F493215
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1348 | 701 | 1120 | 271 |
Family's Representative Sequence
| Representative Sequence | 3300009545|Ga0105237_10449027|Ga0105237_104490272 |
| Length | 326 |
| Sequence | LLALVVVSSPGDLLSPVRFGSKQRNVQRAVAGEPACRDVTATPYLFQATPTREEMPRILMTGAAGGIGTSLRKLLPPIYPDLVLSDLKAPADLGSHENFKAADLSDLAQVEAICEGVDGILHFGGYSVEGAWDDILQANIIGGYNLFEAARRRGVKRVIFASSNHAVGFYPRHHRIGNDVTPRPDGRYGVSKVFGEAVGSLYADKHGLKVTCIRIGNFGDKPLDHRRLAMWLKPEDLVQLCRIGLERPDIHFEIFYGASLNERTWWDNHRAYELGYRPTGRAEDFREHAMAEQAKLPPDPIGDYYQGGAFCSIEFDGDRSRIIDWK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 7 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 8 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 9 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 10 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 11 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 12 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 13 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 14 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 15 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 16 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 17 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 18 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 19 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 20 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 21 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 22 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 23 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 24 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 25 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 26 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 27 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 28 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 29 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 30 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 31 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 32 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 33 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 34 | 2791355199 | |||
| 35 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 36 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 37 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 38 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 39 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 40 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 41 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 42 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 43 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 44 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 45 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 46 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 47 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 48 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 49 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 50 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 51 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 52 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 53 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 54 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 55 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 56 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 57 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 58 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 59 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 60 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 61 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 62 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 63 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 64 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 65 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 66 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 67 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 68 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 69 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 70 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 71 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 72 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 73 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 74 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 75 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 76 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 77 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 78 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 79 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 80 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 81 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 82 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 83 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 84 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 85 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 86 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 87 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 88 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 89 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 90 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 91 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 92 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 93 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 94 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 95 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 96 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 97 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 98 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 99 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 100 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 101 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 102 | 2904699407 | |||
| 103 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 104 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 105 | 2906610324 | |||
| 106 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 107 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 108 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 109 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 110 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 111 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 112 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 113 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 114 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 115 | 2922368715 | |||
| 116 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 117 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 118 | 2922425934 | |||
| 119 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 120 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 121 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 122 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 123 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 124 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 125 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 126 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 127 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 128 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 129 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 130 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 131 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 132 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 133 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 134 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 135 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 136 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 137 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 138 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 139 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 140 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 141 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 142 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 143 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 144 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 145 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 146 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 147 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 148 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 149 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 150 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 151 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 152 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 153 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 154 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 155 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 156 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 157 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 158 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 159 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 160 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 161 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 162 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 163 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 164 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 165 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 166 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 167 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 168 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 169 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 170 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 171 