F493306
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1358 | 373 | 2716 | 322 |
Family's Representative Sequence
| Representative Sequence | 3300025935|Ga0207709_10247618|Ga0207709_102476181 |
| Length | 370 |
| Sequence | MSQAVQVSLLVPAKDEAENLPEFVRLCAEALTAAPFSFEVVIVDDGSRDDSASLLARLRAEHPFLRVVTHRRQRGIADALRSASEAATGDILVFYPADLQYLPSDIPALVAPILSGEADIVTGTKQGRYEKAFVSGVYNALCRRLFGVKVEDLNSVKAWRAEITRNVSLRPDWHRYMVVIAAVDGFRLDSRPVPLHPRKHGVSKFNWRRIPVGVIDLISVWFQIRFGRKPMLFFGVAGAVLFLIGLLAGIIALVLRFGXXXXFRPLLNLVETMVICGVVLFGFGFVGELIAGMREEQRELLRFLPPPSELSAREAEVLRLVAEGLSDGEIAARLIVSPHTVHRHVANIRTKLGQPSRAAAAADATRRGLI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 77 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 81 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 82 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 83 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 84 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 85 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 90 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 91 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 92 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 93 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 94 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 95 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 96 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 97 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 99 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 100 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 101 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 126 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 199 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 200 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 201 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 202 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 203 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 204 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 205 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 206 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 207 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 208 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 209 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 210 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 211 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 212 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 213 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 214 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 215 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 216 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 217 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 218 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 219 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 221 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 222 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 223 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 224 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 225 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 226 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 227 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 228 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 229 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 230 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 231 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 232 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 233 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 236 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 237 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 238 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 239 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 240 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 241 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 242 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 243 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 244 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 245 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 246 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 247 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 248 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 249 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 250 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 251 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 252 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 253 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 254 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 255 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 256 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 305 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 306 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 307 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 308 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 309 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 310 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 313 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 314 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 315 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 316 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 317 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 318 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 319 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 345 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 346 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 347 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 352 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 353 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 357 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 370 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 371 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 372 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.85 |
| Metatranscriptomes | 0.15 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.31 |
| Rhizosphere | 96.54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207709_10247618 | 3300025935 | Bacteria | 1300 |
| 2 | MBSR1b_contig_3324880 | 2162886012 | Bacteria | 2228 |
| 3 | JGI24752J21851_1011504 | 3300001976 | Bacteria | 1158 |
| 4 | JGI24737J22298_10035544 | 3300001990 | Unclassified | 1541 |
| 5 | Ga0058863_10002510 | 3300004799 | Bacteria | 3768 |
| 6 | Ga0065712_10091947 | 3300005290 | Bacteria | 2348 |
| 7 | Ga0065715_10108757 | 3300005293 | Bacteria | 2702 |
| 8 | Ga0065715_10139884 | 3300005293 | Unclassified | 1870 |
| 9 | Ga0070658_10001114 | 3300005327 | Bacteria | 22934 |
| 10 | Ga0070658_10006876 | 3300005327 | Bacteria | 9194 |
| 11 | Ga0070658_10008230 | 3300005327 | Bacteria | 8386 |
| 12 | Ga0070658_10088574 | 3300005327 | Bacteria | 2548 |
| 13 | Ga0070658_10136562 | 3300005327 | Bacteria | 2046 |
| 14 | Ga0070658_10187659 | 3300005327 | Bacteria | 1742 |
| 15 | Ga0070676_10121088 | 3300005328 | Bacteria | 1642 |
| 16 | Ga0070683_100000998 | 3300005329 | Bacteria | 21199 |
| 17 | Ga0070683_100013221 | 3300005329 | Bacteria | 7191 |
| 18 | Ga0070683_100014484 | 3300005329 | Bacteria | 6900 |
| 19 | Ga0070683_100019132 | 3300005329 | Bacteria | 6078 |
| 20 | Ga0070683_100019244 | 3300005329 | Bacteria | 6064 |
| 21 | Ga0070683_100029690 | 3300005329 | Bacteria | 4954 |
| 22 | Ga0070683_100051215 | 3300005329 | Unclassified | 3822 |
| 23 | Ga0070683_100085545 | 3300005329 | Bacteria | 2956 |
| 24 | Ga0070683_100087340 | 3300005329 | Bacteria | 2925 |
| 25 | Ga0070683_100087887 | 3300005329 | Bacteria | 2915 |
| 26 | Ga0070683_100127782 | 3300005329 | Bacteria | 2404 |
| 27 | Ga0070683_100204198 | 3300005329 | Bacteria | 1877 |
| 28 | Ga0070683_100337900 | 3300005329 | Bacteria | 1434 |
| 29 | Ga0070690_100030384 | 3300005330 | Bacteria | 3357 |
| 30 | Ga0070690_100151977 | 3300005330 | Bacteria | 1580 |
| 31 | Ga0070670_100000545 | 3300005331 | Bacteria | 29977 |
| 32 | Ga0070670_100005337 | 3300005331 | Bacteria | 10836 |
| 33 | Ga0070677_10002094 | 3300005333 | Bacteria | 6357 |
| 34 | Ga0068869_100007637 | 3300005334 | Bacteria | 6923 |
| 35 | Ga0068869_100047898 | 3300005334 | Bacteria | 3089 |
| 36 | Ga0068869_100292290 | 3300005334 | Bacteria | 1313 |
| 37 | Ga0070666_10032300 | 3300005335 | Bacteria | 3457 |
| 38 | Ga0070666_10039426 | 3300005335 | Bacteria | 3149 |
| 39 | Ga0070680_100000074 | 3300005336 | Bacteria | 53742 |
| 40 | Ga0070680_100000413 | 3300005336 | Bacteria | 29124 |
| 41 | Ga0070680_100003658 | 3300005336 | Bacteria | 11490 |
| 42 | Ga0070680_100003960 | 3300005336 | Bacteria | 11077 |
| 43 | Ga0070680_100004433 | 3300005336 | Bacteria | 10569 |
| 44 | Ga0070680_100005930 | 3300005336 | Bacteria | 9271 |
| 45 | Ga0070680_100012040 | 3300005336 | Bacteria | 6712 |
| 46 | Ga0070680_100013319 | 3300005336 | Bacteria | 6405 |
| 47 | Ga0070680_100054875 | 3300005336 | Bacteria | 3255 |
| 48 | Ga0070680_100069126 | 3300005336 | Bacteria | 2900 |
| 49 | Ga0070680_100073879 | 3300005336 | Bacteria | 2804 |
| 50 | Ga0070680_100090146 | 3300005336 | Bacteria | 2538 |
| 51 | Ga0070680_100167821 | 3300005336 | Bacteria | 1846 |
| 52 | Ga0070682_100004414 | 3300005337 | Bacteria | 7804 |
| 53 | Ga0070682_100163464 | 3300005337 | Bacteria | 1540 |
| 54 | Ga0070682_100212709 | 3300005337 | Bacteria | 1371 |
| 55 | Ga0068868_100005889 | 3300005338 | Bacteria | 8645 |
| 56 | Ga0070660_100001958 | 3300005339 | Bacteria | 14198 |
| 57 | Ga0070660_100025383 | 3300005339 | Bacteria | 4405 |
| 58 | Ga0070660_100048150 | 3300005339 | Bacteria | 3273 |
| 59 | Ga0070660_100078566 | 3300005339 | Bacteria | 2587 |
| 60 | Ga0070660_100201138 | 3300005339 | Bacteria | 1616 |
| 61 | Ga0070660_100266243 | 3300005339 | Bacteria | 1400 |
| 62 | Ga0070689_100015702 | 3300005340 | Bacteria | 5528 |
| 63 | Ga0070689_100164365 | 3300005340 | Bacteria | 1796 |
| 64 | Ga0070689_100182749 | 3300005340 | Unclassified | 1704 |
| 65 | Ga0070691_10001670 | 3300005341 | Bacteria | 9618 |
| 66 | Ga0070691_10007813 | 3300005341 | Bacteria | 4895 |
| 67 | Ga0070691_10013212 | 3300005341 | Bacteria | 3783 |
| 68 | Ga0070687_100102100 | 3300005343 | Bacteria | 1608 |
| 69 | Ga0070661_100005342 | 3300005344 | Bacteria | 8862 |
| 70 | Ga0070661_100006352 | 3300005344 | Bacteria | 8151 |
| 71 | Ga0070661_100006568 | 3300005344 | Bacteria | 8020 |
| 72 | Ga0070661_100009437 | 3300005344 | Bacteria | 6752 |
| 73 | Ga0070661_100015646 | 3300005344 | Bacteria | 5354 |
| 74 | Ga0070661_100282636 | 3300005344 | Bacteria | 1288 |
| 75 | Ga0070692_10056741 | 3300005345 | Bacteria | 2052 |
| 76 | Ga0070692_10074155 | 3300005345 | Bacteria | 1819 |
| 77 | Ga0070692_10107852 | 3300005345 | Bacteria | 1536 |
| 78 | Ga0070668_100001979 | 3300005347 | Bacteria | 14966 |
| 79 | Ga0070668_100007235 | 3300005347 | Bacteria | 8230 |
| 80 | Ga0070668_100016181 | 3300005347 | Bacteria | 5580 |
| 81 | Ga0070669_100015410 | 3300005353 | Bacteria | 5447 |
| 82 | Ga0070669_100153597 | 3300005353 | Bacteria | 1783 |
| 83 | Ga0070675_100000777 | 3300005354 | Bacteria | 22314 |
| 84 | Ga0070675_100003949 | 3300005354 | Bacteria | 11241 |
| 85 | Ga0070675_100176653 | 3300005354 | Bacteria | 1844 |
| 86 | Ga0070675_100214230 | 3300005354 | Bacteria | 1675 |
| 87 | Ga0070675_100229123 | 3300005354 | Bacteria | 1620 |
| 88 | Ga0070675_100255088 | 3300005354 | Bacteria | 1536 |
| 89 | Ga0070675_100327503 | 3300005354 | Bacteria | 1354 |
| 90 | Ga0070671_100029155 | 3300005355 | Bacteria | 4550 |
| 91 | Ga0070671_100044899 | 3300005355 | Bacteria | 3672 |
| 92 | Ga0070671_100212372 | 3300005355 | Bacteria | 1641 |
| 93 | Ga0070671_100245767 | 3300005355 | Bacteria | 1519 |
| 94 | Ga0070674_100000378 | 3300005356 | Bacteria | 22336 |
| 95 | Ga0070674_100031767 | 3300005356 | Bacteria | 3502 |
| 96 | Ga0070674_100046773 | 3300005356 | Bacteria | 2962 |
| 97 | Ga0070674_100059766 | 3300005356 | Bacteria | 2654 |
| 98 | Ga0070674_100084226 | 3300005356 | Bacteria | 2280 |
| 99 | Ga0070674_100202808 | 3300005356 | Unclassified | 1533 |
| 100 | Ga0070673_100047043 | 3300005364 | Bacteria | 3354 |
| 101 | Ga0070673_100057293 | 3300005364 | Bacteria | 3078 |
| 102 | Ga0070673_100109188 | 3300005364 | Bacteria | 2292 |
| 103 | Ga0070673_100217393 | 3300005364 | Bacteria | 1652 |
| 104 | Ga0070688_100015113 | 3300005365 | Bacteria | 4384 |
| 105 | Ga0070688_100205160 | 3300005365 | Bacteria | 1381 |
| 106 | Ga0070659_100000726 | 3300005366 | Bacteria | 23942 |
| 107 | Ga0070659_100001533 | 3300005366 | Bacteria | 16660 |
| 108 | Ga0070659_100047921 | 3300005366 | Bacteria | 3354 |
| 109 | Ga0070659_100080860 | 3300005366 | Bacteria | 2595 |
| 110 | Ga0070659_100086400 | 3300005366 | Bacteria | 2510 |
| 111 | Ga0070659_100244549 | 3300005366 | Bacteria | 1486 |
| 112 | Ga0070659_100351343 | 3300005366 | Bacteria | 1237 |
| 113 | Ga0070667_100006589 | 3300005367 | Bacteria | 9654 |
| 114 | Ga0070667_100073170 | 3300005367 | Bacteria | 2922 |
| 115 | Ga0070667_100196899 | 3300005367 | Bacteria | 1786 |
| 116 | Ga0070667_100312953 | 3300005367 | Bacteria | 1416 |
| 117 | Ga0070667_100431310 | 3300005367 | Bacteria | 1202 |
| 118 | Ga0070703_10000072 | 3300005406 | Bacteria | 50010 |
| 119 | Ga0070709_10003005 | 3300005434 | Bacteria | 9077 |
| 120 | Ga0070709_10019622 | 3300005434 | Bacteria | 3911 |
| 121 | Ga0070714_100005258 | 3300005435 | Bacteria | 9860 |
| 122 | Ga0070714_100007482 | 3300005435 | Bacteria | 8501 |
| 123 | Ga0070714_100221057 | 3300005435 | Bacteria | 1740 |
| 124 | Ga0070714_100304316 | 3300005435 | Bacteria | 1487 |
| 125 | Ga0070714_100311809 | 3300005435 | Bacteria | 1469 |
| 126 | Ga0070713_100001395 | 3300005436 | Bacteria | 15475 |
| 127 | Ga0070713_100031379 | 3300005436 | Bacteria | 4232 |
| 128 | Ga0070713_100228991 | 3300005436 | Bacteria | 1689 |
| 129 | Ga0070710_10037005 | 3300005437 | Bacteria | 2672 |
| 130 | Ga0070710_10136293 | 3300005437 | Bacteria | 1501 |
| 131 | Ga0070701_10018517 | 3300005438 | Bacteria | 3274 |
| 132 | Ga0070701_10018955 | 3300005438 | Bacteria | 3243 |
| 133 | Ga0070701_10021050 | 3300005438 | Bacteria | 3106 |
| 134 | Ga0070701_10026509 | 3300005438 | Bacteria | 2827 |
| 135 | Ga0070701_10127911 | 3300005438 | Bacteria | 1440 |
| 136 | Ga0070711_100142639 | 3300005439 | Bacteria | 1798 |
| 137 | Ga0070711_100216852 | 3300005439 | Unclassified | 1485 |
| 138 | Ga0070705_100002554 | 3300005440 | Bacteria | 9147 |
| 139 | Ga0070705_100002844 | 3300005440 | Bacteria | 8628 |
| 140 | Ga0070705_100021616 | 3300005440 | Bacteria | 3425 |
| 141 | Ga0070705_100024921 | 3300005440 | Bacteria | 3236 |
| 142 | Ga0070705_100035744 | 3300005440 | Bacteria | 2787 |
| 143 | Ga0070705_100082669 | 3300005440 | Bacteria | 1977 |
| 144 | Ga0070705_100130359 | 3300005440 | Bacteria | 1639 |
| 145 | Ga0070700_100005908 | 3300005441 | Bacteria | 6507 |
| 146 | Ga0070700_100166264 | 3300005441 | Bacteria | 1523 |
| 147 | Ga0070694_100000767 | 3300005444 | Bacteria | 17957 |
| 148 | Ga0070694_100003473 | 3300005444 | Bacteria | 9433 |
| 149 | Ga0070694_100005169 | 3300005444 | Bacteria | 7874 |
| 150 | Ga0070694_100010198 | 3300005444 | Bacteria | 5786 |
| 151 | Ga0070694_100069965 | 3300005444 | Bacteria | 2415 |
| 152 | Ga0070694_100150556 | 3300005444 | Bacteria | 1699 |
| 153 | Ga0070694_100223379 | 3300005444 | Bacteria | 1414 |
| 154 | Ga0070708_100000170 | 3300005445 | Bacteria | 46089 |
| 155 | Ga0070708_100008540 | 3300005445 | Bacteria | 8230 |
| 156 | Ga0070708_100122182 | 3300005445 | Bacteria | 2403 |
| 157 | Ga0070708_100162821 | 3300005445 | Bacteria | 2079 |
| 158 | Ga0070708_100391801 | 3300005445 | Bacteria | 1310 |
| 159 | Ga0070663_100015151 | 3300005455 | Bacteria | 4967 |
| 160 | Ga0070663_100055490 | 3300005455 | Bacteria | 2836 |
| 161 | Ga0070678_100023130 | 3300005456 | Bacteria | 4135 |
| 162 | Ga0070662_100000290 | 3300005457 | Bacteria | 29689 |
| 163 | Ga0070662_100001016 | 3300005457 | Bacteria | 17162 |
| 164 | Ga0070662_100010812 | 3300005457 | Bacteria | 6010 |
| 165 | Ga0070662_100025718 | 3300005457 | Bacteria | 4068 |
| 166 | Ga0070662_100053243 | 3300005457 | Bacteria | 2929 |
| 167 | Ga0070662_100057167 | 3300005457 | Bacteria | 2834 |
| 168 | Ga0070662_100156262 | 3300005457 | Bacteria | 1780 |
| 169 | Ga0070662_100177365 | 3300005457 | Bacteria | 1678 |
| 170 | Ga0070681_10000380 | 3300005458 | Bacteria | 35836 |
| 171 | Ga0070681_10000841 | 3300005458 | Bacteria | 25746 |
| 172 | Ga0070681_10004130 | 3300005458 | Bacteria | 13733 |
| 173 | Ga0070681_10009348 | 3300005458 | Bacteria | 9644 |
| 174 | Ga0070681_10035538 | 3300005458 | Bacteria | 5006 |
| 175 | Ga0070681_10050026 | 3300005458 | Bacteria | 4171 |
| 176 | Ga0070681_10077208 | 3300005458 | Bacteria | 3289 |
| 177 | Ga0070681_10231086 | 3300005458 | Bacteria | 1764 |
| 178 | Ga0068867_100001302 | 3300005459 | Bacteria | 17244 |
| 179 | Ga0068867_100177233 | 3300005459 | Bacteria | 1692 |
