteria 1675
87 Ga0070675_100229123 3300005354 Bacteria 1620
88 Ga0070675_100255088 3300005354 Bacteria 1536
89 Ga0070675_100327503 3300005354 Bacteria 1354
90 Ga0070671_100029155 3300005355 Bacteria 4550
91 Ga0070671_100044899 3300005355 Bacteria 3672
92 Ga0070671_100212372 3300005355 Bacteria 1641
93 Ga0070671_100245767 3300005355 Bacteria 1519
94 Ga0070674_100000378 3300005356 Bacteria 22336
95 Ga0070674_100031767 3300005356 Bacteria 3502
96 Ga0070674_100046773 3300005356 Bacteria 2962
97 Ga0070674_100059766 3300005356 Bacteria 2654
98 Ga0070674_100084226 3300005356 Bacteria 2280
99 Ga0070674_100202808 3300005356 Unclassified 1533
100 Ga0070673_100047043 3300005364 Bacteria 3354
101 Ga0070673_100057293 3300005364 Bacteria 3078
102 Ga0070673_100109188 3300005364 Bacteria 2292
103 Ga0070673_100217393 3300005364 Bacteria 1652
104 Ga0070688_100015113 3300005365 Bacteria 4384
105 Ga0070688_100205160 3300005365 Bacteria 1381
106 Ga0070659_100000726 3300005366 Bacteria 23942
107 Ga0070659_100001533 3300005366 Bacteria 16660
108 Ga0070659_100047921 3300005366 Bacteria 3354
109 Ga0070659_100080860 3300005366 Bacteria 2595
110 Ga0070659_100086400 3300005366 Bacteria 2510
111 Ga0070659_100244549 3300005366 Bacteria 1486
112 Ga0070659_100351343 3300005366 Bacteria 1237
113 Ga0070667_100006589 3300005367 Bacteria 9654
114 Ga0070667_100073170 3300005367 Bacteria 2922
115 Ga0070667_100196899 3300005367 Bacteria 1786
116 Ga0070667_100312953 3300005367 Bacteria 1416
117 Ga0070667_100431310 3300005367 Bacteria 1202
118 Ga0070703_10000072 3300005406 Bacteria 50010
119 Ga0070709_10003005 3300005434 Bacteria 9077
120 Ga0070709_10019622 3300005434 Bacteria 3911
121 Ga0070714_100005258 3300005435 Bacteria 9860
122 Ga0070714_100007482 3300005435 Bacteria 8501
123 Ga0070714_100221057 3300005435 Bacteria 1740
124 Ga0070714_100304316 3300005435 Bacteria 1487
125 Ga0070714_100311809 3300005435 Bacteria 1469
126 Ga0070713_100001395 3300005436 Bacteria 15475
127 Ga0070713_100031379 3300005436 Bacteria 4232
128 Ga0070713_100228991 3300005436 Bacteria 1689
129 Ga0070710_10037005 3300005437 Bacteria 2672
130 Ga0070710_10136293 3300005437 Bacteria 1501
131 Ga0070701_10018517 3300005438 Bacteria 3274
132 Ga0070701_10018955 3300005438 Bacteria 3243
133 Ga0070701_10021050 3300005438 Bacteria 3106
134 Ga0070701_10026509 3300005438 Bacteria 2827
135 Ga0070701_10127911 3300005438 Bacteria 1440
136 Ga0070711_100142639 3300005439 Bacteria 1798
137 Ga0070711_100216852 3300005439 Unclassified 1485
138 Ga0070705_100002554 3300005440 Bacteria 9147
139 Ga0070705_100002844 3300005440 Bacteria 8628
140 Ga0070705_100021616 3300005440 Bacteria 3425
141 Ga0070705_100024921 3300005440 Bacteria 3236
142 Ga0070705_100035744 3300005440 Bacteria 2787
143 Ga0070705_100082669 3300005440 Bacteria 1977
144 Ga0070705_100130359 3300005440 Bacteria 1639
145 Ga0070700_100005908 3300005441 Bacteria 6507
146 Ga0070700_100166264 3300005441 Bacteria 1523
147 Ga0070694_100000767 3300005444 Bacteria 17957
148 Ga0070694_100003473 3300005444 Bacteria 9433
149 Ga0070694_100005169 3300005444 Bacteria 7874
150 Ga0070694_100010198 3300005444 Bacteria 5786
151 Ga0070694_100069965 3300005444 Bacteria 2415
152 Ga0070694_100150556 3300005444 Bacteria 1699
153 Ga0070694_100223379 3300005444 Bacteria 1414
154 Ga0070708_100000170 3300005445 Bacteria 46089
155 Ga0070708_100008540 3300005445 Bacteria 8230
156 Ga0070708_100122182 3300005445 Bacteria 2403
157 Ga0070708_100162821 3300005445 Bacteria 2079
158 Ga0070708_100391801 3300005445 Bacteria 1310
159 Ga0070663_100015151 3300005455 Bacteria 4967
160 Ga0070663_100055490 3300005455 Bacteria 2836
161 Ga0070678_100023130 3300005456 Bacteria 4135
162 Ga0070662_100000290 3300005457 Bacteria 29689
163 Ga0070662_100001016 3300005457 Bacteria 17162
164 Ga0070662_100010812 3300005457 Bacteria 6010
165 Ga0070662_100025718 3300005457 Bacteria 4068
166 Ga0070662_100053243 3300005457 Bacteria 2929
167 Ga0070662_100057167 3300005457 Bacteria 2834
168 Ga0070662_100156262 3300005457 Bacteria 1780
169 Ga0070662_100177365 3300005457 Bacteria 1678
170 Ga0070681_10000380 3300005458 Bacteria 35836
171 Ga0070681_10000841 3300005458 Bacteria 25746
172 Ga0070681_10004130 3300005458 Bacteria 13733
173 Ga0070681_10009348 3300005458 Bacteria 9644
174 Ga0070681_10035538 3300005458 Bacteria 5006
175 Ga0070681_10050026 3300005458 Bacteria 4171
176 Ga0070681_10077208 3300005458 Bacteria 3289
177 Ga0070681_10231086 3300005458 Bacteria 1764
178 Ga0068867_100001302 3300005459 Bacteria 17244
179 Ga0068867_100177233 3300005459 Bacteria 1692
180 Ga0070706_100017417 3300005467 Bacteria 6630
181 Ga0070706_100035766 3300005467 Bacteria 4586
182 Ga0070706_100057009 3300005467 Bacteria 3604
183 Ga0070706_100120749 3300005467 Bacteria 2443
184 Ga0070706_100428798 3300005467 Bacteria 1230
185 Ga0070706_100489853 3300005467 Unclassified 1144
186 Ga0070707_100005597 3300005468 Bacteria 11739
187 Ga0070707_100008444 3300005468 Bacteria 9567
188 Ga0070707_100010336 3300005468 Bacteria 8688
189 Ga0070707_100010473 3300005468 Bacteria 8637
190 Ga0070707_100014038 3300005468 Bacteria 7506
191 Ga0070707_100055458 3300005468 Bacteria 3799
192 Ga0070707_100091208 3300005468 Bacteria 2950
193 Ga0070707_100136224 3300005468 Bacteria 2389
194 Ga0070707_100139334 3300005468 Bacteria 2360
195 Ga0070707_100162085 3300005468 Bacteria 2179
196 Ga0070707_100198186 3300005468 Bacteria 1957
197 Ga0070707_100333813 3300005468 Unclassified 1473
198 Ga0070698_100000037 3300005471 Bacteria 92307
199 Ga0070698_100002580 3300005471 Bacteria 19948
200 Ga0070698_100008726 3300005471 Bacteria 10917
201 Ga0070698_100016814 3300005471 Bacteria 7715
202 Ga0070698_100029962 3300005471 Bacteria 5647
203 Ga0070698_100042943 3300005471 Bacteria 4637
204 Ga0070698_100070184 3300005471 Bacteria 3516
205 Ga0070698_100074457 3300005471 Bacteria 3401
206 Ga0070698_100092687 3300005471 Bacteria 3002
207 Ga0070698_100288043 3300005471 Bacteria 1573
208 Ga0070699_100001113 3300005518 Bacteria 25024
209 Ga0070699_100002242 3300005518 Bacteria 17436
210 Ga0070699_100003489 3300005518 Bacteria 13902
211 Ga0070699_100008908 3300005518 Bacteria 8693
212 Ga0070699_100009101 3300005518 Bacteria 8611
213 Ga0070699_100012828 3300005518 Bacteria 7224
214 Ga0070699_100030641 3300005518 Bacteria 4644
215 Ga0070699_100051232 3300005518 Bacteria 3574
216 Ga0070699_100061031 3300005518 Bacteria 3268
217 Ga0070699_100095808 3300005518 Bacteria 2599
218 Ga0070699_100115628 3300005518 Bacteria 2357
219 Ga0070699_100117766 3300005518 Bacteria 2335
220 Ga0070699_100134605 3300005518 Bacteria 2180
221 Ga0070699_100246181 3300005518 Bacteria 1597
222 Ga0070699_100276797 3300005518 Bacteria 1503
223 Ga0070699_100305266 3300005518 Bacteria 1428
224 Ga0070679_100002320 3300005530 Bacteria 17220
225 Ga0070679_100002482 3300005530 Bacteria 16711
226 Ga0070679_100006378 3300005530 Bacteria 10984
227 Ga0070679_100009621 3300005530 Bacteria 9143
228 Ga0070679_100020819 3300005530 Bacteria 6398
229 Ga0070679_100036659 3300005530 Bacteria 4867
230 Ga0070679_100062093 3300005530 Bacteria 3724
231 Ga0070679_100076937 3300005530 Bacteria 3325
232 Ga0070679_100129908 3300005530 Unclassified 2501
233 Ga0070679_100144964 3300005530 Unclassified 2353
234 Ga0070679_100257622 3300005530 Bacteria 1700
235 Ga0070679_100263344 3300005530 Bacteria 1679
236 Ga0070684_100002962 3300005535 Bacteria 12637
237 Ga0070684_100008607 3300005535 Bacteria 7993
238 Ga0070684_100054921 3300005535 Bacteria 3471
239 Ga0070684_100113377 3300005535 Bacteria 2433
240 Ga0070684_100136248 3300005535 Unclassified 2218
241 Ga0070684_100144322 3300005535 Bacteria 2154
242 Ga0070684_100177567 3300005535 Bacteria 1936
243 Ga0070684_100198402 3300005535 Bacteria 1828
244 Ga0070684_100278448 3300005535 Bacteria 1532
245 Ga0070684_100281138 3300005535 Bacteria 1525
246 Ga0070684_100397158 3300005535 Bacteria 1271
247 Ga0070697_100001282 3300005536 Bacteria 18927
248 Ga0070697_100002404 3300005536 Bacteria 14414
249 Ga0070697_100030212 3300005536 Bacteria 4352
250 Ga0070697_100045499 3300005536 Bacteria 3556
251 Ga0070697_100047299 3300005536 Bacteria 3488
252 Ga0070697_100090607 3300005536 Bacteria 2527
253 Ga0070697_100457600 3300005536 Bacteria 1112
254 Ga0068853_100278107 3300005539 Bacteria 1543
255 Ga0070672_100159327 3300005543 Bacteria 1871
256 Ga0070672_100159996 3300005543 Bacteria 1867
257 Ga0070672_100186856 3300005543 Bacteria 1728
258 Ga0070672_100208609 3300005543 Bacteria 1636
259 Ga0070672_100231963 3300005543 Bacteria 1551
260 Ga0070686_100059599 3300005544 Bacteria 2460
261 Ga0070695_100004134 3300005545 Bacteria 8479
262 Ga0070695_100005429 3300005545 Bacteria 7499
263 Ga0070695_100005764 3300005545 Bacteria 7297
264 Ga0070695_100010694 3300005545 Bacteria 5484
265 Ga0070695_100012134 3300005545 Bacteria 5166
266 Ga0070695_100016264 3300005545 Bacteria 4500
267 Ga0070695_100023241 3300005545 Bacteria 3807
268 Ga0070695_100039079 3300005545 Bacteria 2997
269 Ga0070695_100057980 3300005545 Bacteria 2503
270 Ga0070695_100099820 3300005545 Bacteria 1953
271 Ga0070696_100000510 3300005546 Bacteria 24577
272 Ga0070696_100000976 3300005546 Bacteria 18550
273 Ga0070696_100002442 3300005546 Bacteria 12318
274 Ga0070696_100004651 3300005546 Bacteria 9165
275 Ga0070696_100006913 3300005546 Bacteria 7575
276 Ga0070696_100008566 3300005546 Bacteria 6842
277 Ga0070696_100018590 3300005546 Bacteria 4700
278 Ga0070696_100020719 3300005546 Bacteria 4455
279 Ga0070696_100034919 3300005546 Bacteria 3461
280 Ga0070696_100037590 3300005546 Bacteria 3340
281 Ga0070696_100142721 3300005546 Bacteria 1752
282 Ga0070693_100007479 3300005547 Bacteria 5341
283 Ga0070693_100021141 3300005547 Bacteria 3444
284 Ga0070693_100067237 3300005547 Bacteria 2100
285 Ga0070665_100105573 3300005548 Bacteria 2819
286 Ga0070665_100280275 3300005548 Bacteria 1669
287 Ga0070704_100000762 3300005549 Bacteria 15854
288 Ga0070704_100004286 3300005549 Bacteria 8244
289 Ga0070704_100008201 3300005549 Bacteria 6249
290 Ga0070704_100010543 3300005549 Bacteria 5627
291 Ga0070704_100011411 3300005549 Bacteria 5446
292 Ga0070704_100012284 3300005549 Bacteria 5287
293 Ga0070704_100021614 3300005549 Bacteria 4175
294 Ga0070704_100028831 3300005549 Bacteria 3698
295 Ga0070704_100046385 3300005549 Bacteria 3030
296 Ga0068855_100009620 3300005563 Bacteria 11663
297 Ga0068855_100015470 3300005563 Bacteria 9185
298 Ga0068855_100051521 3300005563 Bacteria 4849
299 Ga0068855_100054125 3300005563 Bacteria 4718
300 Ga0068855_100054576 3300005563 Bacteria 4697
301 Ga0068855_100073823 3300005563 Bacteria 3963
302 Ga0068855_100145576 3300005563 Bacteria 2698
303 Ga0068855_100200005 3300005563 Bacteria 2250
304 Ga0070664_100002877 3300005564 Bacteria 13947
305 Ga0070664_100010902 3300005564 Bacteria 7370
306 Ga0070664_100026090 3300005564 Bacteria 4845
307 Ga0070664_100064713 3300005564 Bacteria 3119
308 Ga0070664_100127592 3300005564 Bacteria 2232
309 Ga0070664_100230988 3300005564 Bacteria 1658
310 Ga0070664_100233476 3300005564 Bacteria 1649
311 Ga0070664_100329999 3300005564 Bacteria 1384
312 Ga0068857_100005146 3300005577 Bacteria 11122
313 Ga0068857_100005151 3300005577 Bacteria 11119
314 Ga0068857_100015574 3300005577 Bacteria 6642
315 Ga0068857_100021174 3300005577 Bacteria 5721
316 Ga0068857_100041282 3300005577 Bacteria 4091
317 Ga0068857_100142020 3300005577 Bacteria 2171
318 Ga0068857_100147554 3300005577 Bacteria 2129
319 Ga0068854_100001114 3300005578 Bacteria 16150
320 Ga0068854_100006569 3300005578 Bacteria 7405
321 Ga0068856_100031723 3300005614 Bacteria 5170
322 Ga0068856_100123412 3300005614 Bacteria 2592
323 Ga0068856_100180165 3300005614 Bacteria 2126
324 Ga0068856_100231845 3300005614 Bacteria 1861
325 Ga0070702_100003169 3300005615 Bacteria 7293
326 Ga0070702_100105654 3300005615 Bacteria 1736
327 Ga0068852_100006187 3300005616 Bacteria 8631
328 Ga0068852_100038569 3300005616 Bacteria 4016
329 Ga0068852_100051599 3300005616 Bacteria 3531
330 Ga0068852_100126434 3300005616 Bacteria 2348
331 Ga0068852_100203009 3300005616 Bacteria 1876
332 Ga0068859_100005677 3300005617 Bacteria 12699