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 172 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 173 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 174 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 175 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 176 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 177 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 178 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 179 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 180 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 181 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 182 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 183 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 184 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 185 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 186 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 187 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 188 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 189 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 190 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 191 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 192 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 193 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 194 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 195 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 196 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 197 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 198 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 199 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 200 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 201 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 202 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 203 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 204 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 205 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 206 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 207 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 208 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 209 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 210 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 211 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 212 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 213 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 214 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 215 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 216 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 217 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 218 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 219 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 220 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 221 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 222 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 223 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 224 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 225 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 226 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 227 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 228 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 229 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 230 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 231 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 232 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 233 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 234 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 235 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 236 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 237 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 238 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 239 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 240 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 241 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 242 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 243 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 244 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 245 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 246 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 247 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 248 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 249 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 250 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 251 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 252 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 253 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 254 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 255 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 256 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 257 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 258 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 259 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 260 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 261 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 262 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 263 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 264 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 265 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 266 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 268 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 269 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 270 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 271 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 272 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 273 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 274 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 276 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 277 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 278 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 279 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 280 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 281 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 282 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 283 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 285 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 286 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 288 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 289 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 290 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 291 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 292 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 293 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 294 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 295 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 296 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 297 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 298 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 299 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 300 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 301 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 302 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 303 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 304 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 305 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 306 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 307 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 308 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 309 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 310 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 311 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 312 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 313 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 314 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 315 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 316 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 317 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 318 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 319 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 320 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 321 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 322 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 323 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 324 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 325 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 326 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 327 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 328 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 329 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 330 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 331 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 373 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 374 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 375 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 376 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 377 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 379 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 380 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 381 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 382 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 383 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 384 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 385 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 386 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 387 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 