| 180 | Ga0070706_100017417 | 3300005467 | Bacteria | 6630 |
| 181 | Ga0070706_100035766 | 3300005467 | Bacteria | 4586 |
| 182 | Ga0070706_100057009 | 3300005467 | Bacteria | 3604 |
| 183 | Ga0070706_100120749 | 3300005467 | Bacteria | 2443 |
| 184 | Ga0070706_100428798 | 3300005467 | Bacteria | 1230 |
| 185 | Ga0070706_100489853 | 3300005467 | Unclassified | 1144 |
| 186 | Ga0070707_100005597 | 3300005468 | Bacteria | 11739 |
| 187 | Ga0070707_100008444 | 3300005468 | Bacteria | 9567 |
| 188 | Ga0070707_100010336 | 3300005468 | Bacteria | 8688 |
| 189 | Ga0070707_100010473 | 3300005468 | Bacteria | 8637 |
| 190 | Ga0070707_100014038 | 3300005468 | Bacteria | 7506 |
| 191 | Ga0070707_100055458 | 3300005468 | Bacteria | 3799 |
| 192 | Ga0070707_100091208 | 3300005468 | Bacteria | 2950 |
| 193 | Ga0070707_100136224 | 3300005468 | Bacteria | 2389 |
| 194 | Ga0070707_100139334 | 3300005468 | Bacteria | 2360 |
| 195 | Ga0070707_100162085 | 3300005468 | Bacteria | 2179 |
| 196 | Ga0070707_100198186 | 3300005468 | Bacteria | 1957 |
| 197 | Ga0070707_100333813 | 3300005468 | Unclassified | 1473 |
| 198 | Ga0070698_100000037 | 3300005471 | Bacteria | 92307 |
| 199 | Ga0070698_100002580 | 3300005471 | Bacteria | 19948 |
| 200 | Ga0070698_100008726 | 3300005471 | Bacteria | 10917 |
| 201 | Ga0070698_100016814 | 3300005471 | Bacteria | 7715 |
| 202 | Ga0070698_100029962 | 3300005471 | Bacteria | 5647 |
| 203 | Ga0070698_100042943 | 3300005471 | Bacteria | 4637 |
| 204 | Ga0070698_100070184 | 3300005471 | Bacteria | 3516 |
| 205 | Ga0070698_100074457 | 3300005471 | Bacteria | 3401 |
| 206 | Ga0070698_100092687 | 3300005471 | Bacteria | 3002 |
| 207 | Ga0070698_100288043 | 3300005471 | Bacteria | 1573 |
| 208 | Ga0070699_100001113 | 3300005518 | Bacteria | 25024 |
| 209 | Ga0070699_100002242 | 3300005518 | Bacteria | 17436 |
| 210 | Ga0070699_100003489 | 3300005518 | Bacteria | 13902 |
| 211 | Ga0070699_100008908 | 3300005518 | Bacteria | 8693 |
| 212 | Ga0070699_100009101 | 3300005518 | Bacteria | 8611 |
| 213 | Ga0070699_100012828 | 3300005518 | Bacteria | 7224 |
| 214 | Ga0070699_100030641 | 3300005518 | Bacteria | 4644 |
| 215 | Ga0070699_100051232 | 3300005518 | Bacteria | 3574 |
| 216 | Ga0070699_100061031 | 3300005518 | Bacteria | 3268 |
| 217 | Ga0070699_100095808 | 3300005518 | Bacteria | 2599 |
| 218 | Ga0070699_100115628 | 3300005518 | Bacteria | 2357 |
| 219 | Ga0070699_100117766 | 3300005518 | Bacteria | 2335 |
| 220 | Ga0070699_100134605 | 3300005518 | Bacteria | 2180 |
| 221 | Ga0070699_100246181 | 3300005518 | Bacteria | 1597 |
| 222 | Ga0070699_100276797 | 3300005518 | Bacteria | 1503 |
| 223 | Ga0070699_100305266 | 3300005518 | Bacteria | 1428 |
| 224 | Ga0070679_100002320 | 3300005530 | Bacteria | 17220 |
| 225 | Ga0070679_100002482 | 3300005530 | Bacteria | 16711 |
| 226 | Ga0070679_100006378 | 3300005530 | Bacteria | 10984 |
| 227 | Ga0070679_100009621 | 3300005530 | Bacteria | 9143 |
| 228 | Ga0070679_100020819 | 3300005530 | Bacteria | 6398 |
| 229 | Ga0070679_100036659 | 3300005530 | Bacteria | 4867 |
| 230 | Ga0070679_100062093 | 3300005530 | Bacteria | 3724 |
| 231 | Ga0070679_100076937 | 3300005530 | Bacteria | 3325 |
| 232 | Ga0070679_100129908 | 3300005530 | Unclassified | 2501 |
| 233 | Ga0070679_100144964 | 3300005530 | Unclassified | 2353 |
| 234 | Ga0070679_100257622 | 3300005530 | Bacteria | 1700 |
| 235 | Ga0070679_100263344 | 3300005530 | Bacteria | 1679 |
| 236 | Ga0070684_100002962 | 3300005535 | Bacteria | 12637 |
| 237 | Ga0070684_100008607 | 3300005535 | Bacteria | 7993 |
| 238 | Ga0070684_100054921 | 3300005535 | Bacteria | 3471 |
| 239 | Ga0070684_100113377 | 3300005535 | Bacteria | 2433 |
| 240 | Ga0070684_100136248 | 3300005535 | Unclassified | 2218 |
| 241 | Ga0070684_100144322 | 3300005535 | Bacteria | 2154 |
| 242 | Ga0070684_100177567 | 3300005535 | Bacteria | 1936 |
| 243 | Ga0070684_100198402 | 3300005535 | Bacteria | 1828 |
| 244 | Ga0070684_100278448 | 3300005535 | Bacteria | 1532 |
| 245 | Ga0070684_100281138 | 3300005535 | Bacteria | 1525 |
| 246 | Ga0070684_100397158 | 3300005535 | Bacteria | 1271 |
| 247 | Ga0070697_100001282 | 3300005536 | Bacteria | 18927 |
| 248 | Ga0070697_100002404 | 3300005536 | Bacteria | 14414 |
| 249 | Ga0070697_100030212 | 3300005536 | Bacteria | 4352 |
| 250 | Ga0070697_100045499 | 3300005536 | Bacteria | 3556 |
| 251 | Ga0070697_100047299 | 3300005536 | Bacteria | 3488 |
| 252 | Ga0070697_100090607 | 3300005536 | Bacteria | 2527 |
| 253 | Ga0070697_100457600 | 3300005536 | Bacteria | 1112 |
| 254 | Ga0068853_100278107 | 3300005539 | Bacteria | 1543 |
| 255 | Ga0070672_100159327 | 3300005543 | Bacteria | 1871 |
| 256 | Ga0070672_100159996 | 3300005543 | Bacteria | 1867 |
| 257 | Ga0070672_100186856 | 3300005543 | Bacteria | 1728 |
| 258 | Ga0070672_100208609 | 3300005543 | Bacteria | 1636 |
| 259 | Ga0070672_100231963 | 3300005543 | Bacteria | 1551 |
| 260 | Ga0070686_100059599 | 3300005544 | Bacteria | 2460 |
| 261 | Ga0070695_100004134 | 3300005545 | Bacteria | 8479 |
| 262 | Ga0070695_100005429 | 3300005545 | Bacteria | 7499 |
| 263 | Ga0070695_100005764 | 3300005545 | Bacteria | 7297 |
| 264 | Ga0070695_100010694 | 3300005545 | Bacteria | 5484 |
| 265 | Ga0070695_100012134 | 3300005545 | Bacteria | 5166 |
| 266 | Ga0070695_100016264 | 3300005545 | Bacteria | 4500 |
| 267 | Ga0070695_100023241 | 3300005545 | Bacteria | 3807 |
| 268 | Ga0070695_100039079 | 3300005545 | Bacteria | 2997 |
| 269 | Ga0070695_100057980 | 3300005545 | Bacteria | 2503 |
| 270 | Ga0070695_100099820 | 3300005545 | Bacteria | 1953 |
| 271 | Ga0070696_100000510 | 3300005546 | Bacteria | 24577 |
| 272 | Ga0070696_100000976 | 3300005546 | Bacteria | 18550 |
| 273 | Ga0070696_100002442 | 3300005546 | Bacteria | 12318 |
| 274 | Ga0070696_100004651 | 3300005546 | Bacteria | 9165 |
| 275 | Ga0070696_100006913 | 3300005546 | Bacteria | 7575 |
| 276 | Ga0070696_100008566 | 3300005546 | Bacteria | 6842 |
| 277 | Ga0070696_100018590 | 3300005546 | Bacteria | 4700 |
| 278 | Ga0070696_100020719 | 3300005546 | Bacteria | 4455 |
| 279 | Ga0070696_100034919 | 3300005546 | Bacteria | 3461 |
| 280 | Ga0070696_100037590 | 3300005546 | Bacteria | 3340 |
| 281 | Ga0070696_100142721 | 3300005546 | Bacteria | 1752 |
| 282 | Ga0070693_100007479 | 3300005547 | Bacteria | 5341 |
| 283 | Ga0070693_100021141 | 3300005547 | Bacteria | 3444 |
| 284 | Ga0070693_100067237 | 3300005547 | Bacteria | 2100 |
| 285 | Ga0070665_100105573 | 3300005548 | Bacteria | 2819 |
| 286 | Ga0070665_100280275 | 3300005548 | Bacteria | 1669 |
| 287 | Ga0070704_100000762 | 3300005549 | Bacteria | 15854 |
| 288 | Ga0070704_100004286 | 3300005549 | Bacteria | 8244 |
| 289 | Ga0070704_100008201 | 3300005549 | Bacteria | 6249 |
| 290 | Ga0070704_100010543 | 3300005549 | Bacteria | 5627 |
| 291 | Ga0070704_100011411 | 3300005549 | Bacteria | 5446 |
| 292 | Ga0070704_100012284 | 3300005549 | Bacteria | 5287 |
| 293 | Ga0070704_100021614 | 3300005549 | Bacteria | 4175 |
| 294 | Ga0070704_100028831 | 3300005549 | Bacteria | 3698 |
| 295 | Ga0070704_100046385 | 3300005549 | Bacteria | 3030 |
| 296 | Ga0068855_100009620 | 3300005563 | Bacteria | 11663 |
| 297 | Ga0068855_100015470 | 3300005563 | Bacteria | 9185 |
| 298 | Ga0068855_100051521 | 3300005563 | Bacteria | 4849 |
| 299 | Ga0068855_100054125 | 3300005563 | Bacteria | 4718 |
| 300 | Ga0068855_100054576 | 3300005563 | Bacteria | 4697 |
| 301 | Ga0068855_100073823 | 3300005563 | Bacteria | 3963 |
| 302 | Ga0068855_100145576 | 3300005563 | Bacteria | 2698 |
| 303 | Ga0068855_100200005 | 3300005563 | Bacteria | 2250 |
| 304 | Ga0070664_100002877 | 3300005564 | Bacteria | 13947 |
| 305 | Ga0070664_100010902 | 3300005564 | Bacteria | 7370 |
| 306 | Ga0070664_100026090 | 3300005564 | Bacteria | 4845 |
| 307 | Ga0070664_100064713 | 3300005564 | Bacteria | 3119 |
| 308 | Ga0070664_100127592 | 3300005564 | Bacteria | 2232 |
| 309 | Ga0070664_100230988 | 3300005564 | Bacteria | 1658 |
| 310 | Ga0070664_100233476 | 3300005564 | Bacteria | 1649 |
| 311 | Ga0070664_100329999 | 3300005564 | Bacteria | 1384 |
| 312 | Ga0068857_100005146 | 3300005577 | Bacteria | 11122 |
| 313 | Ga0068857_100005151 | 3300005577 | Bacteria | 11119 |
| 314 | Ga0068857_100015574 | 3300005577 | Bacteria | 6642 |
| 315 | Ga0068857_100021174 | 3300005577 | Bacteria | 5721 |
| 316 | Ga0068857_100041282 | 3300005577 | Bacteria | 4091 |
| 317 | Ga0068857_100142020 | 3300005577 | Bacteria | 2171 |
| 318 | Ga0068857_100147554 | 3300005577 | Bacteria | 2129 |
| 319 | Ga0068854_100001114 | 3300005578 | Bacteria | 16150 |
| 320 | Ga0068854_100006569 | 3300005578 | Bacteria | 7405 |
| 321 | Ga0068856_100031723 | 3300005614 | Bacteria | 5170 |
| 322 | Ga0068856_100123412 | 3300005614 | Bacteria | 2592 |
| 323 | Ga0068856_100180165 | 3300005614 | Bacteria | 2126 |
| 324 | Ga0068856_100231845 | 3300005614 | Bacteria | 1861 |
| 325 | Ga0070702_100003169 | 3300005615 | Bacteria | 7293 |
| 326 | Ga0070702_100105654 | 3300005615 | Bacteria | 1736 |
| 327 | Ga0068852_100006187 | 3300005616 | Bacteria | 8631 |
| 328 | Ga0068852_100038569 | 3300005616 | Bacteria | 4016 |
| 329 | Ga0068852_100051599 | 3300005616 | Bacteria | 3531 |
| 330 | Ga0068852_100126434 | 3300005616 | Bacteria | 2348 |
| 331 | Ga0068852_100203009 | 3300005616 | Bacteria | 1876 |
| 332 | Ga0068859_100005677 | 3300005617 | Bacteria | 12699 |
| 333 | Ga0068859_100022805 | 3300005617 | Bacteria | 6276 |
| 334 | Ga0068859_100347603 | 3300005617 | Bacteria | 1578 |
| 335 | Ga0068859_100692502 | 3300005617 | Unclassified | 1110 |
| 336 | Ga0068864_100002802 | 3300005618 | Bacteria | 14393 |
| 337 | Ga0068864_100010018 | 3300005618 | Bacteria | 7824 |
| 338 | Ga0068864_100213683 | 3300005618 | Bacteria | 1777 |
| 339 | Ga0068864_100391659 | 3300005618 | Bacteria | 1319 |
| 340 | Ga0068864_100421049 | 3300005618 | Bacteria | 1272 |
| 341 | Ga0068866_10000401 | 3300005718 | Bacteria | 20182 |
| 342 | Ga0068866_10138587 | 3300005718 | Unclassified | 1393 |
| 343 | Ga0068861_100000364 | 3300005719 | Bacteria | 26004 |
| 344 | Ga0068861_100051823 | 3300005719 | Bacteria | 3117 |
| 345 | Ga0068861_100081205 | 3300005719 | Bacteria | 2538 |
| 346 | Ga0068851_10057196 | 3300005834 | Bacteria | 1991 |
| 347 | Ga0068870_10003912 | 3300005840 | Bacteria | 6355 |
| 348 | Ga0068870_10042640 | 3300005840 | Bacteria | 2363 |
| 349 | Ga0068863_100003141 | 3300005841 | Bacteria | 16310 |
| 350 | Ga0068863_100341490 | 3300005841 | Bacteria | 1457 |
| 351 | Ga0068858_100040883 | 3300005842 | Bacteria | 4300 |
| 352 | Ga0068858_100202258 | 3300005842 | Bacteria | 1878 |
| 353 | Ga0068858_100360283 | 3300005842 | Bacteria | 1394 |
| 354 | Ga0068858_100390187 | 3300005842 | Bacteria | 1337 |
| 355 | Ga0068860_100008736 | 3300005843 | Bacteria | 10090 |
| 356 | Ga0068860_100038640 | 3300005843 | Bacteria | 4566 |
| 357 | Ga0068860_100208145 | 3300005843 | Bacteria | 1897 |
| 358 | Ga0068860_100222385 | 3300005843 | Bacteria | 1833 |
| 359 | Ga0068862_100004058 | 3300005844 | Bacteria | 12411 |
| 360 | Ga0068862_100005592 | 3300005844 | Bacteria | 10501 |
| 361 | Ga0068862_100124858 | 3300005844 | Bacteria | 2271 |
| 362 | Ga0081455_10025751 | 3300005937 | Bacteria | 5424 |
| 363 | Ga0081538_10039338 | 3300005981 | Bacteria | 3034 |
| 364 | Ga0081539_10008986 | 3300005985 | Bacteria | 8498 |
| 365 | Ga0070716_100021124 | 3300006173 | Bacteria | 3426 |
| 366 | Ga0070716_100082864 | 3300006173 | Bacteria | 1919 |
| 367 | Ga0070712_100057282 | 3300006175 | Bacteria | 2737 |
| 368 | Ga0070712_100337944 | 3300006175 | Unclassified | 1229 |
| 369 | Ga0097621_100015842 | 3300006237 | Bacteria | 5683 |
| 370 | Ga0097621_100286288 | 3300006237 | Bacteria | 1452 |
| 371 | Ga0068871_100028026 | 3300006358 | Unclassified | 4411 |
| 372 | Ga0075428_100022755 | 3300006844 | Bacteria | 6934 |
| 373 | Ga0075428_100062985 | 3300006844 | Bacteria | 4060 |
| 374 | Ga0075428_100115375 | 3300006844 | Bacteria | 2926 |
| 375 | Ga0075430_100016293 | 3300006846 | Bacteria | 6331 |
| 376 | Ga0075430_100037372 | 3300006846 | Bacteria | 4116 |
| 377 | Ga0075430_100109903 | 3300006846 | Bacteria | 2299 |
| 378 | Ga0075430_100139661 | 3300006846 | Bacteria | 2018 |
| 379 | Ga0075431_100052677 | 3300006847 | Bacteria | 4196 |
| 380 | Ga0075431_100063453 | 3300006847 | Bacteria | 3813 |
| 381 | Ga0075431_100081554 | 3300006847 | Bacteria | 3340 |
| 382 | Ga0075431_100189178 | 3300006847 | Bacteria | 2110 |
| 383 | Ga0075431_100233776 | 3300006847 | Unclassified | 1872 |
| 384 | Ga0075431_100249914 | 3300006847 | Bacteria | 1802 |
| 385 | Ga0075431_100484624 | 3300006847 | Unclassified | 1229 |
| 386 | Ga0075433_10004001 | 3300006852 | Bacteria | 11406 |
| 387 | Ga0075433_10004074 | 3300006852 | Bacteria | 11327 |
| 388 | Ga0075433_10013983 | 3300006852 | Bacteria | 6545 |
| 389 | Ga0075433_10026026 | 3300006852 | Bacteria | 4949 |
| 390 | Ga0075433_10064689 | 3300006852 | Bacteria | 3206 |
| 391 | Ga0075434_100006449 | 3300006871 | Bacteria | 10753 |
| 392 | Ga0075434_100010304 | 3300006871 | Bacteria | 8763 |
| 393 | Ga0075434_100013833 | 3300006871 | Bacteria | 7695 |
| 394 | Ga0075434_100022999 | 3300006871 | Bacteria | 6068 |
| 395 | Ga0075434_100034022 | 3300006871 | Bacteria | 5030 |
| 396 | Ga0075434_100038953 | 3300006871 | Bacteria | 4710 |
| 397 | Ga0075434_100043884 | 3300006871 | Bacteria | 4435 |
| 398 | Ga0075434_100075352 | 3300006871 | Bacteria | 3367 |
| 399 | Ga0075434_100078264 | 3300006871 | Bacteria | 3302 |
| 400 | Ga0075434_100087772 | 3300006871 | Bacteria | 3112 |
| 401 | Ga0075434_100163249 | 3300006871 | Bacteria | 2247 |
| 402 | Ga0075434_100183701 | 3300006871 | Unclassified | 2112 |
| 403 | Ga0075434_100187303 | 3300006871 | Bacteria | 2090 |
| 404 | Ga0075434_100190376 | 3300006871 | Bacteria | 2072 |
| 405 | Ga0075434_100265560 | 3300006871 | Bacteria | 1735 |
| 406 | Ga0075434_100417390 | 3300006871 | Bacteria | 1363 |
| 407 | Ga0075429_100001523 | 3300006880 | Bacteria | 19059 |
| 408 | Ga0075429_100040646 | 3300006880 | Bacteria | 4049 |
| 409 | Ga0075429_100060576 | 3300006880 | Bacteria | 3297 |
| 410 | Ga0075429_100186621 | 3300006880 | Bacteria | 1817 |
| 411 | Ga0075429_100216545 | 3300006880 | Bacteria | 1678 |
| 412 | Ga0068865_100003327 | 3300006881 | Bacteria | 9628 |
| 413 | Ga0068865_100003920 | 3300006881 | Bacteria | 8930 |
| 414 | Ga0068865_100025474 | 3300006881 | Bacteria | 3891 |
| 415 | Ga0068865_100082061 | 3300006881 | Bacteria | 2317 |
| 416 | Ga0075436_100000571 | 3300006914 | Bacteria | 24085 |
| 417 | Ga0075436_100010480 | 3300006914 | Bacteria | 6355 |
| 418 | Ga0075436_100026519 | 3300006914 | Bacteria | 3990 |
| 419 | Ga0075436_100027275 | 3300006914 | Bacteria | 3931 |
| 420 | Ga0075436_100030577 | 3300006914 | Bacteria | 3706 |
| 421 | Ga0075436_100037135 | 3300006914 | Bacteria | 3364 |
| 422 | Ga0075436_100077218 | 3300006914 | Unclassified | 2307 |
| 423 | Ga0075436_100188310 | 3300006914 | Unclassified | 1460 |
| 424 | Ga0075436_100300154 | 3300006914 | Bacteria | 1151 |
| 425 | Ga0097620_100005677 | 3300006931 | Bacteria | 12699 |
| 426 | Ga0097620_100022806 | 3300006931 | Bacteria | 6276 |
| 427 | Ga0097620_100347582 | 3300006931 | Bacteria | 1578 |
| 428 | Ga0097620_100692539 | 3300006931 | Unclassified | 1110 |
| 429 | Ga0075435_100002070 | 3300007076 | Bacteria | 13150 |
| 430 | Ga0075435_100026094 | 3300007076 | Bacteria | 4554 |
| 431 | Ga0075435_100077732 | 3300007076 | Bacteria | 2721 |
| 432 | Ga0075435_100079287 | 3300007076 | Bacteria | 2694 |
| 433 | Ga0075435_100109526 | 3300007076 | Bacteria | 2296 |
| 434 | Ga0075435_100158752 | 3300007076 | Bacteria | 1904 |
| 435 | Ga0075435_100181754 | 3300007076 | Bacteria | 1777 |
| 436 | Ga0075435_100230996 | 3300007076 | Bacteria | 1572 |
| 437 | Ga0075435_100293791 | 3300007076 | Bacteria | 1389 |
| 438 | Ga0075435_100318526 | 3300007076 | Bacteria | 1331 |
| 439 | Ga0099794_10000178 | 3300007265 | Bacteria | 23179 |
| 440 | Ga0099794_10021608 | 3300007265 | Bacteria | 2925 |
| 441 | Ga0099794_10065122 | 3300007265 | Bacteria | 1777 |
| 442 | Ga0099795_10006951 | 3300007788 | Bacteria | 3124 |
| 443 | Ga0105240_10010311 | 3300009093 | Bacteria | 13153 |
| 444 | Ga0105240_10038754 | 3300009093 | Bacteria | 6110 |
| 445 | Ga0105240_10053547 | 3300009093 | Bacteria | 5065 |
| 446 | Ga0105240_10074675 | 3300009093 | Bacteria | 4184 |
| 447 | Ga0105240_10090847 | 3300009093 | Bacteria | 3732 |
| 448 | Ga0105240_10102245 | 3300009093 | Bacteria | 3483 |
| 449 | Ga0111539_10032459 | 3300009094 | Bacteria | 6339 |
| 450 | Ga0111539_10045772 | 3300009094 | Bacteria | 5236 |
| 451 | Ga0111539_10065230 | 3300009094 | Bacteria | 4304 |
| 452 | Ga0111539_10074441 | 3300009094 | Bacteria | 4001 |
| 453 | Ga0111539_10441721 | 3300009094 | Bacteria | 1515 |
| 454 | Ga0105245_10032173 | 3300009098 | Bacteria | 4643 |
| 455 | Ga0105245_10096433 | 3300009098 | Bacteria | 2729 |
| 456 | Ga0105245_10250874 | 3300009098 | Bacteria | 1719 |
| 457 | Ga0105245_10379305 | 3300009098 | Bacteria | 1408 |
| 458 | Ga0105245_10438425 | 3300009098 | Bacteria | 1312 |
| 459 | Ga0105247_10069873 | 3300009101 | Bacteria | 2193 |