333 Ga0068859_100022805 3300005617 Bacteria 6276
334 Ga0068859_100347603 3300005617 Bacteria 1578
335 Ga0068859_100692502 3300005617 Unclassified 1110
336 Ga0068864_100002802 3300005618 Bacteria 14393
337 Ga0068864_100010018 3300005618 Bacteria 7824
338 Ga0068864_100213683 3300005618 Bacteria 1777
339 Ga0068864_100391659 3300005618 Bacteria 1319
340 Ga0068864_100421049 3300005618 Bacteria 1272
341 Ga0068866_10000401 3300005718 Bacteria 20182
342 Ga0068866_10138587 3300005718 Unclassified 1393
343 Ga0068861_100000364 3300005719 Bacteria 26004
344 Ga0068861_100051823 3300005719 Bacteria 3117
345 Ga0068861_100081205 3300005719 Bacteria 2538
346 Ga0068851_10057196 3300005834 Bacteria 1991
347 Ga0068870_10003912 3300005840 Bacteria 6355
348 Ga0068870_10042640 3300005840 Bacteria 2363
349 Ga0068863_100003141 3300005841 Bacteria 16310
350 Ga0068863_100341490 3300005841 Bacteria 1457
351 Ga0068858_100040883 3300005842 Bacteria 4300
352 Ga0068858_100202258 3300005842 Bacteria 1878
353 Ga0068858_100360283 3300005842 Bacteria 1394
354 Ga0068858_100390187 3300005842 Bacteria 1337
355 Ga0068860_100008736 3300005843 Bacteria 10090
356 Ga0068860_100038640 3300005843 Bacteria 4566
357 Ga0068860_100208145 3300005843 Bacteria 1897
358 Ga0068860_100222385 3300005843 Bacteria 1833
359 Ga0068862_100004058 3300005844 Bacteria 12411
360 Ga0068862_100005592 3300005844 Bacteria 10501
361 Ga0068862_100124858 3300005844 Bacteria 2271
362 Ga0081455_10025751 3300005937 Bacteria 5424
363 Ga0081538_10039338 3300005981 Bacteria 3034
364 Ga0081539_10008986 3300005985 Bacteria 8498
365 Ga0070716_100021124 3300006173 Bacteria 3426
366 Ga0070716_100082864 3300006173 Bacteria 1919
367 Ga0070712_100057282 3300006175 Bacteria 2737
368 Ga0070712_100337944 3300006175 Unclassified 1229
369 Ga0097621_100015842 3300006237 Bacteria 5683
370 Ga0097621_100286288 3300006237 Bacteria 1452
371 Ga0068871_100028026 3300006358 Unclassified 4411
372 Ga0075428_100022755 3300006844 Bacteria 6934
373 Ga0075428_100062985 3300006844 Bacteria 4060
374 Ga0075428_100115375 3300006844 Bacteria 2926
375 Ga0075430_100016293 3300006846 Bacteria 6331
376 Ga0075430_100037372 3300006846 Bacteria 4116
377 Ga0075430_100109903 3300006846 Bacteria 2299
378 Ga0075430_100139661 3300006846 Bacteria 2018
379 Ga0075431_100052677 3300006847 Bacteria 4196
380 Ga0075431_100063453 3300006847 Bacteria 3813
381 Ga0075431_100081554 3300006847 Bacteria 3340
382 Ga0075431_100189178 3300006847 Bacteria 2110
383 Ga0075431_100233776 3300006847 Unclassified 1872
384 Ga0075431_100249914 3300006847 Bacteria 1802
385 Ga0075431_100484624 3300006847 Unclassified 1229
386 Ga0075433_10004001 3300006852 Bacteria 11406
387 Ga0075433_10004074 3300006852 Bacteria 11327
388 Ga0075433_10013983 3300006852 Bacteria 6545
389 Ga0075433_10026026 3300006852 Bacteria 4949
390 Ga0075433_10064689 3300006852 Bacteria 3206
391 Ga0075434_100006449 3300006871 Bacteria 10753
392 Ga0075434_100010304 3300006871 Bacteria 8763
393 Ga0075434_100013833 3300006871 Bacteria 7695
394 Ga0075434_100022999 3300006871 Bacteria 6068
395 Ga0075434_100034022 3300006871 Bacteria 5030
396 Ga0075434_100038953 3300006871 Bacteria 4710
397 Ga0075434_100043884 3300006871 Bacteria 4435
398 Ga0075434_100075352 3300006871 Bacteria 3367
399 Ga0075434_100078264 3300006871 Bacteria 3302
400 Ga0075434_100087772 3300006871 Bacteria 3112
401 Ga0075434_100163249 3300006871 Bacteria 2247
402 Ga0075434_100183701 3300006871 Unclassified 2112
403 Ga0075434_100187303 3300006871 Bacteria 2090
404 Ga0075434_100190376 3300006871 Bacteria 2072
405 Ga0075434_100265560 3300006871 Bacteria 1735
406 Ga0075434_100417390 3300006871 Bacteria 1363
407 Ga0075429_100001523 3300006880 Bacteria 19059
408 Ga0075429_100040646 3300006880 Bacteria 4049
409 Ga0075429_100060576 3300006880 Bacteria 3297
410 Ga0075429_100186621 3300006880 Bacteria 1817
411 Ga0075429_100216545 3300006880 Bacteria 1678
412 Ga0068865_100003327 3300006881 Bacteria 9628
413 Ga0068865_100003920 3300006881 Bacteria 8930
414 Ga0068865_100025474 3300006881 Bacteria 3891
415 Ga0068865_100082061 3300006881 Bacteria 2317
416 Ga0075436_100000571 3300006914 Bacteria 24085
417 Ga0075436_100010480 3300006914 Bacteria 6355
418 Ga0075436_100026519 3300006914 Bacteria 3990
419 Ga0075436_100027275 3300006914 Bacteria 3931
420 Ga0075436_100030577 3300006914 Bacteria 3706
421 Ga0075436_100037135 3300006914 Bacteria 3364
422 Ga0075436_100077218 3300006914 Unclassified 2307
423 Ga0075436_100188310 3300006914 Unclassified 1460
424 Ga0075436_100300154 3300006914 Bacteria 1151
425 Ga0097620_100005677 3300006931 Bacteria 12699
426 Ga0097620_100022806 3300006931 Bacteria 6276
427 Ga0097620_100347582 3300006931 Bacteria 1578
428 Ga0097620_100692539 3300006931 Unclassified 1110
429 Ga0075435_100002070 3300007076 Bacteria 13150
430 Ga0075435_100026094 3300007076 Bacteria 4554
431 Ga0075435_100077732 3300007076 Bacteria 2721
432 Ga0075435_100079287 3300007076 Bacteria 2694
433 Ga0075435_100109526 3300007076 Bacteria 2296
434 Ga0075435_100158752 3300007076 Bacteria 1904
435 Ga0075435_100181754 3300007076 Bacteria 1777
436 Ga0075435_100230996 3300007076 Bacteria 1572
437 Ga0075435_100293791 3300007076 Bacteria 1389
438 Ga0075435_100318526 3300007076 Bacteria 1331
439 Ga0099794_10000178 3300007265 Bacteria 23179
440 Ga0099794_10021608 3300007265 Bacteria 2925
441 Ga0099794_10065122 3300007265 Bacteria 1777
442 Ga0099795_10006951 3300007788 Bacteria 3124
443 Ga0105240_10010311 3300009093 Bacteria 13153
444 Ga0105240_10038754 3300009093 Bacteria 6110
445 Ga0105240_10053547 3300009093 Bacteria 5065
446 Ga0105240_10074675 3300009093 Bacteria 4184
447 Ga0105240_10090847 3300009093 Bacteria 3732
448 Ga0105240_10102245 3300009093 Bacteria 3483
449 Ga0111539_10032459 3300009094 Bacteria 6339
450 Ga0111539_10045772 3300009094 Bacteria 5236
451 Ga0111539_10065230 3300009094 Bacteria 4304
452 Ga0111539_10074441 3300009094 Bacteria 4001
453 Ga0111539_10441721 3300009094 Bacteria 1515
454 Ga0105245_10032173 3300009098 Bacteria 4643
455 Ga0105245_10096433 3300009098 Bacteria 2729
456 Ga0105245_10250874 3300009098 Bacteria 1719
457 Ga0105245_10379305 3300009098 Bacteria 1408
458 Ga0105245_10438425 3300009098 Bacteria 1312
459 Ga0105247_10069873 3300009101 Bacteria 2193
460 Ga0114129_10001639 3300009147 Bacteria 30412
461 Ga0114129_10007805 3300009147 Bacteria 15222
462 Ga0114129_10066146 3300009147 Bacteria 5042
463 Ga0114129_10070357 3300009147 Bacteria 4879
464 Ga0114129_10271166 3300009147 Bacteria 2270
465 Ga0114129_10403136 3300009147 Unclassified 1802
466 Ga0114129_10725711 3300009147 Bacteria 1275
467 Ga0105243_10002610 3300009148 Bacteria 15026
468 Ga0105243_10200282 3300009148 Bacteria 1751
469 Ga0105241_10000025 3300009174 Bacteria 132929
470 Ga0105241_10007428 3300009174 Bacteria 8068
471 Ga0105241_10104215 3300009174 Bacteria 2259
472 Ga0105241_10153651 3300009174 Bacteria 1885
473 Ga0105242_10001397 3300009176 Bacteria 19028
474 Ga0105248_10000658 3300009177 Bacteria 39283
475 Ga0105248_10015291 3300009177 Bacteria 8461
476 Ga0105248_10037957 3300009177 Bacteria 5389
477 Ga0105248_10053356 3300009177 Bacteria 4537
478 Ga0105248_10089736 3300009177 Bacteria 3460
479 Ga0105248_10099483 3300009177 Bacteria 3277
480 Ga0105248_10266431 3300009177 Bacteria 1928
481 Ga0105248_10474646 3300009177 Bacteria 1410
482 Ga0105237_10097585 3300009545 Bacteria 2929
483 Ga0105237_10386456 3300009545 Bacteria 1404
484 Ga0105249_10000083 3300009553 Bacteria 135844
485 Ga0105249_10001049 3300009553 Bacteria 24466
486 Ga0105249_10001200 3300009553 Bacteria 22851
487 Ga0105249_10007224 3300009553 Bacteria 9691
488 Ga0105249_10022839 3300009553 Bacteria 5607
489 Ga0105239_10060464 3300010375 Bacteria 4158
490 Ga0105239_10069697 3300010375 Bacteria 3863
491 Ga0105239_10219021 3300010375 Bacteria 2134
492 Ga0105239_10385941 3300010375 Bacteria 1584
493 Ga0105246_10000937 3300011119 Bacteria 16710
494 Ga0105246_10254715 3300011119 Bacteria 1395
495 Ga0157373_10020264 3300013100 Bacteria 4837
496 Ga0157373_10029175 3300013100 Bacteria 3976
497 Ga0157373_10042096 3300013100 Bacteria 3265
498 Ga0157373_10209151 3300013100 Unclassified 1376
499 Ga0157373_10253927 3300013100 Bacteria 1244
500 Ga0157371_10028628 3300013102 Bacteria 4032
501 Ga0157371_10056882 3300013102 Bacteria 2774
502 Ga0157371_10109814 3300013102 Bacteria 1958
503 Ga0157371_10208561 3300013102 Bacteria 1402
504 Ga0157370_10001352 3300013104 Bacteria 30418
505 Ga0157370_10009331 3300013104 Bacteria 10503
506 Ga0157370_10023060 3300013104 Bacteria 6187
507 Ga0157370_10301032 3300013104 Unclassified 1480
508 Ga0157369_10004455 3300013105 Bacteria 16501
509 Ga0157369_10010646 3300013105 Bacteria 10469
510 Ga0157369_10032769 3300013105 Bacteria 5711
511 Ga0157369_10036813 3300013105 Bacteria 5360
512 Ga0157369_10148309 3300013105 Bacteria 2480
513 Ga0157369_10186626 3300013105 Bacteria 2180
514 Ga0157369_10270608 3300013105 Bacteria 1770
515 Ga0157369_10422969 3300013105 Bacteria 1381
516 Ga0157374_10021577 3300013296 Bacteria 5733
517 Ga0157374_10021754 3300013296 Bacteria 5712
518 Ga0157374_10107989 3300013296 Bacteria 2674
519 Ga0157378_10033195 3300013297 Bacteria 4561
520 Ga0157378_10055874 3300013297 Bacteria 3517
521 Ga0157378_10078557 3300013297 Bacteria 2977
522 Ga0157378_10083622 3300013297 Bacteria 2889
523 Ga0157378_10102274 3300013297 Bacteria 2617
524 Ga0157378_10322468 3300013297 Bacteria 1501
525 Ga0163162_10039491 3300013306 Bacteria 4717
526 Ga0163162_10207242 3300013306 Bacteria 2090
527 Ga0157372_10001740 3300013307 Bacteria 23617
528 Ga0157372_10002494 3300013307 Bacteria 19954
529 Ga0157372_10003084 3300013307 Bacteria 17944
530 Ga0157372_10005801 3300013307 Bacteria 13150
531 Ga0157372_10010221 3300013307 Bacteria 9964
532 Ga0157372_10019475 3300013307 Bacteria 7315
533 Ga0157372_10063803 3300013307 Bacteria 4132
534 Ga0157372_10071687 3300013307 Unclassified 3902
535 Ga0157372_10080213 3300013307 Bacteria 3691
536 Ga0157372_10081523 3300013307 Bacteria 3662
537 Ga0157372_10102646 3300013307 Bacteria 3267
538 Ga0157372_10154299 3300013307 Bacteria 2652
539 Ga0157372_10156622 3300013307 Bacteria 2631
540 Ga0157372_10166347 3300013307 Bacteria 2550
541 Ga0157372_10308089 3300013307 Bacteria 1843
542 Ga0157372_10441787 3300013307 Bacteria 1516
543 Ga0157372_10492516 3300013307 Bacteria 1429
544 Ga0157372_10780076 3300013307 Bacteria 1111
545 Ga0157375_10041631 3300013308 Bacteria 4438
546 Ga0157375_10068267 3300013308 Bacteria 3557
547 Ga0157375_10117344 3300013308 Bacteria 2766
548 Ga0157375_10276113 3300013308 Bacteria 1843
549 Ga0157375_10483416 3300013308 Bacteria 1403
550 Ga0163163_10137410 3300014325 Bacteria 2485
551 Ga0163163_10336543 3300014325 Bacteria 1564
552 Ga0157380_10009811 3300014326 Bacteria 6872
553 Ga0157380_10093235 3300014326 Bacteria 2490
554 Ga0157380_10137122 3300014326 Bacteria 2096
555 Ga0157380_10257193 3300014326 Bacteria 1584
556 Ga0182008_10024756 3300014497 Bacteria 3053
557 Ga0182008_10076374 3300014497 Bacteria 1648
558 Ga0157377_10002859 3300014745 Bacteria 7706
559 Ga0157377_10005428 3300014745 Bacteria 5990
560 Ga0157379_10005967 3300014968 Bacteria 10498
561 Ga0157379_10093822 3300014968 Bacteria 2693
562 Ga0157379_10302135 3300014968 Bacteria 1459
563 Ga0157376_10259046 3300014969 Bacteria 1628
564 Ga0157376_10330617 3300014969 Bacteria 1452
565 Ga0157376_10482624 3300014969 Bacteria 1215
566 Ga0163161_10129020 3300017792 Bacteria 1906
567 Ga0206356_10784497 3300020070 Bacteria 2197
568 Ga0207697_10002904 3300025315 Bacteria 8674
569 Ga0207653_10000053 3300025885 Bacteria 87641
570 Ga0207653_10023574 3300025885 Bacteria 1960
571 Ga0207653_10024659 3300025885 Bacteria 1920
572 Ga0207653_10066532 3300025885 Bacteria 1225
573 Ga0207642_10000799 3300025899 Bacteria 9788
574 Ga0207642_10004837 3300025899 Bacteria 4359
575 Ga0207680_10045244 3300025903 Bacteria 2594
576 Ga0207699_10011001 3300025906 Bacteria 4558
577 Ga0207699_10120803 3300025906 Bacteria 1694
578 Ga0207645_10000052 3300025907 Bacteria 83428
579 Ga0207645_10000145 3300025907 Bacteria 55543
580 Ga0207645_10031145 3300025907 Bacteria 3434
581 Ga0207643_10002996 3300025908 Bacteria 9106