388 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 389 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 390 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 391 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 392 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 393 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 394 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 395 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 396 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 397 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 398 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 399 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 400 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 401 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 402 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 403 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 404 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 405 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 406 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 407 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 408 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 409 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 410 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 411 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 412 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 413 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 414 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 415 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 416 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 417 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 418 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 419 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 420 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 421 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 422 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 423 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 424 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 425 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 426 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 427 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 428 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 429 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 430 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 431 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 432 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 433 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 434 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 435 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 436 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 437 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 438 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 439 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 440 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 441 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 442 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 443 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 444 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 445 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 446 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 447 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 448 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 449 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 450 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 451 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 452 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 453 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 454 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 455 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 456 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 457 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 458 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 459 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 460 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 461 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 462 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 463 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 464 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 465 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 466 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 467 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 468 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 469 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 541 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 542 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 543 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 544 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 545 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 546 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 547 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 548 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 549 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 550 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 551 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 552 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 553 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 554 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 555 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 556 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 557 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 558 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 559 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 560 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 561 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 562 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 563 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 564 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 565 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 566 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 567 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 568 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 569 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 570 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 571 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 572 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 573 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 574 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 575 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 576 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 577 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 578 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 579 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 580 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 581 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 582 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 583 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 584 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 585 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 586 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 587 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 588 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 589 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 590 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 591 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 592 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 593 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 594 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 595 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 596 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 597 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 598 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 599 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 600 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 601 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 602 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 603 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 604 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 605 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 606 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 607 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 608 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 609 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 610 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 611 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 612 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 613 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 614 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 615 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 616 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 617 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 618 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 619 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 620 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 621 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 622 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 623 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 624 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 625 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 626 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 627 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 628 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 629 