| 460 | Ga0114129_10001639 | 3300009147 | Bacteria | 30412 |
| 461 | Ga0114129_10007805 | 3300009147 | Bacteria | 15222 |
| 462 | Ga0114129_10066146 | 3300009147 | Bacteria | 5042 |
| 463 | Ga0114129_10070357 | 3300009147 | Bacteria | 4879 |
| 464 | Ga0114129_10271166 | 3300009147 | Bacteria | 2270 |
| 465 | Ga0114129_10403136 | 3300009147 | Unclassified | 1802 |
| 466 | Ga0114129_10725711 | 3300009147 | Bacteria | 1275 |
| 467 | Ga0105243_10002610 | 3300009148 | Bacteria | 15026 |
| 468 | Ga0105243_10200282 | 3300009148 | Bacteria | 1751 |
| 469 | Ga0105241_10000025 | 3300009174 | Bacteria | 132929 |
| 470 | Ga0105241_10007428 | 3300009174 | Bacteria | 8068 |
| 471 | Ga0105241_10104215 | 3300009174 | Bacteria | 2259 |
| 472 | Ga0105241_10153651 | 3300009174 | Bacteria | 1885 |
| 473 | Ga0105242_10001397 | 3300009176 | Bacteria | 19028 |
| 474 | Ga0105248_10000658 | 3300009177 | Bacteria | 39283 |
| 475 | Ga0105248_10015291 | 3300009177 | Bacteria | 8461 |
| 476 | Ga0105248_10037957 | 3300009177 | Bacteria | 5389 |
| 477 | Ga0105248_10053356 | 3300009177 | Bacteria | 4537 |
| 478 | Ga0105248_10089736 | 3300009177 | Bacteria | 3460 |
| 479 | Ga0105248_10099483 | 3300009177 | Bacteria | 3277 |
| 480 | Ga0105248_10266431 | 3300009177 | Bacteria | 1928 |
| 481 | Ga0105248_10474646 | 3300009177 | Bacteria | 1410 |
| 482 | Ga0105237_10097585 | 3300009545 | Bacteria | 2929 |
| 483 | Ga0105237_10386456 | 3300009545 | Bacteria | 1404 |
| 484 | Ga0105249_10000083 | 3300009553 | Bacteria | 135844 |
| 485 | Ga0105249_10001049 | 3300009553 | Bacteria | 24466 |
| 486 | Ga0105249_10001200 | 3300009553 | Bacteria | 22851 |
| 487 | Ga0105249_10007224 | 3300009553 | Bacteria | 9691 |
| 488 | Ga0105249_10022839 | 3300009553 | Bacteria | 5607 |
| 489 | Ga0105239_10060464 | 3300010375 | Bacteria | 4158 |
| 490 | Ga0105239_10069697 | 3300010375 | Bacteria | 3863 |
| 491 | Ga0105239_10219021 | 3300010375 | Bacteria | 2134 |
| 492 | Ga0105239_10385941 | 3300010375 | Bacteria | 1584 |
| 493 | Ga0105246_10000937 | 3300011119 | Bacteria | 16710 |
| 494 | Ga0105246_10254715 | 3300011119 | Bacteria | 1395 |
| 495 | Ga0157373_10020264 | 3300013100 | Bacteria | 4837 |
| 496 | Ga0157373_10029175 | 3300013100 | Bacteria | 3976 |
| 497 | Ga0157373_10042096 | 3300013100 | Bacteria | 3265 |
| 498 | Ga0157373_10209151 | 3300013100 | Unclassified | 1376 |
| 499 | Ga0157373_10253927 | 3300013100 | Bacteria | 1244 |
| 500 | Ga0157371_10028628 | 3300013102 | Bacteria | 4032 |
| 501 | Ga0157371_10056882 | 3300013102 | Bacteria | 2774 |
| 502 | Ga0157371_10109814 | 3300013102 | Bacteria | 1958 |
| 503 | Ga0157371_10208561 | 3300013102 | Bacteria | 1402 |
| 504 | Ga0157370_10001352 | 3300013104 | Bacteria | 30418 |
| 505 | Ga0157370_10009331 | 3300013104 | Bacteria | 10503 |
| 506 | Ga0157370_10023060 | 3300013104 | Bacteria | 6187 |
| 507 | Ga0157370_10301032 | 3300013104 | Unclassified | 1480 |
| 508 | Ga0157369_10004455 | 3300013105 | Bacteria | 16501 |
| 509 | Ga0157369_10010646 | 3300013105 | Bacteria | 10469 |
| 510 | Ga0157369_10032769 | 3300013105 | Bacteria | 5711 |
| 511 | Ga0157369_10036813 | 3300013105 | Bacteria | 5360 |
| 512 | Ga0157369_10148309 | 3300013105 | Bacteria | 2480 |
| 513 | Ga0157369_10186626 | 3300013105 | Bacteria | 2180 |
| 514 | Ga0157369_10270608 | 3300013105 | Bacteria | 1770 |
| 515 | Ga0157369_10422969 | 3300013105 | Bacteria | 1381 |
| 516 | Ga0157374_10021577 | 3300013296 | Bacteria | 5733 |
| 517 | Ga0157374_10021754 | 3300013296 | Bacteria | 5712 |
| 518 | Ga0157374_10107989 | 3300013296 | Bacteria | 2674 |
| 519 | Ga0157378_10033195 | 3300013297 | Bacteria | 4561 |
| 520 | Ga0157378_10055874 | 3300013297 | Bacteria | 3517 |
| 521 | Ga0157378_10078557 | 3300013297 | Bacteria | 2977 |
| 522 | Ga0157378_10083622 | 3300013297 | Bacteria | 2889 |
| 523 | Ga0157378_10102274 | 3300013297 | Bacteria | 2617 |
| 524 | Ga0157378_10322468 | 3300013297 | Bacteria | 1501 |
| 525 | Ga0163162_10039491 | 3300013306 | Bacteria | 4717 |
| 526 | Ga0163162_10207242 | 3300013306 | Bacteria | 2090 |
| 527 | Ga0157372_10001740 | 3300013307 | Bacteria | 23617 |
| 528 | Ga0157372_10002494 | 3300013307 | Bacteria | 19954 |
| 529 | Ga0157372_10003084 | 3300013307 | Bacteria | 17944 |
| 530 | Ga0157372_10005801 | 3300013307 | Bacteria | 13150 |
| 531 | Ga0157372_10010221 | 3300013307 | Bacteria | 9964 |
| 532 | Ga0157372_10019475 | 3300013307 | Bacteria | 7315 |
| 533 | Ga0157372_10063803 | 3300013307 | Bacteria | 4132 |
| 534 | Ga0157372_10071687 | 3300013307 | Unclassified | 3902 |
| 535 | Ga0157372_10080213 | 3300013307 | Bacteria | 3691 |
| 536 | Ga0157372_10081523 | 3300013307 | Bacteria | 3662 |
| 537 | Ga0157372_10102646 | 3300013307 | Bacteria | 3267 |
| 538 | Ga0157372_10154299 | 3300013307 | Bacteria | 2652 |
| 539 | Ga0157372_10156622 | 3300013307 | Bacteria | 2631 |
| 540 | Ga0157372_10166347 | 3300013307 | Bacteria | 2550 |
| 541 | Ga0157372_10308089 | 3300013307 | Bacteria | 1843 |
| 542 | Ga0157372_10441787 | 3300013307 | Bacteria | 1516 |
| 543 | Ga0157372_10492516 | 3300013307 | Bacteria | 1429 |
| 544 | Ga0157372_10780076 | 3300013307 | Bacteria | 1111 |
| 545 | Ga0157375_10041631 | 3300013308 | Bacteria | 4438 |
| 546 | Ga0157375_10068267 | 3300013308 | Bacteria | 3557 |
| 547 | Ga0157375_10117344 | 3300013308 | Bacteria | 2766 |
| 548 | Ga0157375_10276113 | 3300013308 | Bacteria | 1843 |
| 549 | Ga0157375_10483416 | 3300013308 | Bacteria | 1403 |
| 550 | Ga0163163_10137410 | 3300014325 | Bacteria | 2485 |
| 551 | Ga0163163_10336543 | 3300014325 | Bacteria | 1564 |
| 552 | Ga0157380_10009811 | 3300014326 | Bacteria | 6872 |
| 553 | Ga0157380_10093235 | 3300014326 | Bacteria | 2490 |
| 554 | Ga0157380_10137122 | 3300014326 | Bacteria | 2096 |
| 555 | Ga0157380_10257193 | 3300014326 | Bacteria | 1584 |
| 556 | Ga0182008_10024756 | 3300014497 | Bacteria | 3053 |
| 557 | Ga0182008_10076374 | 3300014497 | Bacteria | 1648 |
| 558 | Ga0157377_10002859 | 3300014745 | Bacteria | 7706 |
| 559 | Ga0157377_10005428 | 3300014745 | Bacteria | 5990 |
| 560 | Ga0157379_10005967 | 3300014968 | Bacteria | 10498 |
| 561 | Ga0157379_10093822 | 3300014968 | Bacteria | 2693 |
| 562 | Ga0157379_10302135 | 3300014968 | Bacteria | 1459 |
| 563 | Ga0157376_10259046 | 3300014969 | Bacteria | 1628 |
| 564 | Ga0157376_10330617 | 3300014969 | Bacteria | 1452 |
| 565 | Ga0157376_10482624 | 3300014969 | Bacteria | 1215 |
| 566 | Ga0163161_10129020 | 3300017792 | Bacteria | 1906 |
| 567 | Ga0206356_10784497 | 3300020070 | Bacteria | 2197 |
| 568 | Ga0207697_10002904 | 3300025315 | Bacteria | 8674 |
| 569 | Ga0207653_10000053 | 3300025885 | Bacteria | 87641 |
| 570 | Ga0207653_10023574 | 3300025885 | Bacteria | 1960 |
| 571 | Ga0207653_10024659 | 3300025885 | Bacteria | 1920 |
| 572 | Ga0207653_10066532 | 3300025885 | Bacteria | 1225 |
| 573 | Ga0207642_10000799 | 3300025899 | Bacteria | 9788 |
| 574 | Ga0207642_10004837 | 3300025899 | Bacteria | 4359 |
| 575 | Ga0207680_10045244 | 3300025903 | Bacteria | 2594 |
| 576 | Ga0207699_10011001 | 3300025906 | Bacteria | 4558 |
| 577 | Ga0207699_10120803 | 3300025906 | Bacteria | 1694 |
| 578 | Ga0207645_10000052 | 3300025907 | Bacteria | 83428 |
| 579 | Ga0207645_10000145 | 3300025907 | Bacteria | 55543 |
| 580 | Ga0207645_10031145 | 3300025907 | Bacteria | 3434 |
| 581 | Ga0207643_10002996 | 3300025908 | Bacteria | 9106 |
| 582 | Ga0207643_10057395 | 3300025908 | Bacteria | 2216 |
| 583 | Ga0207705_10001545 | 3300025909 | Bacteria | 18273 |
| 584 | Ga0207705_10008946 | 3300025909 | Bacteria | 7293 |
| 585 | Ga0207705_10022727 | 3300025909 | Bacteria | 4472 |
| 586 | Ga0207705_10043874 | 3300025909 | Bacteria | 3213 |
| 587 | Ga0207705_10079705 | 3300025909 | Bacteria | 2385 |
| 588 | Ga0207705_10105316 | 3300025909 | Bacteria | 2079 |
| 589 | Ga0207705_10147505 | 3300025909 | Bacteria | 1761 |
| 590 | Ga0207684_10017658 | 3300025910 | Bacteria | 6121 |
| 591 | Ga0207684_10049299 | 3300025910 | Bacteria | 3572 |
| 592 | Ga0207684_10065732 | 3300025910 | Bacteria | 3079 |
| 593 | Ga0207684_10098026 | 3300025910 | Bacteria | 2503 |
| 594 | Ga0207654_10069856 | 3300025911 | Bacteria | 2083 |
| 595 | Ga0207654_10088150 | 3300025911 | Bacteria | 1885 |
| 596 | Ga0207654_10232462 | 3300025911 | Bacteria | 1228 |
| 597 | Ga0207707_10000368 | 3300025912 | Bacteria | 47267 |
| 598 | Ga0207707_10001843 | 3300025912 | Bacteria | 19422 |
| 599 | Ga0207707_10002577 | 3300025912 | Bacteria | 16238 |
| 600 | Ga0207707_10002663 | 3300025912 | Bacteria | 15948 |
| 601 | Ga0207707_10005261 | 3300025912 | Bacteria | 11332 |
| 602 | Ga0207707_10006129 | 3300025912 | Bacteria | 10510 |
| 603 | Ga0207707_10019193 | 3300025912 | Bacteria | 5966 |
| 604 | Ga0207707_10027900 | 3300025912 | Bacteria | 4936 |
| 605 | Ga0207707_10028674 | 3300025912 | Bacteria | 4865 |
| 606 | Ga0207707_10033518 | 3300025912 | Bacteria | 4494 |
| 607 | Ga0207707_10092218 | 3300025912 | Bacteria | 2647 |
| 608 | Ga0207707_10220628 | 3300025912 | Bacteria | 1650 |
| 609 | Ga0207695_10005807 | 3300025913 | Bacteria | 16244 |
| 610 | Ga0207695_10006323 | 3300025913 | Bacteria | 15408 |
| 611 | Ga0207695_10006746 | 3300025913 | Bacteria | 14808 |
| 612 | Ga0207695_10007672 | 3300025913 | Bacteria | 13663 |
| 613 | Ga0207695_10082098 | 3300025913 | Bacteria | 3260 |
| 614 | Ga0207671_10091208 | 3300025914 | Bacteria | 2296 |
| 615 | Ga0207693_10011197 | 3300025915 | Bacteria | 7259 |
| 616 | Ga0207693_10057046 | 3300025915 | Bacteria | 3061 |
| 617 | Ga0207663_10204464 | 3300025916 | Unclassified | 1427 |
| 618 | Ga0207660_10000017 | 3300025917 | Bacteria | 75942 |
| 619 | Ga0207660_10000488 | 3300025917 | Bacteria | 26440 |
| 620 | Ga0207660_10003121 | 3300025917 | Bacteria | 10835 |
| 621 | Ga0207660_10007380 | 3300025917 | Bacteria | 7114 |
| 622 | Ga0207660_10007539 | 3300025917 | Bacteria | 7043 |
| 623 | Ga0207660_10011464 | 3300025917 | Bacteria | 5771 |
| 624 | Ga0207660_10012885 | 3300025917 | Bacteria | 5476 |
| 625 | Ga0207660_10038959 | 3300025917 | Bacteria | 3321 |
| 626 | Ga0207660_10050522 | 3300025917 | Bacteria | 2953 |
| 627 | Ga0207660_10056216 | 3300025917 | Bacteria | 2815 |
| 628 | Ga0207660_10100214 | 3300025917 | Bacteria | 2163 |
| 629 | Ga0207660_10112889 | 3300025917 | Bacteria | 2048 |
| 630 | Ga0207660_10164593 | 3300025917 | Bacteria | 1713 |
| 631 | Ga0207660_10282755 | 3300025917 | Bacteria | 1317 |
| 632 | Ga0207662_10001708 | 3300025918 | Bacteria | 10753 |
| 633 | Ga0207662_10046877 | 3300025918 | Bacteria | 2558 |
| 634 | Ga0207657_10000432 | 3300025919 | Bacteria | 44554 |
| 635 | Ga0207657_10001418 | 3300025919 | Bacteria | 25590 |
| 636 | Ga0207657_10013214 | 3300025919 | Bacteria | 8104 |
| 637 | Ga0207657_10017286 | 3300025919 | Bacteria | 6923 |
| 638 | Ga0207657_10099066 | 3300025919 | Bacteria | 2421 |
| 639 | Ga0207657_10127791 | 3300025919 | Bacteria | 2086 |
| 640 | Ga0207657_10162901 | 3300025919 | Bacteria | 1811 |
| 641 | Ga0207657_10334700 | 3300025919 | Bacteria | 1195 |
| 642 | Ga0207649_10003178 | 3300025920 | Bacteria | 9006 |
| 643 | Ga0207649_10005400 | 3300025920 | Bacteria | 6920 |
| 644 | Ga0207649_10132163 | 3300025920 | Bacteria | 1697 |
| 645 | Ga0207652_10000429 | 3300025921 | Bacteria | 43684 |
| 646 | Ga0207652_10001247 | 3300025921 | Bacteria | 22702 |
| 647 | Ga0207652_10002800 | 3300025921 | Bacteria | 14631 |
| 648 | Ga0207652_10010571 | 3300025921 | Bacteria | 7429 |
| 649 | Ga0207652_10019078 | 3300025921 | Bacteria | 5634 |
| 650 | Ga0207652_10042163 | 3300025921 | Bacteria | 3883 |
| 651 | Ga0207652_10061666 | 3300025921 | Bacteria | 3239 |
| 652 | Ga0207652_10123627 | 3300025921 | Bacteria | 2304 |
| 653 | Ga0207652_10142679 | 3300025921 | Bacteria | 2142 |
| 654 | Ga0207652_10206844 | 3300025921 | Bacteria | 1767 |
| 655 | Ga0207652_10245829 | 3300025921 | Unclassified | 1613 |
| 656 | Ga0207646_10003549 | 3300025922 | Bacteria | 17535 |
| 657 | Ga0207646_10006308 | 3300025922 | Bacteria | 12292 |
| 658 | Ga0207646_10006748 | 3300025922 | Bacteria | 11816 |
| 659 | Ga0207646_10010262 | 3300025922 | Bacteria | 9170 |
| 660 | Ga0207646_10031963 | 3300025922 | Bacteria | 4764 |
| 661 | Ga0207646_10049721 | 3300025922 | Bacteria | 3754 |
| 662 | Ga0207646_10064341 | 3300025922 | Bacteria | 3273 |
| 663 | Ga0207646_10077853 | 3300025922 | Bacteria | 2963 |
| 664 | Ga0207646_10106574 | 3300025922 | Bacteria | 2514 |
| 665 | Ga0207646_10134689 | 3300025922 | Bacteria | 2224 |
| 666 | Ga0207646_10139062 | 3300025922 | Bacteria | 2187 |
| 667 | Ga0207646_10151207 | 3300025922 | Bacteria | 2094 |
| 668 | Ga0207646_10185404 | 3300025922 | Bacteria | 1879 |
| 669 | Ga0207681_10004406 | 3300025923 | Bacteria | 8675 |
| 670 | Ga0207681_10004849 | 3300025923 | Bacteria | 8264 |
| 671 | Ga0207681_10009612 | 3300025923 | Bacteria | 5910 |
| 672 | Ga0207681_10069411 | 3300025923 | Bacteria | 2451 |
| 673 | Ga0207694_10011630 | 3300025924 | Bacteria | 6641 |
| 674 | Ga0207650_10050505 | 3300025925 | Bacteria | 3076 |
| 675 | Ga0207650_10105747 | 3300025925 | Bacteria | 2173 |
| 676 | Ga0207659_10058534 | 3300025926 | Bacteria | 2766 |
| 677 | Ga0207659_10382949 | 3300025926 | Bacteria | 1173 |
| 678 | Ga0207687_10116260 | 3300025927 | Bacteria | 1993 |
| 679 | Ga0207700_10010137 | 3300025928 | Bacteria | 5926 |
| 680 | Ga0207700_10110534 | 3300025928 | Bacteria | 2210 |
| 681 | Ga0207664_10026579 | 3300025929 | Bacteria | 4377 |
| 682 | Ga0207664_10029190 | 3300025929 | Bacteria | 4199 |
| 683 | Ga0207664_10069028 | 3300025929 | Bacteria | 2841 |
| 684 | Ga0207644_10022470 | 3300025931 | Bacteria | 4310 |
| 685 | Ga0207644_10024347 | 3300025931 | Bacteria | 4155 |
| 686 | Ga0207644_10138201 | 3300025931 | Bacteria | 1873 |
| 687 | Ga0207690_10011107 | 3300025932 | Bacteria | 5372 |
| 688 | Ga0207690_10011507 | 3300025932 | Bacteria | 5288 |
| 689 | Ga0207690_10034563 | 3300025932 | Bacteria | 3258 |
| 690 | Ga0207690_10060821 | 3300025932 | Bacteria | 2565 |
| 691 | Ga0207690_10095573 | 3300025932 | Bacteria | 2111 |
| 692 | Ga0207706_10000146 | 3300025933 | Bacteria | 76821 |
| 693 | Ga0207706_10000217 | 3300025933 | Bacteria | 63442 |
| 694 | Ga0207706_10008952 | 3300025933 | Bacteria | 9214 |
| 695 | Ga0207706_10019611 | 3300025933 | Bacteria | 6083 |
| 696 | Ga0207706_10027712 | 3300025933 | Bacteria | 5065 |
| 697 | Ga0207706_10222443 | 3300025933 | Bacteria | 1653 |
| 698 | Ga0207706_10257480 | 3300025933 | Bacteria | 1524 |
| 699 | Ga0207706_10282150 | 3300025933 | Bacteria | 1448 |
| 700 | Ga0207686_10000067 | 3300025934 | Bacteria | 94339 |
| 701 | Ga0207686_10012901 | 3300025934 | Bacteria | 4608 |
| 702 | Ga0207709_10001445 | 3300025935 | Bacteria | 16588 |
| 703 | Ga0207670_10061761 | 3300025936 | Bacteria | 2558 |
| 704 | Ga0207670_10114091 | 3300025936 | Unclassified | 1952 |
| 705 | Ga0207669_10001177 | 3300025937 | Bacteria | 11105 |
| 706 | Ga0207669_10286069 | 3300025937 | Unclassified | 1246 |
| 707 | Ga0207704_10019685 | 3300025938 | Bacteria | 3551 |
| 708 | Ga0207704_10021877 | 3300025938 | Bacteria | 3415 |
| 709 | Ga0207704_10122168 | 3300025938 | Bacteria | 1785 |
| 710 | Ga0207665_10001924 | 3300025939 | Bacteria | 13978 |
| 711 | Ga0207665_10057196 | 3300025939 | Bacteria | 2634 |
| 712 | Ga0207691_10000818 | 3300025940 | Bacteria | 31020 |
| 713 | Ga0207691_10002987 | 3300025940 | Bacteria | 16496 |
| 714 | Ga0207691_10011023 | 3300025940 | Bacteria | 8672 |
| 715 | Ga0207691_10053833 | 3300025940 | Bacteria | 3672 |
| 716 | Ga0207691_10111390 | 3300025940 | Bacteria | 2434 |
| 717 | Ga0207691_10144207 | 3300025940 | Bacteria | 2097 |
| 718 | Ga0207691_10169436 | 3300025940 | Bacteria | 1913 |
| 719 | Ga0207711_10002609 | 3300025941 | Bacteria | 16005 |
| 720 | Ga0207711_10024175 | 3300025941 | Bacteria | 5086 |
| 721 | Ga0207711_10092930 | 3300025941 | Bacteria | 2656 |
| 722 | Ga0207711_10523421 | 3300025941 | Bacteria | 1106 |
| 723 | Ga0207689_10007511 | 3300025942 | Bacteria | 9557 |
| 724 | Ga0207689_10084019 | 3300025942 | Bacteria | 2617 |
| 725 | Ga0207689_10280290 | 3300025942 | Bacteria | 1380 |
| 726 | Ga0207661_10002514 | 3300025944 | Bacteria | 12612 |
| 727 | Ga0207661_10009050 | 3300025944 | Bacteria | 7136 |
| 728 | Ga0207661_10014030 | 3300025944 | Bacteria | 5863 |
| 729 | Ga0207661_10016893 | 3300025944 | Bacteria | 5390 |
| 730 | Ga0207661_10021314 | 3300025944 | Bacteria | 4854 |
| 731 | Ga0207661_10026665 | 3300025944 | Bacteria | 4406 |
| 732 | Ga0207661_10056198 | 3300025944 | Bacteria | 3159 |
| 733 | Ga0207661_10079465 | 3300025944 | Bacteria | 2703 |
| 734 | Ga0207661_10100801 | 3300025944 | Bacteria | 2424 |
| 735 | Ga0207661_10148395 | 3300025944 | Bacteria | 2025 |
| 736 | Ga0207661_10151140 | 3300025944 | Bacteria | 2007 |
| 737 | Ga0207661_10186027 | 3300025944 | Bacteria | 1818 |
| 738 | Ga0207661_10199702 | 3300025944 | Bacteria | 1758 |
| 739 | Ga0207661_10406808 | 3300025944 | Bacteria | 1235 |
| 740 | Ga0207679_10006823 | 3300025945 | Bacteria | 7238 |
| 741 | Ga0207679_10009638 | 3300025945 | Bacteria | 6190 |
| 742 | Ga0207679_10012824 | 3300025945 | Bacteria | 5480 |
| 743 | Ga0207679_10073834 | 3300025945 | Bacteria | 2582 |
| 744 | Ga0207679_10114713 | 3300025945 | Bacteria | 2133 |