582 Ga0207643_10057395 3300025908 Bacteria 2216
583 Ga0207705_10001545 3300025909 Bacteria 18273
584 Ga0207705_10008946 3300025909 Bacteria 7293
585 Ga0207705_10022727 3300025909 Bacteria 4472
586 Ga0207705_10043874 3300025909 Bacteria 3213
587 Ga0207705_10079705 3300025909 Bacteria 2385
588 Ga0207705_10105316 3300025909 Bacteria 2079
589 Ga0207705_10147505 3300025909 Bacteria 1761
590 Ga0207684_10017658 3300025910 Bacteria 6121
591 Ga0207684_10049299 3300025910 Bacteria 3572
592 Ga0207684_10065732 3300025910 Bacteria 3079
593 Ga0207684_10098026 3300025910 Bacteria 2503
594 Ga0207654_10069856 3300025911 Bacteria 2083
595 Ga0207654_10088150 3300025911 Bacteria 1885
596 Ga0207654_10232462 3300025911 Bacteria 1228
597 Ga0207707_10000368 3300025912 Bacteria 47267
598 Ga0207707_10001843 3300025912 Bacteria 19422
599 Ga0207707_10002577 3300025912 Bacteria 16238
600 Ga0207707_10002663 3300025912 Bacteria 15948
601 Ga0207707_10005261 3300025912 Bacteria 11332
602 Ga0207707_10006129 3300025912 Bacteria 10510
603 Ga0207707_10019193 3300025912 Bacteria 5966
604 Ga0207707_10027900 3300025912 Bacteria 4936
605 Ga0207707_10028674 3300025912 Bacteria 4865
606 Ga0207707_10033518 3300025912 Bacteria 4494
607 Ga0207707_10092218 3300025912 Bacteria 2647
608 Ga0207707_10220628 3300025912 Bacteria 1650
609 Ga0207695_10005807 3300025913 Bacteria 16244
610 Ga0207695_10006323 3300025913 Bacteria 15408
611 Ga0207695_10006746 3300025913 Bacteria 14808
612 Ga0207695_10007672 3300025913 Bacteria 13663
613 Ga0207695_10082098 3300025913 Bacteria 3260
614 Ga0207671_10091208 3300025914 Bacteria 2296
615 Ga0207693_10011197 3300025915 Bacteria 7259
616 Ga0207693_10057046 3300025915 Bacteria 3061
617 Ga0207663_10204464 3300025916 Unclassified 1427
618 Ga0207660_10000017 3300025917 Bacteria 75942
619 Ga0207660_10000488 3300025917 Bacteria 26440
620 Ga0207660_10003121 3300025917 Bacteria 10835
621 Ga0207660_10007380 3300025917 Bacteria 7114
622 Ga0207660_10007539 3300025917 Bacteria 7043
623 Ga0207660_10011464 3300025917 Bacteria 5771
624 Ga0207660_10012885 3300025917 Bacteria 5476
625 Ga0207660_10038959 3300025917 Bacteria 3321
626 Ga0207660_10050522 3300025917 Bacteria 2953
627 Ga0207660_10056216 3300025917 Bacteria 2815
628 Ga0207660_10100214 3300025917 Bacteria 2163
629 Ga0207660_10112889 3300025917 Bacteria 2048
630 Ga0207660_10164593 3300025917 Bacteria 1713
631 Ga0207660_10282755 3300025917 Bacteria 1317
632 Ga0207662_10001708 3300025918 Bacteria 10753
633 Ga0207662_10046877 3300025918 Bacteria 2558
634 Ga0207657_10000432 3300025919 Bacteria 44554
635 Ga0207657_10001418 3300025919 Bacteria 25590
636 Ga0207657_10013214 3300025919 Bacteria 8104
637 Ga0207657_10017286 3300025919 Bacteria 6923
638 Ga0207657_10099066 3300025919 Bacteria 2421
639 Ga0207657_10127791 3300025919 Bacteria 2086
640 Ga0207657_10162901 3300025919 Bacteria 1811
641 Ga0207657_10334700 3300025919 Bacteria 1195
642 Ga0207649_10003178 3300025920 Bacteria 9006
643 Ga0207649_10005400 3300025920 Bacteria 6920
644 Ga0207649_10132163 3300025920 Bacteria 1697
645 Ga0207652_10000429 3300025921 Bacteria 43684
646 Ga0207652_10001247 3300025921 Bacteria 22702
647 Ga0207652_10002800 3300025921 Bacteria 14631
648 Ga0207652_10010571 3300025921 Bacteria 7429
649 Ga0207652_10019078 3300025921 Bacteria 5634
650 Ga0207652_10042163 3300025921 Bacteria 3883
651 Ga0207652_10061666 3300025921 Bacteria 3239
652 Ga0207652_10123627 3300025921 Bacteria 2304
653 Ga0207652_10142679 3300025921 Bacteria 2142
654 Ga0207652_10206844 3300025921 Bacteria 1767
655 Ga0207652_10245829 3300025921 Unclassified 1613
656 Ga0207646_10003549 3300025922 Bacteria 17535
657 Ga0207646_10006308 3300025922 Bacteria 12292
658 Ga0207646_10006748 3300025922 Bacteria 11816
659 Ga0207646_10010262 3300025922 Bacteria 9170
660 Ga0207646_10031963 3300025922 Bacteria 4764
661 Ga0207646_10049721 3300025922 Bacteria 3754
662 Ga0207646_10064341 3300025922 Bacteria 3273
663 Ga0207646_10077853 3300025922 Bacteria 2963
664 Ga0207646_10106574 3300025922 Bacteria 2514
665 Ga0207646_10134689 3300025922 Bacteria 2224
666 Ga0207646_10139062 3300025922 Bacteria 2187
667 Ga0207646_10151207 3300025922 Bacteria 2094
668 Ga0207646_10185404 3300025922 Bacteria 1879
669 Ga0207681_10004406 3300025923 Bacteria 8675
670 Ga0207681_10004849 3300025923 Bacteria 8264
671 Ga0207681_10009612 3300025923 Bacteria 5910
672 Ga0207681_10069411 3300025923 Bacteria 2451
673 Ga0207694_10011630 3300025924 Bacteria 6641
674 Ga0207650_10050505 3300025925 Bacteria 3076
675 Ga0207650_10105747 3300025925 Bacteria 2173
676 Ga0207659_10058534 3300025926 Bacteria 2766
677 Ga0207659_10382949 3300025926 Bacteria 1173
678 Ga0207687_10116260 3300025927 Bacteria 1993
679 Ga0207700_10010137 3300025928 Bacteria 5926
680 Ga0207700_10110534 3300025928 Bacteria 2210
681 Ga0207664_10026579 3300025929 Bacteria 4377
682 Ga0207664_10029190 3300025929 Bacteria 4199
683 Ga0207664_10069028 3300025929 Bacteria 2841
684 Ga0207644_10022470 3300025931 Bacteria 4310
685 Ga0207644_10024347 3300025931 Bacteria 4155
686 Ga0207644_10138201 3300025931 Bacteria 1873
687 Ga0207690_10011107 3300025932 Bacteria 5372
688 Ga0207690_10011507 3300025932 Bacteria 5288
689 Ga0207690_10034563 3300025932 Bacteria 3258
690 Ga0207690_10060821 3300025932 Bacteria 2565
691 Ga0207690_10095573 3300025932 Bacteria 2111
692 Ga0207706_10000146 3300025933 Bacteria 76821
693 Ga0207706_10000217 3300025933 Bacteria 63442
694 Ga0207706_10008952 3300025933 Bacteria 9214
695 Ga0207706_10019611 3300025933 Bacteria 6083
696 Ga0207706_10027712 3300025933 Bacteria 5065
697 Ga0207706_10222443 3300025933 Bacteria 1653
698 Ga0207706_10257480 3300025933 Bacteria 1524
699 Ga0207706_10282150 3300025933 Bacteria 1448
700 Ga0207686_10000067 3300025934 Bacteria 94339
701 Ga0207686_10012901 3300025934 Bacteria 4608
702 Ga0207709_10001445 3300025935 Bacteria 16588
703 Ga0207670_10061761 3300025936 Bacteria 2558
704 Ga0207670_10114091 3300025936 Unclassified 1952
705 Ga0207669_10001177 3300025937 Bacteria 11105
706 Ga0207669_10286069 3300025937 Unclassified 1246
707 Ga0207704_10019685 3300025938 Bacteria 3551
708 Ga0207704_10021877 3300025938 Bacteria 3415
709 Ga0207704_10122168 3300025938 Bacteria 1785
710 Ga0207665_10001924 3300025939 Bacteria 13978
711 Ga0207665_10057196 3300025939 Bacteria 2634
712 Ga0207691_10000818 3300025940 Bacteria 31020
713 Ga0207691_10002987 3300025940 Bacteria 16496
714 Ga0207691_10011023 3300025940 Bacteria 8672
715 Ga0207691_10053833 3300025940 Bacteria 3672
716 Ga0207691_10111390 3300025940 Bacteria 2434
717 Ga0207691_10144207 3300025940 Bacteria 2097
718 Ga0207691_10169436 3300025940 Bacteria 1913
719 Ga0207711_10002609 3300025941 Bacteria 16005
720 Ga0207711_10024175 3300025941 Bacteria 5086
721 Ga0207711_10092930 3300025941 Bacteria 2656
722 Ga0207711_10523421 3300025941 Bacteria 1106
723 Ga0207689_10007511 3300025942 Bacteria 9557
724 Ga0207689_10084019 3300025942 Bacteria 2617
725 Ga0207689_10280290 3300025942 Bacteria 1380
726 Ga0207661_10002514 3300025944 Bacteria 12612
727 Ga0207661_10009050 3300025944 Bacteria 7136
728 Ga0207661_10014030 3300025944 Bacteria 5863
729 Ga0207661_10016893 3300025944 Bacteria 5390
730 Ga0207661_10021314 3300025944 Bacteria 4854
731 Ga0207661_10026665 3300025944 Bacteria 4406
732 Ga0207661_10056198 3300025944 Bacteria 3159
733 Ga0207661_10079465 3300025944 Bacteria 2703
734 Ga0207661_10100801 3300025944 Bacteria 2424
735 Ga0207661_10148395 3300025944 Bacteria 2025
736 Ga0207661_10151140 3300025944 Bacteria 2007
737 Ga0207661_10186027 3300025944 Bacteria 1818
738 Ga0207661_10199702 3300025944 Bacteria 1758
739 Ga0207661_10406808 3300025944 Bacteria 1235
740 Ga0207679_10006823 3300025945 Bacteria 7238
741 Ga0207679_10009638 3300025945 Bacteria 6190
742 Ga0207679_10012824 3300025945 Bacteria 5480
743 Ga0207679_10073834 3300025945 Bacteria 2582
744 Ga0207679_10114713 3300025945 Bacteria 2133
745 Ga0207679_10132726 3300025945 Bacteria 2000
746 Ga0207679_10269176 3300025945 Bacteria 1456
747 Ga0207679_10341051 3300025945 Bacteria 1303
748 Ga0207667_10013600 3300025949 Bacteria 9304
749 Ga0207667_10021631 3300025949 Bacteria 7125
750 Ga0207667_10049482 3300025949 Bacteria 4438
751 Ga0207667_10070493 3300025949 Bacteria 3637
752 Ga0207667_10133699 3300025949 Bacteria 2555
753 Ga0207667_10217742 3300025949 Bacteria 1956
754 Ga0207667_10245987 3300025949 Bacteria 1830
755 Ga0207651_10036234 3300025960 Unclassified 3218
756 Ga0207651_10047984 3300025960 Bacteria 2883
757 Ga0207712_10000079 3300025961 Bacteria 115164
758 Ga0207712_10000116 3300025961 Bacteria 86504
759 Ga0207712_10001918 3300025961 Bacteria 13678
760 Ga0207712_10004409 3300025961 Bacteria 8893
761 Ga0207712_10329818 3300025961 Bacteria 1262
762 Ga0207668_10037485 3300025972 Bacteria 3245
763 Ga0207640_10001376 3300025981 Bacteria 13153
764 Ga0207640_10019297 3300025981 Bacteria 4026
765 Ga0207640_10034959 3300025981 Bacteria 3141
766 Ga0207640_10232608 3300025981 Bacteria 1419
767 Ga0207658_10125952 3300025986 Bacteria 2050
768 Ga0207658_10224459 3300025986 Bacteria 1582
769 Ga0207658_10244812 3300025986 Unclassified 1521
770 Ga0207658_10303622 3300025986 Bacteria 1376
771 Ga0207677_10049606 3300026023 Bacteria 2834
772 Ga0207703_10052808 3300026035 Bacteria 3302
773 Ga0207703_10080590 3300026035 Bacteria 2711
774 Ga0207703_10148741 3300026035 Bacteria 2040
775 Ga0207639_10019393 3300026041 Bacteria 4850
776 Ga0207639_10030731 3300026041 Bacteria 3941
777 Ga0207639_10103885 3300026041 Bacteria 2303
778 Ga0207639_10130182 3300026041 Bacteria 2082
779 Ga0207639_10278301 3300026041 Bacteria 1471
780 Ga0207678_10002885 3300026067 Bacteria 15604
781 Ga0207678_10162549 3300026067 Bacteria 1907
782 Ga0207678_10223973 3300026067 Bacteria 1610
783 Ga0207708_10004066 3300026075 Bacteria 10758
784 Ga0207708_10054547 3300026075 Bacteria 3047
785 Ga0207708_10262713 3300026075 Bacteria 1394
786 Ga0207702_10023570 3300026078 Bacteria 5106
787 Ga0207702_10164302 3300026078 Bacteria 2029
788 Ga0207702_10183644 3300026078 Bacteria 1928
789 Ga0207641_10162409 3300026088 Bacteria 2032
790 Ga0207641_10459253 3300026088 Bacteria 1232
791 Ga0207648_10001390 3300026089 Bacteria 26643
792 Ga0207648_10020801 3300026089 Bacteria 5907
793 Ga0207648_10076676 3300026089 Bacteria 2914
794 Ga0207648_10364933 3300026089 Bacteria 1303
795 Ga0207676_10036819 3300026095 Bacteria 3725
796 Ga0207676_10129677 3300026095 Bacteria 2142
797 Ga0207676_10156303 3300026095 Bacteria 1970
798 Ga0207676_10156989 3300026095 Bacteria 1967
799 Ga0207676_10164598 3300026095 Bacteria 1925
800 Ga0207676_10276515 3300026095 Bacteria 1523
801 Ga0207674_10000677 3300026116 Bacteria 44223
802 Ga0207674_10002099 3300026116 Bacteria 25266
803 Ga0207674_10002912 3300026116 Bacteria 21243
804 Ga0207674_10019018 3300026116 Bacteria 7444
805 Ga0207674_10132766 3300026116 Bacteria 2452
806 Ga0207674_10144844 3300026116 Bacteria 2334
807 Ga0207674_10367419 3300026116 Bacteria 1391
808 Ga0207675_100000102 3300026118 Bacteria 67767
809 Ga0207675_100017147 3300026118 Bacteria 6763
810 Ga0207675_100118017 3300026118 Bacteria 2508
811 Ga0207675_100147291 3300026118 Bacteria 2239
812 Ga0207675_100201544 3300026118 Bacteria 1912
813 Ga0207698_10006848 3300026142 Bacteria 7129
814 Ga0207698_10007858 3300026142 Bacteria 6710
815 Ga0207698_10009341 3300026142 Bacteria 6249
816 Ga0207698_10029014 3300026142 Bacteria 3956
817 Ga0207698_10046115 3300026142 Bacteria 3289
818 Ga0207698_10073598 3300026142 Bacteria 2721
819 Ga0207698_10083431 3300026142 Bacteria 2586
820 Ga0207698_10202809 3300026142 Bacteria 1777
821 Ga0207698_10382751 3300026142 Bacteria 1339
822 Ga0209970_1007623 3300027614 Bacteria 1774
823 Ga0209588_1000809 3300027671 Bacteria 7948
824 Ga0209588_1004273 3300027671 Bacteria 4022
825 Ga0209588_1027027 3300027671 Bacteria 1825
826 Ga0209966_1004660 3300027695 Bacteria 2331
827 Ga0209998_10002169 3300027717 Bacteria 4556
828 Ga0209998_10009120 3300027717 Bacteria 2056
829 Ga0209974_10038427 3300027876 Bacteria 1591
830 Ga0209974_10071083 3300027876 Bacteria 1187
831 Ga0268266_10036186 3300028379 Bacteria 4201
832 Ga0268266_10200454 3300028379 Bacteria 1826