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 630 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 631 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 632 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 633 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 634 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 635 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 636 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 637 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 638 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 639 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 640 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 641 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 642 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 643 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 644 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 645 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 646 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 647 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 648 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 649 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 650 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 651 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 652 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 653 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 654 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 655 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 656 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 657 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 658 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 659 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 660 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 661 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 662 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 663 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 664 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 665 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 666 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 667 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 668 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 669 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 670 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 671 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 672 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 673 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 674 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 675 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 676 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 677 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 678 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 679 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 680 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 681 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 682 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 683 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 684 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 685 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 686 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 687 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 688 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 689 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 690 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 691 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 692 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 693 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 694 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 695 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 696 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 697 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 698 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 699 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 700 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 701 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.32 |
| Metatranscriptomes | 0.07 |
| Isolates | 16.6 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.72 |
| Nodule | 13.58 |
| Rhizoplane | 4.9 |
| Rhizosphere | 57.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24744J21845_10003919 | 3300002077 | Unclassified | 3069 |
| 2 | JGI25406J46586_10000391 | 3300003203 | Bacteria | 20143 |
| 3 | JGI25406J46586_10005202 | 3300003203 | Bacteria | 6033 |
| 4 | JGI25153J46596_10007259 | 3300003215 | Bacteria | 5481 |
| 5 | JGI25153J46596_10013656 | 3300003215 | Bacteria | 3420 |
| 6 | JGI25153J46596_10015011 | 3300003215 | Bacteria | 3181 |
| 7 | JGI25160J50197_1003221 | 3300003354 | Bacteria | 7373 |
| 8 | JGI25404J52841_10004376 | 3300003659 | Bacteria | 2856 |
| 9 | JGI25404J52841_10005736 | 3300003659 | Bacteria | 2571 |
| 10 | Ga0055539_1010899 | 3300003752 | Bacteria | 1124 |
| 11 | Ga0055529_1007225 | 3300003763 | Bacteria | 1519 |
| 12 | Ga0055524_1031307 | 3300003775 | Bacteria | 1532 |
| 13 | Ga0055531_10006295 | 3300003794 | Bacteria | 6763 |
| 14 | JGI25405J52794_10017435 | 3300003911 | Unclassified | 1426 |
| 15 | Ga0055543_1004898 | 3300004625 | Bacteria | 3534 |
| 16 | Ga0065165_1000853 | 3300005262 | Bacteria | 39889 |
| 17 | Ga0065165_1005620 | 3300005262 | Bacteria | 6942 |
| 18 | Ga0065165_1012247 | 3300005262 | Bacteria | 3507 |
| 19 | Ga0065165_1016176 | 3300005262 | Bacteria | 2805 |
| 20 | Ga0065704_10128417 | 3300005289 | Bacteria | 1662 |
| 21 | Ga0070658_10061106 | 3300005327 | Bacteria | 3069 |
| 22 | Ga0070683_100045511 | 3300005329 | Bacteria | 4050 |
| 23 | Ga0070683_100660745 | 3300005329 | Bacteria | 1001 |
| 24 | Ga0070690_100035524 | 3300005330 | Bacteria | 3128 |
| 25 | Ga0070670_100092410 | 3300005331 | Bacteria | 2602 |
| 26 | Ga0070670_100578246 | 3300005331 | Bacteria | 1004 |
| 27 | Ga0068869_100380863 | 3300005334 | Bacteria | 1156 |
| 28 | Ga0070680_100156869 | 3300005336 | Bacteria | 1912 |
| 29 | Ga0070680_100407405 | 3300005336 | Bacteria | 1159 |
| 30 | Ga0070680_100458882 | 3300005336 | Bacteria | 1088 |
| 31 | Ga0068868_100237116 | 3300005338 | Bacteria | 1532 |
| 32 | Ga0070660_100288931 | 3300005339 | Bacteria | 1343 |
| 33 | Ga0070689_100260611 | 3300005340 | Bacteria | 1433 |
| 34 | Ga0070691_10014629 | 3300005341 | Bacteria | 3601 |
| 35 | Ga0070691_10100882 | 3300005341 | Bacteria | 1433 |
| 36 | Ga0070661_100038481 | 3300005344 | Bacteria | 3482 |
| 37 | Ga0070668_100234762 | 3300005347 | Bacteria | 1517 |
| 38 | Ga0070668_100595673 | 3300005347 | Bacteria | 966 |
| 39 | Ga0070669_100136290 | 3300005353 | Bacteria | 1888 |
| 40 | Ga0070659_100306358 | 3300005366 | Bacteria | 1326 |
| 41 | Ga0070667_100392216 | 3300005367 | Bacteria | 1262 |
| 42 | Ga0070709_10001342 | 3300005434 | Bacteria | 13411 |
| 43 | Ga0070709_10003187 | 3300005434 | Bacteria | 8800 |
| 44 | Ga0070709_10009893 | 3300005434 | Bacteria | 5269 |
| 45 | Ga0070714_100000835 | 3300005435 | Bacteria | 21809 |
| 46 | Ga0070714_100057465 | 3300005435 | Bacteria | 3331 |
| 47 | Ga0070714_100085911 | 3300005435 | Bacteria | 2749 |
| 48 | Ga0070713_100001417 | 3300005436 | Bacteria | 15374 |
| 49 | Ga0070713_100039204 | 3300005436 | Bacteria | 3843 |
| 50 | Ga0070713_100101671 | 3300005436 | Bacteria | 2491 |
| 51 | Ga0070713_100229081 | 3300005436 | Bacteria | 1688 |
| 52 | Ga0070710_10003269 | 3300005437 | Bacteria | 7684 |
| 53 | Ga0070710_10037034 | 3300005437 | Bacteria | 2671 |
| 54 | Ga0070711_100014424 | 3300005439 | Bacteria | 4980 |
| 55 | Ga0070711_100016093 | 3300005439 | Bacteria | 4744 |
| 56 | Ga0070711_100032926 | 3300005439 | Bacteria | 3449 |
| 57 | Ga0070711_100165385 | 3300005439 | Bacteria | 1681 |
| 58 | Ga0070711_100177074 | 3300005439 | Bacteria | 1630 |
| 59 | Ga0070700_100110292 | 3300005441 | Bacteria | 1828 |
| 60 | Ga0070694_100325749 | 3300005444 | Bacteria | 1184 |
| 61 | Ga0070708_100212960 | 3300005445 | Bacteria | 1811 |
| 62 | Ga0070663_100014922 | 3300005455 | Bacteria | 4998 |
| 63 | Ga0070663_100039003 | 3300005455 | Bacteria | 3317 |
| 64 | Ga0070663_100085015 | 3300005455 | Bacteria | 2333 |
| 65 | Ga0070663_100118823 | 3300005455 | Bacteria | 1994 |
| 66 | Ga0070663_100256517 | 3300005455 | Bacteria | 1386 |
| 67 | Ga0070678_100019205 | 3300005456 | Bacteria | 4450 |
| 68 | Ga0070678_100027449 | 3300005456 | Bacteria | 3865 |
| 69 | Ga0070681_10093437 | 3300005458 | Bacteria | 2956 |
| 70 | Ga0070681_10227941 | 3300005458 | Bacteria | 1778 |
| 71 | Ga0070698_100215997 | 3300005471 | Bacteria | 1852 |
| 72 | Ga0070698_100275392 | 3300005471 | Bacteria | 1614 |
| 73 | Ga0070698_100572178 | 3300005471 | Bacteria | 1069 |
| 74 | Ga0070679_100076306 | 3300005530 | Bacteria | 3341 |
| 75 | Ga0070679_100146885 | 3300005530 | Bacteria | 2335 |
| 76 | Ga0070679_100621503 | 3300005530 | Bacteria | 1023 |
| 77 | Ga0070684_100045561 | 3300005535 | Bacteria | 3797 |
| 78 | Ga0070684_100076539 | 3300005535 | Bacteria | 2953 |
| 79 | Ga0070684_100309590 | 3300005535 | Bacteria | 1450 |
| 80 | Ga0070697_100349224 | 3300005536 | Bacteria | 1277 |
| 81 | Ga0068853_100004923 | 3300005539 | Bacteria | 10398 |
| 82 | Ga0068853_100111138 | 3300005539 | Bacteria | 2434 |
| 83 | Ga0068853_100186638 | 3300005539 | Bacteria | 1882 |
| 84 | Ga0068853_100412430 | 3300005539 | Bacteria | 1266 |
| 85 | Ga0068853_100600809 | 3300005539 | Bacteria | 1045 |
| 86 | Ga0070672_100024545 | 3300005543 | Bacteria | 4458 |
| 87 | Ga0070665_100036968 | 3300005548 | Bacteria | 4910 |
| 88 | Ga0070665_100152285 | 3300005548 | Bacteria | 2315 |
| 89 | Ga0070665_100269149 | 3300005548 | Bacteria | 1705 |
| 90 | Ga0070665_100344807 | 3300005548 | Bacteria | 1494 |
| 91 | Ga0068855_100007753 | 3300005563 | Bacteria | 12964 |