| 745 | Ga0207679_10132726 | 3300025945 | Bacteria | 2000 |
| 746 | Ga0207679_10269176 | 3300025945 | Bacteria | 1456 |
| 747 | Ga0207679_10341051 | 3300025945 | Bacteria | 1303 |
| 748 | Ga0207667_10013600 | 3300025949 | Bacteria | 9304 |
| 749 | Ga0207667_10021631 | 3300025949 | Bacteria | 7125 |
| 750 | Ga0207667_10049482 | 3300025949 | Bacteria | 4438 |
| 751 | Ga0207667_10070493 | 3300025949 | Bacteria | 3637 |
| 752 | Ga0207667_10133699 | 3300025949 | Bacteria | 2555 |
| 753 | Ga0207667_10217742 | 3300025949 | Bacteria | 1956 |
| 754 | Ga0207667_10245987 | 3300025949 | Bacteria | 1830 |
| 755 | Ga0207651_10036234 | 3300025960 | Unclassified | 3218 |
| 756 | Ga0207651_10047984 | 3300025960 | Bacteria | 2883 |
| 757 | Ga0207712_10000079 | 3300025961 | Bacteria | 115164 |
| 758 | Ga0207712_10000116 | 3300025961 | Bacteria | 86504 |
| 759 | Ga0207712_10001918 | 3300025961 | Bacteria | 13678 |
| 760 | Ga0207712_10004409 | 3300025961 | Bacteria | 8893 |
| 761 | Ga0207712_10329818 | 3300025961 | Bacteria | 1262 |
| 762 | Ga0207668_10037485 | 3300025972 | Bacteria | 3245 |
| 763 | Ga0207640_10001376 | 3300025981 | Bacteria | 13153 |
| 764 | Ga0207640_10019297 | 3300025981 | Bacteria | 4026 |
| 765 | Ga0207640_10034959 | 3300025981 | Bacteria | 3141 |
| 766 | Ga0207640_10232608 | 3300025981 | Bacteria | 1419 |
| 767 | Ga0207658_10125952 | 3300025986 | Bacteria | 2050 |
| 768 | Ga0207658_10224459 | 3300025986 | Bacteria | 1582 |
| 769 | Ga0207658_10244812 | 3300025986 | Unclassified | 1521 |
| 770 | Ga0207658_10303622 | 3300025986 | Bacteria | 1376 |
| 771 | Ga0207677_10049606 | 3300026023 | Bacteria | 2834 |
| 772 | Ga0207703_10052808 | 3300026035 | Bacteria | 3302 |
| 773 | Ga0207703_10080590 | 3300026035 | Bacteria | 2711 |
| 774 | Ga0207703_10148741 | 3300026035 | Bacteria | 2040 |
| 775 | Ga0207639_10019393 | 3300026041 | Bacteria | 4850 |
| 776 | Ga0207639_10030731 | 3300026041 | Bacteria | 3941 |
| 777 | Ga0207639_10103885 | 3300026041 | Bacteria | 2303 |
| 778 | Ga0207639_10130182 | 3300026041 | Bacteria | 2082 |
| 779 | Ga0207639_10278301 | 3300026041 | Bacteria | 1471 |
| 780 | Ga0207678_10002885 | 3300026067 | Bacteria | 15604 |
| 781 | Ga0207678_10162549 | 3300026067 | Bacteria | 1907 |
| 782 | Ga0207678_10223973 | 3300026067 | Bacteria | 1610 |
| 783 | Ga0207708_10004066 | 3300026075 | Bacteria | 10758 |
| 784 | Ga0207708_10054547 | 3300026075 | Bacteria | 3047 |
| 785 | Ga0207708_10262713 | 3300026075 | Bacteria | 1394 |
| 786 | Ga0207702_10023570 | 3300026078 | Bacteria | 5106 |
| 787 | Ga0207702_10164302 | 3300026078 | Bacteria | 2029 |
| 788 | Ga0207702_10183644 | 3300026078 | Bacteria | 1928 |
| 789 | Ga0207641_10162409 | 3300026088 | Bacteria | 2032 |
| 790 | Ga0207641_10459253 | 3300026088 | Bacteria | 1232 |
| 791 | Ga0207648_10001390 | 3300026089 | Bacteria | 26643 |
| 792 | Ga0207648_10020801 | 3300026089 | Bacteria | 5907 |
| 793 | Ga0207648_10076676 | 3300026089 | Bacteria | 2914 |
| 794 | Ga0207648_10364933 | 3300026089 | Bacteria | 1303 |
| 795 | Ga0207676_10036819 | 3300026095 | Bacteria | 3725 |
| 796 | Ga0207676_10129677 | 3300026095 | Bacteria | 2142 |
| 797 | Ga0207676_10156303 | 3300026095 | Bacteria | 1970 |
| 798 | Ga0207676_10156989 | 3300026095 | Bacteria | 1967 |
| 799 | Ga0207676_10164598 | 3300026095 | Bacteria | 1925 |
| 800 | Ga0207676_10276515 | 3300026095 | Bacteria | 1523 |
| 801 | Ga0207674_10000677 | 3300026116 | Bacteria | 44223 |
| 802 | Ga0207674_10002099 | 3300026116 | Bacteria | 25266 |
| 803 | Ga0207674_10002912 | 3300026116 | Bacteria | 21243 |
| 804 | Ga0207674_10019018 | 3300026116 | Bacteria | 7444 |
| 805 | Ga0207674_10132766 | 3300026116 | Bacteria | 2452 |
| 806 | Ga0207674_10144844 | 3300026116 | Bacteria | 2334 |
| 807 | Ga0207674_10367419 | 3300026116 | Bacteria | 1391 |
| 808 | Ga0207675_100000102 | 3300026118 | Bacteria | 67767 |
| 809 | Ga0207675_100017147 | 3300026118 | Bacteria | 6763 |
| 810 | Ga0207675_100118017 | 3300026118 | Bacteria | 2508 |
| 811 | Ga0207675_100147291 | 3300026118 | Bacteria | 2239 |
| 812 | Ga0207675_100201544 | 3300026118 | Bacteria | 1912 |
| 813 | Ga0207698_10006848 | 3300026142 | Bacteria | 7129 |
| 814 | Ga0207698_10007858 | 3300026142 | Bacteria | 6710 |
| 815 | Ga0207698_10009341 | 3300026142 | Bacteria | 6249 |
| 816 | Ga0207698_10029014 | 3300026142 | Bacteria | 3956 |
| 817 | Ga0207698_10046115 | 3300026142 | Bacteria | 3289 |
| 818 | Ga0207698_10073598 | 3300026142 | Bacteria | 2721 |
| 819 | Ga0207698_10083431 | 3300026142 | Bacteria | 2586 |
| 820 | Ga0207698_10202809 | 3300026142 | Bacteria | 1777 |
| 821 | Ga0207698_10382751 | 3300026142 | Bacteria | 1339 |
| 822 | Ga0209970_1007623 | 3300027614 | Bacteria | 1774 |
| 823 | Ga0209588_1000809 | 3300027671 | Bacteria | 7948 |
| 824 | Ga0209588_1004273 | 3300027671 | Bacteria | 4022 |
| 825 | Ga0209588_1027027 | 3300027671 | Bacteria | 1825 |
| 826 | Ga0209966_1004660 | 3300027695 | Bacteria | 2331 |
| 827 | Ga0209998_10002169 | 3300027717 | Bacteria | 4556 |
| 828 | Ga0209998_10009120 | 3300027717 | Bacteria | 2056 |
| 829 | Ga0209974_10038427 | 3300027876 | Bacteria | 1591 |
| 830 | Ga0209974_10071083 | 3300027876 | Bacteria | 1187 |
| 831 | Ga0268266_10036186 | 3300028379 | Bacteria | 4201 |
| 832 | Ga0268266_10200454 | 3300028379 | Bacteria | 1826 |
| 833 | Ga0268265_10002084 | 3300028380 | Bacteria | 15584 |
| 834 | Ga0268265_10092523 | 3300028380 | Bacteria | 2420 |
| 835 | Ga0268264_10009387 | 3300028381 | Bacteria | 8099 |
| 836 | Ga0268264_10021128 | 3300028381 | Bacteria | 5318 |
| 837 | Ga0268264_10119955 | 3300028381 | Bacteria | 2316 |
| 838 | Ga0265332_10060665 | 3300031238 | Bacteria | 1618 |
| 839 | Ga0265332_10062056 | 3300031238 | Bacteria | 1597 |
| 840 | Ga0265340_10045394 | 3300031247 | Bacteria | 2147 |
| 841 | Ga0307408_100007165 | 3300031548 | Bacteria | 7387 |
| 842 | Ga0307408_100009023 | 3300031548 | Bacteria | 6588 |
| 843 | Ga0307408_100010179 | 3300031548 | Bacteria | 6204 |
| 844 | Ga0307408_100012296 | 3300031548 | Bacteria | 5668 |
| 845 | Ga0307408_100017692 | 3300031548 | Unclassified | 4774 |
| 846 | Ga0307408_100021612 | 3300031548 | Bacteria | 4358 |
| 847 | Ga0307408_100024813 | 3300031548 | Bacteria | 4099 |
| 848 | Ga0307408_100053345 | 3300031548 | Bacteria | 2919 |
| 849 | Ga0307408_100074641 | 3300031548 | Bacteria | 2517 |
| 850 | Ga0307408_100079633 | 3300031548 | Bacteria | 2445 |
| 851 | Ga0307408_100099428 | 3300031548 | Unclassified | 2214 |
| 852 | Ga0307408_100102510 | 3300031548 | Bacteria | 2183 |
| 853 | Ga0265314_10068058 | 3300031711 | Bacteria | 2395 |
| 854 | Ga0265314_10078400 | 3300031711 | Bacteria | 2187 |
| 855 | Ga0265342_10041153 | 3300031712 | Bacteria | 2800 |
| 856 | Ga0316576_10091337 | 3300031727 | Bacteria | 2269 |
| 857 | Ga0307405_10000062 | 3300031731 | Bacteria | 51691 |
| 858 | Ga0307405_10011464 | 3300031731 | Bacteria | 4647 |
| 859 | Ga0307405_10013607 | 3300031731 | Bacteria | 4345 |
| 860 | Ga0307405_10054931 | 3300031731 | Bacteria | 2489 |
| 861 | Ga0307405_10081353 | 3300031731 | Bacteria | 2117 |
| 862 | Ga0307405_10165847 | 3300031731 | Bacteria | 1570 |
| 863 | Ga0307413_10000544 | 3300031824 | Bacteria | 12547 |
| 864 | Ga0307413_10001813 | 3300031824 | Bacteria | 8385 |
| 865 | Ga0307413_10002458 | 3300031824 | Bacteria | 7539 |
| 866 | Ga0307413_10019795 | 3300031824 | Bacteria | 3564 |
| 867 | Ga0307413_10035476 | 3300031824 | Bacteria | 2861 |
| 868 | Ga0307413_10059565 | 3300031824 | Bacteria | 2346 |
| 869 | Ga0307413_10153614 | 3300031824 | Bacteria | 1607 |
| 870 | Ga0307413_10372208 | 3300031824 | Bacteria | 1110 |
| 871 | Ga0307410_10008556 | 3300031852 | Bacteria | 5683 |
| 872 | Ga0307410_10010028 | 3300031852 | Bacteria | 5345 |
| 873 | Ga0307410_10010357 | 3300031852 | Bacteria | 5277 |
| 874 | Ga0307410_10010607 | 3300031852 | Bacteria | 5229 |
| 875 | Ga0307410_10017648 | 3300031852 | Bacteria | 4292 |
| 876 | Ga0307410_10028513 | 3300031852 | Bacteria | 3543 |
| 877 | Ga0307410_10031073 | 3300031852 | Bacteria | 3422 |
| 878 | Ga0307410_10034960 | 3300031852 | Bacteria | 3259 |
| 879 | Ga0307410_10053785 | 3300031852 | Unclassified | 2726 |
| 880 | Ga0307410_10080401 | 3300031852 | Bacteria | 2286 |
| 881 | Ga0307410_10135240 | 3300031852 | Bacteria | 1816 |
| 882 | Ga0307410_10152854 | 3300031852 | Bacteria | 1720 |
| 883 | Ga0307410_10174415 | 3300031852 | Bacteria | 1623 |
| 884 | Ga0307406_10002612 | 3300031901 | Bacteria | 9818 |
| 885 | Ga0307406_10002804 | 3300031901 | Bacteria | 9506 |
| 886 | Ga0307406_10010298 | 3300031901 | Bacteria | 5270 |
| 887 | Ga0307406_10018265 | 3300031901 | Bacteria | 4094 |
| 888 | Ga0307406_10031081 | 3300031901 | Bacteria | 3249 |
| 889 | Ga0307406_10056065 | 3300031901 | Bacteria | 2521 |
| 890 | Ga0307406_10071554 | 3300031901 | Bacteria | 2273 |
| 891 | Ga0307406_10075287 | 3300031901 | Bacteria | 2227 |
| 892 | Ga0307406_10165923 | 3300031901 | Bacteria | 1593 |
| 893 | Ga0307406_10216074 | 3300031901 | Bacteria | 1422 |
| 894 | Ga0307406_10248068 | 3300031901 | Bacteria | 1339 |
| 895 | Ga0307407_10000205 | 3300031903 | Bacteria | 17969 |
| 896 | Ga0307407_10000240 | 3300031903 | Bacteria | 16149 |
| 897 | Ga0307407_10000896 | 3300031903 | Bacteria | 10038 |
| 898 | Ga0307407_10003266 | 3300031903 | Bacteria | 6604 |
| 899 | Ga0307407_10012983 | 3300031903 | Bacteria | 4026 |
| 900 | Ga0307407_10034975 | 3300031903 | Bacteria | 2756 |
| 901 | Ga0307407_10036198 | 3300031903 | Bacteria | 2718 |
| 902 | Ga0307407_10050453 | 3300031903 | Bacteria | 2381 |
| 903 | Ga0307407_10053048 | 3300031903 | Bacteria | 2331 |
| 904 | Ga0307412_10002291 | 3300031911 | Bacteria | 10598 |
| 905 | Ga0307412_10015849 | 3300031911 | Bacteria | 4476 |
| 906 | Ga0307412_10017277 | 3300031911 | Bacteria | 4316 |
| 907 | Ga0307412_10035156 | 3300031911 | Bacteria | 3199 |
| 908 | Ga0307412_10038352 | 3300031911 | Bacteria | 3085 |
| 909 | Ga0307412_10053466 | 3300031911 | Bacteria | 2677 |
| 910 | Ga0307412_10085917 | 3300031911 | Bacteria | 2188 |
| 911 | Ga0307412_10107015 | 3300031911 | Bacteria | 1989 |
| 912 | Ga0307412_10113723 | 3300031911 | Bacteria | 1937 |
| 913 | Ga0307412_10178617 | 3300031911 | Bacteria | 1594 |
| 914 | Ga0307409_100000540 | 3300031995 | Bacteria | 16375 |
| 915 | Ga0307409_100000760 | 3300031995 | Bacteria | 14560 |
| 916 | Ga0307409_100002465 | 3300031995 | Bacteria | 9692 |
| 917 | Ga0307409_100005482 | 3300031995 | Bacteria | 7314 |
| 918 | Ga0307409_100015464 | 3300031995 | Bacteria | 5011 |
| 919 | Ga0307409_100021211 | 3300031995 | Bacteria | 4449 |
| 920 | Ga0307409_100035527 | 3300031995 | Bacteria | 3653 |
| 921 | Ga0307409_100049812 | 3300031995 | Bacteria | 3196 |
| 922 | Ga0307409_100123108 | 3300031995 | Bacteria | 2201 |
| 923 | Ga0307409_100171507 | 3300031995 | Bacteria | 1910 |
| 924 | Ga0307409_100203216 | 3300031995 | Bacteria | 1774 |
| 925 | Ga0307416_100000492 | 3300032002 | Bacteria | 20070 |
| 926 | Ga0307416_100002344 | 3300032002 | Bacteria | 10833 |
| 927 | Ga0307416_100004110 | 3300032002 | Bacteria | 8711 |
| 928 | Ga0307416_100006234 | 3300032002 | Bacteria | 7445 |
| 929 | Ga0307416_100006582 | 3300032002 | Bacteria | 7289 |
| 930 | Ga0307416_100022784 | 3300032002 | Bacteria | 4530 |
| 931 | Ga0307416_100044221 | 3300032002 | Bacteria | 3494 |
| 932 | Ga0307416_100047694 | 3300032002 | Bacteria | 3393 |
| 933 | Ga0307416_100055875 | 3300032002 | Bacteria | 3182 |
| 934 | Ga0307416_100078594 | 3300032002 | Unclassified | 2777 |
| 935 | Ga0307416_100103796 | 3300032002 | Unclassified | 2483 |
| 936 | Ga0307416_100203299 | 3300032002 | Bacteria | 1882 |
| 937 | Ga0307416_100314874 | 3300032002 | Bacteria | 1564 |
| 938 | Ga0307416_100356769 | 3300032002 | Bacteria | 1482 |
| 939 | Ga0307414_10008272 | 3300032004 | Bacteria | 5889 |
| 940 | Ga0307414_10019309 | 3300032004 | Bacteria | 4220 |
| 941 | Ga0307414_10024174 | 3300032004 | Bacteria | 3869 |
| 942 | Ga0307414_10077085 | 3300032004 | Bacteria | 2425 |
| 943 | Ga0307414_10078821 | 3300032004 | Bacteria | 2402 |
| 944 | Ga0307414_10096087 | 3300032004 | Bacteria | 2216 |
| 945 | Ga0307414_10140643 | 3300032004 | Bacteria | 1889 |
| 946 | Ga0307414_10196940 | 3300032004 | Bacteria | 1635 |
| 947 | Ga0307411_10000132 | 3300032005 | Bacteria | 23505 |
| 948 | Ga0307411_10000346 | 3300032005 | Bacteria | 15638 |
| 949 | Ga0307411_10002338 | 3300032005 | Bacteria | 8326 |
| 950 | Ga0307411_10020498 | 3300032005 | Bacteria | 3846 |
| 951 | Ga0307411_10021629 | 3300032005 | Bacteria | 3769 |
| 952 | Ga0307411_10026707 | 3300032005 | Bacteria | 3480 |
| 953 | Ga0307411_10051404 | 3300032005 | Bacteria | 2688 |
| 954 | Ga0307411_10108003 | 3300032005 | Bacteria | 1984 |
| 955 | Ga0307411_10141432 | 3300032005 | Bacteria | 1775 |
| 956 | Ga0307411_10172311 | 3300032005 | Bacteria | 1633 |
| 957 | Ga0307411_10208715 | 3300032005 | Bacteria | 1506 |
| 958 | Ga0307411_10274083 | 3300032005 | Bacteria | 1339 |
| 959 | Ga0307415_100000261 | 3300032126 | Bacteria | 22792 |
| 960 | Ga0307415_100002765 | 3300032126 | Bacteria | 8776 |
| 961 | Ga0307415_100004433 | 3300032126 | Bacteria | 7279 |
| 962 | Ga0307415_100010341 | 3300032126 | Bacteria | 5280 |
| 963 | Ga0307415_100013741 | 3300032126 | Bacteria | 4736 |
| 964 | Ga0307415_100021565 | 3300032126 | Bacteria | 3962 |
| 965 | Ga0307415_100035689 | 3300032126 | Bacteria | 3249 |
| 966 | Ga0307415_100037794 | 3300032126 | Bacteria | 3176 |
| 967 | Ga0307415_100100053 | 3300032126 | Bacteria | 2124 |
| 968 | Ga0307415_100137587 | 3300032126 | Bacteria | 1860 |
| 969 | Ga0373926_0041506 | 3300035083 | Bacteria | 1644 |
| 970 | Ga0373934_0000216 | 3300035086 | Bacteria | 21032 |
| 971 | Ga0373934_0004067 | 3300035086 | Bacteria | 5389 |
| 972 | Ga0373934_0009539 | 3300035086 | Bacteria | 3637 |
| 973 | Ga0373944_0044710 | 3300035089 | Bacteria | 1380 |
| 974 | Ga0373923_0017713 | 3300035111 | Bacteria | 2728 |
| 975 | Ga0373932_0013413 | 3300035112 | Bacteria | 2038 |
| 976 | Ga0373939_0022428 | 3300035114 | Bacteria | 1740 |
| 977 | Ga0373941_0029969 | 3300035115 | Bacteria | 1609 |
| 978 | Ga0373954_0097330 | 3300035118 | Bacteria | 1418 |
| 979 | Ga0373956_0000127 | 3300035119 | Bacteria | 26808 |
| 980 | Ga0373957_0020187 | 3300035120 | Bacteria | 2352 |
| 981 | Ga0373943_0005852 | 3300035170 | Bacteria | 5521 |
| 982 | Ga0373946_0004631 | 3300035171 | Bacteria | 4933 |
| 983 | Ga0373955_0004826 | 3300035172 | Bacteria | 6008 |
| 984 | Ga0373924_0053102 | 3300035410 | Bacteria | 1683 |
| 985 | Ga0373931_0015201 | 3300035691 | Bacteria | 3773 |
| 986 | Ga0373931_0130774 | 3300035691 | Bacteria | 1445 |
| 987 | Ga0373927_0012077 | 3300035695 | Bacteria | 5743 |
| 988 | Ga0373927_0050519 | 3300035695 | Bacteria | 2689 |
| 989 | Ga0373927_0066263 | 3300035695 | Bacteria | 2336 |
| 990 | Ga0373927_0131277 | 3300035695 | Bacteria | 1637 |
| 991 | Ga0373933_0000353 | 3300035724 | Bacteria | 29440 |
| 992 | Ga0373933_0264535 | 3300035724 | Unclassified | 1109 |
| 993 | Ga0373947_0006463 | 3300035725 | Bacteria | 6806 |
| 994 | Ga0373937_0000195 | 3300036401 | Bacteria | 59262 |
| 995 | Ga0373937_0003317 | 3300036401 | Bacteria | 13518 |
| 996 | Ga0373937_0009385 | 3300036401 | Bacteria | 8499 |
| 997 | Ga0373937_0013444 | 3300036401 | Bacteria | 7210 |
| 998 | Ga0373937_0337205 | 3300036401 | Bacteria | 1428 |
| 999 | Ga0373925_0022548 | 3300037068 | Bacteria | 4593 |
| 1000 | Ga0395899_0024706 | 3300037312 | Bacteria | 4542 |
| 1001 | Ga0395900_0048539 | 3300037418 | Bacteria | 4373 |
| 1002 | Ga0395905_0043072 | 3300037471 | Bacteria | 4235 |
| 1003 | Ga0395905_0081476 | 3300037471 | Bacteria | 3033 |
| 1004 | Ga0436364_0458848 | 3300037853 | Bacteria | 1370 |
| 1005 | Ga0395901_0001422 | 3300038443 | Bacteria | 24965 |
| 1006 | Ga0395901_0507637 | 3300038443 | Bacteria | 1227 |
| 1007 | Ga0242420_023197 | 3300038996 | Bacteria | 1120 |
| 1008 | Ga0436365_0252405 | 3300039437 | Bacteria | 1897 |
| 1009 | Ga0439439_0008615 | 3300041406 | Unclassified | 2412 |
| 1010 | Ga0439439_0014247 | 3300041406 | Bacteria | 1935 |
| 1011 | Ga0439439_0048717 | 3300041406 | Bacteria | 1108 |
| 1012 | Ga0439448_0037820 | 3300042005 | Unclassified | 1552 |
| 1013 | Ga0450898_002774 | 3300042134 | Bacteria | 2459 |
| 1014 | Ga0439446_0083473 | 3300042156 | Bacteria | 992 |
| 1015 | Ga0439434_0020186 | 3300042435 | Bacteria | 2000 |
| 1016 | Ga0439435_0005336 | 3300042436 | Bacteria | 2822 |
| 1017 | Ga0439435_0014857 | 3300042436 | Bacteria | 1929 |
| 1018 | Ga0451577_0000016 | 3300042876 | Bacteria | 531002 |
| 1019 | Ga0451577_0040015 | 3300042876 | Bacteria | 4209 |
| 1020 | Ga0451577_0060761 | 3300042876 | Bacteria | 3369 |
| 1021 | Ga0451577_0082558 | 3300042876 | Bacteria | 2867 |
| 1022 | Ga0451577_0393345 | 3300042876 | Bacteria | 1258 |
| 1023 | Ga0451577_0435502 | 3300042876 | Bacteria | 1190 |
| 1024 | Ga0453683_0030556 | 3300044673 | Bacteria | 3405 |
| 1025 | Ga0466966_0007072 | 3300044684 | Bacteria | 7435 |
| 1026 | Ga0466966_0064590 | 3300044684 | Bacteria | 2304 |
| 1027 | Ga0466961_0033364 | 3300044693 | Bacteria | 3308 |
| 1028 | Ga0466961_0089755 | 3300044693 | Bacteria | 1941 |