833 Ga0268265_10002084 3300028380 Bacteria 15584
834 Ga0268265_10092523 3300028380 Bacteria 2420
835 Ga0268264_10009387 3300028381 Bacteria 8099
836 Ga0268264_10021128 3300028381 Bacteria 5318
837 Ga0268264_10119955 3300028381 Bacteria 2316
838 Ga0265332_10060665 3300031238 Bacteria 1618
839 Ga0265332_10062056 3300031238 Bacteria 1597
840 Ga0265340_10045394 3300031247 Bacteria 2147
841 Ga0307408_100007165 3300031548 Bacteria 7387
842 Ga0307408_100009023 3300031548 Bacteria 6588
843 Ga0307408_100010179 3300031548 Bacteria 6204
844 Ga0307408_100012296 3300031548 Bacteria 5668
845 Ga0307408_100017692 3300031548 Unclassified 4774
846 Ga0307408_100021612 3300031548 Bacteria 4358
847 Ga0307408_100024813 3300031548 Bacteria 4099
848 Ga0307408_100053345 3300031548 Bacteria 2919
849 Ga0307408_100074641 3300031548 Bacteria 2517
850 Ga0307408_100079633 3300031548 Bacteria 2445
851 Ga0307408_100099428 3300031548 Unclassified 2214
852 Ga0307408_100102510 3300031548 Bacteria 2183
853 Ga0265314_10068058 3300031711 Bacteria 2395
854 Ga0265314_10078400 3300031711 Bacteria 2187
855 Ga0265342_10041153 3300031712 Bacteria 2800
856 Ga0316576_10091337 3300031727 Bacteria 2269
857 Ga0307405_10000062 3300031731 Bacteria 51691
858 Ga0307405_10011464 3300031731 Bacteria 4647
859 Ga0307405_10013607 3300031731 Bacteria 4345
860 Ga0307405_10054931 3300031731 Bacteria 2489
861 Ga0307405_10081353 3300031731 Bacteria 2117
862 Ga0307405_10165847 3300031731 Bacteria 1570
863 Ga0307413_10000544 3300031824 Bacteria 12547
864 Ga0307413_10001813 3300031824 Bacteria 8385
865 Ga0307413_10002458 3300031824 Bacteria 7539
866 Ga0307413_10019795 3300031824 Bacteria 3564
867 Ga0307413_10035476 3300031824 Bacteria 2861
868 Ga0307413_10059565 3300031824 Bacteria 2346
869 Ga0307413_10153614 3300031824 Bacteria 1607
870 Ga0307413_10372208 3300031824 Bacteria 1110
871 Ga0307410_10008556 3300031852 Bacteria 5683
872 Ga0307410_10010028 3300031852 Bacteria 5345
873 Ga0307410_10010357 3300031852 Bacteria 5277
874 Ga0307410_10010607 3300031852 Bacteria 5229
875 Ga0307410_10017648 3300031852 Bacteria 4292
876 Ga0307410_10028513 3300031852 Bacteria 3543
877 Ga0307410_10031073 3300031852 Bacteria 3422
878 Ga0307410_10034960 3300031852 Bacteria 3259
879 Ga0307410_10053785 3300031852 Unclassified 2726
880 Ga0307410_10080401 3300031852 Bacteria 2286
881 Ga0307410_10135240 3300031852 Bacteria 1816
882 Ga0307410_10152854 3300031852 Bacteria 1720
883 Ga0307410_10174415 3300031852 Bacteria 1623
884 Ga0307406_10002612 3300031901 Bacteria 9818
885 Ga0307406_10002804 3300031901 Bacteria 9506
886 Ga0307406_10010298 3300031901 Bacteria 5270
887 Ga0307406_10018265 3300031901 Bacteria 4094
888 Ga0307406_10031081 3300031901 Bacteria 3249
889 Ga0307406_10056065 3300031901 Bacteria 2521
890 Ga0307406_10071554 3300031901 Bacteria 2273
891 Ga0307406_10075287 3300031901 Bacteria 2227
892 Ga0307406_10165923 3300031901 Bacteria 1593
893 Ga0307406_10216074 3300031901 Bacteria 1422
894 Ga0307406_10248068 3300031901 Bacteria 1339
895 Ga0307407_10000205 3300031903 Bacteria 17969
896 Ga0307407_10000240 3300031903 Bacteria 16149
897 Ga0307407_10000896 3300031903 Bacteria 10038
898 Ga0307407_10003266 3300031903 Bacteria 6604
899 Ga0307407_10012983 3300031903 Bacteria 4026
900 Ga0307407_10034975 3300031903 Bacteria 2756
901 Ga0307407_10036198 3300031903 Bacteria 2718
902 Ga0307407_10050453 3300031903 Bacteria 2381
903 Ga0307407_10053048 3300031903 Bacteria 2331
904 Ga0307412_10002291 3300031911 Bacteria 10598
905 Ga0307412_10015849 3300031911 Bacteria 4476
906 Ga0307412_10017277 3300031911 Bacteria 4316
907 Ga0307412_10035156 3300031911 Bacteria 3199
908 Ga0307412_10038352 3300031911 Bacteria 3085
909 Ga0307412_10053466 3300031911 Bacteria 2677
910 Ga0307412_10085917 3300031911 Bacteria 2188
911 Ga0307412_10107015 3300031911 Bacteria 1989
912 Ga0307412_10113723 3300031911 Bacteria 1937
913 Ga0307412_10178617 3300031911 Bacteria 1594
914 Ga0307409_100000540 3300031995 Bacteria 16375
915 Ga0307409_100000760 3300031995 Bacteria 14560
916 Ga0307409_100002465 3300031995 Bacteria 9692
917 Ga0307409_100005482 3300031995 Bacteria 7314
918 Ga0307409_100015464 3300031995 Bacteria 5011
919 Ga0307409_100021211 3300031995 Bacteria 4449
920 Ga0307409_100035527 3300031995 Bacteria 3653
921 Ga0307409_100049812 3300031995 Bacteria 3196
922 Ga0307409_100123108 3300031995 Bacteria 2201
923 Ga0307409_100171507 3300031995 Bacteria 1910
924 Ga0307409_100203216 3300031995 Bacteria 1774
925 Ga0307416_100000492 3300032002 Bacteria 20070
926 Ga0307416_100002344 3300032002 Bacteria 10833
927 Ga0307416_100004110 3300032002 Bacteria 8711
928 Ga0307416_100006234 3300032002 Bacteria 7445
929 Ga0307416_100006582 3300032002 Bacteria 7289
930 Ga0307416_100022784 3300032002 Bacteria 4530
931 Ga0307416_100044221 3300032002 Bacteria 3494
932 Ga0307416_100047694 3300032002 Bacteria 3393
933 Ga0307416_100055875 3300032002 Bacteria 3182
934 Ga0307416_100078594 3300032002 Unclassified 2777
935 Ga0307416_100103796 3300032002 Unclassified 2483
936 Ga0307416_100203299 3300032002 Bacteria 1882
937 Ga0307416_100314874 3300032002 Bacteria 1564
938 Ga0307416_100356769 3300032002 Bacteria 1482
939 Ga0307414_10008272 3300032004 Bacteria 5889
940 Ga0307414_10019309 3300032004 Bacteria 4220
941 Ga0307414_10024174 3300032004 Bacteria 3869
942 Ga0307414_10077085 3300032004 Bacteria 2425
943 Ga0307414_10078821 3300032004 Bacteria 2402
944 Ga0307414_10096087 3300032004 Bacteria 2216
945 Ga0307414_10140643 3300032004 Bacteria 1889
946 Ga0307414_10196940 3300032004 Bacteria 1635
947 Ga0307411_10000132 3300032005 Bacteria 23505
948 Ga0307411_10000346 3300032005 Bacteria 15638
949 Ga0307411_10002338 3300032005 Bacteria 8326
950 Ga0307411_10020498 3300032005 Bacteria 3846
951 Ga0307411_10021629 3300032005 Bacteria 3769
952 Ga0307411_10026707 3300032005 Bacteria 3480
953 Ga0307411_10051404 3300032005 Bacteria 2688
954 Ga0307411_10108003 3300032005 Bacteria 1984
955 Ga0307411_10141432 3300032005 Bacteria 1775
956 Ga0307411_10172311 3300032005 Bacteria 1633
957 Ga0307411_10208715 3300032005 Bacteria 1506
958 Ga0307411_10274083 3300032005 Bacteria 1339
959 Ga0307415_100000261 3300032126 Bacteria 22792
960 Ga0307415_100002765 3300032126 Bacteria 8776
961 Ga0307415_100004433 3300032126 Bacteria 7279
962 Ga0307415_100010341 3300032126 Bacteria 5280
963 Ga0307415_100013741 3300032126 Bacteria 4736
964 Ga0307415_100021565 3300032126 Bacteria 3962
965 Ga0307415_100035689 3300032126 Bacteria 3249
966 Ga0307415_100037794 3300032126 Bacteria 3176
967 Ga0307415_100100053 3300032126 Bacteria 2124
968 Ga0307415_100137587 3300032126 Bacteria 1860
969 Ga0373926_0041506 3300035083 Bacteria 1644
970 Ga0373934_0000216 3300035086 Bacteria 21032
971 Ga0373934_0004067 3300035086 Bacteria 5389
972 Ga0373934_0009539 3300035086 Bacteria 3637
973 Ga0373944_0044710 3300035089 Bacteria 1380
974 Ga0373923_0017713 3300035111 Bacteria 2728
975 Ga0373932_0013413 3300035112 Bacteria 2038
976 Ga0373939_0022428 3300035114 Bacteria 1740
977 Ga0373941_0029969 3300035115 Bacteria 1609
978 Ga0373954_0097330 3300035118 Bacteria 1418
979 Ga0373956_0000127 3300035119 Bacteria 26808
980 Ga0373957_0020187 3300035120 Bacteria 2352
981 Ga0373943_0005852 3300035170 Bacteria 5521
982 Ga0373946_0004631 3300035171 Bacteria 4933
983 Ga0373955_0004826 3300035172 Bacteria 6008
984 Ga0373924_0053102 3300035410 Bacteria 1683
985 Ga0373931_0015201 3300035691 Bacteria 3773
986 Ga0373931_0130774 3300035691 Bacteria 1445
987 Ga0373927_0012077 3300035695 Bacteria 5743
988 Ga0373927_0050519 3300035695 Bacteria 2689
989 Ga0373927_0066263 3300035695 Bacteria 2336
990 Ga0373927_0131277 3300035695 Bacteria 1637
991 Ga0373933_0000353 3300035724 Bacteria 29440
992 Ga0373933_0264535 3300035724 Unclassified 1109
993 Ga0373947_0006463 3300035725 Bacteria 6806
994 Ga0373937_0000195 3300036401 Bacteria 59262
995 Ga0373937_0003317 3300036401 Bacteria 13518
996 Ga0373937_0009385 3300036401 Bacteria 8499
997 Ga0373937_0013444 3300036401 Bacteria 7210
998 Ga0373937_0337205 3300036401 Bacteria 1428
999 Ga0373925_0022548 3300037068 Bacteria 4593
1000 Ga0395899_0024706 3300037312 Bacteria 4542
1001 Ga0395900_0048539 3300037418 Bacteria 4373
1002 Ga0395905_0043072 3300037471 Bacteria 4235
1003 Ga0395905_0081476 3300037471 Bacteria 3033
1004 Ga0436364_0458848 3300037853 Bacteria 1370
1005 Ga0395901_0001422 3300038443 Bacteria 24965
1006 Ga0395901_0507637 3300038443 Bacteria 1227
1007 Ga0242420_023197 3300038996 Bacteria 1120
1008 Ga0436365_0252405 3300039437 Bacteria 1897
1009 Ga0439439_0008615 3300041406 Unclassified 2412
1010 Ga0439439_0014247 3300041406 Bacteria 1935
1011 Ga0439439_0048717 3300041406 Bacteria 1108
1012 Ga0439448_0037820 3300042005 Unclassified 1552
1013 Ga0450898_002774 3300042134 Bacteria 2459
1014 Ga0439446_0083473 3300042156 Bacteria 992
1015 Ga0439434_0020186 3300042435 Bacteria 2000
1016 Ga0439435_0005336 3300042436 Bacteria 2822
1017 Ga0439435_0014857 3300042436 Bacteria 1929
1018 Ga0451577_0000016 3300042876 Bacteria 531002
1019 Ga0451577_0040015 3300042876 Bacteria 4209
1020 Ga0451577_0060761 3300042876 Bacteria 3369
1021 Ga0451577_0082558 3300042876 Bacteria 2867
1022 Ga0451577_0393345 3300042876 Bacteria 1258
1023 Ga0451577_0435502 3300042876 Bacteria 1190
1024 Ga0453683_0030556 3300044673 Bacteria 3405
1025 Ga0466966_0007072 3300044684 Bacteria 7435
1026 Ga0466966_0064590 3300044684 Bacteria 2304
1027 Ga0466961_0033364 3300044693 Bacteria 3308
1028 Ga0466961_0089755 3300044693 Bacteria 1941
1029 Ga0453684_0000886 3300044712 Bacteria 100081
1030 Ga0453684_0083936 3300044712 Bacteria 3963
1031 Ga0453684_0088534 3300044712 Bacteria 3833
1032 Ga0453684_0287342 3300044712 Bacteria 1874
1033 Ga0453684_0580793 3300044712 Unclassified 1231
1034 Ga0453684_0640519 3300044712 Bacteria 1161
1035 Ga0451576_0001721 3300045051 Bacteria 36069
1036 Ga0451576_0009275 3300045051 Bacteria 11431
1037 Ga0451576_0020198 3300045051 Bacteria 7257
1038 Ga0451576_0078786 3300045051 Bacteria 3428
1039 Ga0451576_0260525 3300045051 Bacteria 1812
1040 Ga0451576_0304305 3300045051 Bacteria 1668
1041 Ga0466958_0172257 3300045836 Unclassified 1371
1042 Ga0466967_0340055 3300045976 Bacteria 1451
1043 Ga0495592_0084118 3300046454 Bacteria 2297
1044 Ga0495603_0012254 3300046455 Bacteria 5192
1045 Ga0495603_0024525 3300046455 Bacteria 3648
1046 Ga0495603_0030389 3300046455 Bacteria 3253
1047 Ga0495590_0055742 3300046457 Bacteria 1381
1048 Ga0495629_0001690 3300046459 Bacteria 17329
1049 Ga0495629_0018369 3300046459 Bacteria 5006
1050 Ga0495629_0037952 3300046459 Bacteria 3395
1051 Ga0495629_0114603 3300046459 Bacteria 1879
1052 Ga0495629_0264041 3300046459 Bacteria 1183
1053 Ga0495651_0000050 3300046462 Bacteria 87816
1054 Ga0495651_0005117 3300046462 Bacteria 10005
1055 Ga0495651_0078463 3300046462 Bacteria 2498
1056 Ga0495653_0000134 3300046463 Bacteria 61770
1057 Ga0495653_0020073 3300046463 Bacteria 5416
1058 Ga0495580_0003170 3300046472 Bacteria 14100
1059 Ga0495580_0270113 3300046472 Bacteria 1161
1060 Ga0495582_0030374 3300046473 Bacteria 2967
1061 Ga0495582_0042084 3300046473 Bacteria 2517
1062 Ga0495582_0076907 3300046473 Bacteria 1850
1063 Ga0495639_0009369 3300046475 Bacteria 4199
1064 Ga0495594_0011181 3300046499 Bacteria 4661
1065 Ga0495594_0020892 3300046499 Bacteria 3491
1066 Ga0495594_0025728 3300046499 Bacteria 3164
1067 Ga0495594_0087123 3300046499 Bacteria 1747
1068 Ga0495594_0095883 3300046499 Unclassified 1666
1069 Ga0495608_0000381 3300046511 Bacteria 30883
1070 Ga0495618_0041637 3300046514 Bacteria 2894
1071 Ga0495618_0076903 3300046514 Bacteria 2127
1072 Ga0495618_0102568 3300046514 Bacteria 1831
1073 Ga0495628_0001915 3300046516 Bacteria 18878
1074 Ga0495628_0020377 3300046516 Bacteria 5471
1075 Ga0495628_0078524 3300046516 Bacteria 2567
1076 Ga0495630_0002550 3300046517 Bacteria 12630
1077 Ga0495630_0004360 3300046517 Bacteria 9937
1078 Ga0495630_0007348 3300046517 Bacteria 7867
1079 Ga0495630_0030695 3300046517 Bacteria 3999
1080 Ga0495630_0074785 3300046517 Bacteria 2552
1081 Ga0495630_0086741 3300046517 Bacteria 2364
1082 Ga0495643_0151747 3300046522 Bacteria 1147
1083 Ga0495666_0021364 3300046526 Bacteria 3204