| 92 | Ga0068855_100050346 | 3300005563 | Bacteria | 4909 |
| 93 | Ga0068855_100246139 | 3300005563 | Bacteria | 1995 |
| 94 | Ga0068855_100329202 | 3300005563 | Bacteria | 1686 |
| 95 | Ga0068855_100725545 | 3300005563 | Bacteria | 1062 |
| 96 | Ga0070664_100156737 | 3300005564 | Bacteria | 2012 |
| 97 | Ga0068857_100365703 | 3300005577 | Bacteria | 1338 |
| 98 | Ga0068857_100412760 | 3300005577 | Bacteria | 1258 |
| 99 | Ga0068854_100229165 | 3300005578 | Bacteria | 1474 |
| 100 | Ga0068856_100014918 | 3300005614 | Bacteria | 7501 |
| 101 | Ga0068852_100006728 | 3300005616 | Bacteria | 8339 |
| 102 | Ga0068852_100029496 | 3300005616 | Bacteria | 4508 |
| 103 | Ga0068852_100034169 | 3300005616 | Bacteria | 4229 |
| 104 | Ga0068859_100100285 | 3300005617 | Bacteria | 2951 |
| 105 | Ga0068864_100110930 | 3300005618 | Bacteria | 2443 |
| 106 | Ga0068866_10016845 | 3300005718 | Bacteria | 3275 |
| 107 | Ga0068866_10176473 | 3300005718 | Bacteria | 1258 |
| 108 | Ga0068861_100018069 | 3300005719 | Bacteria | 5015 |
| 109 | Ga0068861_100192999 | 3300005719 | Bacteria | 1704 |
| 110 | Ga0068861_100769040 | 3300005719 | Bacteria | 901 |
| 111 | Ga0068851_10076308 | 3300005834 | Bacteria | 1743 |
| 112 | Ga0068870_10085467 | 3300005840 | Bacteria | 1753 |
| 113 | Ga0068858_100469503 | 3300005842 | Bacteria | 1214 |
| 114 | Ga0068858_100597355 | 3300005842 | Bacteria | 1070 |
| 115 | Ga0068860_100005382 | 3300005843 | Bacteria | 12990 |
| 116 | Ga0068860_100107636 | 3300005843 | Bacteria | 2664 |
| 117 | Ga0068860_100159341 | 3300005843 | Bacteria | 2175 |
| 118 | Ga0068862_100026953 | 3300005844 | Bacteria | 4833 |
| 119 | Ga0068862_100100545 | 3300005844 | Bacteria | 2529 |
| 120 | Ga0068862_100444164 | 3300005844 | Bacteria | 1221 |
| 121 | Ga0081455_10000014 | 3300005937 | Bacteria | 193884 |
| 122 | Ga0081455_10000369 | 3300005937 | Bacteria | 59441 |
| 123 | Ga0081455_10010826 | 3300005937 | Bacteria | 9211 |
| 124 | Ga0081455_10034101 | 3300005937 | Bacteria | 4565 |
| 125 | Ga0081455_10037309 | 3300005937 | Bacteria | 4318 |
| 126 | Ga0081540_1004021 | 3300005983 | Bacteria | 11387 |
| 127 | Ga0081540_1004329 | 3300005983 | Bacteria | 10873 |
| 128 | Ga0081540_1008008 | 3300005983 | Bacteria | 7437 |
| 129 | Ga0081540_1008727 | 3300005983 | Bacteria | 7054 |
| 130 | Ga0081540_1022414 | 3300005983 | Bacteria | 3730 |
| 131 | Ga0081540_1032815 | 3300005983 | Bacteria | 2828 |
| 132 | Ga0081540_1058131 | 3300005983 | Bacteria | 1865 |
| 133 | Ga0081540_1065069 | 3300005983 | Bacteria | 1717 |
| 134 | Ga0081540_1083771 | 3300005983 | Bacteria | 1425 |
| 135 | Ga0081540_1099877 | 3300005983 | Bacteria | 1252 |
| 136 | Ga0081539_10000220 | 3300005985 | Bacteria | 133834 |
| 137 | Ga0081539_10000325 | 3300005985 | Bacteria | 106431 |
| 138 | Ga0081539_10006739 | 3300005985 | Bacteria | 10792 |
| 139 | Ga0081539_10040159 | 3300005985 | Bacteria | 2750 |
| 140 | Ga0081539_10135549 | 3300005985 | Bacteria | 1203 |
| 141 | Ga0070717_10006335 | 3300006028 | Bacteria | 8700 |
| 142 | Ga0070717_10212075 | 3300006028 | Bacteria | 1700 |
| 143 | Ga0070717_10432250 | 3300006028 | Bacteria | 1185 |
| 144 | Ga0075365_10083535 | 3300006038 | Bacteria | 2166 |
| 145 | Ga0075363_100033836 | 3300006048 | Bacteria | 2665 |
| 146 | Ga0075363_100045543 | 3300006048 | Bacteria | 2326 |
| 147 | Ga0075363_100144990 | 3300006048 | Bacteria | 1338 |
| 148 | Ga0075364_10002466 | 3300006051 | Bacteria | 10364 |
| 149 | Ga0075364_10093466 | 3300006051 | Bacteria | 1997 |
| 150 | Ga0075432_10024821 | 3300006058 | Bacteria | 2056 |
| 151 | Ga0070715_10005010 | 3300006163 | Bacteria | 4388 |
| 152 | Ga0070715_10138035 | 3300006163 | Bacteria | 1181 |
| 153 | Ga0070716_100001256 | 3300006173 | Bacteria | 11154 |
| 154 | Ga0070712_100013561 | 3300006175 | Bacteria | 5211 |
| 155 | Ga0070712_100040184 | 3300006175 | Bacteria | 3205 |
| 156 | Ga0070712_100180633 | 3300006175 | Bacteria | 1644 |
| 157 | Ga0075362_10008875 | 3300006177 | Bacteria | 3865 |
| 158 | Ga0075367_10000878 | 3300006178 | Bacteria | 12058 |
| 159 | Ga0075369_10015615 | 3300006186 | Bacteria | 3051 |
| 160 | Ga0075369_10024483 | 3300006186 | Bacteria | 2501 |
| 161 | Ga0075369_10074848 | 3300006186 | Bacteria | 1494 |
| 162 | Ga0075366_10285782 | 3300006195 | Bacteria | 1008 |
| 163 | Ga0097621_100225723 | 3300006237 | Bacteria | 1634 |
| 164 | Ga0075370_10029868 | 3300006353 | Bacteria | 3038 |
| 165 | Ga0075370_10084550 | 3300006353 | Bacteria | 1826 |
| 166 | Ga0075428_100110072 | 3300006844 | Bacteria | 3001 |
| 167 | Ga0075428_100140341 | 3300006844 | Bacteria | 2627 |
| 168 | Ga0075430_100277398 | 3300006846 | Bacteria | 1387 |
| 169 | Ga0075430_100300599 | 3300006846 | Bacteria | 1327 |
| 170 | Ga0075431_100108804 | 3300006847 | Bacteria | 2860 |
| 171 | Ga0075431_100395566 | 3300006847 | Bacteria | 1384 |
| 172 | Ga0075433_10011738 | 3300006852 | Bacteria | 7054 |
| 173 | Ga0075433_10339818 | 3300006852 | Bacteria | 1327 |
| 174 | Ga0075433_10627769 | 3300006852 | Bacteria | 942 |
| 175 | Ga0075434_100006402 | 3300006871 | Bacteria | 10789 |
| 176 | Ga0075434_100110443 | 3300006871 | Bacteria | 2760 |
| 177 | Ga0075434_100414574 | 3300006871 | Bacteria | 1368 |
| 178 | Ga0068865_100286329 | 3300006881 | Bacteria | 1314 |
| 179 | Ga0097620_100100281 | 3300006931 | Bacteria | 2951 |
| 180 | Ga0099825_1027434 | 3300006941 | Bacteria | 2894 |
| 181 | Ga0099824_1004802 | 3300006942 | Bacteria | 19329 |
| 182 | Ga0099822_1020900 | 3300006943 | Bacteria | 6418 |
| 183 | Ga0099823_1036094 | 3300006944 | Bacteria | 3818 |
| 184 | Ga0075435_100013816 | 3300007076 | Bacteria | 6019 |
| 185 | Ga0075435_100043817 | 3300007076 | Bacteria | 3583 |
| 186 | Ga0099794_10049565 | 3300007265 | Bacteria | 2018 |
| 187 | Ga0099795_10048119 | 3300007788 | Bacteria | 1543 |
| 188 | Ga0099795_10111071 | 3300007788 | Bacteria | 1086 |
| 189 | Ga0105240_10125198 | 3300009093 | Bacteria | 3089 |
| 190 | Ga0105240_10137254 | 3300009093 | Bacteria | 2928 |
| 191 | Ga0105240_10297915 | 3300009093 | Bacteria | 1846 |
| 192 | Ga0105240_10348521 | 3300009093 | Bacteria | 1680 |
| 193 | Ga0105240_10620993 | 3300009093 | Bacteria | 1188 |
| 194 | Ga0111539_10003490 | 3300009094 | Bacteria | 20728 |
| 195 | Ga0111539_10009581 | 3300009094 | Bacteria | 12223 |
| 196 | Ga0111539_10013311 | 3300009094 | Bacteria | 10280 |
| 197 | Ga0111539_10227122 | 3300009094 | Bacteria | 2174 |
| 198 | Ga0111539_10447984 | 3300009094 | Bacteria | 1503 |
| 199 | Ga0105245_10073655 | 3300009098 | Bacteria | 3106 |
| 200 | Ga0105245_10358013 | 3300009098 | Bacteria | 1448 |
| 201 | Ga0105247_10025114 | 3300009101 | Bacteria | 3595 |
| 202 | Ga0105247_10035537 | 3300009101 | Bacteria | 3038 |
| 203 | Ga0105247_10378481 | 3300009101 | Bacteria | 1003 |
| 204 | Ga0114129_10074974 | 3300009147 | Bacteria | 4711 |
| 205 | Ga0114129_10082645 | 3300009147 | Bacteria | 4462 |
| 206 | Ga0114129_10101542 | 3300009147 | Bacteria | 3979 |
| 207 | Ga0114129_10285905 | 3300009147 | Bacteria | 2202 |
| 208 | Ga0105243_10144550 | 3300009148 | Bacteria | 2033 |
| 209 | Ga0105241_10048140 | 3300009174 | Bacteria | 3243 |
| 210 | Ga0105242_10268488 | 3300009176 | Bacteria | 1544 |
| 211 | Ga0105248_10061008 | 3300009177 | Bacteria | 4233 |
| 212 | Ga0105248_10812927 | 3300009177 | Bacteria | 1055 |
| 213 | Ga0105237_10014975 | 3300009545 | Bacteria | 8083 |
| 214 | Ga0105237_10069166 | 3300009545 | Bacteria | 3526 |
| 215 | Ga0105237_10130594 | 3300009545 | Bacteria | 2506 |
| 216 | Ga0105237_10135379 | 3300009545 | Bacteria | 2458 |
| 217 | Ga0105237_10201180 | 3300009545 | Bacteria | 1992 |
| 218 | Ga0105237_10449027 | 3300009545 | Bacteria | 1295 |
| 219 | Ga0105237_10758528 | 3300009545 | Bacteria | 977 |
| 220 | Ga0105238_10028458 | 3300009551 | Bacteria | 5693 |
| 221 | Ga0105238_10328097 | 3300009551 | Bacteria | 1517 |
| 222 | Ga0105249_10044779 | 3300009553 | Bacteria | 4024 |
| 223 | Ga0105249_10566284 | 3300009553 | Bacteria | 1188 |
| 224 | Ga0099796_10057120 | 3300010159 | Bacteria | 1372 |
| 225 | Ga0099796_10111847 | 3300010159 | Bacteria | 1040 |
| 226 | Ga0105239_10096516 | 3300010375 | Bacteria | 3266 |
| 227 | Ga0105239_10101856 | 3300010375 | Bacteria | 3177 |
| 228 | Ga0105239_10121472 | 3300010375 | Bacteria | 2901 |
| 229 | Ga0105239_10262961 | 3300010375 | Bacteria | 1939 |
| 230 | Ga0105246_10020487 | 3300011119 | Bacteria | 4241 |
| 231 | Ga0105246_10034865 | 3300011119 | Bacteria | 3358 |
| 232 | Ga0105246_10329520 | 3300011119 | Bacteria | 1244 |
| 233 | Ga0157320_1002965 | 3300012481 | Bacteria | 999 |
| 234 | Ga0157373_10036645 | 3300013100 | Bacteria | 3519 |
| 235 | Ga0157370_10117592 | 3300013104 | Bacteria | 2483 |
| 236 | Ga0157370_10203581 | 3300013104 | Bacteria | 1836 |
| 237 | Ga0157370_10256451 | 3300013104 | Bacteria | 1617 |
| 238 | Ga0157370_10735882 | 3300013104 | Bacteria | 899 |
| 239 | Ga0157369_10090974 | 3300013105 | Bacteria | 3258 |
| 240 | Ga0157374_10140035 | 3300013296 | Bacteria | 2348 |
| 241 | Ga0157374_10149247 | 3300013296 | Bacteria | 2272 |
| 242 | Ga0157374_10154517 | 3300013296 | Bacteria | 2232 |
| 243 | Ga0157374_10189497 | 3300013296 | Bacteria | 2011 |
| 244 | Ga0157374_10331150 | 3300013296 | Bacteria | 1510 |
| 245 | Ga0157378_10103216 | 3300013297 | Bacteria | 2605 |
| 246 | Ga0157378_10490949 | 3300013297 | Bacteria | 1225 |
| 247 | Ga0163162_10035253 | 3300013306 | Bacteria | 4982 |
| 248 | Ga0157372_10234507 | 3300013307 | Bacteria | 2128 |
| 249 | Ga0157372_10399832 | 3300013307 | Bacteria | 1601 |
| 250 | Ga0157375_10026770 | 3300013308 | Bacteria | 5381 |
| 251 | Ga0163163_10030777 | 3300014325 | Bacteria | 5175 |
| 252 | Ga0163163_10112738 | 3300014325 | Bacteria | 2749 |
| 253 | Ga0157380_10088615 | 3300014326 | Bacteria | 2547 |
| 254 | Ga0157376_10004024 | 3300014969 | Bacteria | 10170 |
| 255 | Ga0157376_10258921 | 3300014969 | Bacteria | 1629 |