| 1029 | Ga0453684_0000886 | 3300044712 | Bacteria | 100081 |
| 1030 | Ga0453684_0083936 | 3300044712 | Bacteria | 3963 |
| 1031 | Ga0453684_0088534 | 3300044712 | Bacteria | 3833 |
| 1032 | Ga0453684_0287342 | 3300044712 | Bacteria | 1874 |
| 1033 | Ga0453684_0580793 | 3300044712 | Unclassified | 1231 |
| 1034 | Ga0453684_0640519 | 3300044712 | Bacteria | 1161 |
| 1035 | Ga0451576_0001721 | 3300045051 | Bacteria | 36069 |
| 1036 | Ga0451576_0009275 | 3300045051 | Bacteria | 11431 |
| 1037 | Ga0451576_0020198 | 3300045051 | Bacteria | 7257 |
| 1038 | Ga0451576_0078786 | 3300045051 | Bacteria | 3428 |
| 1039 | Ga0451576_0260525 | 3300045051 | Bacteria | 1812 |
| 1040 | Ga0451576_0304305 | 3300045051 | Bacteria | 1668 |
| 1041 | Ga0466958_0172257 | 3300045836 | Unclassified | 1371 |
| 1042 | Ga0466967_0340055 | 3300045976 | Bacteria | 1451 |
| 1043 | Ga0495592_0084118 | 3300046454 | Bacteria | 2297 |
| 1044 | Ga0495603_0012254 | 3300046455 | Bacteria | 5192 |
| 1045 | Ga0495603_0024525 | 3300046455 | Bacteria | 3648 |
| 1046 | Ga0495603_0030389 | 3300046455 | Bacteria | 3253 |
| 1047 | Ga0495590_0055742 | 3300046457 | Bacteria | 1381 |
| 1048 | Ga0495629_0001690 | 3300046459 | Bacteria | 17329 |
| 1049 | Ga0495629_0018369 | 3300046459 | Bacteria | 5006 |
| 1050 | Ga0495629_0037952 | 3300046459 | Bacteria | 3395 |
| 1051 | Ga0495629_0114603 | 3300046459 | Bacteria | 1879 |
| 1052 | Ga0495629_0264041 | 3300046459 | Bacteria | 1183 |
| 1053 | Ga0495651_0000050 | 3300046462 | Bacteria | 87816 |
| 1054 | Ga0495651_0005117 | 3300046462 | Bacteria | 10005 |
| 1055 | Ga0495651_0078463 | 3300046462 | Bacteria | 2498 |
| 1056 | Ga0495653_0000134 | 3300046463 | Bacteria | 61770 |
| 1057 | Ga0495653_0020073 | 3300046463 | Bacteria | 5416 |
| 1058 | Ga0495580_0003170 | 3300046472 | Bacteria | 14100 |
| 1059 | Ga0495580_0270113 | 3300046472 | Bacteria | 1161 |
| 1060 | Ga0495582_0030374 | 3300046473 | Bacteria | 2967 |
| 1061 | Ga0495582_0042084 | 3300046473 | Bacteria | 2517 |
| 1062 | Ga0495582_0076907 | 3300046473 | Bacteria | 1850 |
| 1063 | Ga0495639_0009369 | 3300046475 | Bacteria | 4199 |
| 1064 | Ga0495594_0011181 | 3300046499 | Bacteria | 4661 |
| 1065 | Ga0495594_0020892 | 3300046499 | Bacteria | 3491 |
| 1066 | Ga0495594_0025728 | 3300046499 | Bacteria | 3164 |
| 1067 | Ga0495594_0087123 | 3300046499 | Bacteria | 1747 |
| 1068 | Ga0495594_0095883 | 3300046499 | Unclassified | 1666 |
| 1069 | Ga0495608_0000381 | 3300046511 | Bacteria | 30883 |
| 1070 | Ga0495618_0041637 | 3300046514 | Bacteria | 2894 |
| 1071 | Ga0495618_0076903 | 3300046514 | Bacteria | 2127 |
| 1072 | Ga0495618_0102568 | 3300046514 | Bacteria | 1831 |
| 1073 | Ga0495628_0001915 | 3300046516 | Bacteria | 18878 |
| 1074 | Ga0495628_0020377 | 3300046516 | Bacteria | 5471 |
| 1075 | Ga0495628_0078524 | 3300046516 | Bacteria | 2567 |
| 1076 | Ga0495630_0002550 | 3300046517 | Bacteria | 12630 |
| 1077 | Ga0495630_0004360 | 3300046517 | Bacteria | 9937 |
| 1078 | Ga0495630_0007348 | 3300046517 | Bacteria | 7867 |
| 1079 | Ga0495630_0030695 | 3300046517 | Bacteria | 3999 |
| 1080 | Ga0495630_0074785 | 3300046517 | Bacteria | 2552 |
| 1081 | Ga0495630_0086741 | 3300046517 | Bacteria | 2364 |
| 1082 | Ga0495643_0151747 | 3300046522 | Bacteria | 1147 |
| 1083 | Ga0495666_0021364 | 3300046526 | Bacteria | 3204 |
| 1084 | Ga0495652_0003898 | 3300046529 | Bacteria | 14519 |
| 1085 | Ga0495652_0052162 | 3300046529 | Bacteria | 3489 |
| 1086 | Ga0495652_0096439 | 3300046529 | Bacteria | 2408 |
| 1087 | Ga0495652_0113016 | 3300046529 | Bacteria | 2181 |
| 1088 | Ga0495665_0002730 | 3300046531 | Bacteria | 9527 |
| 1089 | Ga0495665_0007115 | 3300046531 | Bacteria | 6037 |
| 1090 | Ga0495665_0033107 | 3300046531 | Bacteria | 2765 |
| 1091 | Ga0495640_0101358 | 3300046533 | Bacteria | 1889 |
| 1092 | Ga0495586_0007821 | 3300046535 | Bacteria | 5702 |
| 1093 | Ga0495586_0013976 | 3300046535 | Bacteria | 4260 |
| 1094 | Ga0495586_0021688 | 3300046535 | Bacteria | 3426 |
| 1095 | Ga0495586_0087993 | 3300046535 | Bacteria | 1713 |
| 1096 | Ga0495587_0000114 | 3300046536 | Bacteria | 61671 |
| 1097 | Ga0495587_0009898 | 3300046536 | Bacteria | 6084 |
| 1098 | Ga0495587_0055948 | 3300046536 | Unclassified | 2322 |
| 1099 | Ga0495587_0106770 | 3300046536 | Bacteria | 1610 |
| 1100 | Ga0495645_0000065 | 3300046543 | Bacteria | 73256 |
| 1101 | Ga0495645_0002208 | 3300046543 | Bacteria | 13243 |
| 1102 | Ga0495645_0010296 | 3300046543 | Bacteria | 6555 |
| 1103 | Ga0495645_0224443 | 3300046543 | Bacteria | 1262 |
| 1104 | Ga0495667_0000316 | 3300046559 | Bacteria | 30681 |
| 1105 | Ga0495667_0001659 | 3300046559 | Bacteria | 14760 |
| 1106 | Ga0495667_0002423 | 3300046559 | Bacteria | 12454 |
| 1107 | Ga0495667_0005100 | 3300046559 | Bacteria | 8873 |
| 1108 | Ga0495634_0023134 | 3300046642 | Bacteria | 4370 |
| 1109 | Ga0495635_0003351 | 3300046663 | Bacteria | 11077 |
| 1110 | Ga0495635_0175850 | 3300046663 | Bacteria | 1455 |
| 1111 | Ga0495659_0014615 | 3300046664 | Bacteria | 2572 |
| 1112 | Ga0495588_0002596 | 3300046674 | Bacteria | 7730 |
| 1113 | Ga0495588_0047731 | 3300046674 | Bacteria | 2199 |
| 1114 | Ga0495657_0001662 | 3300046675 | Bacteria | 19126 |
| 1115 | Ga0495657_0087933 | 3300046675 | Bacteria | 1999 |
| 1116 | Ga0495599_0000754 | 3300046678 | Bacteria | 18240 |
| 1117 | Ga0495599_0036568 | 3300046678 | Bacteria | 3084 |
| 1118 | Ga0495599_0044302 | 3300046678 | Bacteria | 2791 |
| 1119 | Ga0495623_0000086 | 3300046679 | Bacteria | 55086 |
| 1120 | Ga0495623_0003506 | 3300046679 | Bacteria | 10381 |
| 1121 | Ga0495623_0055733 | 3300046679 | Bacteria | 2491 |
| 1122 | Ga0495623_0062428 | 3300046679 | Unclassified | 2335 |
| 1123 | Ga0495646_0004169 | 3300046680 | Bacteria | 9082 |
| 1124 | Ga0495647_0029495 | 3300046681 | Bacteria | 2029 |
| 1125 | Ga0495658_0005675 | 3300046683 | Bacteria | 6131 |
| 1126 | Ga0495658_0075933 | 3300046683 | Bacteria | 1962 |
| 1127 | Ga0495669_0081346 | 3300046684 | Bacteria | 1487 |
| 1128 | Ga0495613_0024883 | 3300046689 | Bacteria | 4461 |
| 1129 | Ga0495613_0045558 | 3300046689 | Bacteria | 3243 |
| 1130 | Ga0495624_0065889 | 3300046690 | Bacteria | 2262 |
| 1131 | Ga0495600_0003319 | 3300046809 | Bacteria | 9447 |
| 1132 | Ga0495600_0110782 | 3300046809 | Bacteria | 1787 |
| 1133 | Ga0495600_0176136 | 3300046809 | Bacteria | 1379 |
| 1134 | Ga0495581_0013945 | 3300047315 | Bacteria | 4661 |
| 1135 | Ga0495581_0095446 | 3300047315 | Bacteria | 1727 |
| 1136 | Ga0495581_0103581 | 3300047315 | Bacteria | 1653 |
| 1137 | Ga0495604_0001195 | 3300047317 | Bacteria | 21435 |
| 1138 | Ga0495604_0126389 | 3300047317 | Bacteria | 1843 |
| 1139 | Ga0495604_0209912 | 3300047317 | Bacteria | 1346 |
| 1140 | Ga0495636_0062063 | 3300047318 | Bacteria | 1582 |
| 1141 | Ga0495674_0000339 | 3300047319 | Bacteria | 41326 |
| 1142 | Ga0495674_0006412 | 3300047319 | Bacteria | 11283 |
| 1143 | Ga0495674_0025755 | 3300047319 | Bacteria | 5387 |
| 1144 | Ga0495674_0041723 | 3300047319 | Bacteria | 4097 |
| 1145 | Ga0495674_0049695 | 3300047319 | Bacteria | 3704 |
| 1146 | Ga0495674_0073351 | 3300047319 | Bacteria | 2951 |
| 1147 | Ga0495675_0015599 | 3300047444 | Bacteria | 4803 |
| 1148 | Ga0495675_0075725 | 3300047444 | Bacteria | 2121 |
| 1149 | Ga0495675_0105424 | 3300047444 | Bacteria | 1762 |
| 1150 | Ga0495675_0108057 | 3300047444 | Bacteria | 1738 |
| 1151 | Ga0495675_0121962 | 3300047444 | Bacteria | 1623 |
| 1152 | Ga0495684_0000141 | 3300047471 | Bacteria | 53032 |
| 1153 | Ga0495684_0002171 | 3300047471 | Bacteria | 15715 |
| 1154 | Ga0495684_0051191 | 3300047471 | Unclassified | 3152 |
| 1155 | Ga0495684_0204747 | 3300047471 | Bacteria | 1453 |
| 1156 | Ga0495593_0000043 | 3300047673 | Bacteria | 50752 |
| 1157 | Ga0495602_0003470 | 3300048088 | Bacteria | 16312 |
| 1158 | Ga0495602_0014360 | 3300048088 | Bacteria | 8042 |
| 1159 | Ga0495614_0000096 | 3300048089 | Bacteria | 29692 |
| 1160 | Ga0496100_0179401 | 3300048903 | Bacteria | 1531 |
| 1161 | Ga0496100_0282483 | 3300048903 | Bacteria | 1238 |
| 1162 | Ga0496101_0009147 | 3300048904 | Bacteria | 6503 |
| 1163 | Ga0496101_0100918 | 3300048904 | Bacteria | 2160 |
| 1164 | Ga0496101_0187262 | 3300048904 | Bacteria | 1596 |
| 1165 | Ga0496102_0047628 | 3300048905 | Bacteria | 3897 |
| 1166 | Ga0496102_0134756 | 3300048905 | Bacteria | 2314 |
| 1167 | Ga0496103_0205199 | 3300048906 | Bacteria | 1267 |
| 1168 | Ga0496104_0010276 | 3300048907 | Bacteria | 8359 |
| 1169 | Ga0496104_0026059 | 3300048907 | Bacteria | 5393 |
| 1170 | Ga0496104_0055390 | 3300048907 | Bacteria | 3750 |
| 1171 | Ga0496104_0055558 | 3300048907 | Bacteria | 3744 |
| 1172 | Ga0496104_0063078 | 3300048907 | Bacteria | 3514 |
| 1173 | Ga0496104_0119252 | 3300048907 | Bacteria | 2533 |
| 1174 | Ga0496104_0234294 | 3300048907 | Bacteria | 1748 |
| 1175 | Ga0496104_0339989 | 3300048907 | Bacteria | 1414 |
| 1176 | Ga0496105_0090022 | 3300048908 | Bacteria | 2535 |
| 1177 | Ga0496105_0113779 | 3300048908 | Bacteria | 2232 |
| 1178 | Ga0496106_0173130 | 3300048909 | Bacteria | 1712 |
| 1179 | Ga0496106_0185399 | 3300048909 | Bacteria | 1653 |
| 1180 | Ga0496106_0250109 | 3300048909 | Bacteria | 1417 |
| 1181 | Ga0496107_0052584 | 3300048910 | Bacteria | 2938 |
| 1182 | Ga0496108_0002171 | 3300048911 | Bacteria | 15736 |
| 1183 | Ga0496108_0017783 | 3300048911 | Bacteria | 5813 |
| 1184 | Ga0496108_0126720 | 3300048911 | Bacteria | 2192 |
| 1185 | Ga0496109_0039510 | 3300048912 | Bacteria | 4271 |
| 1186 | Ga0496109_0045291 | 3300048912 | Bacteria | 3991 |
| 1187 | Ga0496109_0222788 | 3300048912 | Bacteria | 1774 |
| 1188 | Ga0496109_0239380 | 3300048912 | Bacteria | 1708 |
| 1189 | Ga0496110_0002484 | 3300048913 | Bacteria | 13822 |
| 1190 | Ga0496110_0042941 | 3300048913 | Bacteria | 3946 |
| 1191 | Ga0496111_0001425 | 3300048914 | Bacteria | 13631 |
| 1192 | Ga0496111_0029946 | 3300048914 | Bacteria | 3869 |
| 1193 | Ga0496112_0000129 | 3300048915 | Bacteria | 47173 |
| 1194 | Ga0496112_0000882 | 3300048915 | Bacteria | 21546 |
| 1195 | Ga0496112_0019955 | 3300048915 | Bacteria | 6343 |
| 1196 | Ga0496112_0032739 | 3300048915 | Bacteria | 5047 |
| 1197 | Ga0496112_0269071 | 3300048915 | Unclassified | 1652 |
| 1198 | Ga0496113_0000062 | 3300048916 | Bacteria | 46801 |
| 1199 | Ga0496113_0122492 | 3300048916 | Bacteria | 2034 |
| 1200 | Ga0496113_0151071 | 3300048916 | Bacteria | 1832 |
| 1201 | Ga0496113_0279607 | 3300048916 | Bacteria | 1334 |
| 1202 | Ga0496114_0059380 | 3300048917 | Bacteria | 3195 |
| 1203 | Ga0496114_0222926 | 3300048917 | Bacteria | 1655 |
| 1204 | Ga0496115_0005916 | 3300048918 | Bacteria | 8920 |
| 1205 | Ga0501292_018642 | 3300049515 | Unclassified | 1106 |
| 1206 | Ga0501031_0059421 | 3300049568 | Bacteria | 2492 |
| 1207 | Ga0501031_0199683 | 3300049568 | Bacteria | 1305 |
| 1208 | Ga0501031_0238987 | 3300049568 | Unclassified | 1181 |
| 1209 | Ga0501033_0148781 | 3300049570 | Bacteria | 1690 |
| 1210 | Ga0501034_0008504 | 3300049571 | Bacteria | 10838 |
| 1211 | Ga0501034_0021718 | 3300049571 | Bacteria | 6540 |
| 1212 | Ga0501034_0163739 | 3300049571 | Bacteria | 2193 |
| 1213 | Ga0501034_0320230 | 3300049571 | Bacteria | 1484 |
| 1214 | Ga0501036_0433937 | 3300049572 | Unclassified | 1095 |
| 1215 | Ga0501036_0500582 | 3300049572 | Bacteria | 1011 |
| 1216 | Ga0501037_0043485 | 3300049573 | Bacteria | 3301 |
| 1217 | Ga0501037_0043614 | 3300049573 | Bacteria | 3296 |
| 1218 | Ga0501038_0030716 | 3300049574 | Bacteria | 4750 |
| 1219 | Ga0501038_0089245 | 3300049574 | Bacteria | 2586 |
| 1220 | Ga0501038_0353564 | 3300049574 | Bacteria | 1144 |
| 1221 | Ga0501039_0057086 | 3300049575 | Bacteria | 3024 |
| 1222 | Ga0501040_0012049 | 3300049576 | Bacteria | 5659 |
| 1223 | Ga0501041_0086024 | 3300049577 | Bacteria | 1939 |
| 1224 | Ga0501042_0096777 | 3300049578 | Bacteria | 2121 |
| 1225 | Ga0501042_0107629 | 3300049578 | Bacteria | 2007 |
| 1226 | Ga0501043_0058442 | 3300049579 | Bacteria | 3027 |
| 1227 | Ga0501046_0205464 | 3300049580 | Bacteria | 1464 |
| 1228 | Ga0501047_0025654 | 3300049581 | Bacteria | 5668 |
| 1229 | Ga0501047_0201897 | 3300049581 | Bacteria | 1849 |
| 1230 | Ga0501047_0348858 | 3300049581 | Bacteria | 1317 |
| 1231 | Ga0501048_0012476 | 3300049582 | Bacteria | 6322 |
| 1232 | Ga0501048_0086144 | 3300049582 | Bacteria | 2216 |
| 1233 | Ga0501067_0002448 | 3300049583 | Bacteria | 10258 |
| 1234 | Ga0501067_0003013 | 3300049583 | Bacteria | 9301 |
| 1235 | Ga0501067_0007870 | 3300049583 | Bacteria | 5924 |
| 1236 | Ga0501067_0098404 | 3300049583 | Bacteria | 1625 |
| 1237 | Ga0501068_0000311 | 3300049584 | Bacteria | 24353 |
| 1238 | Ga0501069_0001105 | 3300049585 | Bacteria | 13017 |
| 1239 | Ga0501069_0002365 | 3300049585 | Bacteria | 9561 |
| 1240 | Ga0501069_0076755 | 3300049585 | Unclassified | 1879 |
| 1241 | Ga0501070_0004182 | 3300049586 | Bacteria | 12426 |
| 1242 | Ga0501070_0047831 | 3300049586 | Bacteria | 3554 |
| 1243 | Ga0501071_0002140 | 3300049587 | Bacteria | 11863 |
| 1244 | Ga0501072_0004214 | 3300049588 | Bacteria | 10909 |
| 1245 | Ga0501072_0150501 | 3300049588 | Bacteria | 1855 |
| 1246 | Ga0501073_0253856 | 3300049589 | Bacteria | 1214 |
| 1247 | Ga0501074_0002285 | 3300049590 | Bacteria | 13335 |
| 1248 | Ga0501074_0002996 | 3300049590 | Bacteria | 11875 |
| 1249 | Ga0501075_0008826 | 3300049591 | Bacteria | 7027 |
| 1250 | Ga0501076_0011216 | 3300049592 | Bacteria | 6671 |
| 1251 | Ga0501076_0030383 | 3300049592 | Bacteria | 4208 |
| 1252 | Ga0501077_0000313 | 3300049593 | Bacteria | 28906 |
| 1253 | Ga0501077_0042267 | 3300049593 | Bacteria | 2898 |
| 1254 | Ga0501077_0077897 | 3300049593 | Bacteria | 2100 |
| 1255 | Ga0501217_042216 | 3300049661 | Bacteria | 1164 |
| 1256 | Ga0501235_011626 | 3300049669 | Unclassified | 1931 |
| 1257 | Ga0501235_019299 | 3300049669 | Bacteria | 1512 |
| 1258 | Ga0501225_0011872 | 3300049705 | Bacteria | 2450 |
| 1259 | Ga0501079_0009697 | 3300049741 | Bacteria | 7300 |
| 1260 | Ga0501079_0016232 | 3300049741 | Bacteria | 5692 |
| 1261 | Ga0501079_0019900 | 3300049741 | Bacteria | 5127 |
| 1262 | Ga0501079_0117394 | 3300049741 | Bacteria | 2068 |
| 1263 | Ga0501079_0170671 | 3300049741 | Bacteria | 1696 |
| 1264 | Ga0501079_0201587 | 3300049741 | Bacteria | 1554 |
| 1265 | Ga0501080_0002645 | 3300049742 | Bacteria | 15668 |
| 1266 | Ga0501080_0012972 | 3300049742 | Bacteria | 7650 |
| 1267 | Ga0501080_0321406 | 3300049742 | Unclassified | 1401 |
| 1268 | Ga0501080_0409614 | 3300049742 | Bacteria | 1219 |
| 1269 | Ga0501081_0005948 | 3300049743 | Bacteria | 7898 |
| 1270 | Ga0501081_0048207 | 3300049743 | Bacteria | 2932 |
| 1271 | Ga0501081_0242427 | 3300049743 | Bacteria | 1315 |
| 1272 | Ga0501083_0002285 | 3300049744 | Bacteria | 13120 |
| 1273 | Ga0501083_0013133 | 3300049744 | Bacteria | 5787 |
| 1274 | Ga0501083_0153114 | 3300049744 | Bacteria | 1510 |
| 1275 | Ga0501266_004840 | 3300049763 | Bacteria | 1676 |
| 1276 | Ga0501268_006067 | 3300049765 | Bacteria | 1759 |
| 1277 | Ga0501268_007168 | 3300049765 | Bacteria | 1657 |
| 1278 | Ga0501035_0007082 | 3300049822 | Bacteria | 10484 |
| 1279 | Ga0501035_0229410 | 3300049822 | Bacteria | 1583 |
| 1280 | Ga0501044_0008093 | 3300049823 | Bacteria | 11540 |
| 1281 | Ga0501044_0190300 | 3300049823 | Bacteria | 2015 |
| 1282 | Ga0501045_0045898 | 3300049824 | Bacteria | 3181 |
| 1283 | Ga0501212_005633 | 3300049851 | Bacteria | 1661 |
| 1284 | nmdc:mga05p37_163212_c1 | 3300050507 | Bacteria | 2720 |
| 1285 | nmdc:mga05p37_17760_c1 | 3300050507 | Bacteria | 4978 |
| 1286 | nmdc:mga05p37_180926_c1 | 3300050507 | Bacteria | 2564 |
| 1287 | nmdc:mga05p37_2011_c1 | 3300050507 | Bacteria | 23721 |
| 1288 | nmdc:mga05p37_290600_c1 | 3300050507 | Bacteria | 1946 |
| 1289 | nmdc:mga05p37_39420_c1 | 3300050507 | Bacteria | 5800 |
| 1290 | nmdc:mga05p37_549497_c1 | 3300050507 | Bacteria | 1315 |
| 1291 | nmdc:mga05p37_606789_c1 | 3300050507 | Bacteria | 1234 |
| 1292 | nmdc:mga05p37_7243_c1 | 3300050507 | Bacteria | 13086 |
| 1293 | nmdc:mga05p37_76582_c1 | 3300050507 | Bacteria | 4118 |
| 1294 | nmdc:mga09592_1219_c1 | 3300050508 | Bacteria | 20601 |
| 1295 | nmdc:mga09592_247484_c1 | 3300050508 | Unclassified | 1545 |
| 1296 | nmdc:mga09592_66723_c1 | 3300050508 | Bacteria | 3050 |
| 1297 | nmdc:mga09592_94674_c1 | 3300050508 | Bacteria | 2554 |
| 1298 | nmdc:mga0qj67_18329_c1 | 3300050509 | Bacteria | 5335 |
| 1299 | nmdc:mga0qj67_235437_c1 | 3300050509 | Bacteria | 1486 |
| 1300 | nmdc:mga0qj67_24210_c1 | 3300050509 | Bacteria | 4678 |
| 1301 | nmdc:mga0qj67_31512_c1 | 3300050509 | Bacteria | 4130 |
| 1302 | nmdc:mga0qj67_41805_c1 | 3300050509 | Bacteria | 3607 |
| 1303 | nmdc:mga0qj67_89934_c1 | 3300050509 | Bacteria | 2466 |
| 1304 | nmdc:mga06r32_124297_c1 | 3300050510 | Bacteria | 2547 |
| 1305 | nmdc:mga06r32_329936_c1 | 3300050510 | Bacteria | 1511 |
| 1306 | nmdc:mga06r32_57790_c1 | 3300050510 | Bacteria | 3727 |
| 1307 | nmdc:mga08y16_135234_c1 | 3300050511 | Bacteria | 2562 |
| 1308 | nmdc:mga08y16_29721_c1 | 3300050511 | Bacteria | 5753 |
| 1309 | nmdc:mga08y16_337659_c1 | 3300050511 | Bacteria | 1549 |
| 1310 | nmdc:mga0n895_125953_c1 | 3300050512 | Unclassified | 2585 |