1084 Ga0495652_0003898 3300046529 Bacteria 14519
1085 Ga0495652_0052162 3300046529 Bacteria 3489
1086 Ga0495652_0096439 3300046529 Bacteria 2408
1087 Ga0495652_0113016 3300046529 Bacteria 2181
1088 Ga0495665_0002730 3300046531 Bacteria 9527
1089 Ga0495665_0007115 3300046531 Bacteria 6037
1090 Ga0495665_0033107 3300046531 Bacteria 2765
1091 Ga0495640_0101358 3300046533 Bacteria 1889
1092 Ga0495586_0007821 3300046535 Bacteria 5702
1093 Ga0495586_0013976 3300046535 Bacteria 4260
1094 Ga0495586_0021688 3300046535 Bacteria 3426
1095 Ga0495586_0087993 3300046535 Bacteria 1713
1096 Ga0495587_0000114 3300046536 Bacteria 61671
1097 Ga0495587_0009898 3300046536 Bacteria 6084
1098 Ga0495587_0055948 3300046536 Unclassified 2322
1099 Ga0495587_0106770 3300046536 Bacteria 1610
1100 Ga0495645_0000065 3300046543 Bacteria 73256
1101 Ga0495645_0002208 3300046543 Bacteria 13243
1102 Ga0495645_0010296 3300046543 Bacteria 6555
1103 Ga0495645_0224443 3300046543 Bacteria 1262
1104 Ga0495667_0000316 3300046559 Bacteria 30681
1105 Ga0495667_0001659 3300046559 Bacteria 14760
1106 Ga0495667_0002423 3300046559 Bacteria 12454
1107 Ga0495667_0005100 3300046559 Bacteria 8873
1108 Ga0495634_0023134 3300046642 Bacteria 4370
1109 Ga0495635_0003351 3300046663 Bacteria 11077
1110 Ga0495635_0175850 3300046663 Bacteria 1455
1111 Ga0495659_0014615 3300046664 Bacteria 2572
1112 Ga0495588_0002596 3300046674 Bacteria 7730
1113 Ga0495588_0047731 3300046674 Bacteria 2199
1114 Ga0495657_0001662 3300046675 Bacteria 19126
1115 Ga0495657_0087933 3300046675 Bacteria 1999
1116 Ga0495599_0000754 3300046678 Bacteria 18240
1117 Ga0495599_0036568 3300046678 Bacteria 3084
1118 Ga0495599_0044302 3300046678 Bacteria 2791
1119 Ga0495623_0000086 3300046679 Bacteria 55086
1120 Ga0495623_0003506 3300046679 Bacteria 10381
1121 Ga0495623_0055733 3300046679 Bacteria 2491
1122 Ga0495623_0062428 3300046679 Unclassified 2335
1123 Ga0495646_0004169 3300046680 Bacteria 9082
1124 Ga0495647_0029495 3300046681 Bacteria 2029
1125 Ga0495658_0005675 3300046683 Bacteria 6131
1126 Ga0495658_0075933 3300046683 Bacteria 1962
1127 Ga0495669_0081346 3300046684 Bacteria 1487
1128 Ga0495613_0024883 3300046689 Bacteria 4461
1129 Ga0495613_0045558 3300046689 Bacteria 3243
1130 Ga0495624_0065889 3300046690 Bacteria 2262
1131 Ga0495600_0003319 3300046809 Bacteria 9447
1132 Ga0495600_0110782 3300046809 Bacteria 1787
1133 Ga0495600_0176136 3300046809 Bacteria 1379
1134 Ga0495581_0013945 3300047315 Bacteria 4661
1135 Ga0495581_0095446 3300047315 Bacteria 1727
1136 Ga0495581_0103581 3300047315 Bacteria 1653
1137 Ga0495604_0001195 3300047317 Bacteria 21435
1138 Ga0495604_0126389 3300047317 Bacteria 1843
1139 Ga0495604_0209912 3300047317 Bacteria 1346
1140 Ga0495636_0062063 3300047318 Bacteria 1582
1141 Ga0495674_0000339 3300047319 Bacteria 41326
1142 Ga0495674_0006412 3300047319 Bacteria 11283
1143 Ga0495674_0025755 3300047319 Bacteria 5387
1144 Ga0495674_0041723 3300047319 Bacteria 4097
1145 Ga0495674_0049695 3300047319 Bacteria 3704
1146 Ga0495674_0073351 3300047319 Bacteria 2951
1147 Ga0495675_0015599 3300047444 Bacteria 4803
1148 Ga0495675_0075725 3300047444 Bacteria 2121
1149 Ga0495675_0105424 3300047444 Bacteria 1762
1150 Ga0495675_0108057 3300047444 Bacteria 1738
1151 Ga0495675_0121962 3300047444 Bacteria 1623
1152 Ga0495684_0000141 3300047471 Bacteria 53032
1153 Ga0495684_0002171 3300047471 Bacteria 15715
1154 Ga0495684_0051191 3300047471 Unclassified 3152
1155 Ga0495684_0204747 3300047471 Bacteria 1453
1156 Ga0495593_0000043 3300047673 Bacteria 50752
1157 Ga0495602_0003470 3300048088 Bacteria 16312
1158 Ga0495602_0014360 3300048088 Bacteria 8042
1159 Ga0495614_0000096 3300048089 Bacteria 29692
1160 Ga0496100_0179401 3300048903 Bacteria 1531
1161 Ga0496100_0282483 3300048903 Bacteria 1238
1162 Ga0496101_0009147 3300048904 Bacteria 6503
1163 Ga0496101_0100918 3300048904 Bacteria 2160
1164 Ga0496101_0187262 3300048904 Bacteria 1596
1165 Ga0496102_0047628 3300048905 Bacteria 3897
1166 Ga0496102_0134756 3300048905 Bacteria 2314
1167 Ga0496103_0205199 3300048906 Bacteria 1267
1168 Ga0496104_0010276 3300048907 Bacteria 8359
1169 Ga0496104_0026059 3300048907 Bacteria 5393
1170 Ga0496104_0055390 3300048907 Bacteria 3750
1171 Ga0496104_0055558 3300048907 Bacteria 3744
1172 Ga0496104_0063078 3300048907 Bacteria 3514
1173 Ga0496104_0119252 3300048907 Bacteria 2533
1174 Ga0496104_0234294 3300048907 Bacteria 1748
1175 Ga0496104_0339989 3300048907 Bacteria 1414
1176 Ga0496105_0090022 3300048908 Bacteria 2535
1177 Ga0496105_0113779 3300048908 Bacteria 2232
1178 Ga0496106_0173130 3300048909 Bacteria 1712
1179 Ga0496106_0185399 3300048909 Bacteria 1653
1180 Ga0496106_0250109 3300048909 Bacteria 1417
1181 Ga0496107_0052584 3300048910 Bacteria 2938
1182 Ga0496108_0002171 3300048911 Bacteria 15736
1183 Ga0496108_0017783 3300048911 Bacteria 5813
1184 Ga0496108_0126720 3300048911 Bacteria 2192
1185 Ga0496109_0039510 3300048912 Bacteria 4271
1186 Ga0496109_0045291 3300048912 Bacteria 3991
1187 Ga0496109_0222788 3300048912 Bacteria 1774
1188 Ga0496109_0239380 3300048912 Bacteria 1708
1189 Ga0496110_0002484 3300048913 Bacteria 13822
1190 Ga0496110_0042941 3300048913 Bacteria 3946
1191 Ga0496111_0001425 3300048914 Bacteria 13631
1192 Ga0496111_0029946 3300048914 Bacteria 3869
1193 Ga0496112_0000129 3300048915 Bacteria 47173
1194 Ga0496112_0000882 3300048915 Bacteria 21546
1195 Ga0496112_0019955 3300048915 Bacteria 6343
1196 Ga0496112_0032739 3300048915 Bacteria 5047
1197 Ga0496112_0269071 3300048915 Unclassified 1652
1198 Ga0496113_0000062 3300048916 Bacteria 46801
1199 Ga0496113_0122492 3300048916 Bacteria 2034
1200 Ga0496113_0151071 3300048916 Bacteria 1832
1201 Ga0496113_0279607 3300048916 Bacteria 1334
1202 Ga0496114_0059380 3300048917 Bacteria 3195
1203 Ga0496114_0222926 3300048917 Bacteria 1655
1204 Ga0496115_0005916 3300048918 Bacteria 8920
1205 Ga0501292_018642 3300049515 Unclassified 1106
1206 Ga0501031_0059421 3300049568 Bacteria 2492
1207 Ga0501031_0199683 3300049568 Bacteria 1305
1208 Ga0501031_0238987 3300049568 Unclassified 1181
1209 Ga0501033_0148781 3300049570 Bacteria 1690
1210 Ga0501034_0008504 3300049571 Bacteria 10838
1211 Ga0501034_0021718 3300049571 Bacteria 6540
1212 Ga0501034_0163739 3300049571 Bacteria 2193
1213 Ga0501034_0320230 3300049571 Bacteria 1484
1214 Ga0501036_0433937 3300049572 Unclassified 1095
1215 Ga0501036_0500582 3300049572 Bacteria 1011
1216 Ga0501037_0043485 3300049573 Bacteria 3301
1217 Ga0501037_0043614 3300049573 Bacteria 3296
1218 Ga0501038_0030716 3300049574 Bacteria 4750
1219 Ga0501038_0089245 3300049574 Bacteria 2586
1220 Ga0501038_0353564 3300049574 Bacteria 1144
1221 Ga0501039_0057086 3300049575 Bacteria 3024
1222 Ga0501040_0012049 3300049576 Bacteria 5659
1223 Ga0501041_0086024 3300049577 Bacteria 1939
1224 Ga0501042_0096777 3300049578 Bacteria 2121
1225 Ga0501042_0107629 3300049578 Bacteria 2007
1226 Ga0501043_0058442 3300049579 Bacteria 3027
1227 Ga0501046_0205464 3300049580 Bacteria 1464
1228 Ga0501047_0025654 3300049581 Bacteria 5668
1229 Ga0501047_0201897 3300049581 Bacteria 1849
1230 Ga0501047_0348858 3300049581 Bacteria 1317
1231 Ga0501048_0012476 3300049582 Bacteria 6322
1232 Ga0501048_0086144 3300049582 Bacteria 2216
1233 Ga0501067_0002448 3300049583 Bacteria 10258
1234 Ga0501067_0003013 3300049583 Bacteria 9301
1235 Ga0501067_0007870 3300049583 Bacteria 5924
1236 Ga0501067_0098404 3300049583 Bacteria 1625
1237 Ga0501068_0000311 3300049584 Bacteria 24353
1238 Ga0501069_0001105 3300049585 Bacteria 13017
1239 Ga0501069_0002365 3300049585 Bacteria 9561
1240 Ga0501069_0076755 3300049585 Unclassified 1879
1241 Ga0501070_0004182 3300049586 Bacteria 12426
1242 Ga0501070_0047831 3300049586 Bacteria 3554
1243 Ga0501071_0002140 3300049587 Bacteria 11863
1244 Ga0501072_0004214 3300049588 Bacteria 10909
1245 Ga0501072_0150501 3300049588 Bacteria 1855
1246 Ga0501073_0253856 3300049589 Bacteria 1214
1247 Ga0501074_0002285 3300049590 Bacteria 13335
1248 Ga0501074_0002996 3300049590 Bacteria 11875
1249 Ga0501075_0008826 3300049591 Bacteria 7027
1250 Ga0501076_0011216 3300049592 Bacteria 6671
1251 Ga0501076_0030383 3300049592 Bacteria 4208
1252 Ga0501077_0000313 3300049593 Bacteria 28906
1253 Ga0501077_0042267 3300049593 Bacteria 2898
1254 Ga0501077_0077897 3300049593 Bacteria 2100
1255 Ga0501217_042216 3300049661 Bacteria 1164
1256 Ga0501235_011626 3300049669 Unclassified 1931
1257 Ga0501235_019299 3300049669 Bacteria 1512
1258 Ga0501225_0011872 3300049705 Bacteria 2450
1259 Ga0501079_0009697 3300049741 Bacteria 7300
1260 Ga0501079_0016232 3300049741 Bacteria 5692
1261 Ga0501079_0019900 3300049741 Bacteria 5127
1262 Ga0501079_0117394 3300049741 Bacteria 2068
1263 Ga0501079_0170671 3300049741 Bacteria 1696
1264 Ga0501079_0201587 3300049741 Bacteria 1554
1265 Ga0501080_0002645 3300049742 Bacteria 15668
1266 Ga0501080_0012972 3300049742 Bacteria 7650
1267 Ga0501080_0321406 3300049742 Unclassified 1401
1268 Ga0501080_0409614 3300049742 Bacteria 1219
1269 Ga0501081_0005948 3300049743 Bacteria 7898
1270 Ga0501081_0048207 3300049743 Bacteria 2932
1271 Ga0501081_0242427 3300049743 Bacteria 1315
1272 Ga0501083_0002285 3300049744 Bacteria 13120
1273 Ga0501083_0013133 3300049744 Bacteria 5787
1274 Ga0501083_0153114 3300049744 Bacteria 1510
1275 Ga0501266_004840 3300049763 Bacteria 1676
1276 Ga0501268_006067 3300049765 Bacteria 1759
1277 Ga0501268_007168 3300049765 Bacteria 1657
1278 Ga0501035_0007082 3300049822 Bacteria 10484
1279 Ga0501035_0229410 3300049822 Bacteria 1583
1280 Ga0501044_0008093 3300049823 Bacteria 11540
1281 Ga0501044_0190300 3300049823 Bacteria 2015
1282 Ga0501045_0045898 3300049824 Bacteria 3181
1283 Ga0501212_005633 3300049851 Bacteria 1661
1284 nmdc:mga05p37_163212_c1 3300050507 Bacteria 2720
1285 nmdc:mga05p37_17760_c1 3300050507 Bacteria 4978
1286 nmdc:mga05p37_180926_c1 3300050507 Bacteria 2564
1287 nmdc:mga05p37_2011_c1 3300050507 Bacteria 23721
1288 nmdc:mga05p37_290600_c1 3300050507 Bacteria 1946
1289 nmdc:mga05p37_39420_c1 3300050507 Bacteria 5800
1290 nmdc:mga05p37_549497_c1 3300050507 Bacteria 1315
1291 nmdc:mga05p37_606789_c1 3300050507 Bacteria 1234
1292 nmdc:mga05p37_7243_c1 3300050507 Bacteria 13086
1293 nmdc:mga05p37_76582_c1 3300050507 Bacteria 4118
1294 nmdc:mga09592_1219_c1 3300050508 Bacteria 20601
1295 nmdc:mga09592_247484_c1 3300050508 Unclassified 1545
1296 nmdc:mga09592_66723_c1 3300050508 Bacteria 3050
1297 nmdc:mga09592_94674_c1 3300050508 Bacteria 2554
1298 nmdc:mga0qj67_18329_c1 3300050509 Bacteria 5335
1299 nmdc:mga0qj67_235437_c1 3300050509 Bacteria 1486
1300 nmdc:mga0qj67_24210_c1 3300050509 Bacteria 4678
1301 nmdc:mga0qj67_31512_c1 3300050509 Bacteria 4130
1302 nmdc:mga0qj67_41805_c1 3300050509 Bacteria 3607
1303 nmdc:mga0qj67_89934_c1 3300050509 Bacteria 2466
1304 nmdc:mga06r32_124297_c1 3300050510 Bacteria 2547
1305 nmdc:mga06r32_329936_c1 3300050510 Bacteria 1511
1306 nmdc:mga06r32_57790_c1 3300050510 Bacteria 3727
1307 nmdc:mga08y16_135234_c1 3300050511 Bacteria 2562
1308 nmdc:mga08y16_29721_c1 3300050511 Bacteria 5753
1309 nmdc:mga08y16_337659_c1 3300050511 Bacteria 1549
1310 nmdc:mga0n895_125953_c1 3300050512 Unclassified 2585
1311 nmdc:mga0n895_27921_c1 3300050512 Bacteria 5363
1312 nmdc:mga0n895_28362_c1 3300050512 Bacteria 5324
1313 nmdc:mga0n895_31893_c1 3300050512 Bacteria 5051
1314 nmdc:mga0n895_327193_c1 3300050512 Bacteria 1553
1315 nmdc:mga0n895_39010_c1 3300050512 Bacteria 4605
1316 nmdc:mga0n895_39846_c1 3300050512 Bacteria 4562
1317 nmdc:mga0n895_488161_c1 3300050512 Bacteria 1242
1318 nmdc:mga0n895_567528_c1 3300050512 Bacteria 1140
1319 nmdc:mga0n895_72069_c1 3300050512 Bacteria 3427
1320 nmdc:mga0n895_79256_c1 3300050512 Bacteria 3271
1321 nmdc:mga0n895_8346_c1 3300050512 Bacteria 8966
1322 nmdc:mga0n895_87492_c1 3300050512 Bacteria 3113
1323 nmdc:mga0rr50_148592_c1 3300050513 Bacteria 1891
1324 nmdc:mga0rr50_16394_c1 3300050513 Bacteria 4921
1325 nmdc:mga0rr50_21872_c1 3300050513 Bacteria 4377
1326 nmdc:mga0rr50_219132_c1 3300050513 Bacteria 1571
1327 nmdc:mga0rr50_29765_c1 3300050513 Bacteria 2144
1328 nmdc:mga0rr50_33702_c1 3300050513 Unclassified 3661