| 256 | Ga0163161_10016765 | 3300017792 | Bacteria | 5120 |
| 257 | Ga0214544_1000001 | 3300021320 | Bacteria | 783667 |
| 258 | Ga0214542_1000037 | 3300021321 | Bacteria | 159256 |
| 259 | Ga0214542_1024295 | 3300021321 | Bacteria | 3419 |
| 260 | Ga0214545_1000003 | 3300021324 | Bacteria | 720274 |
| 261 | Ga0214545_1019845 | 3300021324 | Bacteria | 5605 |
| 262 | Ga0214543_1000002 | 3300021327 | Bacteria | 712733 |
| 263 | Ga0214543_1019910 | 3300021327 | Bacteria | 5605 |
| 264 | Ga0213873_10013840 | 3300021358 | Bacteria | 1777 |
| 265 | Ga0213876_10002392 | 3300021384 | Bacteria | 11043 |
| 266 | Ga0213876_10014129 | 3300021384 | Bacteria | 4235 |
| 267 | Ga0224712_10125695 | 3300022467 | Bacteria | 1115 |
| 268 | Ga0209677_100738 | 3300025253 | Bacteria | 16622 |
| 269 | Ga0209677_108755 | 3300025253 | Bacteria | 1909 |
| 270 | Ga0209148_1000462 | 3300025254 | Bacteria | 43711 |
| 271 | Ga0209148_1005612 | 3300025254 | Bacteria | 2848 |
| 272 | Ga0209233_1001426 | 3300025261 | Bacteria | 9430 |
| 273 | Ga0209233_1010624 | 3300025261 | Bacteria | 2747 |
| 274 | Ga0209233_1011343 | 3300025261 | Bacteria | 2629 |
| 275 | Ga0209455_1000870 | 3300025272 | Bacteria | 16003 |
| 276 | Ga0209455_1004780 | 3300025272 | Bacteria | 4341 |
| 277 | Ga0209673_1038407 | 3300025273 | Bacteria | 1394 |
| 278 | Ga0209675_1018221 | 3300025291 | Bacteria | 1972 |
| 279 | Ga0209676_1005128 | 3300025292 | Bacteria | 6976 |
| 280 | Ga0209025_1028128 | 3300025294 | Bacteria | 2766 |
| 281 | Ga0209564_1000468 | 3300025295 | Bacteria | 67696 |
| 282 | Ga0209564_1006054 | 3300025295 | Bacteria | 6664 |
| 283 | Ga0209564_1008088 | 3300025295 | Bacteria | 5264 |
| 284 | Ga0209564_1028155 | 3300025295 | Bacteria | 1805 |
| 285 | Ga0209758_1000011 | 3300025297 | Bacteria | 1049685 |
| 286 | Ga0209758_1001760 | 3300025297 | Bacteria | 24019 |
| 287 | Ga0209758_1002930 | 3300025297 | Bacteria | 16429 |
| 288 | Ga0209758_1003253 | 3300025297 | Bacteria | 15067 |
| 289 | Ga0209758_1004985 | 3300025297 | Bacteria | 10609 |
| 290 | Ga0209758_1018571 | 3300025297 | Bacteria | 3399 |
| 291 | Ga0209758_1025749 | 3300025297 | Bacteria | 2570 |
| 292 | Ga0209758_1030236 | 3300025297 | Bacteria | 2247 |
| 293 | Ga0209256_1011489 | 3300025299 | Bacteria | 3532 |
| 294 | Ga0207426_1000270 | 3300025302 | Bacteria | 108404 |
| 295 | Ga0207426_1000292 | 3300025302 | Bacteria | 99342 |
| 296 | Ga0207426_1005288 | 3300025302 | Bacteria | 5943 |
| 297 | Ga0207426_1016172 | 3300025302 | Bacteria | 2687 |
| 298 | Ga0209051_1042029 | 3300025303 | Bacteria | 1619 |
| 299 | Ga0209257_1000654 | 3300025304 | Bacteria | 54783 |
| 300 | Ga0207697_10142617 | 3300025315 | Bacteria | 1040 |
| 301 | Ga0207656_10025546 | 3300025321 | Bacteria | 2399 |
| 302 | Ga0207656_10033874 | 3300025321 | Bacteria | 2130 |
| 303 | Ga0207692_10111208 | 3300025898 | Unclassified | 1520 |
| 304 | Ga0207692_10127390 | 3300025898 | Bacteria | 1434 |
| 305 | Ga0207642_10016713 | 3300025899 | Bacteria | 2772 |
| 306 | Ga0207647_10008237 | 3300025904 | Bacteria | 7491 |
| 307 | Ga0207685_10001301 | 3300025905 | Bacteria | 5126 |
| 308 | Ga0207685_10146372 | 3300025905 | Bacteria | 1064 |
| 309 | Ga0207699_10000605 | 3300025906 | Bacteria | 17554 |
| 310 | Ga0207645_10144098 | 3300025907 | Bacteria | 1553 |
| 311 | Ga0207643_10060820 | 3300025908 | Bacteria | 2157 |
| 312 | Ga0207705_10144574 | 3300025909 | Bacteria | 1778 |
| 313 | Ga0207705_10388082 | 3300025909 | Bacteria | 1079 |
| 314 | Ga0207684_10024711 | 3300025910 | Bacteria | 5123 |
| 315 | Ga0207684_10072538 | 3300025910 | Bacteria | 2924 |
| 316 | Ga0207654_10026874 | 3300025911 | Bacteria | 3122 |
| 317 | Ga0207654_10108455 | 3300025911 | Bacteria | 1723 |
| 318 | Ga0207654_10251844 | 3300025911 | Bacteria | 1184 |
| 319 | Ga0207654_10252555 | 3300025911 | Bacteria | 1183 |
| 320 | Ga0207707_10002844 | 3300025912 | Bacteria | 15450 |
| 321 | Ga0207707_10074493 | 3300025912 | Bacteria | 2961 |
| 322 | Ga0207707_10097433 | 3300025912 | Bacteria | 2570 |
| 323 | Ga0207707_10201329 | 3300025912 | Bacteria | 1736 |
| 324 | Ga0207707_10379058 | 3300025912 | Bacteria | 1216 |
| 325 | Ga0207695_10000008 | 3300025913 | Bacteria | 1058268 |
| 326 | Ga0207695_10083217 | 3300025913 | Bacteria | 3233 |
| 327 | Ga0207695_10171179 | 3300025913 | Bacteria | 2097 |
| 328 | Ga0207695_10574822 | 3300025913 | Bacteria | 1008 |
| 329 | Ga0207671_10002106 | 3300025914 | Bacteria | 21714 |
| 330 | Ga0207671_10080342 | 3300025914 | Bacteria | 2444 |
| 331 | Ga0207671_10129525 | 3300025914 | Bacteria | 1936 |
| 332 | Ga0207671_10177288 | 3300025914 | Bacteria | 1657 |
| 333 | Ga0207671_10217102 | 3300025914 | Bacteria | 1497 |
| 334 | Ga0207693_10000085 | 3300025915 | Bacteria | 83879 |
| 335 | Ga0207693_10038986 | 3300025915 | Bacteria | 3740 |
| 336 | Ga0207693_10050596 | 3300025915 | Bacteria | 3262 |
| 337 | Ga0207693_10375159 | 3300025915 | Bacteria | 1113 |
| 338 | Ga0207663_10000228 | 3300025916 | Bacteria | 25084 |
| 339 | Ga0207663_10009791 | 3300025916 | Bacteria | 5074 |
| 340 | Ga0207663_10298760 | 3300025916 | Bacteria | 1202 |
| 341 | Ga0207660_10016204 | 3300025917 | Bacteria | 4931 |
| 342 | Ga0207660_10071357 | 3300025917 | Bacteria | 2527 |
| 343 | Ga0207660_10147962 | 3300025917 | Bacteria | 1802 |
| 344 | Ga0207660_10155323 | 3300025917 | Bacteria | 1761 |
| 345 | Ga0207660_10277392 | 3300025917 | Bacteria | 1329 |
| 346 | Ga0207657_10003303 | 3300025919 | Bacteria | 17242 |
| 347 | Ga0207657_10092304 | 3300025919 | Bacteria | 2524 |
| 348 | Ga0207657_10113268 | 3300025919 | Bacteria | 2238 |
| 349 | Ga0207657_10504955 | 3300025919 | Bacteria | 947 |
| 350 | Ga0207652_10019545 | 3300025921 | Bacteria | 5572 |
| 351 | Ga0207652_10084932 | 3300025921 | Bacteria | 2773 |
| 352 | Ga0207652_10112842 | 3300025921 | Bacteria | 2412 |
| 353 | Ga0207652_10124493 | 3300025921 | Bacteria | 2296 |
| 354 | Ga0207652_10141705 | 3300025921 | Bacteria | 2150 |
| 355 | Ga0207652_10558798 | 3300025921 | Bacteria | 1028 |
| 356 | Ga0207681_10229485 | 3300025923 | Bacteria | 1440 |
| 357 | Ga0207694_10034781 | 3300025924 | Bacteria | 3864 |
| 358 | Ga0207694_10069219 | 3300025924 | Bacteria | 2757 |
| 359 | Ga0207694_10239896 | 3300025924 | Bacteria | 1481 |
| 360 | Ga0207687_10142287 | 3300025927 | Bacteria | 1821 |
| 361 | Ga0207700_10032159 | 3300025928 | Bacteria | 3738 |
| 362 | Ga0207700_10039891 | 3300025928 | Bacteria | 3422 |
| 363 | Ga0207700_10077832 | 3300025928 | Bacteria | 2578 |
| 364 | Ga0207700_10100760 | 3300025928 | Bacteria | 2303 |
| 365 | Ga0207700_10156218 | 3300025928 | Bacteria | 1890 |
| 366 | Ga0207700_10212150 | 3300025928 | Bacteria | 1637 |
| 367 | Ga0207664_10038107 | 3300025929 | Bacteria | 3726 |
| 368 | Ga0207664_10046277 | 3300025929 | Bacteria | 3414 |
| 369 | Ga0207664_10774036 | 3300025929 | Bacteria | 863 |
| 370 | Ga0207690_10101306 | 3300025932 | Bacteria | 2057 |
| 371 | Ga0207706_10172113 | 3300025933 | Bacteria | 1903 |
| 372 | Ga0207686_10143902 | 3300025934 | Bacteria | 1651 |
| 373 | Ga0207686_10174492 | 3300025934 | Bacteria | 1519 |
| 374 | Ga0207669_10003695 | 3300025937 | Bacteria | 6653 |
| 375 | Ga0207704_10183035 | 3300025938 | Bacteria | 1516 |
| 376 | Ga0207665_10000066 | 3300025939 | Bacteria | 68434 |
| 377 | Ga0207665_10138150 | 3300025939 | Bacteria | 1735 |
| 378 | Ga0207665_10415338 | 3300025939 | Bacteria | 1027 |
| 379 | Ga0207665_10535148 | 3300025939 | Bacteria | 909 |
| 380 | Ga0207689_10022048 | 3300025942 | Bacteria | 5356 |
| 381 | Ga0207689_10427735 | 3300025942 | Bacteria | 1105 |
| 382 | Ga0207661_10004899 | 3300025944 | Bacteria | 9379 |
| 383 | Ga0207661_10052115 | 3300025944 | Bacteria | 3268 |
| 384 | Ga0207679_10065955 | 3300025945 | Bacteria | 2711 |
| 385 | Ga0207667_10011021 | 3300025949 | Bacteria | 10532 |
| 386 | Ga0207667_10036292 | 3300025949 | Bacteria | 5284 |
| 387 | Ga0207667_10062046 | 3300025949 | Bacteria | 3910 |
| 388 | Ga0207667_10278883 | 3300025949 | Bacteria | 1708 |
| 389 | Ga0207667_10371601 | 3300025949 | Bacteria | 1457 |
| 390 | Ga0207640_10043892 | 3300025981 | Bacteria | 2861 |
| 391 | Ga0207640_10431227 | 3300025981 | Bacteria | 1081 |
| 392 | Ga0207658_10300048 | 3300025986 | Bacteria | 1384 |
| 393 | Ga0207658_10410917 | 3300025986 | Bacteria | 1191 |
| 394 | Ga0207703_10073038 | 3300026035 | Bacteria | 2837 |
| 395 | Ga0207703_10144412 | 3300026035 | Bacteria | 2068 |
| 396 | Ga0207703_10433103 | 3300026035 | Bacteria | 1226 |
| 397 | Ga0207703_10454980 | 3300026035 | Bacteria | 1196 |
| 398 | Ga0207639_10012204 | 3300026041 | Bacteria | 5978 |
| 399 | Ga0207639_10136294 | 3300026041 | Bacteria | 2039 |
| 400 | Ga0207678_10006117 | 3300026067 | Bacteria | 10705 |
| 401 | Ga0207678_10108291 | 3300026067 | Bacteria | 2370 |
| 402 | Ga0207678_10199304 | 3300026067 | Bacteria | 1711 |
| 403 | Ga0207678_10304404 | 3300026067 | Bacteria | 1370 |
| 404 | Ga0207708_10017997 | 3300026075 | Bacteria | 5317 |
| 405 | Ga0207708_10327670 | 3300026075 | Bacteria | 1251 |
| 406 | Ga0207702_10009707 | 3300026078 | Bacteria | 8082 |
| 407 | Ga0207702_10117738 | 3300026078 | Bacteria | 2373 |
| 408 | Ga0207702_10243733 | 3300026078 | Bacteria | 1685 |
| 409 | Ga0207648_10010213 | 3300026089 | Bacteria | 8930 |
| 410 | Ga0207648_10320125 | 3300026089 | Bacteria | 1394 |
| 411 | Ga0207676_10132415 | 3300026095 | Bacteria | 2122 |
| 412 | Ga0207676_10306967 | 3300026095 | Bacteria | 1451 |
| 413 | Ga0207674_10015966 | 3300026116 | Bacteria | 8227 |
| 414 | Ga0207674_10142681 | 3300026116 | Bacteria | 2354 |
| 415 | Ga0207674_10283035 | 3300026116 | Bacteria | 1606 |
| 416 | Ga0207675_100030458 | 3300026118 | Bacteria | 5025 |
| 417 | Ga0207675_100177736 | 3300026118 | Bacteria | 2037 |
| 418 | Ga0207675_100709820 | 3300026118 | Bacteria | 1015 |
| 419 | Ga0207683_10010439 | 3300026121 | Bacteria | 7923 |