| 1311 | nmdc:mga0n895_27921_c1 | 3300050512 | Bacteria | 5363 |
| 1312 | nmdc:mga0n895_28362_c1 | 3300050512 | Bacteria | 5324 |
| 1313 | nmdc:mga0n895_31893_c1 | 3300050512 | Bacteria | 5051 |
| 1314 | nmdc:mga0n895_327193_c1 | 3300050512 | Bacteria | 1553 |
| 1315 | nmdc:mga0n895_39010_c1 | 3300050512 | Bacteria | 4605 |
| 1316 | nmdc:mga0n895_39846_c1 | 3300050512 | Bacteria | 4562 |
| 1317 | nmdc:mga0n895_488161_c1 | 3300050512 | Bacteria | 1242 |
| 1318 | nmdc:mga0n895_567528_c1 | 3300050512 | Bacteria | 1140 |
| 1319 | nmdc:mga0n895_72069_c1 | 3300050512 | Bacteria | 3427 |
| 1320 | nmdc:mga0n895_79256_c1 | 3300050512 | Bacteria | 3271 |
| 1321 | nmdc:mga0n895_8346_c1 | 3300050512 | Bacteria | 8966 |
| 1322 | nmdc:mga0n895_87492_c1 | 3300050512 | Bacteria | 3113 |
| 1323 | nmdc:mga0rr50_148592_c1 | 3300050513 | Bacteria | 1891 |
| 1324 | nmdc:mga0rr50_16394_c1 | 3300050513 | Bacteria | 4921 |
| 1325 | nmdc:mga0rr50_21872_c1 | 3300050513 | Bacteria | 4377 |
| 1326 | nmdc:mga0rr50_219132_c1 | 3300050513 | Bacteria | 1571 |
| 1327 | nmdc:mga0rr50_29765_c1 | 3300050513 | Bacteria | 2144 |
| 1328 | nmdc:mga0rr50_33702_c1 | 3300050513 | Unclassified | 3661 |
| 1329 | nmdc:mga0rr50_5554_c1 | 3300050513 | Bacteria | 7541 |
| 1330 | nmdc:mga08x19_20307_c1 | 3300050514 | Bacteria | 4090 |
| 1331 | nmdc:mga08x19_5774_c1 | 3300050514 | Bacteria | 7314 |
| 1332 | nmdc:mga08x19_5826_c1 | 3300050514 | Bacteria | 7289 |
| 1333 | nmdc:mga08x19_67607_c1 | 3300050514 | Unclassified | 2324 |
| 1334 | nmdc:mga08x19_7637_c1 | 3300050514 | Bacteria | 6425 |
| 1335 | nmdc:mga08x19_7876_c1 | 3300050514 | Bacteria | 6328 |
| 1336 | nmdc:mga08x19_9849_c1 | 3300050514 | Bacteria | 5727 |
| 1337 | nmdc:mga0a205_123396_c1 | 3300050515 | Bacteria | 2490 |
| 1338 | nmdc:mga0a205_18694_c1 | 3300050515 | Bacteria | 6522 |
| 1339 | nmdc:mga0a205_26983_c1 | 3300050515 | Bacteria | 5484 |
| 1340 | nmdc:mga0a205_31926_c1 | 3300050515 | Bacteria | 5048 |
| 1341 | nmdc:mga0a205_7805_c1 | 3300050515 | Bacteria | 9716 |
| 1342 | nmdc:mga0a205_86401_c1 | 3300050515 | Bacteria | 3029 |
| 1343 | nmdc:mga0a205_989_c1 | 3300050515 | Bacteria | 23529 |
| 1344 | Ga0495612_0055401 | 3300053078 | Bacteria | 1634 |
| 1345 | Ga0495619_0006607 | 3300053085 | Bacteria | 7337 |
| 1346 | Ga0501084_0001049 | 3300054114 | Bacteria | 21463 |
| 1347 | Ga0501084_0035691 | 3300054114 | Bacteria | 4156 |
| 1348 | Ga0501084_0054276 | 3300054114 | Bacteria | 3352 |
| 1349 | Ga0501084_0073327 | 3300054114 | Bacteria | 2867 |
| 1350 | Ga0501084_0082642 | 3300054114 | Bacteria | 2695 |
| 1351 | Ga0590071_000553 | 3300059421 | Bacteria | 10824 |
| 1352 | Ga0590074_013181 | 3300059423 | Bacteria | 1394 |
| 1353 | Ga0590077_017968 | 3300059426 | Bacteria | 1491 |
| 1354 | Ga0501082_0005808 | 3300060353 | Bacteria | 10714 |
| 1355 | Ga0501082_0024265 | 3300060353 | Bacteria | 5227 |
| 1356 | Ga0501082_0030793 | 3300060353 | Bacteria | 4625 |
| 1357 | Ga0501082_0077709 | 3300060353 | Bacteria | 2862 |
| 1358 | Ga0530510_0157151 | 3300061734 | Bacteria | 1681 |
| 1359 | Ga0207709_10247618 | |||
| 1360 | MBSR1b_contig_3324880 | |||
| 1361 | JGI24752J21851_1011504 | |||
| 1362 | JGI24737J22298_10035544 | |||
| 1363 | Ga0058863_10002510 | |||
| 1364 | Ga0065712_10091947 | |||
| 1365 | Ga0065715_10108757 | |||
| 1366 | Ga0065715_10139884 | |||
| 1367 | Ga0070658_10001114 | |||
| 1368 | Ga0070658_10006876 | |||
| 1369 | Ga0070658_10008230 | |||
| 1370 | Ga0070658_10088574 | |||
| 1371 | Ga0070658_10136562 | |||
| 1372 | Ga0070658_10187659 | |||
| 1373 | Ga0070676_10121088 | |||
| 1374 | Ga0070683_100000998 | |||
| 1375 | Ga0070683_100013221 | |||
| 1376 | Ga0070683_100014484 | |||
| 1377 | Ga0070683_100019132 | |||
| 1378 | Ga0070683_100019244 | |||
| 1379 | Ga0070683_100029690 | |||
| 1380 | Ga0070683_100051215 | |||
| 1381 | Ga0070683_100085545 | |||
| 1382 | Ga0070683_100087340 | |||
| 1383 | Ga0070683_100087887 | |||
| 1384 | Ga0070683_100127782 | |||
| 1385 | Ga0070683_100204198 | |||
| 1386 | Ga0070683_100337900 | |||
| 1387 | Ga0070690_100030384 | |||
| 1388 | Ga0070690_100151977 | |||
| 1389 | Ga0070670_100000545 | |||
| 1390 | Ga0070670_100005337 | |||
| 1391 | Ga0070677_10002094 | |||
| 1392 | Ga0068869_100007637 | |||
| 1393 | Ga0068869_100047898 | |||
| 1394 | Ga0068869_100292290 | |||
| 1395 | Ga0070666_10032300 | |||
| 1396 | Ga0070666_10039426 | |||
| 1397 | Ga0070680_100000074 | |||
| 1398 | Ga0070680_100000413 | |||
| 1399 | Ga0070680_100003658 | |||
| 1400 | Ga0070680_100003960 | |||
| 1401 | Ga0070680_100004433 | |||
| 1402 | Ga0070680_100005930 | |||
| 1403 | Ga0070680_100012040 | |||
| 1404 | Ga0070680_100013319 | |||
| 1405 | Ga0070680_100054875 | |||
| 1406 | Ga0070680_100069126 | |||
| 1407 | Ga0070680_100073879 | |||
| 1408 | Ga0070680_100090146 | |||
| 1409 | Ga0070680_100167821 | |||
| 1410 | Ga0070682_100004414 | |||
| 1411 | Ga0070682_100163464 | |||
| 1412 | Ga0070682_100212709 | |||
| 1413 | Ga0068868_100005889 | |||
| 1414 | Ga0070660_100001958 | |||
| 1415 | Ga0070660_100025383 | |||
| 1416 | Ga0070660_100048150 | |||
| 1417 | Ga0070660_100078566 | |||
| 1418 | Ga0070660_100201138 | |||
| 1419 | Ga0070660_100266243 | |||
| 1420 | Ga0070689_100015702 | |||
| 1421 | Ga0070689_100164365 | |||
| 1422 | Ga0070689_100182749 | |||
| 1423 | Ga0070691_10001670 | |||
| 1424 | Ga0070691_10007813 | |||
| 1425 | Ga0070691_10013212 | |||
| 1426 | Ga0070687_100102100 | |||
| 1427 | Ga0070661_100005342 | |||
| 1428 | Ga0070661_100006352 | |||
| 1429 | Ga0070661_100006568 | |||
| 1430 | Ga0070661_100009437 | |||
| 1431 | Ga0070661_100015646 | |||
| 1432 | Ga0070661_100282636 | |||
| 1433 | Ga0070692_10056741 | |||
| 1434 | Ga0070692_10074155 | |||
| 1435 | Ga0070692_10107852 | |||
| 1436 | Ga0070668_100001979 | |||
| 1437 | Ga0070668_100007235 | |||
| 1438 | Ga0070668_100016181 | |||
| 1439 | Ga0070669_100015410 | |||
| 1440 | Ga0070669_100153597 | |||
| 1441 | Ga0070675_100000777 | |||
| 1442 | Ga0070675_100003949 | |||
| 1443 | Ga0070675_100176653 | |||
| 1444 | Ga0070675_100214230 | |||
| 1445 | Ga0070675_100229123 | |||
| 1446 | Ga0070675_100255088 | |||
| 1447 | Ga0070675_100327503 | |||
| 1448 | Ga0070671_100029155 | |||
| 1449 | Ga0070671_100044899 | |||
| 1450 | Ga0070671_100212372 | |||
| 1451 | Ga0070671_100245767 | |||
| 1452 | Ga0070674_100000378 | |||
| 1453 | Ga0070674_100031767 | |||
| 1454 | Ga0070674_100046773 | |||
| 1455 | Ga0070674_100059766 | |||
| 1456 | Ga0070674_100084226 | |||
| 1457 | Ga0070674_100202808 | |||
| 1458 | Ga0070673_100047043 | |||
| 1459 | Ga0070673_100057293 | |||
| 1460 | Ga0070673_100109188 | |||
| 1461 | Ga0070673_100217393 | |||
| 1462 | Ga0070688_100015113 | |||
| 1463 | Ga0070688_100205160 | |||
| 1464 | Ga0070659_100000726 | |||
| 1465 | Ga0070659_100001533 | |||
| 1466 | Ga0070659_100047921 | |||
| 1467 | Ga0070659_100080860 | |||
| 1468 | Ga0070659_100086400 | |||
| 1469 | Ga0070659_100244549 | |||
| 1470 | Ga0070659_100351343 | |||
| 1471 | Ga0070667_100006589 | |||
| 1472 | Ga0070667_100073170 | |||
| 1473 | Ga0070667_100196899 | |||
| 1474 | Ga0070667_100312953 | |||
| 1475 | Ga0070667_100431310 | |||
| 1476 | Ga0070703_10000072 | |||
| 1477 | Ga0070709_10003005 | |||
| 1478 | Ga0070709_10019622 | |||
| 1479 | Ga0070714_100005258 | |||
| 1480 | Ga0070714_100007482 | |||
| 1481 | Ga0070714_100221057 | |||
| 1482 | Ga0070714_100304316 | |||
| 1483 | Ga0070714_100311809 | |||
| 1484 | Ga0070713_100001395 | |||
| 1485 | Ga0070713_100031379 | |||
| 1486 | Ga0070713_100228991 | |||
| 1487 | Ga0070710_10037005 | |||
| 1488 | Ga0070710_10136293 | |||
| 1489 | Ga0070701_10018517 | |||
| 1490 | Ga0070701_10018955 | |||
| 1491 | Ga0070701_10021050 | |||
| 1492 | Ga0070701_10026509 | |||
| 1493 | Ga0070701_10127911 | |||
| 1494 | Ga0070711_100142639 | |||
| 1495 | Ga0070711_100216852 | |||
| 1496 | Ga0070705_100002554 | |||
| 1497 | Ga0070705_100002844 | |||
| 1498 | Ga0070705_100021616 | |||
| 1499 | Ga0070705_100024921 | |||
| 1500 | Ga0070705_100035744 | |||
| 1501 | Ga0070705_100082669 | |||
| 1502 | Ga0070705_100130359 | |||
| 1503 | Ga0070700_100005908 | |||
| 1504 | Ga0070700_100166264 | |||
| 1505 | Ga0070694_100000767 | |||
| 1506 | Ga0070694_100003473 | |||
| 1507 | Ga0070694_100005169 | |||
| 1508 | Ga0070694_100010198 | |||
| 1509 | Ga0070694_100069965 | |||
| 1510 | Ga0070694_100150556 | |||
| 1511 | Ga0070694_100223379 | |||
| 1512 | Ga0070708_100000170 | |||
| 1513 | Ga0070708_100008540 | |||
| 1514 | Ga0070708_100122182 | |||
| 1515 | Ga0070708_100162821 | |||
| 1516 | Ga0070708_100391801 | |||
| 1517 | Ga0070663_100015151 | |||
| 1518 | Ga0070663_100055490 | |||
| 1519 | Ga0070678_100023130 | |||
| 1520 | Ga0070662_100000290 | |||
| 1521 | Ga0070662_100001016 | |||
| 1522 | Ga0070662_100010812 | |||
| 1523 | Ga0070662_100025718 | |||
| 1524 | Ga0070662_100053243 | |||
| 1525 | Ga0070662_100057167 | |||
| 1526 | Ga0070662_100156262 | |||
| 1527 | Ga0070662_100177365 | |||
| 1528 | Ga0070681_10000380 | |||
| 1529 | Ga0070681_10000841 | |||
| 1530 | Ga0070681_10004130 | |||
| 1531 | Ga0070681_10009348 | |||
| 1532 | Ga0070681_10035538 | |||
| 1533 | Ga0070681_10050026 | |||
| 1534 | Ga0070681_10077208 | |||
| 1535 | Ga0070681_10231086 | |||
| 1536 | Ga0068867_100001302 | |||
| 1537 | Ga0068867_100177233 | |||
| 1538 | Ga0070706_100017417 | |||
| 1539 | Ga0070706_100035766 | |||
| 1540 | Ga0070706_100057009 | |||
| 1541 | Ga0070706_100120749 | |||
| 1542 | Ga0070706_100428798 | |||
| 1543 | Ga0070706_100489853 | |||
| 1544 | Ga0070707_100005597 | |||
| 1545 | Ga0070707_100008444 | |||
| 1546 | Ga0070707_100010336 | |||
| 1547 | Ga0070707_100010473 | |||
| 1548 | Ga0070707_100014038 | |||
| 1549 | Ga0070707_100055458 | |||
| 1550 | Ga0070707_100091208 | |||
| 1551 | Ga0070707_100136224 | |||
| 1552 | Ga0070707_100139334 | |||
| 1553 | Ga0070707_100162085 | |||
| 1554 | Ga0070707_100198186 | |||
| 1555 | Ga0070707_100333813 | |||
| 1556 | Ga0070698_100000037 | |||
| 1557 | Ga0070698_100002580 | |||
| 1558 | Ga0070698_100008726 | |||
| 1559 | Ga0070698_100016814 | |||
| 1560 | Ga0070698_100029962 | |||
| 1561 | Ga0070698_100042943 | |||
| 1562 | Ga0070698_100070184 | |||
| 1563 | Ga0070698_100074457 | |||
| 1564 | Ga0070698_100092687 | |||
| 1565 | Ga0070698_100288043 | |||
| 1566 | Ga0070699_100001113 | |||
| 1567 | Ga0070699_100002242 | |||
| 1568 | Ga0070699_100003489 | |||
| 1569 | Ga0070699_100008908 | |||
| 1570 | Ga0070699_100009101 | |||
| 1571 | Ga0070699_100012828 | |||
| 1572 | Ga0070699_100030641 | |||
| 1573 | Ga0070699_100051232 | |||
| 1574 | Ga0070699_100061031 | |||
| 1575 | Ga0070699_100095808 | |||
| 1576 | Ga0070699_100115628 | |||
| 1577 | Ga0070699_100117766 | |||
| 1578 | Ga0070699_100134605 | |||
| 1579 | Ga0070699_100246181 | |||
| 1580 | Ga0070699_100276797 | |||
| 1581 | Ga0070699_100305266 | |||
| 1582 | Ga0070679_100002320 | |||
| 1583 | Ga0070679_100002482 | |||
| 1584 | Ga0070679_100006378 | |||
| 1585 | Ga0070679_100009621 | |||
| 1586 | Ga0070679_100020819 | |||
| 1587 | Ga0070679_100036659 | |||
| 1588 | Ga0070679_100062093 | |||
| 1589 | Ga0070679_100076937 | |||
| 1590 | Ga0070679_100129908 | |||
| 1591 | Ga0070679_100144964 | |||
| 1592 | Ga0070679_100257622 | |||
| 1593 | Ga0070679_100263344 | |||
| 1594 | Ga0070684_100002962 | |||
| 1595 | Ga0070684_100008607 | |||
| 1596 | Ga0070684_100054921 | |||
| 1597 | Ga0070684_100113377 | |||
| 1598 | Ga0070684_100136248 | |||
| 1599 | Ga0070684_100144322 | |||
| 1600 | Ga0070684_100177567 | |||
| 1601 | Ga0070684_100198402 | |||
| 1602 | Ga0070684_100278448 | |||
| 1603 | Ga0070684_100281138 | |||
| 1604 | Ga0070684_100397158 | |||
| 1605 | Ga0070697_100001282 | |||
| 1606 | Ga0070697_100002404 | |||
| 1607 | Ga0070697_100030212 | |||
| 1608 | Ga0070697_100045499 | |||
| 1609 | Ga0070697_100047299 | |||
| 1610 | Ga0070697_100090607 | |||
| 1611 | Ga0070697_100457600 | |||
| 1612 | Ga0068853_100278107 | |||
| 1613 | Ga0070672_100159327 | |||
| 1614 | Ga0070672_100159996 | |||
| 1615 | Ga0070672_100186856 | |||
| 1616 | Ga0070672_100208609 | |||
| 1617 | Ga0070672_100231963 | |||
| 1618 | Ga0070686_100059599 | |||
| 1619 | Ga0070695_100004134 | |||
| 1620 | Ga0070695_100005429 | |||
| 1621 | Ga0070695_100005764 | |||
| 1622 | Ga0070695_100010694 | |||
| 1623 | Ga0070695_100012134 | |||
| 1624 | Ga0070695_100016264 | |||
| 1625 | Ga0070695_100023241 | |||
| 1626 | Ga0070695_100039079 | |||
| 1627 | Ga0070695_100057980 | |||
| 1628 | Ga0070695_100099820 | |||
| 1629 | Ga0070696_100000510 | |||
| 1630 | Ga0070696_100000976 | |||
| 1631 | Ga0070696_100002442 | |||
| 1632 | Ga0070696_100004651 | |||
| 1633 | Ga0070696_100006913 | |||
| 1634 | Ga0070696_100008566 | |||
| 1635 | Ga0070696_100018590 | |||
| 1636 | Ga0070696_100020719 | |||
| 1637 | Ga0070696_100034919 | |||
| 1638 | Ga0070696_100037590 | |||
| 1639 | Ga0070696_100142721 | |||
| 1640 | Ga0070693_100007479 | |||
| 1641 | Ga0070693_100021141 | |||
| 1642 | Ga0070693_100067237 | |||
| 1643 | Ga0070665_100105573 | |||
| 1644 | Ga0070665_100280275 | |||
| 1645 | Ga0070704_100000762 | |||
| 1646 | Ga0070704_100004286 | |||
| 1647 | Ga0070704_100008201 | |||
| 1648 | Ga0070704_100010543 | |||
| 1649 | Ga0070704_100011411 | |||
| 1650 | Ga0070704_100012284 | |||
| 1651 | Ga0070704_100021614 | |||
| 1652 | Ga0070704_100028831 | |||
| 1653 | Ga0070704_100046385 | |||
| 1654 | Ga0068855_100009620 | |||
| 1655 | Ga0068855_100015470 | |||
| 1656 | Ga0068855_100051521 | |||
| 1657 | Ga0068855_100054125 | |||
| 1658 | Ga0068855_100054576 | |||
| 1659 | Ga0068855_100073823 | |||
| 1660 | Ga0068855_100145576 | |||
| 1661 | Ga0068855_100200005 | |||
| 1662 | Ga0070664_100002877 | |||
| 1663 | Ga0070664_100010902 | |||
| 1664 | Ga0070664_100026090 | |||
| 1665 | Ga0070664_100064713 | |||
| 1666 | Ga0070664_100127592 | |||
| 1667 | Ga0070664_100230988 | |||
| 1668 | Ga0070664_100233476 | |||
| 1669 | Ga0070664_100329999 | |||
| 1670 | Ga0068857_100005146 | |||
| 1671 | Ga0068857_100005151 | |||
| 1672 | Ga0068857_100015574 | |||
| 1673 | Ga0068857_100021174 | |||
| 1674 | Ga0068857_100041282 | |||
| 1675 | Ga0068857_100142020 | |||
| 1676 | Ga0068857_100147554 | |||
| 1677 | Ga0068854_100001114 | |||
| 1678 | Ga0068854_100006569 | |||
| 1679 | Ga0068856_100031723 | |||
| 1680 | Ga0068856_100123412 | |||
| 1681 | Ga0068856_100180165 | |||
| 1682 | Ga0068856_100231845 | |||
| 1683 | Ga0070702_100003169 | |||
| 1684 | Ga0070702_100105654 | |||
| 1685 | Ga0068852_100006187 | |||
| 1686 | Ga0068852_100038569 | |||
| 1687 | Ga0068852_100051599 | |||
| 1688 | Ga0068852_100126434 | |||
| 1689 | Ga0068852_100203009 | |||
| 1690 | Ga0068859_100005677 | |||
| 1691 | Ga0068859_100022805 | |||
| 1692 | Ga0068859_100347603 | |||
| 1693 | Ga0068859_100692502 | |||
| 1694 | Ga0068864_100002802 | |||
| 1695 | Ga0068864_100010018 | |||
| 1696 | Ga0068864_100213683 | |||
| 1697 | Ga0068864_100391659 | |||
| 1698 | Ga0068864_100421049 | |||
| 1699 | Ga0068866_10000401 | |||
| 1700 | Ga0068866_10138587 | |||
| 1701 | Ga0068861_100000364 | |||
| 1702 | Ga0068861_100051823 | |||
| 1703 | Ga0068861_100081205 | |||
| 1704 | Ga0068851_10057196 | |||
| 1705 | Ga0068870_10003912 | |||
| 1706 | Ga0068870_10042640 | |||
| 1707 | Ga0068863_100003141 | |||
| 1708 | Ga0068863_100341490 | |||
| 1709 | Ga0068858_100040883 | |||
| 1710 | Ga0068858_100202258 | |||
| 1711 | Ga0068858_100360283 | |||
| 1712 | Ga0068858_100390187 | |||
| 1713 | Ga0068860_100008736 | |||
| 1714 | Ga0068860_100038640 | |||
| 1715 | Ga0068860_100208145 | |||
| 1716 | Ga0068860_100222385 | |||
| 1717 | Ga0068862_100004058 | |||
| 1718 | Ga0068862_100005592 | |||
| 1719 | Ga0068862_100124858 | |||
| 1720 | Ga0081455_10025751 | |||
| 1721 | Ga0081538_10039338 | |||
| 1722 | Ga0081539_10008986 | |||
| 1723 | Ga0070716_100021124 | |||
| 1724 | Ga0070716_100082864 | |||
| 1725 | Ga0070712_100057282 | |||
| 1726 | Ga0070712_100337944 | |||
| 1727 | Ga0097621_100015842 | |||
| 1728 | Ga0097621_100286288 | |||
| 1729 | Ga0068871_100028026 | |||
| 1730 | Ga0075428_100022755 | |||
| 1731 | Ga0075428_100062985 | |||
| 1732 | Ga0075428_100115375 | |||
| 1733 | Ga0075430_100016293 | |||
| 1734 | Ga0075430_100037372 | |||
| 1735 | Ga0075430_100109903 | |||
| 1736 | Ga0075430_100139661 | |||
| 1737 | Ga0075431_100052677 | |||
| 1738 | Ga0075431_100063453 | |||
| 1739 | Ga0075431_100081554 | |||
| 1740 | Ga0075431_100189178 | |||
| 1741 | Ga0075431_100233776 | |||
| 1742 | Ga0075431_100249914 | |||
| 1743 | Ga0075431_100484624 | |||
| 1744 | Ga0075433_10004001 | |||
| 1745 | Ga0075433_10004074 | |||
| 1746 | Ga0075433_10013983 | |||
| 1747 | Ga0075433_10026026 | |||
| 1748 | Ga0075433_10064689 | |||
| 1749 | Ga0075434_100006449 | |||
| 1750 | Ga0075434_100010304 | |||
| 1751 | Ga0075434_100013833 | |||
| 1752 | Ga0075434_100022999 | |||
| 1753 | Ga0075434_100034022 | |||
| 1754 | Ga0075434_100038953 | |||
| 1755 | Ga0075434_100043884 | |||
| 1756 | Ga0075434_100075352 | |||
| 1757 | Ga0075434_100078264 | |||
| 1758 | Ga0075434_100087772 | |||
| 1759 | Ga0075434_100163249 | |||
| 1760 | Ga0075434_100183701 | |||
| 1761 | Ga0075434_100187303 | |||
| 1762 | Ga0075434_100190376 | |||