1329 nmdc:mga0rr50_5554_c1 3300050513 Bacteria 7541
1330 nmdc:mga08x19_20307_c1 3300050514 Bacteria 4090
1331 nmdc:mga08x19_5774_c1 3300050514 Bacteria 7314
1332 nmdc:mga08x19_5826_c1 3300050514 Bacteria 7289
1333 nmdc:mga08x19_67607_c1 3300050514 Unclassified 2324
1334 nmdc:mga08x19_7637_c1 3300050514 Bacteria 6425
1335 nmdc:mga08x19_7876_c1 3300050514 Bacteria 6328
1336 nmdc:mga08x19_9849_c1 3300050514 Bacteria 5727
1337 nmdc:mga0a205_123396_c1 3300050515 Bacteria 2490
1338 nmdc:mga0a205_18694_c1 3300050515 Bacteria 6522
1339 nmdc:mga0a205_26983_c1 3300050515 Bacteria 5484
1340 nmdc:mga0a205_31926_c1 3300050515 Bacteria 5048
1341 nmdc:mga0a205_7805_c1 3300050515 Bacteria 9716
1342 nmdc:mga0a205_86401_c1 3300050515 Bacteria 3029
1343 nmdc:mga0a205_989_c1 3300050515 Bacteria 23529
1344 Ga0495612_0055401 3300053078 Bacteria 1634
1345 Ga0495619_0006607 3300053085 Bacteria 7337
1346 Ga0501084_0001049 3300054114 Bacteria 21463
1347 Ga0501084_0035691 3300054114 Bacteria 4156
1348 Ga0501084_0054276 3300054114 Bacteria 3352
1349 Ga0501084_0073327 3300054114 Bacteria 2867
1350 Ga0501084_0082642 3300054114 Bacteria 2695
1351 Ga0590071_000553 3300059421 Bacteria 10824
1352 Ga0590074_013181 3300059423 Bacteria 1394
1353 Ga0590077_017968 3300059426 Bacteria 1491
1354 Ga0501082_0005808 3300060353 Bacteria 10714
1355 Ga0501082_0024265 3300060353 Bacteria 5227
1356 Ga0501082_0030793 3300060353 Bacteria 4625
1357 Ga0501082_0077709 3300060353 Bacteria 2862
1358 Ga0530510_0157151 3300061734 Bacteria 1681
1359 Ga0207709_10247618
1360 MBSR1b_contig_3324880
1361 JGI24752J21851_1011504
1362 JGI24737J22298_10035544
1363 Ga0058863_10002510
1364 Ga0065712_10091947
1365 Ga0065715_10108757
1366 Ga0065715_10139884
1367 Ga0070658_10001114
1368 Ga0070658_10006876
1369 Ga0070658_10008230
1370 Ga0070658_10088574
1371 Ga0070658_10136562
1372 Ga0070658_10187659
1373 Ga0070676_10121088
1374 Ga0070683_100000998
1375 Ga0070683_100013221
1376 Ga0070683_100014484
1377 Ga0070683_100019132
1378 Ga0070683_100019244
1379 Ga0070683_100029690
1380 Ga0070683_100051215
1381 Ga0070683_100085545
1382 Ga0070683_100087340
1383 Ga0070683_100087887
1384 Ga0070683_100127782
1385 Ga0070683_100204198
1386 Ga0070683_100337900
1387 Ga0070690_100030384
1388 Ga0070690_100151977
1389 Ga0070670_100000545
1390 Ga0070670_100005337
1391 Ga0070677_10002094
1392 Ga0068869_100007637
1393 Ga0068869_100047898
1394 Ga0068869_100292290
1395 Ga0070666_10032300
1396 Ga0070666_10039426
1397 Ga0070680_100000074
1398 Ga0070680_100000413
1399 Ga0070680_100003658
1400 Ga0070680_100003960
1401 Ga0070680_100004433
1402 Ga0070680_100005930
1403 Ga0070680_100012040
1404 Ga0070680_100013319
1405 Ga0070680_100054875
1406 Ga0070680_100069126
1407 Ga0070680_100073879
1408 Ga0070680_100090146
1409 Ga0070680_100167821
1410 Ga0070682_100004414
1411 Ga0070682_100163464
1412 Ga0070682_100212709
1413 Ga0068868_100005889
1414 Ga0070660_100001958
1415 Ga0070660_100025383
1416 Ga0070660_100048150
1417 Ga0070660_100078566
1418 Ga0070660_100201138
1419 Ga0070660_100266243
1420 Ga0070689_100015702
1421 Ga0070689_100164365
1422 Ga0070689_100182749
1423 Ga0070691_10001670
1424 Ga0070691_10007813
1425 Ga0070691_10013212
1426 Ga0070687_100102100
1427 Ga0070661_100005342
1428 Ga0070661_100006352
1429 Ga0070661_100006568
1430 Ga0070661_100009437
1431 Ga0070661_100015646
1432 Ga0070661_100282636
1433 Ga0070692_10056741
1434 Ga0070692_10074155
1435 Ga0070692_10107852
1436 Ga0070668_100001979
1437 Ga0070668_100007235
1438 Ga0070668_100016181
1439 Ga0070669_100015410
1440 Ga0070669_100153597
1441 Ga0070675_100000777
1442 Ga0070675_100003949
1443 Ga0070675_100176653
1444 Ga0070675_100214230
1445 Ga0070675_100229123
1446 Ga0070675_100255088
1447 Ga0070675_100327503
1448 Ga0070671_100029155
1449 Ga0070671_100044899
1450 Ga0070671_100212372
1451 Ga0070671_100245767
1452 Ga0070674_100000378
1453 Ga0070674_100031767
1454 Ga0070674_100046773
1455 Ga0070674_100059766
1456 Ga0070674_100084226
1457 Ga0070674_100202808
1458 Ga0070673_100047043
1459 Ga0070673_100057293
1460 Ga0070673_100109188
1461 Ga0070673_100217393
1462 Ga0070688_100015113
1463 Ga0070688_100205160
1464 Ga0070659_100000726
1465 Ga0070659_100001533
1466 Ga0070659_100047921
1467 Ga0070659_100080860
1468 Ga0070659_100086400
1469 Ga0070659_100244549
1470 Ga0070659_100351343
1471 Ga0070667_100006589
1472 Ga0070667_100073170
1473 Ga0070667_100196899
1474 Ga0070667_100312953
1475 Ga0070667_100431310
1476 Ga0070703_10000072
1477 Ga0070709_10003005
1478 Ga0070709_10019622
1479 Ga0070714_100005258
1480 Ga0070714_100007482
1481 Ga0070714_100221057
1482 Ga0070714_100304316
1483 Ga0070714_100311809
1484 Ga0070713_100001395
1485 Ga0070713_100031379
1486 Ga0070713_100228991
1487 Ga0070710_10037005
1488 Ga0070710_10136293
1489 Ga0070701_10018517
1490 Ga0070701_10018955
1491 Ga0070701_10021050
1492 Ga0070701_10026509
1493 Ga0070701_10127911
1494 Ga0070711_100142639
1495 Ga0070711_100216852
1496 Ga0070705_100002554
1497 Ga0070705_100002844
1498 Ga0070705_100021616
1499 Ga0070705_100024921
1500 Ga0070705_100035744
1501 Ga0070705_100082669
1502 Ga0070705_100130359
1503 Ga0070700_100005908
1504 Ga0070700_100166264
1505 Ga0070694_100000767
1506 Ga0070694_100003473
1507 Ga0070694_100005169
1508 Ga0070694_100010198
1509 Ga0070694_100069965
1510 Ga0070694_100150556
1511 Ga0070694_100223379
1512 Ga0070708_100000170
1513 Ga0070708_100008540
1514 Ga0070708_100122182
1515 Ga0070708_100162821
1516 Ga0070708_100391801
1517 Ga0070663_100015151
1518 Ga0070663_100055490
1519 Ga0070678_100023130
1520 Ga0070662_100000290
1521 Ga0070662_100001016
1522 Ga0070662_100010812
1523 Ga0070662_100025718
1524 Ga0070662_100053243
1525 Ga0070662_100057167
1526 Ga0070662_100156262
1527 Ga0070662_100177365
1528 Ga0070681_10000380
1529 Ga0070681_10000841
1530 Ga0070681_10004130
1531 Ga0070681_10009348
1532 Ga0070681_10035538
1533 Ga0070681_10050026
1534 Ga0070681_10077208
1535 Ga0070681_10231086
1536 Ga0068867_100001302
1537 Ga0068867_100177233
1538 Ga0070706_100017417
1539 Ga0070706_100035766
1540 Ga0070706_100057009
1541 Ga0070706_100120749
1542 Ga0070706_100428798
1543 Ga0070706_100489853
1544 Ga0070707_100005597
1545 Ga0070707_100008444
1546 Ga0070707_100010336
1547 Ga0070707_100010473
1548 Ga0070707_100014038
1549 Ga0070707_100055458
1550 Ga0070707_100091208
1551 Ga0070707_100136224
1552 Ga0070707_100139334
1553 Ga0070707_100162085
1554 Ga0070707_100198186
1555 Ga0070707_100333813
1556 Ga0070698_100000037
1557 Ga0070698_100002580
1558 Ga0070698_100008726
1559 Ga0070698_100016814
1560 Ga0070698_100029962
1561 Ga0070698_100042943
1562 Ga0070698_100070184
1563 Ga0070698_100074457
1564 Ga0070698_100092687
1565 Ga0070698_100288043
1566 Ga0070699_100001113
1567 Ga0070699_100002242
1568 Ga0070699_100003489
1569 Ga0070699_100008908
1570 Ga0070699_100009101
1571 Ga0070699_100012828
1572 Ga0070699_100030641
1573 Ga0070699_100051232
1574 Ga0070699_100061031
1575 Ga0070699_100095808
1576 Ga0070699_100115628
1577 Ga0070699_100117766
1578 Ga0070699_100134605
1579 Ga0070699_100246181
1580 Ga0070699_100276797
1581 Ga0070699_100305266
1582 Ga0070679_100002320
1583 Ga0070679_100002482
1584 Ga0070679_100006378
1585 Ga0070679_100009621
1586 Ga0070679_100020819
1587 Ga0070679_100036659
1588 Ga0070679_100062093
1589 Ga0070679_100076937
1590 Ga0070679_100129908
1591 Ga0070679_100144964
1592 Ga0070679_100257622
1593 Ga0070679_100263344
1594 Ga0070684_100002962
1595 Ga0070684_100008607
1596 Ga0070684_100054921
1597 Ga0070684_100113377
1598 Ga0070684_100136248
1599 Ga0070684_100144322
1600 Ga0070684_100177567
1601 Ga0070684_100198402
1602 Ga0070684_100278448
1603 Ga0070684_100281138
1604 Ga0070684_100397158
1605 Ga0070697_100001282
1606 Ga0070697_100002404
1607 Ga0070697_100030212
1608 Ga0070697_100045499
1609 Ga0070697_100047299
1610 Ga0070697_100090607
1611 Ga0070697_100457600
1612 Ga0068853_100278107
1613 Ga0070672_100159327
1614 Ga0070672_100159996
1615 Ga0070672_100186856
1616 Ga0070672_100208609
1617 Ga0070672_100231963
1618 Ga0070686_100059599
1619 Ga0070695_100004134
1620 Ga0070695_100005429
1621 Ga0070695_100005764
1622 Ga0070695_100010694
1623 Ga0070695_100012134
1624 Ga0070695_100016264
1625 Ga0070695_100023241
1626 Ga0070695_100039079
1627 Ga0070695_100057980
1628 Ga0070695_100099820
1629 Ga0070696_100000510
1630 Ga0070696_100000976
1631 Ga0070696_100002442
1632 Ga0070696_100004651
1633 Ga0070696_100006913
1634 Ga0070696_100008566
1635 Ga0070696_100018590
1636 Ga0070696_100020719
1637 Ga0070696_100034919
1638 Ga0070696_100037590
1639 Ga0070696_100142721
1640 Ga0070693_100007479
1641 Ga0070693_100021141
1642 Ga0070693_100067237
1643 Ga0070665_100105573
1644 Ga0070665_100280275
1645 Ga0070704_100000762
1646 Ga0070704_100004286
1647 Ga0070704_100008201
1648 Ga0070704_100010543
1649 Ga0070704_100011411
1650 Ga0070704_100012284
1651 Ga0070704_100021614
1652 Ga0070704_100028831
1653 Ga0070704_100046385
1654 Ga0068855_100009620
1655 Ga0068855_100015470
1656 Ga0068855_100051521
1657 Ga0068855_100054125
1658 Ga0068855_100054576
1659 Ga0068855_100073823
1660 Ga0068855_100145576
1661 Ga0068855_100200005
1662 Ga0070664_100002877
1663 Ga0070664_100010902
1664 Ga0070664_100026090
1665 Ga0070664_100064713
1666 Ga0070664_100127592
1667 Ga0070664_100230988
1668 Ga0070664_100233476
1669 Ga0070664_100329999
1670 Ga0068857_100005146
1671 Ga0068857_100005151
1672 Ga0068857_100015574
1673 Ga0068857_100021174
1674 Ga0068857_100041282
1675 Ga0068857_100142020
1676 Ga0068857_100147554
1677 Ga0068854_100001114
1678 Ga0068854_100006569
1679 Ga0068856_100031723
1680 Ga0068856_100123412
1681 Ga0068856_100180165
1682 Ga0068856_100231845
1683 Ga0070702_100003169
1684 Ga0070702_100105654
1685 Ga0068852_100006187
1686 Ga0068852_100038569
1687 Ga0068852_100051599
1688 Ga0068852_100126434
1689 Ga0068852_100203009
1690 Ga0068859_100005677
1691 Ga0068859_100022805
1692 Ga0068859_100347603
1693 Ga0068859_100692502
1694 Ga0068864_100002802
1695 Ga0068864_100010018
1696 Ga0068864_100213683
1697 Ga0068864_100391659
1698 Ga0068864_100421049
1699 Ga0068866_10000401
1700 Ga0068866_10138587
1701 Ga0068861_100000364
1702 Ga0068861_100051823
1703 Ga0068861_100081205
1704 Ga0068851_10057196
1705 Ga0068870_10003912
1706 Ga0068870_10042640
1707 Ga0068863_100003141
1708 Ga0068863_100341490
1709 Ga0068858_100040883
1710 Ga0068858_100202258
1711 Ga0068858_100360283
1712 Ga0068858_100390187
1713 Ga0068860_100008736
1714 Ga0068860_100038640
1715 Ga0068860_100208145
1716 Ga0068860_100222385
1717 Ga0068862_100004058
1718 Ga0068862_100005592
1719 Ga0068862_100124858
1720 Ga0081455_10025751
1721 Ga0081538_10039338
1722 Ga0081539_10008986
1723 Ga0070716_100021124
1724 Ga0070716_100082864
1725 Ga0070712_100057282
1726 Ga0070712_100337944
1727 Ga0097621_100015842
1728 Ga0097621_100286288
1729 Ga0068871_100028026
1730 Ga0075428_100022755
1731 Ga0075428_100062985
1732 Ga0075428_100115375
1733 Ga0075430_100016293
1734 Ga0075430_100037372
1735 Ga0075430_100109903
1736 Ga0075430_100139661
1737 Ga0075431_100052677
1738 Ga0075431_100063453
1739 Ga0075431_100081554
1740 Ga0075431_100189178
1741 Ga0075431_100233776
1742 Ga0075431_100249914
1743 Ga0075431_100484624
1744 Ga0075433_10004001
1745 Ga0075433_10004074
1746 Ga0075433_10013983
1747 Ga0075433_10026026
1748 Ga0075433_10064689
1749 Ga0075434_100006449
1750 Ga0075434_100010304
1751 Ga0075434_100013833
1752 Ga0075434_100022999
1753 Ga0075434_100034022
1754 Ga0075434_100038953
1755 Ga0075434_100043884
1756 Ga0075434_100075352
1757 Ga0075434_100078264
1758 Ga0075434_100087772
1759 Ga0075434_100163249
1760 Ga0075434_100183701
1761 Ga0075434_100187303
1762 Ga0075434_100190376
1763 Ga0075434_100265560
1764 Ga0075434_100417390
1765 Ga0075429_100001523
1766 Ga0075429_100040646
1767 Ga0075429_100060576
1768 Ga0075429_100186621
1769 Ga0075429_100216545
1770 Ga0068865_100003327
1771 Ga0068865_100003920
1772 Ga0068865_100025474
1773 Ga0068865_100082061
1774 Ga0075436_100000571
1775 Ga0075436_100010480
1776 Ga0075436_100026519
1777 Ga0075436_100027275
1778 Ga0075436_100030577
1779 Ga0075436_100037135
1780 Ga0075436_100077218
1781 Ga0075436_100188310
1782 Ga0075436_100300154
1783 Ga0097620_100005677
1784 Ga0097620_100022806
1785 Ga0097620_100347582