| 420 | Ga0207683_10089790 | 3300026121 | Bacteria | 2735 |
| 421 | Ga0207683_10112619 | 3300026121 | Bacteria | 2437 |
| 422 | Ga0207683_10320192 | 3300026121 | Bacteria | 1421 |
| 423 | Ga0207683_10740019 | 3300026121 | Bacteria | 912 |
| 424 | Ga0207698_10020158 | 3300026142 | Bacteria | 4584 |
| 425 | Ga0209389_1000001 | 3300027296 | Bacteria | 463799 |
| 426 | Ga0209389_1000014 | 3300027296 | Bacteria | 188621 |
| 427 | Ga0209589_1000011 | 3300027357 | Bacteria | 236981 |
| 428 | Ga0209589_1000020 | 3300027357 | Bacteria | 188617 |
| 429 | Ga0209489_100012 | 3300027361 | Bacteria | 236981 |
| 430 | Ga0209489_100060 | 3300027361 | Bacteria | 147091 |
| 431 | Ga0209489_108402 | 3300027361 | Bacteria | 14127 |
| 432 | Ga0209700_100007 | 3300027363 | Bacteria | 454608 |
| 433 | Ga0209700_100019 | 3300027363 | Bacteria | 236981 |
| 434 | Ga0209179_1018161 | 3300027512 | Bacteria | 1341 |
| 435 | Ga0209588_1001117 | 3300027671 | Bacteria | 6910 |
| 436 | Ga0207428_10042238 | 3300027907 | Bacteria | 3687 |
| 437 | Ga0207428_10043309 | 3300027907 | Bacteria | 3636 |
| 438 | Ga0268266_10007937 | 3300028379 | Bacteria | 9497 |
| 439 | Ga0268266_10010415 | 3300028379 | Bacteria | 8124 |
| 440 | Ga0268266_10036832 | 3300028379 | Bacteria | 4167 |
| 441 | Ga0268266_10072341 | 3300028379 | Bacteria | 2990 |
| 442 | Ga0268266_10119288 | 3300028379 | Bacteria | 2346 |
| 443 | Ga0268266_10411526 | 3300028379 | Bacteria | 1280 |
| 444 | Ga0268266_10578681 | 3300028379 | Bacteria | 1077 |
| 445 | Ga0268265_10108576 | 3300028380 | Bacteria | 2259 |
| 446 | Ga0268265_10250820 | 3300028380 | Bacteria | 1567 |
| 447 | Ga0268265_10771846 | 3300028380 | Bacteria | 934 |
| 448 | Ga0268264_10000030 | 3300028381 | Bacteria | 418542 |
| 449 | Ga0265326_10003741 | 3300028558 | Bacteria | 4962 |
| 450 | Ga0265319_1025011 | 3300028563 | Bacteria | 2141 |
| 451 | Ga0265334_10017207 | 3300028573 | Bacteria | 2989 |
| 452 | Ga0265334_10031321 | 3300028573 | Bacteria | 2126 |
| 453 | Ga0265323_10011856 | 3300028653 | Bacteria | 3506 |
| 454 | Ga0265336_10000251 | 3300028666 | Bacteria | 38092 |
| 455 | Ga0307517_10000386 | 3300028786 | Bacteria | 75442 |
| 456 | Ga0307515_10192193 | 3300028794 | Bacteria | 1947 |
| 457 | Ga0265338_10000582 | 3300028800 | Bacteria | 64301 |
| 458 | Ga0265324_10011006 | 3300029957 | Bacteria | 3463 |
| 459 | Ga0307511_10141592 | 3300030521 | Bacteria | 1411 |
| 460 | Ga0307511_10190129 | 3300030521 | Bacteria | 1086 |
| 461 | Ga0265330_10003655 | 3300031235 | Bacteria | 7995 |
| 462 | Ga0265332_10033252 | 3300031238 | Bacteria | 2245 |
| 463 | Ga0265328_10013263 | 3300031239 | Bacteria | 3267 |
| 464 | Ga0265325_10015708 | 3300031241 | Bacteria | 4250 |
| 465 | Ga0265340_10044318 | 3300031247 | Bacteria | 2176 |
| 466 | Ga0265339_10002586 | 3300031249 | Bacteria | 12910 |
| 467 | Ga0265339_10192092 | 3300031249 | Bacteria | 1012 |
| 468 | Ga0265316_10098547 | 3300031344 | Bacteria | 2224 |
| 469 | Ga0265316_10196275 | 3300031344 | Bacteria | 1498 |
| 470 | Ga0307513_10177891 | 3300031456 | Bacteria | 1995 |
| 471 | Ga0307509_10014321 | 3300031507 | Bacteria | 9329 |
| 472 | Ga0307509_10150890 | 3300031507 | Bacteria | 2239 |
| 473 | Ga0307509_10236451 | 3300031507 | Bacteria | 1624 |
| 474 | Ga0265313_10096495 | 3300031595 | Bacteria | 1318 |
| 475 | Ga0307508_10000015 | 3300031616 | Bacteria | 210182 |
| 476 | Ga0307508_10134754 | 3300031616 | Bacteria | 2073 |
| 477 | Ga0265314_10026866 | 3300031711 | Bacteria | 4319 |
| 478 | Ga0265314_10102592 | 3300031711 | Bacteria | 1835 |
| 479 | Ga0265342_10002383 | 3300031712 | Bacteria | 16284 |
| 480 | Ga0265342_10104031 | 3300031712 | Bacteria | 1614 |
| 481 | Ga0265342_10212757 | 3300031712 | Bacteria | 1045 |
| 482 | Ga0307516_10007160 | 3300031730 | Bacteria | 12878 |
| 483 | Ga0307516_10029862 | 3300031730 | Bacteria | 5507 |
| 484 | Ga0307516_10069384 | 3300031730 | Bacteria | 3390 |
| 485 | Ga0307415_100176890 | 3300032126 | Bacteria | 1670 |
| 486 | Ga0307415_100480536 | 3300032126 | Bacteria | 1081 |
| 487 | Ga0307507_10025778 | 3300033179 | Bacteria | 6361 |
| 488 | Ga0307510_10002829 | 3300033180 | Bacteria | 19919 |
| 489 | Ga0307510_10003237 | 3300033180 | Bacteria | 18930 |
| 490 | Ga0307510_10024965 | 3300033180 | Bacteria | 6901 |
| 491 | Ga0307510_10110295 | 3300033180 | Bacteria | 2497 |
| 492 | Ga0307510_10130587 | 3300033180 | Bacteria | 2187 |
| 493 | Ga0315911_1000002 | 3300033442 | Bacteria | 926833 |
| 494 | Ga0373958_0046442 | 3300034819 | Bacteria | 905 |
| 495 | Ga0373938_0014174 | 3300034957 | Bacteria | 1526 |
| 496 | Ga0373926_0057375 | 3300035083 | Bacteria | 1414 |
| 497 | Ga0373926_0072531 | 3300035083 | Bacteria | 1266 |
| 498 | Ga0373934_0076243 | 3300035086 | Bacteria | 1345 |
| 499 | Ga0373940_0004827 | 3300035088 | Bacteria | 2877 |
| 500 | Ga0373923_0020786 | 3300035111 | Bacteria | 2555 |
| 501 | Ga0373923_0057129 | 3300035111 | Bacteria | 1649 |
| 502 | Ga0373936_0002958 | 3300035113 | Bacteria | 6354 |
| 503 | Ga0373936_0011793 | 3300035113 | Bacteria | 3315 |
| 504 | Ga0373939_0031764 | 3300035114 | Bacteria | 1529 |
| 505 | Ga0373945_0008932 | 3300035116 | Bacteria | 3275 |
| 506 | Ga0373953_0100611 | 3300035117 | Bacteria | 1216 |
| 507 | Ga0373954_0000386 | 3300035118 | Bacteria | 16413 |
| 508 | Ga0373954_0056760 | 3300035118 | Bacteria | 1843 |
| 509 | Ga0373956_0000925 | 3300035119 | Bacteria | 12191 |
| 510 | Ga0373956_0017608 | 3300035119 | Bacteria | 3014 |
| 511 | Ga0373956_0024352 | 3300035119 | Bacteria | 2607 |
| 512 | Ga0373957_0000393 | 3300035120 | Bacteria | 11077 |
| 513 | Ga0373957_0014654 | 3300035120 | Bacteria | 2684 |
| 514 | Ga0373943_0001227 | 3300035170 | Bacteria | 11466 |
| 515 | Ga0373943_0093998 | 3300035170 | Bacteria | 1557 |
| 516 | Ga0373943_0125121 | 3300035170 | Bacteria | 1370 |
| 517 | Ga0373943_0254186 | 3300035170 | Bacteria | 988 |
| 518 | Ga0373946_0042723 | 3300035171 | Bacteria | 1865 |
| 519 | Ga0373946_0052240 | 3300035171 | Bacteria | 1713 |
| 520 | Ga0373955_0000286 | 3300035172 | Bacteria | 20971 |
| 521 | Ga0373955_0078074 | 3300035172 | Bacteria | 1865 |
| 522 | Ga0373955_0220554 | 3300035172 | Bacteria | 1132 |
| 523 | Ga0373955_0257773 | 3300035172 | Bacteria | 1046 |
| 524 | Ga0373942_0013102 | 3300035207 | Bacteria | 1989 |
| 525 | Ga0373961_0017050 | 3300035241 | Bacteria | 1878 |
| 526 | Ga0373962_0052088 | 3300035242 | Bacteria | 1182 |
| 527 | Ga0373924_0005755 | 3300035410 | Bacteria | 4405 |
| 528 | Ga0373924_0031724 | 3300035410 | Bacteria | 2126 |
| 529 | Ga0373931_0001094 | 3300035691 | Bacteria | 11497 |
| 530 | Ga0373931_0078187 | 3300035691 | Bacteria | 1820 |
| 531 | Ga0373935_0020771 | 3300035692 | Bacteria | 4015 |
| 532 | Ga0373935_0038824 | 3300035692 | Bacteria | 2982 |
| 533 | Ga0373935_0118261 | 3300035692 | Bacteria | 1767 |
| 534 | Ga0373927_0000674 | 3300035695 | Bacteria | 26028 |
| 535 | Ga0373927_0015921 | 3300035695 | Bacteria | 4962 |
| 536 | Ga0373927_0035148 | 3300035695 | Bacteria | 3259 |
| 537 | Ga0373927_0071305 | 3300035695 | Bacteria | 2249 |
| 538 | Ga0373927_0075233 | 3300035695 | Bacteria | 2186 |
| 539 | Ga0373927_0113202 | 3300035695 | Bacteria | 1768 |
| 540 | Ga0373927_0119071 | 3300035695 | Bacteria | 1723 |
| 541 | Ga0373927_0142055 | 3300035695 | Bacteria | 1570 |
| 542 | Ga0373933_0000525 | 3300035724 | Bacteria | 23898 |
| 543 | Ga0373933_0000952 | 3300035724 | Bacteria | 17650 |
| 544 | Ga0373947_0007856 | 3300035725 | Bacteria | 6160 |
| 545 | Ga0373947_0017156 | 3300035725 | Bacteria | 4163 |
| 546 | Ga0373947_0017819 | 3300035725 | Bacteria | 4086 |
| 547 | Ga0373947_0044567 | 3300035725 | Bacteria | 2652 |
| 548 | Ga0373947_0177458 | 3300035725 | Bacteria | 1385 |
| 549 | Ga0373937_0001493 | 3300036401 | Bacteria | 19622 |
| 550 | Ga0373937_0034649 | 3300036401 | Bacteria | 4592 |
| 551 | Ga0373937_0276384 | 3300036401 | Bacteria | 1586 |
| 552 | Ga0373937_0663941 | 3300036401 | Bacteria | 988 |
| 553 | Ga0373925_0006535 | 3300037068 | Bacteria | 8573 |
| 554 | Ga0373925_0059832 | 3300037068 | Bacteria | 2858 |
| 555 | Ga0373925_0444934 | 3300037068 | Bacteria | 1061 |
| 556 | Ga0395899_0287739 | 3300037312 | Bacteria | 1116 |
| 557 | Ga0395899_0290610 | 3300037312 | Bacteria | 1109 |
| 558 | Ga0395900_0001070 | 3300037418 | Bacteria | 34841 |
| 559 | Ga0395900_0053426 | 3300037418 | Bacteria | 4158 |
| 560 | Ga0395900_0196098 | 3300037418 | Bacteria | 2046 |
| 561 | Ga0395900_0605898 | 3300037418 | Bacteria | 1035 |
| 562 | Ga0395898_0005530 | 3300037466 | Bacteria | 13635 |
| 563 | Ga0395898_0029984 | 3300037466 | Bacteria | 5446 |
| 564 | Ga0395905_0013406 | 3300037471 | Bacteria | 7855 |
| 565 | Ga0395905_0184583 | 3300037471 | Bacteria | 1958 |
| 566 | Ga0395905_0347702 | 3300037471 | Bacteria | 1374 |
| 567 | Ga0436364_0263012 | 3300037853 | Bacteria | 5170 |
| 568 | Ga0395901_0050417 | 3300038443 | Bacteria | 4325 |
| 569 | Ga0395901_0128609 | 3300038443 | Bacteria | 2662 |
| 570 | Ga0395901_0525841 | 3300038443 | Bacteria | 1201 |
| 571 | Ga0395901_0645637 | 3300038443 | Bacteria | 1062 |
| 572 | Ga0436365_1009821 | 3300039437 | Bacteria | 1517 |
| 573 | Ga0436365_1058602 | 3300039437 | Bacteria | 3264 |
| 574 | Ga0436365_1424648 | 3300039437 | Bacteria | 18159 |
| 575 | Ga0436365_1446446 | 3300039437 | Bacteria | 1640 |
| 576 | Ga0436365_1602790 | 3300039437 | Bacteria | 1104 |
| 577 | Ga0436360_0380976 | 3300039438 | Bacteria | 1273 |
| 578 | Ga0436361_0085886 | 3300039447 | Bacteria | 2409 |
| 579 | Ga0436361_0487707 | 3300039447 | Bacteria | 1737 |
| 580 | Ga0436361_0956174 | 3300039447 | Bacteria | 2928 |
| 581 | Ga0436361_0963296 | 3300039447 | Bacteria | 24549 |
| 582 | Ga0436363_0460428 | 3300039450 | Bacteria | 2137 |
| 583 | Ga0436363_0594913 | 3300039450 | Bacteria | 1321 |
| 584 | Ga0436363_1519808 | 3300039450 | Bacteria | 3166 |
| 585 | Ga0436362_0232091 | 3300039453 | Bacteria | 3945 |