| 1763 | Ga0075434_100265560 | |||
| 1764 | Ga0075434_100417390 | |||
| 1765 | Ga0075429_100001523 | |||
| 1766 | Ga0075429_100040646 | |||
| 1767 | Ga0075429_100060576 | |||
| 1768 | Ga0075429_100186621 | |||
| 1769 | Ga0075429_100216545 | |||
| 1770 | Ga0068865_100003327 | |||
| 1771 | Ga0068865_100003920 | |||
| 1772 | Ga0068865_100025474 | |||
| 1773 | Ga0068865_100082061 | |||
| 1774 | Ga0075436_100000571 | |||
| 1775 | Ga0075436_100010480 | |||
| 1776 | Ga0075436_100026519 | |||
| 1777 | Ga0075436_100027275 | |||
| 1778 | Ga0075436_100030577 | |||
| 1779 | Ga0075436_100037135 | |||
| 1780 | Ga0075436_100077218 | |||
| 1781 | Ga0075436_100188310 | |||
| 1782 | Ga0075436_100300154 | |||
| 1783 | Ga0097620_100005677 | |||
| 1784 | Ga0097620_100022806 | |||
| 1785 | Ga0097620_100347582 | |||
| 1786 | Ga0097620_100692539 | |||
| 1787 | Ga0075435_100002070 | |||
| 1788 | Ga0075435_100026094 | |||
| 1789 | Ga0075435_100077732 | |||
| 1790 | Ga0075435_100079287 | |||
| 1791 | Ga0075435_100109526 | |||
| 1792 | Ga0075435_100158752 | |||
| 1793 | Ga0075435_100181754 | |||
| 1794 | Ga0075435_100230996 | |||
| 1795 | Ga0075435_100293791 | |||
| 1796 | Ga0075435_100318526 | |||
| 1797 | Ga0099794_10000178 | |||
| 1798 | Ga0099794_10021608 | |||
| 1799 | Ga0099794_10065122 | |||
| 1800 | Ga0099795_10006951 | |||
| 1801 | Ga0105240_10010311 | |||
| 1802 | Ga0105240_10038754 | |||
| 1803 | Ga0105240_10053547 | |||
| 1804 | Ga0105240_10074675 | |||
| 1805 | Ga0105240_10090847 | |||
| 1806 | Ga0105240_10102245 | |||
| 1807 | Ga0111539_10032459 | |||
| 1808 | Ga0111539_10045772 | |||
| 1809 | Ga0111539_10065230 | |||
| 1810 | Ga0111539_10074441 | |||
| 1811 | Ga0111539_10441721 | |||
| 1812 | Ga0105245_10032173 | |||
| 1813 | Ga0105245_10096433 | |||
| 1814 | Ga0105245_10250874 | |||
| 1815 | Ga0105245_10379305 | |||
| 1816 | Ga0105245_10438425 | |||
| 1817 | Ga0105247_10069873 | |||
| 1818 | Ga0114129_10001639 | |||
| 1819 | Ga0114129_10007805 | |||
| 1820 | Ga0114129_10066146 | |||
| 1821 | Ga0114129_10070357 | |||
| 1822 | Ga0114129_10271166 | |||
| 1823 | Ga0114129_10403136 | |||
| 1824 | Ga0114129_10725711 | |||
| 1825 | Ga0105243_10002610 | |||
| 1826 | Ga0105243_10200282 | |||
| 1827 | Ga0105241_10000025 | |||
| 1828 | Ga0105241_10007428 | |||
| 1829 | Ga0105241_10104215 | |||
| 1830 | Ga0105241_10153651 | |||
| 1831 | Ga0105242_10001397 | |||
| 1832 | Ga0105248_10000658 | |||
| 1833 | Ga0105248_10015291 | |||
| 1834 | Ga0105248_10037957 | |||
| 1835 | Ga0105248_10053356 | |||
| 1836 | Ga0105248_10089736 | |||
| 1837 | Ga0105248_10099483 | |||
| 1838 | Ga0105248_10266431 | |||
| 1839 | Ga0105248_10474646 | |||
| 1840 | Ga0105237_10097585 | |||
| 1841 | Ga0105237_10386456 | |||
| 1842 | Ga0105249_10000083 | |||
| 1843 | Ga0105249_10001049 | |||
| 1844 | Ga0105249_10001200 | |||
| 1845 | Ga0105249_10007224 | |||
| 1846 | Ga0105249_10022839 | |||
| 1847 | Ga0105239_10060464 | |||
| 1848 | Ga0105239_10069697 | |||
| 1849 | Ga0105239_10219021 | |||
| 1850 | Ga0105239_10385941 | |||
| 1851 | Ga0105246_10000937 | |||
| 1852 | Ga0105246_10254715 | |||
| 1853 | Ga0157373_10020264 | |||
| 1854 | Ga0157373_10029175 | |||
| 1855 | Ga0157373_10042096 | |||
| 1856 | Ga0157373_10209151 | |||
| 1857 | Ga0157373_10253927 | |||
| 1858 | Ga0157371_10028628 | |||
| 1859 | Ga0157371_10056882 | |||
| 1860 | Ga0157371_10109814 | |||
| 1861 | Ga0157371_10208561 | |||
| 1862 | Ga0157370_10001352 | |||
| 1863 | Ga0157370_10009331 | |||
| 1864 | Ga0157370_10023060 | |||
| 1865 | Ga0157370_10301032 | |||
| 1866 | Ga0157369_10004455 | |||
| 1867 | Ga0157369_10010646 | |||
| 1868 | Ga0157369_10032769 | |||
| 1869 | Ga0157369_10036813 | |||
| 1870 | Ga0157369_10148309 | |||
| 1871 | Ga0157369_10186626 | |||
| 1872 | Ga0157369_10270608 | |||
| 1873 | Ga0157369_10422969 | |||
| 1874 | Ga0157374_10021577 | |||
| 1875 | Ga0157374_10021754 | |||
| 1876 | Ga0157374_10107989 | |||
| 1877 | Ga0157378_10033195 | |||
| 1878 | Ga0157378_10055874 | |||
| 1879 | Ga0157378_10078557 | |||
| 1880 | Ga0157378_10083622 | |||
| 1881 | Ga0157378_10102274 | |||
| 1882 | Ga0157378_10322468 | |||
| 1883 | Ga0163162_10039491 | |||
| 1884 | Ga0163162_10207242 | |||
| 1885 | Ga0157372_10001740 | |||
| 1886 | Ga0157372_10002494 | |||
| 1887 | Ga0157372_10003084 | |||
| 1888 | Ga0157372_10005801 | |||
| 1889 | Ga0157372_10010221 | |||
| 1890 | Ga0157372_10019475 | |||
| 1891 | Ga0157372_10063803 | |||
| 1892 | Ga0157372_10071687 | |||
| 1893 | Ga0157372_10080213 | |||
| 1894 | Ga0157372_10081523 | |||
| 1895 | Ga0157372_10102646 | |||
| 1896 | Ga0157372_10154299 | |||
| 1897 | Ga0157372_10156622 | |||
| 1898 | Ga0157372_10166347 | |||
| 1899 | Ga0157372_10308089 | |||
| 1900 | Ga0157372_10441787 | |||
| 1901 | Ga0157372_10492516 | |||
| 1902 | Ga0157372_10780076 | |||
| 1903 | Ga0157375_10041631 | |||
| 1904 | Ga0157375_10068267 | |||
| 1905 | Ga0157375_10117344 | |||
| 1906 | Ga0157375_10276113 | |||
| 1907 | Ga0157375_10483416 | |||
| 1908 | Ga0163163_10137410 | |||
| 1909 | Ga0163163_10336543 | |||
| 1910 | Ga0157380_10009811 | |||
| 1911 | Ga0157380_10093235 | |||
| 1912 | Ga0157380_10137122 | |||
| 1913 | Ga0157380_10257193 | |||
| 1914 | Ga0182008_10024756 | |||
| 1915 | Ga0182008_10076374 | |||
| 1916 | Ga0157377_10002859 | |||
| 1917 | Ga0157377_10005428 | |||
| 1918 | Ga0157379_10005967 | |||
| 1919 | Ga0157379_10093822 | |||
| 1920 | Ga0157379_10302135 | |||
| 1921 | Ga0157376_10259046 | |||
| 1922 | Ga0157376_10330617 | |||
| 1923 | Ga0157376_10482624 | |||
| 1924 | Ga0163161_10129020 | |||
| 1925 | Ga0206356_10784497 | |||
| 1926 | Ga0207697_10002904 | |||
| 1927 | Ga0207653_10000053 | |||
| 1928 | Ga0207653_10023574 | |||
| 1929 | Ga0207653_10024659 | |||
| 1930 | Ga0207653_10066532 | |||
| 1931 | Ga0207642_10000799 | |||
| 1932 | Ga0207642_10004837 | |||
| 1933 | Ga0207680_10045244 | |||
| 1934 | Ga0207699_10011001 | |||
| 1935 | Ga0207699_10120803 | |||
| 1936 | Ga0207645_10000052 | |||
| 1937 | Ga0207645_10000145 | |||
| 1938 | Ga0207645_10031145 | |||
| 1939 | Ga0207643_10002996 | |||
| 1940 | Ga0207643_10057395 | |||
| 1941 | Ga0207705_10001545 | |||
| 1942 | Ga0207705_10008946 | |||
| 1943 | Ga0207705_10022727 | |||
| 1944 | Ga0207705_10043874 | |||
| 1945 | Ga0207705_10079705 | |||
| 1946 | Ga0207705_10105316 | |||
| 1947 | Ga0207705_10147505 | |||
| 1948 | Ga0207684_10017658 | |||
| 1949 | Ga0207684_10049299 | |||
| 1950 | Ga0207684_10065732 | |||
| 1951 | Ga0207684_10098026 | |||
| 1952 | Ga0207654_10069856 | |||
| 1953 | Ga0207654_10088150 | |||
| 1954 | Ga0207654_10232462 | |||
| 1955 | Ga0207707_10000368 | |||
| 1956 | Ga0207707_10001843 | |||
| 1957 | Ga0207707_10002577 | |||
| 1958 | Ga0207707_10002663 | |||
| 1959 | Ga0207707_10005261 | |||
| 1960 | Ga0207707_10006129 | |||
| 1961 | Ga0207707_10019193 | |||
| 1962 | Ga0207707_10027900 | |||
| 1963 | Ga0207707_10028674 | |||
| 1964 | Ga0207707_10033518 | |||
| 1965 | Ga0207707_10092218 | |||
| 1966 | Ga0207707_10220628 | |||
| 1967 | Ga0207695_10005807 | |||
| 1968 | Ga0207695_10006323 | |||
| 1969 | Ga0207695_10006746 | |||
| 1970 | Ga0207695_10007672 | |||
| 1971 | Ga0207695_10082098 | |||
| 1972 | Ga0207671_10091208 | |||
| 1973 | Ga0207693_10011197 | |||
| 1974 | Ga0207693_10057046 | |||
| 1975 | Ga0207663_10204464 | |||
| 1976 | Ga0207660_10000017 | |||
| 1977 | Ga0207660_10000488 | |||
| 1978 | Ga0207660_10003121 | |||
| 1979 | Ga0207660_10007380 | |||
| 1980 | Ga0207660_10007539 | |||
| 1981 | Ga0207660_10011464 | |||
| 1982 | Ga0207660_10012885 | |||
| 1983 | Ga0207660_10038959 | |||
| 1984 | Ga0207660_10050522 | |||
| 1985 | Ga0207660_10056216 | |||
| 1986 | Ga0207660_10100214 | |||
| 1987 | Ga0207660_10112889 | |||
| 1988 | Ga0207660_10164593 | |||
| 1989 | Ga0207660_10282755 | |||
| 1990 | Ga0207662_10001708 | |||
| 1991 | Ga0207662_10046877 | |||
| 1992 | Ga0207657_10000432 | |||
| 1993 | Ga0207657_10001418 | |||
| 1994 | Ga0207657_10013214 | |||
| 1995 | Ga0207657_10017286 | |||
| 1996 | Ga0207657_10099066 | |||
| 1997 | Ga0207657_10127791 | |||
| 1998 | Ga0207657_10162901 | |||
| 1999 | Ga0207657_10334700 | |||
| 2000 | Ga0207649_10003178 | |||
| 2001 | Ga0207649_10005400 | |||
| 2002 | Ga0207649_10132163 | |||
| 2003 | Ga0207652_10000429 | |||
| 2004 | Ga0207652_10001247 | |||
| 2005 | Ga0207652_10002800 | |||
| 2006 | Ga0207652_10010571 | |||
| 2007 | Ga0207652_10019078 | |||
| 2008 | Ga0207652_10042163 | |||
| 2009 | Ga0207652_10061666 | |||
| 2010 | Ga0207652_10123627 | |||
| 2011 | Ga0207652_10142679 | |||
| 2012 | Ga0207652_10206844 | |||
| 2013 | Ga0207652_10245829 | |||
| 2014 | Ga0207646_10003549 | |||
| 2015 | Ga0207646_10006308 | |||
| 2016 | Ga0207646_10006748 | |||
| 2017 | Ga0207646_10010262 | |||
| 2018 | Ga0207646_10031963 | |||
| 2019 | Ga0207646_10049721 | |||
| 2020 | Ga0207646_10064341 | |||
| 2021 | Ga0207646_10077853 | |||
| 2022 | Ga0207646_10106574 | |||
| 2023 | Ga0207646_10134689 | |||
| 2024 | Ga0207646_10139062 | |||
| 2025 | Ga0207646_10151207 | |||
| 2026 | Ga0207646_10185404 | |||
| 2027 | Ga0207681_10004406 | |||
| 2028 | Ga0207681_10004849 | |||
| 2029 | Ga0207681_10009612 | |||
| 2030 | Ga0207681_10069411 | |||
| 2031 | Ga0207694_10011630 | |||
| 2032 | Ga0207650_10050505 | |||
| 2033 | Ga0207650_10105747 | |||
| 2034 | Ga0207659_10058534 | |||
| 2035 | Ga0207659_10382949 | |||
| 2036 | Ga0207687_10116260 | |||
| 2037 | Ga0207700_10010137 | |||
| 2038 | Ga0207700_10110534 | |||
| 2039 | Ga0207664_10026579 | |||
| 2040 | Ga0207664_10029190 | |||
| 2041 | Ga0207664_10069028 | |||
| 2042 | Ga0207644_10022470 | |||
| 2043 | Ga0207644_10024347 | |||
| 2044 | Ga0207644_10138201 | |||
| 2045 | Ga0207690_10011107 | |||
| 2046 | Ga0207690_10011507 | |||
| 2047 | Ga0207690_10034563 | |||
| 2048 | Ga0207690_10060821 | |||
| 2049 | Ga0207690_10095573 | |||
| 2050 | Ga0207706_10000146 | |||
| 2051 | Ga0207706_10000217 | |||
| 2052 | Ga0207706_10008952 | |||
| 2053 | Ga0207706_10019611 | |||
| 2054 | Ga0207706_10027712 | |||
| 2055 | Ga0207706_10222443 | |||
| 2056 | Ga0207706_10257480 | |||
| 2057 | Ga0207706_10282150 | |||
| 2058 | Ga0207686_10000067 | |||
| 2059 | Ga0207686_10012901 | |||
| 2060 | Ga0207709_10001445 | |||
| 2061 | Ga0207670_10061761 | |||
| 2062 | Ga0207670_10114091 | |||
| 2063 | Ga0207669_10001177 | |||
| 2064 | Ga0207669_10286069 | |||
| 2065 | Ga0207704_10019685 | |||
| 2066 | Ga0207704_10021877 | |||
| 2067 | Ga0207704_10122168 | |||
| 2068 | Ga0207665_10001924 | |||
| 2069 | Ga0207665_10057196 | |||
| 2070 | Ga0207691_10000818 | |||
| 2071 | Ga0207691_10002987 | |||
| 2072 | Ga0207691_10011023 | |||
| 2073 | Ga0207691_10053833 | |||
| 2074 | Ga0207691_10111390 | |||
| 2075 | Ga0207691_10144207 | |||
| 2076 | Ga0207691_10169436 | |||
| 2077 | Ga0207711_10002609 | |||
| 2078 | Ga0207711_10024175 | |||
| 2079 | Ga0207711_10092930 | |||
| 2080 | Ga0207711_10523421 | |||
| 2081 | Ga0207689_10007511 | |||
| 2082 | Ga0207689_10084019 | |||
| 2083 | Ga0207689_10280290 | |||
| 2084 | Ga0207661_10002514 | |||
| 2085 | Ga0207661_10009050 | |||
| 2086 | Ga0207661_10014030 | |||
| 2087 | Ga0207661_10016893 | |||
| 2088 | Ga0207661_10021314 | |||
| 2089 | Ga0207661_10026665 | |||
| 2090 | Ga0207661_10056198 | |||
| 2091 | Ga0207661_10079465 | |||
| 2092 | Ga0207661_10100801 | |||
| 2093 | Ga0207661_10148395 | |||
| 2094 | Ga0207661_10151140 | |||
| 2095 | Ga0207661_10186027 | |||
| 2096 | Ga0207661_10199702 | |||
| 2097 | Ga0207661_10406808 | |||
| 2098 | Ga0207679_10006823 | |||
| 2099 | Ga0207679_10009638 | |||
| 2100 | Ga0207679_10012824 | |||
| 2101 | Ga0207679_10073834 | |||
| 2102 | Ga0207679_10114713 | |||
| 2103 | Ga0207679_10132726 | |||
| 2104 | Ga0207679_10269176 | |||
| 2105 | Ga0207679_10341051 | |||
| 2106 | Ga0207667_10013600 | |||
| 2107 | Ga0207667_10021631 | |||
| 2108 | Ga0207667_10049482 | |||
| 2109 | Ga0207667_10070493 | |||
| 2110 | Ga0207667_10133699 | |||
| 2111 | Ga0207667_10217742 | |||
| 2112 | Ga0207667_10245987 | |||
| 2113 | Ga0207651_10036234 | |||
| 2114 | Ga0207651_10047984 | |||
| 2115 | Ga0207712_10000079 | |||
| 2116 | Ga0207712_10000116 | |||
| 2117 | Ga0207712_10001918 | |||
| 2118 | Ga0207712_10004409 | |||
| 2119 | Ga0207712_10329818 | |||
| 2120 | Ga0207668_10037485 | |||
| 2121 | Ga0207640_10001376 | |||
| 2122 | Ga0207640_10019297 | |||
| 2123 | Ga0207640_10034959 | |||
| 2124 | Ga0207640_10232608 | |||
| 2125 | Ga0207658_10125952 | |||
| 2126 | Ga0207658_10224459 | |||
| 2127 | Ga0207658_10244812 | |||
| 2128 | Ga0207658_10303622 | |||
| 2129 | Ga0207677_10049606 | |||
| 2130 | Ga0207703_10052808 | |||
| 2131 | Ga0207703_10080590 | |||
| 2132 | Ga0207703_10148741 | |||
| 2133 | Ga0207639_10019393 | |||
| 2134 | Ga0207639_10030731 | |||
| 2135 | Ga0207639_10103885 | |||
| 2136 | Ga0207639_10130182 | |||
| 2137 | Ga0207639_10278301 | |||
| 2138 | Ga0207678_10002885 | |||
| 2139 | Ga0207678_10162549 | |||
| 2140 | Ga0207678_10223973 | |||
| 2141 | Ga0207708_10004066 | |||
| 2142 | Ga0207708_10054547 | |||
| 2143 | Ga0207708_10262713 | |||
| 2144 | Ga0207702_10023570 | |||
| 2145 | Ga0207702_10164302 | |||
| 2146 | Ga0207702_10183644 | |||
| 2147 | Ga0207641_10162409 | |||
| 2148 | Ga0207641_10459253 | |||
| 2149 | Ga0207648_10001390 | |||
| 2150 | Ga0207648_10020801 | |||
| 2151 | Ga0207648_10076676 | |||
| 2152 | Ga0207648_10364933 | |||
| 2153 | Ga0207676_10036819 | |||
| 2154 | Ga0207676_10129677 | |||
| 2155 | Ga0207676_10156303 | |||
| 2156 | Ga0207676_10156989 | |||
| 2157 | Ga0207676_10164598 | |||
| 2158 | Ga0207676_10276515 | |||
| 2159 | Ga0207674_10000677 | |||
| 2160 | Ga0207674_10002099 | |||
| 2161 | Ga0207674_10002912 | |||
| 2162 | Ga0207674_10019018 | |||
| 2163 | Ga0207674_10132766 | |||
| 2164 | Ga0207674_10144844 | |||
| 2165 | Ga0207674_10367419 | |||
| 2166 | Ga0207675_100000102 | |||
| 2167 | Ga0207675_100017147 | |||
| 2168 | Ga0207675_100118017 | |||
| 2169 | Ga0207675_100147291 | |||
| 2170 | Ga0207675_100201544 | |||
| 2171 | Ga0207698_10006848 | |||
| 2172 | Ga0207698_10007858 | |||
| 2173 | Ga0207698_10009341 | |||
| 2174 | Ga0207698_10029014 | |||
| 2175 | Ga0207698_10046115 | |||
| 2176 | Ga0207698_10073598 | |||
| 2177 | Ga0207698_10083431 | |||
| 2178 | Ga0207698_10202809 | |||
| 2179 | Ga0207698_10382751 | |||
| 2180 | Ga0209970_1007623 | |||
| 2181 | Ga0209588_1000809 | |||
| 2182 | Ga0209588_1004273 | |||
| 2183 | Ga0209588_1027027 | |||
| 2184 | Ga0209966_1004660 | |||
| 2185 | Ga0209998_10002169 | |||
| 2186 | Ga0209998_10009120 | |||
| 2187 | Ga0209974_10038427 | |||
| 2188 | Ga0209974_10071083 | |||
| 2189 | Ga0268266_10036186 | |||
| 2190 | Ga0268266_10200454 | |||
| 2191 | Ga0268265_10002084 | |||
| 2192 | Ga0268265_10092523 | |||
| 2193 | Ga0268264_10009387 | |||
| 2194 | Ga0268264_10021128 | |||
| 2195 | Ga0268264_10119955 | |||
| 2196 | Ga0265332_10060665 | |||
| 2197 | Ga0265332_10062056 | |||
| 2198 | Ga0265340_10045394 | |||
| 2199 | Ga0307408_100007165 | |||
| 2200 | Ga0307408_100009023 | |||
| 2201 | Ga0307408_100010179 | |||
| 2202 | Ga0307408_100012296 | |||
| 2203 | Ga0307408_100017692 | |||
| 2204 | Ga0307408_100021612 | |||
| 2205 | Ga0307408_100024813 | |||
| 2206 | Ga0307408_100053345 | |||
| 2207 | Ga0307408_100074641 | |||
| 2208 | Ga0307408_100079633 | |||
| 2209 | Ga0307408_100099428 | |||
| 2210 | Ga0307408_100102510 | |||
| 2211 | Ga0265314_10068058 | |||
| 2212 | Ga0265314_10078400 | |||
| 2213 | Ga0265342_10041153 | |||
| 2214 | Ga0316576_10091337 | |||
| 2215 | Ga0307405_10000062 | |||
| 2216 | Ga0307405_10011464 | |||
| 2217 | Ga0307405_10013607 | |||
| 2218 | Ga0307405_10054931 | |||
| 2219 | Ga0307405_10081353 | |||
| 2220 | Ga0307405_10165847 | |||
| 2221 | Ga0307413_10000544 | |||
| 2222 | Ga0307413_10001813 | |||
| 2223 | Ga0307413_10002458 | |||
| 2224 | Ga0307413_10019795 | |||
| 2225 | Ga0307413_10035476 | |||
| 2226 | Ga0307413_10059565 | |||
| 2227 | Ga0307413_10153614 | |||
| 2228 | Ga0307413_10372208 | |||
| 2229 | Ga0307410_10008556 | |||
| 2230 | Ga0307410_10010028 | |||
| 2231 | Ga0307410_10010357 | |||
| 2232 | Ga0307410_10010607 | |||
| 2233 | Ga0307410_10017648 | |||
| 2234 | Ga0307410_10028513 | |||
| 2235 | Ga0307410_10031073 | |||
| 2236 | Ga0307410_10034960 | |||
| 2237 | Ga0307410_10053785 | |||
| 2238 | Ga0307410_10080401 | |||
| 2239 | Ga0307410_10135240 | |||
| 2240 | Ga0307410_10152854 | |||
| 2241 | Ga0307410_10174415 | |||
| 2242 | Ga0307406_10002612 | |||
| 2243 | Ga0307406_10002804 | |||
| 2244 | Ga0307406_10010298 | |||
| 2245 | Ga0307406_10018265 | |||
| 2246 | Ga0307406_10031081 | |||
| 2247 | Ga0307406_10056065 | |||
| 2248 | Ga0307406_10071554 | |||
| 2249 | Ga0307406_10075287 | |||
| 2250 | Ga0307406_10165923 | |||
| 2251 | Ga0307406_10216074 | |||
| 2252 | Ga0307406_10248068 | |||
| 2253 | Ga0307407_10000205 | |||
| 2254 | Ga0307407_10000240 | |||
| 2255 | Ga0307407_10000896 | |||
| 2256 | Ga0307407_10003266 | |||
| 2257 | Ga0307407_10012983 | |||
| 2258 | Ga0307407_10034975 | |||
| 2259 | Ga0307407_10036198 | |||
| 2260 | Ga0307407_10050453 | |||
| 2261 | Ga0307407_10053048 | |||
| 2262 | Ga0307412_10002291 | |||
| 2263 | Ga0307412_10015849 | |||
| 2264 | Ga0307412_10017277 | |||
| 2265 | Ga0307412_10035156 | |||
| 2266 | Ga0307412_10038352 | |||