1786 Ga0097620_100692539
1787 Ga0075435_100002070
1788 Ga0075435_100026094
1789 Ga0075435_100077732
1790 Ga0075435_100079287
1791 Ga0075435_100109526
1792 Ga0075435_100158752
1793 Ga0075435_100181754
1794 Ga0075435_100230996
1795 Ga0075435_100293791
1796 Ga0075435_100318526
1797 Ga0099794_10000178
1798 Ga0099794_10021608
1799 Ga0099794_10065122
1800 Ga0099795_10006951
1801 Ga0105240_10010311
1802 Ga0105240_10038754
1803 Ga0105240_10053547
1804 Ga0105240_10074675
1805 Ga0105240_10090847
1806 Ga0105240_10102245
1807 Ga0111539_10032459
1808 Ga0111539_10045772
1809 Ga0111539_10065230
1810 Ga0111539_10074441
1811 Ga0111539_10441721
1812 Ga0105245_10032173
1813 Ga0105245_10096433
1814 Ga0105245_10250874
1815 Ga0105245_10379305
1816 Ga0105245_10438425
1817 Ga0105247_10069873
1818 Ga0114129_10001639
1819 Ga0114129_10007805
1820 Ga0114129_10066146
1821 Ga0114129_10070357
1822 Ga0114129_10271166
1823 Ga0114129_10403136
1824 Ga0114129_10725711
1825 Ga0105243_10002610
1826 Ga0105243_10200282
1827 Ga0105241_10000025
1828 Ga0105241_10007428
1829 Ga0105241_10104215
1830 Ga0105241_10153651
1831 Ga0105242_10001397
1832 Ga0105248_10000658
1833 Ga0105248_10015291
1834 Ga0105248_10037957
1835 Ga0105248_10053356
1836 Ga0105248_10089736
1837 Ga0105248_10099483
1838 Ga0105248_10266431
1839 Ga0105248_10474646
1840 Ga0105237_10097585
1841 Ga0105237_10386456
1842 Ga0105249_10000083
1843 Ga0105249_10001049
1844 Ga0105249_10001200
1845 Ga0105249_10007224
1846 Ga0105249_10022839
1847 Ga0105239_10060464
1848 Ga0105239_10069697
1849 Ga0105239_10219021
1850 Ga0105239_10385941
1851 Ga0105246_10000937
1852 Ga0105246_10254715
1853 Ga0157373_10020264
1854 Ga0157373_10029175
1855 Ga0157373_10042096
1856 Ga0157373_10209151
1857 Ga0157373_10253927
1858 Ga0157371_10028628
1859 Ga0157371_10056882
1860 Ga0157371_10109814
1861 Ga0157371_10208561
1862 Ga0157370_10001352
1863 Ga0157370_10009331
1864 Ga0157370_10023060
1865 Ga0157370_10301032
1866 Ga0157369_10004455
1867 Ga0157369_10010646
1868 Ga0157369_10032769
1869 Ga0157369_10036813
1870 Ga0157369_10148309
1871 Ga0157369_10186626
1872 Ga0157369_10270608
1873 Ga0157369_10422969
1874 Ga0157374_10021577
1875 Ga0157374_10021754
1876 Ga0157374_10107989
1877 Ga0157378_10033195
1878 Ga0157378_10055874
1879 Ga0157378_10078557
1880 Ga0157378_10083622
1881 Ga0157378_10102274
1882 Ga0157378_10322468
1883 Ga0163162_10039491
1884 Ga0163162_10207242
1885 Ga0157372_10001740
1886 Ga0157372_10002494
1887 Ga0157372_10003084
1888 Ga0157372_10005801
1889 Ga0157372_10010221
1890 Ga0157372_10019475
1891 Ga0157372_10063803
1892 Ga0157372_10071687
1893 Ga0157372_10080213
1894 Ga0157372_10081523
1895 Ga0157372_10102646
1896 Ga0157372_10154299
1897 Ga0157372_10156622
1898 Ga0157372_10166347
1899 Ga0157372_10308089
1900 Ga0157372_10441787
1901 Ga0157372_10492516
1902 Ga0157372_10780076
1903 Ga0157375_10041631
1904 Ga0157375_10068267
1905 Ga0157375_10117344
1906 Ga0157375_10276113
1907 Ga0157375_10483416
1908 Ga0163163_10137410
1909 Ga0163163_10336543
1910 Ga0157380_10009811
1911 Ga0157380_10093235
1912 Ga0157380_10137122
1913 Ga0157380_10257193
1914 Ga0182008_10024756
1915 Ga0182008_10076374
1916 Ga0157377_10002859
1917 Ga0157377_10005428
1918 Ga0157379_10005967
1919 Ga0157379_10093822
1920 Ga0157379_10302135
1921 Ga0157376_10259046
1922 Ga0157376_10330617
1923 Ga0157376_10482624
1924 Ga0163161_10129020
1925 Ga0206356_10784497
1926 Ga0207697_10002904
1927 Ga0207653_10000053
1928 Ga0207653_10023574
1929 Ga0207653_10024659
1930 Ga0207653_10066532
1931 Ga0207642_10000799
1932 Ga0207642_10004837
1933 Ga0207680_10045244
1934 Ga0207699_10011001
1935 Ga0207699_10120803
1936 Ga0207645_10000052
1937 Ga0207645_10000145
1938 Ga0207645_10031145
1939 Ga0207643_10002996
1940 Ga0207643_10057395
1941 Ga0207705_10001545
1942 Ga0207705_10008946
1943 Ga0207705_10022727
1944 Ga0207705_10043874
1945 Ga0207705_10079705
1946 Ga0207705_10105316
1947 Ga0207705_10147505
1948 Ga0207684_10017658
1949 Ga0207684_10049299
1950 Ga0207684_10065732
1951 Ga0207684_10098026
1952 Ga0207654_10069856
1953 Ga0207654_10088150
1954 Ga0207654_10232462
1955 Ga0207707_10000368
1956 Ga0207707_10001843
1957 Ga0207707_10002577
1958 Ga0207707_10002663
1959 Ga0207707_10005261
1960 Ga0207707_10006129
1961 Ga0207707_10019193
1962 Ga0207707_10027900
1963 Ga0207707_10028674
1964 Ga0207707_10033518
1965 Ga0207707_10092218
1966 Ga0207707_10220628
1967 Ga0207695_10005807
1968 Ga0207695_10006323
1969 Ga0207695_10006746
1970 Ga0207695_10007672
1971 Ga0207695_10082098
1972 Ga0207671_10091208
1973 Ga0207693_10011197
1974 Ga0207693_10057046
1975 Ga0207663_10204464
1976 Ga0207660_10000017
1977 Ga0207660_10000488
1978 Ga0207660_10003121
1979 Ga0207660_10007380
1980 Ga0207660_10007539
1981 Ga0207660_10011464
1982 Ga0207660_10012885
1983 Ga0207660_10038959
1984 Ga0207660_10050522
1985 Ga0207660_10056216
1986 Ga0207660_10100214
1987 Ga0207660_10112889
1988 Ga0207660_10164593
1989 Ga0207660_10282755
1990 Ga0207662_10001708
1991 Ga0207662_10046877
1992 Ga0207657_10000432
1993 Ga0207657_10001418
1994 Ga0207657_10013214
1995 Ga0207657_10017286
1996 Ga0207657_10099066
1997 Ga0207657_10127791
1998 Ga0207657_10162901
1999 Ga0207657_10334700
2000 Ga0207649_10003178
2001 Ga0207649_10005400
2002 Ga0207649_10132163
2003 Ga0207652_10000429
2004 Ga0207652_10001247
2005 Ga0207652_10002800
2006 Ga0207652_10010571
2007 Ga0207652_10019078
2008 Ga0207652_10042163
2009 Ga0207652_10061666
2010 Ga0207652_10123627
2011 Ga0207652_10142679
2012 Ga0207652_10206844
2013 Ga0207652_10245829
2014 Ga0207646_10003549
2015 Ga0207646_10006308
2016 Ga0207646_10006748
2017 Ga0207646_10010262
2018 Ga0207646_10031963
2019 Ga0207646_10049721
2020 Ga0207646_10064341
2021 Ga0207646_10077853
2022 Ga0207646_10106574
2023 Ga0207646_10134689
2024 Ga0207646_10139062
2025 Ga0207646_10151207
2026 Ga0207646_10185404
2027 Ga0207681_10004406
2028 Ga0207681_10004849
2029 Ga0207681_10009612
2030 Ga0207681_10069411
2031 Ga0207694_10011630
2032 Ga0207650_10050505
2033 Ga0207650_10105747
2034 Ga0207659_10058534
2035 Ga0207659_10382949
2036 Ga0207687_10116260
2037 Ga0207700_10010137
2038 Ga0207700_10110534
2039 Ga0207664_10026579
2040 Ga0207664_10029190
2041 Ga0207664_10069028
2042 Ga0207644_10022470
2043 Ga0207644_10024347
2044 Ga0207644_10138201
2045 Ga0207690_10011107
2046 Ga0207690_10011507
2047 Ga0207690_10034563
2048 Ga0207690_10060821
2049 Ga0207690_10095573
2050 Ga0207706_10000146
2051 Ga0207706_10000217
2052 Ga0207706_10008952
2053 Ga0207706_10019611
2054 Ga0207706_10027712
2055 Ga0207706_10222443
2056 Ga0207706_10257480
2057 Ga0207706_10282150
2058 Ga0207686_10000067
2059 Ga0207686_10012901
2060 Ga0207709_10001445
2061 Ga0207670_10061761
2062 Ga0207670_10114091
2063 Ga0207669_10001177
2064 Ga0207669_10286069
2065 Ga0207704_10019685
2066 Ga0207704_10021877
2067 Ga0207704_10122168
2068 Ga0207665_10001924
2069 Ga0207665_10057196
2070 Ga0207691_10000818
2071 Ga0207691_10002987
2072 Ga0207691_10011023
2073 Ga0207691_10053833
2074 Ga0207691_10111390
2075 Ga0207691_10144207
2076 Ga0207691_10169436
2077 Ga0207711_10002609
2078 Ga0207711_10024175
2079 Ga0207711_10092930
2080 Ga0207711_10523421
2081 Ga0207689_10007511
2082 Ga0207689_10084019
2083 Ga0207689_10280290
2084 Ga0207661_10002514
2085 Ga0207661_10009050
2086 Ga0207661_10014030
2087 Ga0207661_10016893
2088 Ga0207661_10021314
2089 Ga0207661_10026665
2090 Ga0207661_10056198
2091 Ga0207661_10079465
2092 Ga0207661_10100801
2093 Ga0207661_10148395
2094 Ga0207661_10151140
2095 Ga0207661_10186027
2096 Ga0207661_10199702
2097 Ga0207661_10406808
2098 Ga0207679_10006823
2099 Ga0207679_10009638
2100 Ga0207679_10012824
2101 Ga0207679_10073834
2102 Ga0207679_10114713
2103 Ga0207679_10132726
2104 Ga0207679_10269176
2105 Ga0207679_10341051
2106 Ga0207667_10013600
2107 Ga0207667_10021631
2108 Ga0207667_10049482
2109 Ga0207667_10070493
2110 Ga0207667_10133699
2111 Ga0207667_10217742
2112 Ga0207667_10245987
2113 Ga0207651_10036234
2114 Ga0207651_10047984
2115 Ga0207712_10000079
2116 Ga0207712_10000116
2117 Ga0207712_10001918
2118 Ga0207712_10004409
2119 Ga0207712_10329818
2120 Ga0207668_10037485
2121 Ga0207640_10001376
2122 Ga0207640_10019297
2123 Ga0207640_10034959
2124 Ga0207640_10232608
2125 Ga0207658_10125952
2126 Ga0207658_10224459
2127 Ga0207658_10244812
2128 Ga0207658_10303622
2129 Ga0207677_10049606
2130 Ga0207703_10052808
2131 Ga0207703_10080590
2132 Ga0207703_10148741
2133 Ga0207639_10019393
2134 Ga0207639_10030731
2135 Ga0207639_10103885
2136 Ga0207639_10130182
2137 Ga0207639_10278301
2138 Ga0207678_10002885
2139 Ga0207678_10162549
2140 Ga0207678_10223973
2141 Ga0207708_10004066
2142 Ga0207708_10054547
2143 Ga0207708_10262713
2144 Ga0207702_10023570
2145 Ga0207702_10164302
2146 Ga0207702_10183644
2147 Ga0207641_10162409
2148 Ga0207641_10459253
2149 Ga0207648_10001390
2150 Ga0207648_10020801
2151 Ga0207648_10076676
2152 Ga0207648_10364933
2153 Ga0207676_10036819
2154 Ga0207676_10129677
2155 Ga0207676_10156303
2156 Ga0207676_10156989
2157 Ga0207676_10164598
2158 Ga0207676_10276515
2159 Ga0207674_10000677
2160 Ga0207674_10002099
2161 Ga0207674_10002912
2162 Ga0207674_10019018
2163 Ga0207674_10132766
2164 Ga0207674_10144844
2165 Ga0207674_10367419
2166 Ga0207675_100000102
2167 Ga0207675_100017147
2168 Ga0207675_100118017
2169 Ga0207675_100147291
2170 Ga0207675_100201544
2171 Ga0207698_10006848
2172 Ga0207698_10007858
2173 Ga0207698_10009341
2174 Ga0207698_10029014
2175 Ga0207698_10046115
2176 Ga0207698_10073598
2177 Ga0207698_10083431
2178 Ga0207698_10202809
2179 Ga0207698_10382751
2180 Ga0209970_1007623
2181 Ga0209588_1000809
2182 Ga0209588_1004273
2183 Ga0209588_1027027
2184 Ga0209966_1004660
2185 Ga0209998_10002169
2186 Ga0209998_10009120
2187 Ga0209974_10038427
2188 Ga0209974_10071083
2189 Ga0268266_10036186
2190 Ga0268266_10200454
2191 Ga0268265_10002084
2192 Ga0268265_10092523
2193 Ga0268264_10009387
2194 Ga0268264_10021128
2195 Ga0268264_10119955
2196 Ga0265332_10060665
2197 Ga0265332_10062056
2198 Ga0265340_10045394
2199 Ga0307408_100007165
2200 Ga0307408_100009023
2201 Ga0307408_100010179
2202 Ga0307408_100012296
2203 Ga0307408_100017692
2204 Ga0307408_100021612
2205 Ga0307408_100024813
2206 Ga0307408_100053345
2207 Ga0307408_100074641
2208 Ga0307408_100079633
2209 Ga0307408_100099428
2210 Ga0307408_100102510
2211 Ga0265314_10068058
2212 Ga0265314_10078400
2213 Ga0265342_10041153
2214 Ga0316576_10091337
2215 Ga0307405_10000062
2216 Ga0307405_10011464
2217 Ga0307405_10013607
2218 Ga0307405_10054931
2219 Ga0307405_10081353
2220 Ga0307405_10165847
2221 Ga0307413_10000544
2222 Ga0307413_10001813
2223 Ga0307413_10002458
2224 Ga0307413_10019795
2225 Ga0307413_10035476
2226 Ga0307413_10059565
2227 Ga0307413_10153614
2228 Ga0307413_10372208
2229 Ga0307410_10008556
2230 Ga0307410_10010028
2231 Ga0307410_10010357
2232 Ga0307410_10010607
2233 Ga0307410_10017648
2234 Ga0307410_10028513
2235 Ga0307410_10031073
2236 Ga0307410_10034960
2237 Ga0307410_10053785
2238 Ga0307410_10080401
2239 Ga0307410_10135240
2240 Ga0307410_10152854
2241 Ga0307410_10174415
2242 Ga0307406_10002612
2243 Ga0307406_10002804
2244 Ga0307406_10010298
2245 Ga0307406_10018265
2246 Ga0307406_10031081
2247 Ga0307406_10056065
2248 Ga0307406_10071554
2249 Ga0307406_10075287
2250 Ga0307406_10165923
2251 Ga0307406_10216074
2252 Ga0307406_10248068
2253 Ga0307407_10000205
2254 Ga0307407_10000240
2255 Ga0307407_10000896
2256 Ga0307407_10003266
2257 Ga0307407_10012983
2258 Ga0307407_10034975
2259 Ga0307407_10036198
2260 Ga0307407_10050453
2261 Ga0307407_10053048
2262 Ga0307412_10002291
2263 Ga0307412_10015849
2264 Ga0307412_10017277
2265 Ga0307412_10035156
2266 Ga0307412_10038352
2267 Ga0307412_10053466
2268 Ga0307412_10085917
2269 Ga0307412_10107015
2270 Ga0307412_10113723
2271 Ga0307412_10178617
2272 Ga0307409_100000540
2273 Ga0307409_100000760
2274 Ga0307409_100002465
2275 Ga0307409_100005482
2276 Ga0307409_100015464
2277 Ga0307409_100021211
2278 Ga0307409_100035527
2279 Ga0307409_100049812
2280 Ga0307409_100123108
2281 Ga0307409_100171507
2282 Ga0307409_100203216
2283 Ga0307416_100000492
2284 Ga0307416_100002344
2285 Ga0307416_100004110
2286 Ga0307416_100006234
2287 Ga0307416_100006582
2288 Ga0307416_100022784