| 2267 | Ga0307412_10053466 | |||
| 2268 | Ga0307412_10085917 | |||
| 2269 | Ga0307412_10107015 | |||
| 2270 | Ga0307412_10113723 | |||
| 2271 | Ga0307412_10178617 | |||
| 2272 | Ga0307409_100000540 | |||
| 2273 | Ga0307409_100000760 | |||
| 2274 | Ga0307409_100002465 | |||
| 2275 | Ga0307409_100005482 | |||
| 2276 | Ga0307409_100015464 | |||
| 2277 | Ga0307409_100021211 | |||
| 2278 | Ga0307409_100035527 | |||
| 2279 | Ga0307409_100049812 | |||
| 2280 | Ga0307409_100123108 | |||
| 2281 | Ga0307409_100171507 | |||
| 2282 | Ga0307409_100203216 | |||
| 2283 | Ga0307416_100000492 | |||
| 2284 | Ga0307416_100002344 | |||
| 2285 | Ga0307416_100004110 | |||
| 2286 | Ga0307416_100006234 | |||
| 2287 | Ga0307416_100006582 | |||
| 2288 | Ga0307416_100022784 | |||
| 2289 | Ga0307416_100044221 | |||
| 2290 | Ga0307416_100047694 | |||
| 2291 | Ga0307416_100055875 | |||
| 2292 | Ga0307416_100078594 | |||
| 2293 | Ga0307416_100103796 | |||
| 2294 | Ga0307416_100203299 | |||
| 2295 | Ga0307416_100314874 | |||
| 2296 | Ga0307416_100356769 | |||
| 2297 | Ga0307414_10008272 | |||
| 2298 | Ga0307414_10019309 | |||
| 2299 | Ga0307414_10024174 | |||
| 2300 | Ga0307414_10077085 | |||
| 2301 | Ga0307414_10078821 | |||
| 2302 | Ga0307414_10096087 | |||
| 2303 | Ga0307414_10140643 | |||
| 2304 | Ga0307414_10196940 | |||
| 2305 | Ga0307411_10000132 | |||
| 2306 | Ga0307411_10000346 | |||
| 2307 | Ga0307411_10002338 | |||
| 2308 | Ga0307411_10020498 | |||
| 2309 | Ga0307411_10021629 | |||
| 2310 | Ga0307411_10026707 | |||
| 2311 | Ga0307411_10051404 | |||
| 2312 | Ga0307411_10108003 | |||
| 2313 | Ga0307411_10141432 | |||
| 2314 | Ga0307411_10172311 | |||
| 2315 | Ga0307411_10208715 | |||
| 2316 | Ga0307411_10274083 | |||
| 2317 | Ga0307415_100000261 | |||
| 2318 | Ga0307415_100002765 | |||
| 2319 | Ga0307415_100004433 | |||
| 2320 | Ga0307415_100010341 | |||
| 2321 | Ga0307415_100013741 | |||
| 2322 | Ga0307415_100021565 | |||
| 2323 | Ga0307415_100035689 | |||
| 2324 | Ga0307415_100037794 | |||
| 2325 | Ga0307415_100100053 | |||
| 2326 | Ga0307415_100137587 | |||
| 2327 | Ga0373926_0041506 | |||
| 2328 | Ga0373934_0000216 | |||
| 2329 | Ga0373934_0004067 | |||
| 2330 | Ga0373934_0009539 | |||
| 2331 | Ga0373944_0044710 | |||
| 2332 | Ga0373923_0017713 | |||
| 2333 | Ga0373932_0013413 | |||
| 2334 | Ga0373939_0022428 | |||
| 2335 | Ga0373941_0029969 | |||
| 2336 | Ga0373954_0097330 | |||
| 2337 | Ga0373956_0000127 | |||
| 2338 | Ga0373957_0020187 | |||
| 2339 | Ga0373943_0005852 | |||
| 2340 | Ga0373946_0004631 | |||
| 2341 | Ga0373955_0004826 | |||
| 2342 | Ga0373924_0053102 | |||
| 2343 | Ga0373931_0015201 | |||
| 2344 | Ga0373931_0130774 | |||
| 2345 | Ga0373927_0012077 | |||
| 2346 | Ga0373927_0050519 | |||
| 2347 | Ga0373927_0066263 | |||
| 2348 | Ga0373927_0131277 | |||
| 2349 | Ga0373933_0000353 | |||
| 2350 | Ga0373933_0264535 | |||
| 2351 | Ga0373947_0006463 | |||
| 2352 | Ga0373937_0000195 | |||
| 2353 | Ga0373937_0003317 | |||
| 2354 | Ga0373937_0009385 | |||
| 2355 | Ga0373937_0013444 | |||
| 2356 | Ga0373937_0337205 | |||
| 2357 | Ga0373925_0022548 | |||
| 2358 | Ga0395899_0024706 | |||
| 2359 | Ga0395900_0048539 | |||
| 2360 | Ga0395905_0043072 | |||
| 2361 | Ga0395905_0081476 | |||
| 2362 | Ga0436364_0458848 | |||
| 2363 | Ga0395901_0001422 | |||
| 2364 | Ga0395901_0507637 | |||
| 2365 | Ga0242420_023197 | |||
| 2366 | Ga0436365_0252405 | |||
| 2367 | Ga0439439_0008615 | |||
| 2368 | Ga0439439_0014247 | |||
| 2369 | Ga0439439_0048717 | |||
| 2370 | Ga0439448_0037820 | |||
| 2371 | Ga0450898_002774 | |||
| 2372 | Ga0439446_0083473 | |||
| 2373 | Ga0439434_0020186 | |||
| 2374 | Ga0439435_0005336 | |||
| 2375 | Ga0439435_0014857 | |||
| 2376 | Ga0451577_0000016 | |||
| 2377 | Ga0451577_0040015 | |||
| 2378 | Ga0451577_0060761 | |||
| 2379 | Ga0451577_0082558 | |||
| 2380 | Ga0451577_0393345 | |||
| 2381 | Ga0451577_0435502 | |||
| 2382 | Ga0453683_0030556 | |||
| 2383 | Ga0466966_0007072 | |||
| 2384 | Ga0466966_0064590 | |||
| 2385 | Ga0466961_0033364 | |||
| 2386 | Ga0466961_0089755 | |||
| 2387 | Ga0453684_0000886 | |||
| 2388 | Ga0453684_0083936 | |||
| 2389 | Ga0453684_0088534 | |||
| 2390 | Ga0453684_0287342 | |||
| 2391 | Ga0453684_0580793 | |||
| 2392 | Ga0453684_0640519 | |||
| 2393 | Ga0451576_0001721 | |||
| 2394 | Ga0451576_0009275 | |||
| 2395 | Ga0451576_0020198 | |||
| 2396 | Ga0451576_0078786 | |||
| 2397 | Ga0451576_0260525 | |||
| 2398 | Ga0451576_0304305 | |||
| 2399 | Ga0466958_0172257 | |||
| 2400 | Ga0466967_0340055 | |||
| 2401 | Ga0495592_0084118 | |||
| 2402 | Ga0495603_0012254 | |||
| 2403 | Ga0495603_0024525 | |||
| 2404 | Ga0495603_0030389 | |||
| 2405 | Ga0495590_0055742 | |||
| 2406 | Ga0495629_0001690 | |||
| 2407 | Ga0495629_0018369 | |||
| 2408 | Ga0495629_0037952 | |||
| 2409 | Ga0495629_0114603 | |||
| 2410 | Ga0495629_0264041 | |||
| 2411 | Ga0495651_0000050 | |||
| 2412 | Ga0495651_0005117 | |||
| 2413 | Ga0495651_0078463 | |||
| 2414 | Ga0495653_0000134 | |||
| 2415 | Ga0495653_0020073 | |||
| 2416 | Ga0495580_0003170 | |||
| 2417 | Ga0495580_0270113 | |||
| 2418 | Ga0495582_0030374 | |||
| 2419 | Ga0495582_0042084 | |||
| 2420 | Ga0495582_0076907 | |||
| 2421 | Ga0495639_0009369 | |||
| 2422 | Ga0495594_0011181 | |||
| 2423 | Ga0495594_0020892 | |||
| 2424 | Ga0495594_0025728 | |||
| 2425 | Ga0495594_0087123 | |||
| 2426 | Ga0495594_0095883 | |||
| 2427 | Ga0495608_0000381 | |||
| 2428 | Ga0495618_0041637 | |||
| 2429 | Ga0495618_0076903 | |||
| 2430 | Ga0495618_0102568 | |||
| 2431 | Ga0495628_0001915 | |||
| 2432 | Ga0495628_0020377 | |||
| 2433 | Ga0495628_0078524 | |||
| 2434 | Ga0495630_0002550 | |||
| 2435 | Ga0495630_0004360 | |||
| 2436 | Ga0495630_0007348 | |||
| 2437 | Ga0495630_0030695 | |||
| 2438 | Ga0495630_0074785 | |||
| 2439 | Ga0495630_0086741 | |||
| 2440 | Ga0495643_0151747 | |||
| 2441 | Ga0495666_0021364 | |||
| 2442 | Ga0495652_0003898 | |||
| 2443 | Ga0495652_0052162 | |||
| 2444 | Ga0495652_0096439 | |||
| 2445 | Ga0495652_0113016 | |||
| 2446 | Ga0495665_0002730 | |||
| 2447 | Ga0495665_0007115 | |||
| 2448 | Ga0495665_0033107 | |||
| 2449 | Ga0495640_0101358 | |||
| 2450 | Ga0495586_0007821 | |||
| 2451 | Ga0495586_0013976 | |||
| 2452 | Ga0495586_0021688 | |||
| 2453 | Ga0495586_0087993 | |||
| 2454 | Ga0495587_0000114 | |||
| 2455 | Ga0495587_0009898 | |||
| 2456 | Ga0495587_0055948 | |||
| 2457 | Ga0495587_0106770 | |||
| 2458 | Ga0495645_0000065 | |||
| 2459 | Ga0495645_0002208 | |||
| 2460 | Ga0495645_0010296 | |||
| 2461 | Ga0495645_0224443 | |||
| 2462 | Ga0495667_0000316 | |||
| 2463 | Ga0495667_0001659 | |||
| 2464 | Ga0495667_0002423 | |||
| 2465 | Ga0495667_0005100 | |||
| 2466 | Ga0495634_0023134 | |||
| 2467 | Ga0495635_0003351 | |||
| 2468 | Ga0495635_0175850 | |||
| 2469 | Ga0495659_0014615 | |||
| 2470 | Ga0495588_0002596 | |||
| 2471 | Ga0495588_0047731 | |||
| 2472 | Ga0495657_0001662 | |||
| 2473 | Ga0495657_0087933 | |||
| 2474 | Ga0495599_0000754 | |||
| 2475 | Ga0495599_0036568 | |||
| 2476 | Ga0495599_0044302 | |||
| 2477 | Ga0495623_0000086 | |||
| 2478 | Ga0495623_0003506 | |||
| 2479 | Ga0495623_0055733 | |||
| 2480 | Ga0495623_0062428 | |||
| 2481 | Ga0495646_0004169 | |||
| 2482 | Ga0495647_0029495 | |||
| 2483 | Ga0495658_0005675 | |||
| 2484 | Ga0495658_0075933 | |||
| 2485 | Ga0495669_0081346 | |||
| 2486 | Ga0495613_0024883 | |||
| 2487 | Ga0495613_0045558 | |||
| 2488 | Ga0495624_0065889 | |||
| 2489 | Ga0495600_0003319 | |||
| 2490 | Ga0495600_0110782 | |||
| 2491 | Ga0495600_0176136 | |||
| 2492 | Ga0495581_0013945 | |||
| 2493 | Ga0495581_0095446 | |||
| 2494 | Ga0495581_0103581 | |||
| 2495 | Ga0495604_0001195 | |||
| 2496 | Ga0495604_0126389 | |||
| 2497 | Ga0495604_0209912 | |||
| 2498 | Ga0495636_0062063 | |||
| 2499 | Ga0495674_0000339 | |||
| 2500 | Ga0495674_0006412 | |||
| 2501 | Ga0495674_0025755 | |||
| 2502 | Ga0495674_0041723 | |||
| 2503 | Ga0495674_0049695 | |||
| 2504 | Ga0495674_0073351 | |||
| 2505 | Ga0495675_0015599 | |||
| 2506 | Ga0495675_0075725 | |||
| 2507 | Ga0495675_0105424 | |||
| 2508 | Ga0495675_0108057 | |||
| 2509 | Ga0495675_0121962 | |||
| 2510 | Ga0495684_0000141 | |||
| 2511 | Ga0495684_0002171 | |||
| 2512 | Ga0495684_0051191 | |||
| 2513 | Ga0495684_0204747 | |||
| 2514 | Ga0495593_0000043 | |||
| 2515 | Ga0495602_0003470 | |||
| 2516 | Ga0495602_0014360 | |||
| 2517 | Ga0495614_0000096 | |||
| 2518 | Ga0496100_0179401 | |||
| 2519 | Ga0496100_0282483 | |||
| 2520 | Ga0496101_0009147 | |||
| 2521 | Ga0496101_0100918 | |||
| 2522 | Ga0496101_0187262 | |||
| 2523 | Ga0496102_0047628 | |||
| 2524 | Ga0496102_0134756 | |||
| 2525 | Ga0496103_0205199 | |||
| 2526 | Ga0496104_0010276 | |||
| 2527 | Ga0496104_0026059 | |||
| 2528 | Ga0496104_0055390 | |||
| 2529 | Ga0496104_0055558 | |||
| 2530 | Ga0496104_0063078 | |||
| 2531 | Ga0496104_0119252 | |||
| 2532 | Ga0496104_0234294 | |||
| 2533 | Ga0496104_0339989 | |||
| 2534 | Ga0496105_0090022 | |||
| 2535 | Ga0496105_0113779 | |||
| 2536 | Ga0496106_0173130 | |||
| 2537 | Ga0496106_0185399 | |||
| 2538 | Ga0496106_0250109 | |||
| 2539 | Ga0496107_0052584 | |||
| 2540 | Ga0496108_0002171 | |||
| 2541 | Ga0496108_0017783 | |||
| 2542 | Ga0496108_0126720 | |||
| 2543 | Ga0496109_0039510 | |||
| 2544 | Ga0496109_0045291 | |||
| 2545 | Ga0496109_0222788 | |||
| 2546 | Ga0496109_0239380 | |||
| 2547 | Ga0496110_0002484 | |||
| 2548 | Ga0496110_0042941 | |||
| 2549 | Ga0496111_0001425 | |||
| 2550 | Ga0496111_0029946 | |||
| 2551 | Ga0496112_0000129 | |||
| 2552 | Ga0496112_0000882 | |||
| 2553 | Ga0496112_0019955 | |||
| 2554 | Ga0496112_0032739 | |||
| 2555 | Ga0496112_0269071 | |||
| 2556 | Ga0496113_0000062 | |||
| 2557 | Ga0496113_0122492 | |||
| 2558 | Ga0496113_0151071 | |||
| 2559 | Ga0496113_0279607 | |||
| 2560 | Ga0496114_0059380 | |||
| 2561 | Ga0496114_0222926 | |||
| 2562 | Ga0496115_0005916 | |||
| 2563 | Ga0501292_018642 | |||
| 2564 | Ga0501031_0059421 | |||
| 2565 | Ga0501031_0199683 | |||
| 2566 | Ga0501031_0238987 | |||
| 2567 | Ga0501033_0148781 | |||
| 2568 | Ga0501034_0008504 | |||
| 2569 | Ga0501034_0021718 | |||
| 2570 | Ga0501034_0163739 | |||
| 2571 | Ga0501034_0320230 | |||
| 2572 | Ga0501036_0433937 | |||
| 2573 | Ga0501036_0500582 | |||
| 2574 | Ga0501037_0043485 | |||
| 2575 | Ga0501037_0043614 | |||
| 2576 | Ga0501038_0030716 | |||
| 2577 | Ga0501038_0089245 | |||
| 2578 | Ga0501038_0353564 | |||
| 2579 | Ga0501039_0057086 | |||
| 2580 | Ga0501040_0012049 | |||
| 2581 | Ga0501041_0086024 | |||
| 2582 | Ga0501042_0096777 | |||
| 2583 | Ga0501042_0107629 | |||
| 2584 | Ga0501043_0058442 | |||
| 2585 | Ga0501046_0205464 | |||
| 2586 | Ga0501047_0025654 | |||
| 2587 | Ga0501047_0201897 | |||
| 2588 | Ga0501047_0348858 | |||
| 2589 | Ga0501048_0012476 | |||
| 2590 | Ga0501048_0086144 | |||
| 2591 | Ga0501067_0002448 | |||
| 2592 | Ga0501067_0003013 | |||
| 2593 | Ga0501067_0007870 | |||
| 2594 | Ga0501067_0098404 | |||
| 2595 | Ga0501068_0000311 | |||
| 2596 | Ga0501069_0001105 | |||
| 2597 | Ga0501069_0002365 | |||
| 2598 | Ga0501069_0076755 | |||
| 2599 | Ga0501070_0004182 | |||
| 2600 | Ga0501070_0047831 | |||
| 2601 | Ga0501071_0002140 | |||
| 2602 | Ga0501072_0004214 | |||
| 2603 | Ga0501072_0150501 | |||
| 2604 | Ga0501073_0253856 | |||
| 2605 | Ga0501074_0002285 | |||
| 2606 | Ga0501074_0002996 | |||
| 2607 | Ga0501075_0008826 | |||
| 2608 | Ga0501076_0011216 | |||
| 2609 | Ga0501076_0030383 | |||
| 2610 | Ga0501077_0000313 | |||
| 2611 | Ga0501077_0042267 | |||
| 2612 | Ga0501077_0077897 | |||
| 2613 | Ga0501217_042216 | |||
| 2614 | Ga0501235_011626 | |||
| 2615 | Ga0501235_019299 | |||
| 2616 | Ga0501225_0011872 | |||
| 2617 | Ga0501079_0009697 | |||
| 2618 | Ga0501079_0016232 | |||
| 2619 | Ga0501079_0019900 | |||
| 2620 | Ga0501079_0117394 | |||
| 2621 | Ga0501079_0170671 | |||
| 2622 | Ga0501079_0201587 | |||
| 2623 | Ga0501080_0002645 | |||
| 2624 | Ga0501080_0012972 | |||
| 2625 | Ga0501080_0321406 | |||
| 2626 | Ga0501080_0409614 | |||
| 2627 | Ga0501081_0005948 | |||
| 2628 | Ga0501081_0048207 | |||
| 2629 | Ga0501081_0242427 | |||
| 2630 | Ga0501083_0002285 | |||
| 2631 | Ga0501083_0013133 | |||
| 2632 | Ga0501083_0153114 | |||
| 2633 | Ga0501266_004840 | |||
| 2634 | Ga0501268_006067 | |||
| 2635 | Ga0501268_007168 | |||
| 2636 | Ga0501035_0007082 | |||
| 2637 | Ga0501035_0229410 | |||
| 2638 | Ga0501044_0008093 | |||
| 2639 | Ga0501044_0190300 | |||
| 2640 | Ga0501045_0045898 | |||
| 2641 | Ga0501212_005633 | |||
| 2642 | nmdc:mga05p37_163212_c1 | |||
| 2643 | nmdc:mga05p37_17760_c1 | |||
| 2644 | nmdc:mga05p37_180926_c1 | |||
| 2645 | nmdc:mga05p37_2011_c1 | |||
| 2646 | nmdc:mga05p37_290600_c1 | |||
| 2647 | nmdc:mga05p37_39420_c1 | |||
| 2648 | nmdc:mga05p37_549497_c1 | |||
| 2649 | nmdc:mga05p37_606789_c1 | |||
| 2650 | nmdc:mga05p37_7243_c1 | |||
| 2651 | nmdc:mga05p37_76582_c1 | |||
| 2652 | nmdc:mga09592_1219_c1 | |||
| 2653 | nmdc:mga09592_247484_c1 | |||
| 2654 | nmdc:mga09592_66723_c1 | |||
| 2655 | nmdc:mga09592_94674_c1 | |||
| 2656 | nmdc:mga0qj67_18329_c1 | |||
| 2657 | nmdc:mga0qj67_235437_c1 | |||
| 2658 | nmdc:mga0qj67_24210_c1 | |||
| 2659 | nmdc:mga0qj67_31512_c1 | |||
| 2660 | nmdc:mga0qj67_41805_c1 | |||
| 2661 | nmdc:mga0qj67_89934_c1 | |||
| 2662 | nmdc:mga06r32_124297_c1 | |||
| 2663 | nmdc:mga06r32_329936_c1 | |||
| 2664 | nmdc:mga06r32_57790_c1 | |||
| 2665 | nmdc:mga08y16_135234_c1 | |||
| 2666 | nmdc:mga08y16_29721_c1 | |||
| 2667 | nmdc:mga08y16_337659_c1 | |||
| 2668 | nmdc:mga0n895_125953_c1 | |||
| 2669 | nmdc:mga0n895_27921_c1 | |||
| 2670 | nmdc:mga0n895_28362_c1 | |||
| 2671 | nmdc:mga0n895_31893_c1 | |||
| 2672 | nmdc:mga0n895_327193_c1 | |||
| 2673 | nmdc:mga0n895_39010_c1 | |||
| 2674 | nmdc:mga0n895_39846_c1 | |||
| 2675 | nmdc:mga0n895_488161_c1 | |||
| 2676 | nmdc:mga0n895_567528_c1 | |||
| 2677 | nmdc:mga0n895_72069_c1 | |||
| 2678 | nmdc:mga0n895_79256_c1 | |||
| 2679 | nmdc:mga0n895_8346_c1 | |||
| 2680 | nmdc:mga0n895_87492_c1 | |||
| 2681 | nmdc:mga0rr50_148592_c1 | |||
| 2682 | nmdc:mga0rr50_16394_c1 | |||
| 2683 | nmdc:mga0rr50_21872_c1 | |||
| 2684 | nmdc:mga0rr50_219132_c1 | |||
| 2685 | nmdc:mga0rr50_29765_c1 | |||
| 2686 | nmdc:mga0rr50_33702_c1 | |||
| 2687 | nmdc:mga0rr50_5554_c1 | |||
| 2688 | nmdc:mga08x19_20307_c1 | |||
| 2689 | nmdc:mga08x19_5774_c1 | |||
| 2690 | nmdc:mga08x19_5826_c1 | |||
| 2691 | nmdc:mga08x19_67607_c1 | |||
| 2692 | nmdc:mga08x19_7637_c1 | |||
| 2693 | nmdc:mga08x19_7876_c1 | |||
| 2694 | nmdc:mga08x19_9849_c1 | |||
| 2695 | nmdc:mga0a205_123396_c1 | |||
| 2696 | nmdc:mga0a205_18694_c1 | |||
| 2697 | nmdc:mga0a205_26983_c1 | |||
| 2698 | nmdc:mga0a205_31926_c1 | |||
| 2699 | nmdc:mga0a205_7805_c1 | |||
| 2700 | nmdc:mga0a205_86401_c1 | |||
| 2701 | nmdc:mga0a205_989_c1 | |||
| 2702 | Ga0495612_0055401 | |||
| 2703 | Ga0495619_0006607 | |||
| 2704 | Ga0501084_0001049 | |||
| 2705 | Ga0501084_0035691 | |||
| 2706 | Ga0501084_0054276 | |||
| 2707 | Ga0501084_0073327 | |||
| 2708 | Ga0501084_0082642 | |||
| 2709 | Ga0590071_000553 | |||
| 2710 | Ga0590074_013181 | |||
| 2711 | Ga0590077_017968 | |||
| 2712 | Ga0501082_0005808 | |||
| 2713 | Ga0501082_0024265 | |||
| 2714 | Ga0501082_0030793 | |||
| 2715 | Ga0501082_0077709 | |||
| 2716 | Ga0530510_0157151 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6p61-assembly3.cif.gz_C | structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) | 0.7434 | 26 | 222 |
| 4dec-assembly1.cif.gz_A-2 | crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with mn2+, uridine-diphosphate (udp) and phosphoglyceric acid (pga) | 0.7428 | 8 | 244 |
| 4y6n-assembly1.cif.gz_A-2 | crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with mn2+, uridine-diphosphate-glucose (udp-glc) and phosphoglyceric acid (pga) - gpgs mn2+ udp-glc pga-1 | 0.7423 | 8 | 244 |
| 6p61-assembly2.cif.gz_B | structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) | 0.7405 | 26 | 219 |
| 5eke-assembly1.cif.gz_D | structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (f215a mutant) | 0.7401 | 26 | 319 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P77757_4_230_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8888 | 28 | 244 | 3.90.550.10 |
| af_Q8WSL9_63_329_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8542 | 28 | 246 | 3.90.550.10 |
| af_Q57964_2_229_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8521 | 32 | 245 | 3.90.550.10 |
| af_P77757_4_230_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8486 | 28 | 244 | 3.90.550.10 |
| af_A4ICW5_2_228_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8447 | 29 | 240 | 3.90.550.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C5I4E0-F1-model_v4 | Glycosyltransferase family 2 protein | 0.9728 | 29 | 124 |
GO:0005886
GO:0016757 |
| AF-A0A4V1ZS11-F1-model_v4 | Glycosyltransferase family 2 protein | 0.9707 | 26 | 130 |
GO:0005886
GO:0099621 |
| AF-A0A7C5I4E0-F1-model_v4 | Glycosyltransferase family 2 protein | 0.9534 | 29 | 124 |
GO:0005886
GO:0016757 |
| AF-A0A7Y6CFG3-F1-model_v4 | Glycosyltransferase | 0.9515 | 29 | 128 |
GO:0005886
GO:0016757 |
| AF-A0A7V6H0B7-F1-model_v4 | Glycosyltransferase | 0.9495 | 23 | 110 |
GO:0005886
GO:0099621 |