2289 Ga0307416_100044221
2290 Ga0307416_100047694
2291 Ga0307416_100055875
2292 Ga0307416_100078594
2293 Ga0307416_100103796
2294 Ga0307416_100203299
2295 Ga0307416_100314874
2296 Ga0307416_100356769
2297 Ga0307414_10008272
2298 Ga0307414_10019309
2299 Ga0307414_10024174
2300 Ga0307414_10077085
2301 Ga0307414_10078821
2302 Ga0307414_10096087
2303 Ga0307414_10140643
2304 Ga0307414_10196940
2305 Ga0307411_10000132
2306 Ga0307411_10000346
2307 Ga0307411_10002338
2308 Ga0307411_10020498
2309 Ga0307411_10021629
2310 Ga0307411_10026707
2311 Ga0307411_10051404
2312 Ga0307411_10108003
2313 Ga0307411_10141432
2314 Ga0307411_10172311
2315 Ga0307411_10208715
2316 Ga0307411_10274083
2317 Ga0307415_100000261
2318 Ga0307415_100002765
2319 Ga0307415_100004433
2320 Ga0307415_100010341
2321 Ga0307415_100013741
2322 Ga0307415_100021565
2323 Ga0307415_100035689
2324 Ga0307415_100037794
2325 Ga0307415_100100053
2326 Ga0307415_100137587
2327 Ga0373926_0041506
2328 Ga0373934_0000216
2329 Ga0373934_0004067
2330 Ga0373934_0009539
2331 Ga0373944_0044710
2332 Ga0373923_0017713
2333 Ga0373932_0013413
2334 Ga0373939_0022428
2335 Ga0373941_0029969
2336 Ga0373954_0097330
2337 Ga0373956_0000127
2338 Ga0373957_0020187
2339 Ga0373943_0005852
2340 Ga0373946_0004631
2341 Ga0373955_0004826
2342 Ga0373924_0053102
2343 Ga0373931_0015201
2344 Ga0373931_0130774
2345 Ga0373927_0012077
2346 Ga0373927_0050519
2347 Ga0373927_0066263
2348 Ga0373927_0131277
2349 Ga0373933_0000353
2350 Ga0373933_0264535
2351 Ga0373947_0006463
2352 Ga0373937_0000195
2353 Ga0373937_0003317
2354 Ga0373937_0009385
2355 Ga0373937_0013444
2356 Ga0373937_0337205
2357 Ga0373925_0022548
2358 Ga0395899_0024706
2359 Ga0395900_0048539
2360 Ga0395905_0043072
2361 Ga0395905_0081476
2362 Ga0436364_0458848
2363 Ga0395901_0001422
2364 Ga0395901_0507637
2365 Ga0242420_023197
2366 Ga0436365_0252405
2367 Ga0439439_0008615
2368 Ga0439439_0014247
2369 Ga0439439_0048717
2370 Ga0439448_0037820
2371 Ga0450898_002774
2372 Ga0439446_0083473
2373 Ga0439434_0020186
2374 Ga0439435_0005336
2375 Ga0439435_0014857
2376 Ga0451577_0000016
2377 Ga0451577_0040015
2378 Ga0451577_0060761
2379 Ga0451577_0082558
2380 Ga0451577_0393345
2381 Ga0451577_0435502
2382 Ga0453683_0030556
2383 Ga0466966_0007072
2384 Ga0466966_0064590
2385 Ga0466961_0033364
2386 Ga0466961_0089755
2387 Ga0453684_0000886
2388 Ga0453684_0083936
2389 Ga0453684_0088534
2390 Ga0453684_0287342
2391 Ga0453684_0580793
2392 Ga0453684_0640519
2393 Ga0451576_0001721
2394 Ga0451576_0009275
2395 Ga0451576_0020198
2396 Ga0451576_0078786
2397 Ga0451576_0260525
2398 Ga0451576_0304305
2399 Ga0466958_0172257
2400 Ga0466967_0340055
2401 Ga0495592_0084118
2402 Ga0495603_0012254
2403 Ga0495603_0024525
2404 Ga0495603_0030389
2405 Ga0495590_0055742
2406 Ga0495629_0001690
2407 Ga0495629_0018369
2408 Ga0495629_0037952
2409 Ga0495629_0114603
2410 Ga0495629_0264041
2411 Ga0495651_0000050
2412 Ga0495651_0005117
2413 Ga0495651_0078463
2414 Ga0495653_0000134
2415 Ga0495653_0020073
2416 Ga0495580_0003170
2417 Ga0495580_0270113
2418 Ga0495582_0030374
2419 Ga0495582_0042084
2420 Ga0495582_0076907
2421 Ga0495639_0009369
2422 Ga0495594_0011181
2423 Ga0495594_0020892
2424 Ga0495594_0025728
2425 Ga0495594_0087123
2426 Ga0495594_0095883
2427 Ga0495608_0000381
2428 Ga0495618_0041637
2429 Ga0495618_0076903
2430 Ga0495618_0102568
2431 Ga0495628_0001915
2432 Ga0495628_0020377
2433 Ga0495628_0078524
2434 Ga0495630_0002550
2435 Ga0495630_0004360
2436 Ga0495630_0007348
2437 Ga0495630_0030695
2438 Ga0495630_0074785
2439 Ga0495630_0086741
2440 Ga0495643_0151747
2441 Ga0495666_0021364
2442 Ga0495652_0003898
2443 Ga0495652_0052162
2444 Ga0495652_0096439
2445 Ga0495652_0113016
2446 Ga0495665_0002730
2447 Ga0495665_0007115
2448 Ga0495665_0033107
2449 Ga0495640_0101358
2450 Ga0495586_0007821
2451 Ga0495586_0013976
2452 Ga0495586_0021688
2453 Ga0495586_0087993
2454 Ga0495587_0000114
2455 Ga0495587_0009898
2456 Ga0495587_0055948
2457 Ga0495587_0106770
2458 Ga0495645_0000065
2459 Ga0495645_0002208
2460 Ga0495645_0010296
2461 Ga0495645_0224443
2462 Ga0495667_0000316
2463 Ga0495667_0001659
2464 Ga0495667_0002423
2465 Ga0495667_0005100
2466 Ga0495634_0023134
2467 Ga0495635_0003351
2468 Ga0495635_0175850
2469 Ga0495659_0014615
2470 Ga0495588_0002596
2471 Ga0495588_0047731
2472 Ga0495657_0001662
2473 Ga0495657_0087933
2474 Ga0495599_0000754
2475 Ga0495599_0036568
2476 Ga0495599_0044302
2477 Ga0495623_0000086
2478 Ga0495623_0003506
2479 Ga0495623_0055733
2480 Ga0495623_0062428
2481 Ga0495646_0004169
2482 Ga0495647_0029495
2483 Ga0495658_0005675
2484 Ga0495658_0075933
2485 Ga0495669_0081346
2486 Ga0495613_0024883
2487 Ga0495613_0045558
2488 Ga0495624_0065889
2489 Ga0495600_0003319
2490 Ga0495600_0110782
2491 Ga0495600_0176136
2492 Ga0495581_0013945
2493 Ga0495581_0095446
2494 Ga0495581_0103581
2495 Ga0495604_0001195
2496 Ga0495604_0126389
2497 Ga0495604_0209912
2498 Ga0495636_0062063
2499 Ga0495674_0000339
2500 Ga0495674_0006412
2501 Ga0495674_0025755
2502 Ga0495674_0041723
2503 Ga0495674_0049695
2504 Ga0495674_0073351
2505 Ga0495675_0015599
2506 Ga0495675_0075725
2507 Ga0495675_0105424
2508 Ga0495675_0108057
2509 Ga0495675_0121962
2510 Ga0495684_0000141
2511 Ga0495684_0002171
2512 Ga0495684_0051191
2513 Ga0495684_0204747
2514 Ga0495593_0000043
2515 Ga0495602_0003470
2516 Ga0495602_0014360
2517 Ga0495614_0000096
2518 Ga0496100_0179401
2519 Ga0496100_0282483
2520 Ga0496101_0009147
2521 Ga0496101_0100918
2522 Ga0496101_0187262
2523 Ga0496102_0047628
2524 Ga0496102_0134756
2525 Ga0496103_0205199
2526 Ga0496104_0010276
2527 Ga0496104_0026059
2528 Ga0496104_0055390
2529 Ga0496104_0055558
2530 Ga0496104_0063078
2531 Ga0496104_0119252
2532 Ga0496104_0234294
2533 Ga0496104_0339989
2534 Ga0496105_0090022
2535 Ga0496105_0113779
2536 Ga0496106_0173130
2537 Ga0496106_0185399
2538 Ga0496106_0250109
2539 Ga0496107_0052584
2540 Ga0496108_0002171
2541 Ga0496108_0017783
2542 Ga0496108_0126720
2543 Ga0496109_0039510
2544 Ga0496109_0045291
2545 Ga0496109_0222788
2546 Ga0496109_0239380
2547 Ga0496110_0002484
2548 Ga0496110_0042941
2549 Ga0496111_0001425
2550 Ga0496111_0029946
2551 Ga0496112_0000129
2552 Ga0496112_0000882
2553 Ga0496112_0019955
2554 Ga0496112_0032739
2555 Ga0496112_0269071
2556 Ga0496113_0000062
2557 Ga0496113_0122492
2558 Ga0496113_0151071
2559 Ga0496113_0279607
2560 Ga0496114_0059380
2561 Ga0496114_0222926
2562 Ga0496115_0005916
2563 Ga0501292_018642
2564 Ga0501031_0059421
2565 Ga0501031_0199683
2566 Ga0501031_0238987
2567 Ga0501033_0148781
2568 Ga0501034_0008504
2569 Ga0501034_0021718
2570 Ga0501034_0163739
2571 Ga0501034_0320230
2572 Ga0501036_0433937
2573 Ga0501036_0500582
2574 Ga0501037_0043485
2575 Ga0501037_0043614
2576 Ga0501038_0030716
2577 Ga0501038_0089245
2578 Ga0501038_0353564
2579 Ga0501039_0057086
2580 Ga0501040_0012049
2581 Ga0501041_0086024
2582 Ga0501042_0096777
2583 Ga0501042_0107629
2584 Ga0501043_0058442
2585 Ga0501046_0205464
2586 Ga0501047_0025654
2587 Ga0501047_0201897
2588 Ga0501047_0348858
2589 Ga0501048_0012476
2590 Ga0501048_0086144
2591 Ga0501067_0002448
2592 Ga0501067_0003013
2593 Ga0501067_0007870
2594 Ga0501067_0098404
2595 Ga0501068_0000311
2596 Ga0501069_0001105
2597 Ga0501069_0002365
2598 Ga0501069_0076755
2599 Ga0501070_0004182
2600 Ga0501070_0047831
2601 Ga0501071_0002140
2602 Ga0501072_0004214
2603 Ga0501072_0150501
2604 Ga0501073_0253856
2605 Ga0501074_0002285
2606 Ga0501074_0002996
2607 Ga0501075_0008826
2608 Ga0501076_0011216
2609 Ga0501076_0030383
2610 Ga0501077_0000313
2611 Ga0501077_0042267
2612 Ga0501077_0077897
2613 Ga0501217_042216
2614 Ga0501235_011626
2615 Ga0501235_019299
2616 Ga0501225_0011872
2617 Ga0501079_0009697
2618 Ga0501079_0016232
2619 Ga0501079_0019900
2620 Ga0501079_0117394
2621 Ga0501079_0170671
2622 Ga0501079_0201587
2623 Ga0501080_0002645
2624 Ga0501080_0012972
2625 Ga0501080_0321406
2626 Ga0501080_0409614
2627 Ga0501081_0005948
2628 Ga0501081_0048207
2629 Ga0501081_0242427
2630 Ga0501083_0002285
2631 Ga0501083_0013133
2632 Ga0501083_0153114
2633 Ga0501266_004840
2634 Ga0501268_006067
2635 Ga0501268_007168
2636 Ga0501035_0007082
2637 Ga0501035_0229410
2638 Ga0501044_0008093
2639 Ga0501044_0190300
2640 Ga0501045_0045898
2641 Ga0501212_005633
2642 nmdc:mga05p37_163212_c1
2643 nmdc:mga05p37_17760_c1
2644 nmdc:mga05p37_180926_c1
2645 nmdc:mga05p37_2011_c1
2646 nmdc:mga05p37_290600_c1
2647 nmdc:mga05p37_39420_c1
2648 nmdc:mga05p37_549497_c1
2649 nmdc:mga05p37_606789_c1
2650 nmdc:mga05p37_7243_c1
2651 nmdc:mga05p37_76582_c1
2652 nmdc:mga09592_1219_c1
2653 nmdc:mga09592_247484_c1
2654 nmdc:mga09592_66723_c1
2655 nmdc:mga09592_94674_c1
2656 nmdc:mga0qj67_18329_c1
2657 nmdc:mga0qj67_235437_c1
2658 nmdc:mga0qj67_24210_c1
2659 nmdc:mga0qj67_31512_c1
2660 nmdc:mga0qj67_41805_c1
2661 nmdc:mga0qj67_89934_c1
2662 nmdc:mga06r32_124297_c1
2663 nmdc:mga06r32_329936_c1
2664 nmdc:mga06r32_57790_c1
2665 nmdc:mga08y16_135234_c1
2666 nmdc:mga08y16_29721_c1
2667 nmdc:mga08y16_337659_c1
2668 nmdc:mga0n895_125953_c1
2669 nmdc:mga0n895_27921_c1
2670 nmdc:mga0n895_28362_c1
2671 nmdc:mga0n895_31893_c1
2672 nmdc:mga0n895_327193_c1
2673 nmdc:mga0n895_39010_c1
2674 nmdc:mga0n895_39846_c1
2675 nmdc:mga0n895_488161_c1
2676 nmdc:mga0n895_567528_c1
2677 nmdc:mga0n895_72069_c1
2678 nmdc:mga0n895_79256_c1
2679 nmdc:mga0n895_8346_c1
2680 nmdc:mga0n895_87492_c1
2681 nmdc:mga0rr50_148592_c1
2682 nmdc:mga0rr50_16394_c1
2683 nmdc:mga0rr50_21872_c1
2684 nmdc:mga0rr50_219132_c1
2685 nmdc:mga0rr50_29765_c1
2686 nmdc:mga0rr50_33702_c1
2687 nmdc:mga0rr50_5554_c1
2688 nmdc:mga08x19_20307_c1
2689 nmdc:mga08x19_5774_c1
2690 nmdc:mga08x19_5826_c1
2691 nmdc:mga08x19_67607_c1
2692 nmdc:mga08x19_7637_c1
2693 nmdc:mga08x19_7876_c1
2694 nmdc:mga08x19_9849_c1
2695 nmdc:mga0a205_123396_c1
2696 nmdc:mga0a205_18694_c1
2697 nmdc:mga0a205_26983_c1
2698 nmdc:mga0a205_31926_c1
2699 nmdc:mga0a205_7805_c1
2700 nmdc:mga0a205_86401_c1
2701 nmdc:mga0a205_989_c1
2702 Ga0495612_0055401
2703 Ga0495619_0006607
2704 Ga0501084_0001049
2705 Ga0501084_0035691
2706 Ga0501084_0054276
2707 Ga0501084_0073327
2708 Ga0501084_0082642
2709 Ga0590071_000553
2710 Ga0590074_013181
2711 Ga0590077_017968
2712 Ga0501082_0005808
2713 Ga0501082_0024265
2714 Ga0501082_0030793
2715 Ga0501082_0077709
2716 Ga0530510_0157151

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00196

GerE

Bacterial regulatory proteins, luxR family

308

364

0.96

PF00535

Glycos_transf_2

Glycosyl transferase family 2

8

151

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6p61-assembly3.cif.gz_C structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.7434 26 222
4dec-assembly1.cif.gz_A-2 crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with mn2+, uridine-diphosphate (udp) and phosphoglyceric acid (pga) 0.7428 8 244
4y6n-assembly1.cif.gz_A-2 crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with mn2+, uridine-diphosphate-glucose (udp-glc) and phosphoglyceric acid (pga) - gpgs mn2+ udp-glc pga-1 0.7423 8 244
6p61-assembly2.cif.gz_B structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.7405 26 219
5eke-assembly1.cif.gz_D structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (f215a mutant) 0.7401 26 319
ID Description Score Start End Superfamily
af_P77757_4_230_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8888 28 244 3.90.550.10
af_Q8WSL9_63_329_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8542 28 246 3.90.550.10
af_Q57964_2_229_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8521 32 245 3.90.550.10
af_P77757_4_230_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8486 28 244 3.90.550.10
af_A4ICW5_2_228_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8447 29 240 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A7C5I4E0-F1-model_v4 Glycosyltransferase family 2 protein 0.9728 29 124 GO:0005886
GO:0016757
AF-A0A4V1ZS11-F1-model_v4 Glycosyltransferase family 2 protein 0.9707 26 130 GO:0005886
GO:0099621
AF-A0A7C5I4E0-F1-model_v4 Glycosyltransferase family 2 protein 0.9534 29 124 GO:0005886
GO:0016757
AF-A0A7Y6CFG3-F1-model_v4 Glycosyltransferase 0.9515 29 128 GO:0005886
GO:0016757
AF-A0A7V6H0B7-F1-model_v4 Glycosyltransferase 0.9495 23 110 GO:0005886
GO:0099621

Map