| 586 | Ga0451797_1443236 | 3300041453 | Bacteria | 1184 |
| 587 | Ga0451847_0265692 | 3300041503 | Bacteria | 1075 |
| 588 | Ga0439432_080205 | 3300042006 | Bacteria | 989 |
| 589 | Ga0439458_0042818 | 3300042157 | Bacteria | 1103 |
| 590 | Ga0466972_0000113 | 3300044658 | Bacteria | 69042 |
| 591 | Ga0466972_0016844 | 3300044658 | Bacteria | 3656 |
| 592 | Ga0466966_0000094 | 3300044684 | Bacteria | 54427 |
| 593 | Ga0466961_0001116 | 3300044693 | Bacteria | 16499 |
| 594 | Ga0466963_0043082 | 3300044694 | Bacteria | 2966 |
| 595 | Ga0466963_0048209 | 3300044694 | Bacteria | 2814 |
| 596 | Ga0466971_0052717 | 3300044719 | Bacteria | 1832 |
| 597 | Ga0466968_0000932 | 3300044735 | Bacteria | 10305 |
| 598 | Ga0466968_0169503 | 3300044735 | Bacteria | 1011 |
| 599 | Ga0466957_0028968 | 3300044842 | Bacteria | 3299 |
| 600 | Ga0466960_0005727 | 3300044901 | Bacteria | 4940 |
| 601 | Ga0466959_0001069 | 3300045049 | Bacteria | 16399 |
| 602 | Ga0466959_0181674 | 3300045049 | Bacteria | 1471 |
| 603 | Ga0466959_0380267 | 3300045049 | Bacteria | 961 |
| 604 | Ga0466959_0384090 | 3300045049 | Bacteria | 955 |
| 605 | Ga0466967_0125214 | 3300045976 | Bacteria | 2379 |
| 606 | Ga0466967_0171324 | 3300045976 | Bacteria | 2043 |
| 607 | Ga0466967_0355512 | 3300045976 | Bacteria | 1418 |
| 608 | Ga0466967_0754349 | 3300045976 | Bacteria | 965 |
| 609 | Ga0495592_0001573 | 3300046454 | Bacteria | 15952 |
| 610 | Ga0495592_0019071 | 3300046454 | Bacteria | 5221 |
| 611 | Ga0495592_0094756 | 3300046454 | Bacteria | 2136 |
| 612 | Ga0495603_0000003 | 3300046455 | Bacteria | 83533 |
| 613 | Ga0495603_0039407 | 3300046455 | Bacteria | 2831 |
| 614 | Ga0495603_0092670 | 3300046455 | Bacteria | 1766 |
| 615 | Ga0495603_0209466 | 3300046455 | Bacteria | 1126 |
| 616 | Ga0495590_0055792 | 3300046457 | Bacteria | 1380 |
| 617 | Ga0495629_0000133 | 3300046459 | Bacteria | 64806 |
| 618 | Ga0495629_0008978 | 3300046459 | Bacteria | 7338 |
| 619 | Ga0495629_0048748 | 3300046459 | Bacteria | 2969 |
| 620 | Ga0495638_0012007 | 3300046460 | Bacteria | 5953 |
| 621 | Ga0495638_0059404 | 3300046460 | Bacteria | 2367 |
| 622 | Ga0495638_0081828 | 3300046460 | Bacteria | 1959 |
| 623 | Ga0495638_0176631 | 3300046460 | Bacteria | 1221 |
| 624 | Ga0495651_0001334 | 3300046462 | Bacteria | 19125 |
| 625 | Ga0495651_0005934 | 3300046462 | Bacteria | 9319 |
| 626 | Ga0495651_0033676 | 3300046462 | Bacteria | 3996 |
| 627 | Ga0495651_0089633 | 3300046462 | Bacteria | 2308 |
| 628 | Ga0495651_0104233 | 3300046462 | Bacteria | 2106 |
| 629 | Ga0495651_0294207 | 3300046462 | Bacteria | 1092 |
| 630 | Ga0495653_0001313 | 3300046463 | Bacteria | 19271 |
| 631 | Ga0495580_0001841 | 3300046472 | Bacteria | 18648 |
| 632 | Ga0495580_0072337 | 3300046472 | Bacteria | 2408 |
| 633 | Ga0495580_0073070 | 3300046472 | Bacteria | 2394 |
| 634 | Ga0495580_0249664 | 3300046472 | Bacteria | 1215 |
| 635 | Ga0495582_0000016 | 3300046473 | Bacteria | 100714 |
| 636 | Ga0495582_0057394 | 3300046473 | Bacteria | 2146 |
| 637 | Ga0495605_0144212 | 3300046474 | Bacteria | 1066 |
| 638 | Ga0495639_0000014 | 3300046475 | Bacteria | 82866 |
| 639 | Ga0495639_0024053 | 3300046475 | Bacteria | 2679 |
| 640 | Ga0495639_0191102 | 3300046475 | Bacteria | 1000 |
| 641 | Ga0495662_0064038 | 3300046476 | Bacteria | 1776 |
| 642 | Ga0495662_0248390 | 3300046476 | Bacteria | 876 |
| 643 | Ga0495664_0033576 | 3300046477 | Bacteria | 3015 |
| 644 | Ga0495664_0047199 | 3300046477 | Bacteria | 2555 |
| 645 | Ga0495664_0066500 | 3300046477 | Bacteria | 2150 |
| 646 | Ga0495585_0022317 | 3300046492 | Bacteria | 3633 |
| 647 | Ga0495585_0099114 | 3300046492 | Bacteria | 1560 |
| 648 | Ga0495585_0177949 | 3300046492 | Bacteria | 1095 |
| 649 | Ga0495594_0000051 | 3300046499 | Bacteria | 52030 |
| 650 | Ga0495594_0053859 | 3300046499 | Bacteria | 2217 |
| 651 | Ga0495594_0109366 | 3300046499 | Bacteria | 1558 |
| 652 | Ga0495596_0060216 | 3300046500 | Bacteria | 1479 |
| 653 | Ga0495583_0069229 | 3300046506 | Bacteria | 1555 |
| 654 | Ga0495583_0139981 | 3300046506 | Bacteria | 1008 |
| 655 | Ga0495606_0000196 | 3300046507 | Bacteria | 105765 |
| 656 | Ga0495608_0004038 | 3300046511 | Bacteria | 10534 |
| 657 | Ga0495608_0091336 | 3300046511 | Bacteria | 1969 |
| 658 | Ga0495610_0054123 | 3300046512 | Bacteria | 1940 |
| 659 | Ga0495616_0115270 | 3300046513 | Bacteria | 1245 |
| 660 | Ga0495616_0147570 | 3300046513 | Bacteria | 1066 |
| 661 | Ga0495618_0090977 | 3300046514 | Bacteria | 1950 |
| 662 | Ga0495618_0198417 | 3300046514 | Bacteria | 1270 |
| 663 | Ga0495620_0053851 | 3300046515 | Bacteria | 1702 |
| 664 | Ga0495628_0006135 | 3300046516 | Bacteria | 10513 |
| 665 | Ga0495628_0097639 | 3300046516 | Bacteria | 2269 |
| 666 | Ga0495630_0023371 | 3300046517 | Bacteria | 4570 |
| 667 | Ga0495630_0050601 | 3300046517 | Bacteria | 3109 |
| 668 | Ga0495630_0223644 | 3300046517 | Bacteria | 1437 |
| 669 | Ga0495630_0234467 | 3300046517 | Bacteria | 1402 |
| 670 | Ga0495632_0038355 | 3300046519 | Bacteria | 2426 |
| 671 | Ga0495632_0110939 | 3300046519 | Bacteria | 1288 |
| 672 | Ga0495643_0005620 | 3300046522 | Bacteria | 8416 |
| 673 | Ga0495644_0079259 | 3300046523 | Bacteria | 1237 |
| 674 | Ga0495648_0001270 | 3300046524 | Bacteria | 25160 |
| 675 | Ga0495648_0010219 | 3300046524 | Bacteria | 7169 |
| 676 | Ga0495666_0019511 | 3300046526 | Bacteria | 3363 |
| 677 | Ga0495666_0094409 | 3300046526 | Bacteria | 1411 |
| 678 | Ga0495666_0124020 | 3300046526 | Bacteria | 1209 |
| 679 | Ga0495652_0002471 | 3300046529 | Bacteria | 19000 |
| 680 | Ga0495652_0101565 | 3300046529 | Bacteria | 2331 |
| 681 | Ga0495652_0138526 | 3300046529 | Bacteria | 1916 |
| 682 | Ga0495665_0000477 | 3300046531 | Bacteria | 20160 |
| 683 | Ga0495640_0001817 | 3300046533 | Bacteria | 16924 |
| 684 | Ga0495640_0042158 | 3300046533 | Bacteria | 3186 |
| 685 | Ga0495640_0137894 | 3300046533 | Bacteria | 1574 |
| 686 | Ga0495586_0261762 | 3300046535 | Bacteria | 988 |
| 687 | Ga0495587_0000862 | 3300046536 | Bacteria | 20057 |
| 688 | Ga0495587_0146093 | 3300046536 | Bacteria | 1348 |
| 689 | Ga0495609_0087916 | 3300046538 | Bacteria | 1353 |
| 690 | Ga0495597_0024076 | 3300046542 | Bacteria | 2812 |
| 691 | Ga0495645_0010074 | 3300046543 | Bacteria | 6623 |
| 692 | Ga0495645_0013562 | 3300046543 | Bacteria | 5767 |
| 693 | Ga0495645_0037627 | 3300046543 | Bacteria | 3528 |
| 694 | Ga0495645_0060349 | 3300046543 | Bacteria | 2749 |
| 695 | Ga0495645_0095231 | 3300046543 | Bacteria | 2123 |
| 696 | Ga0495622_0006059 | 3300046557 | Bacteria | 5619 |
| 697 | Ga0495622_0009328 | 3300046557 | Bacteria | 4539 |
| 698 | Ga0495622_0040568 | 3300046557 | Bacteria | 2166 |
| 699 | Ga0495622_0155600 | 3300046557 | Bacteria | 1032 |
| 700 | Ga0495667_0000424 | 3300046559 | Bacteria | 27001 |
| 701 | Ga0495667_0050784 | 3300046559 | Bacteria | 2737 |
| 702 | Ga0495667_0200973 | 3300046559 | Bacteria | 1275 |
| 703 | Ga0495656_0004171 | 3300046615 | Bacteria | 4931 |
| 704 | Ga0495668_0030735 | 3300046616 | Bacteria | 3030 |
| 705 | Ga0495668_0038764 | 3300046616 | Bacteria | 2662 |
| 706 | Ga0495668_0151857 | 3300046616 | Bacteria | 1268 |
| 707 | Ga0495668_0176457 | 3300046616 | Bacteria | 1171 |
| 708 | Ga0495634_0000064 | 3300046642 | Bacteria | 85710 |
| 709 | Ga0495634_0092885 | 3300046642 | Bacteria | 1957 |
| 710 | Ga0495634_0149944 | 3300046642 | Bacteria | 1475 |
| 711 | Ga0495634_0157369 | 3300046642 | Bacteria | 1434 |
| 712 | Ga0495611_0056988 | 3300046648 | Bacteria | 1770 |
| 713 | Ga0495625_0064674 | 3300046660 | Bacteria | 2580 |
| 714 | Ga0495625_0078976 | 3300046660 | Bacteria | 2296 |
| 715 | Ga0495635_0000792 | 3300046663 | Bacteria | 20615 |
| 716 | Ga0495635_0004040 | 3300046663 | Bacteria | 10186 |
| 717 | Ga0495635_0043702 | 3300046663 | Bacteria | 3091 |
| 718 | Ga0495635_0369391 | 3300046663 | Bacteria | 955 |
| 719 | Ga0495661_0081560 | 3300046665 | Bacteria | 1864 |
| 720 | Ga0495661_0110791 | 3300046665 | Bacteria | 1530 |
| 721 | Ga0495588_0004419 | 3300046674 | Bacteria | 6214 |
| 722 | Ga0495588_0032949 | 3300046674 | Bacteria | 2614 |
| 723 | Ga0495588_0068276 | 3300046674 | Bacteria | 1846 |
| 724 | Ga0495657_0001449 | 3300046675 | Bacteria | 20519 |
| 725 | Ga0495657_0005063 | 3300046675 | Bacteria | 10473 |
| 726 | Ga0495657_0019734 | 3300046675 | Bacteria | 4859 |
| 727 | Ga0495599_0000879 | 3300046678 | Bacteria | 16765 |
| 728 | Ga0495599_0005399 | 3300046678 | Bacteria | 7636 |
| 729 | Ga0495599_0021677 | 3300046678 | Bacteria | 4009 |
| 730 | Ga0495599_0091379 | 3300046678 | Bacteria | 1899 |
| 731 | Ga0495623_0003211 | 3300046679 | Bacteria | 10790 |
| 732 | Ga0495623_0010714 | 3300046679 | Bacteria | 5937 |
| 733 | Ga0495623_0102854 | 3300046679 | Bacteria | 1739 |
| 734 | Ga0495623_0114482 | 3300046679 | Bacteria | 1630 |
| 735 | Ga0495623_0168901 | 3300046679 | Bacteria | 1279 |
| 736 | Ga0495623_0190517 | 3300046679 | Bacteria | 1185 |
| 737 | Ga0495646_0002245 | 3300046680 | Bacteria | 11802 |
| 738 | Ga0495646_0044303 | 3300046680 | Bacteria | 2721 |
| 739 | Ga0495646_0058827 | 3300046680 | Bacteria | 2297 |
| 740 | Ga0495658_0005113 | 3300046683 | Bacteria | 6447 |
| 741 | Ga0495658_0136993 | 3300046683 | Bacteria | 1494 |
| 742 | Ga0495658_0196172 | 3300046683 | Bacteria | 1257 |
| 743 | Ga0495669_0005740 | 3300046684 | Bacteria | 5176 |
| 744 | Ga0495613_0016887 | 3300046689 | Bacteria | 5435 |
| 745 | Ga0495613_0034122 | 3300046689 | Bacteria | 3780 |
| 746 | Ga0495613_0057842 | 3300046689 | Bacteria | 2847 |
| 747 | Ga0495613_0194052 | 3300046689 | Bacteria | 1434 |
| 748 | Ga0495613_0243446 | 3300046689 | Bacteria | 1257 |
| 749 | Ga0495624_0000505 | 3300046690 | Bacteria | 30571 |
| 750 | Ga0495624_0082485 | 3300046690 | Bacteria | 1989 |
| 751 | Ga0495649_0034616 | 3300046694 | Bacteria | 2779 |
| 752 | Ga0495649_0215346 | 3300046694 | Bacteria | 994 |
| 753 | Ga0495600_0000337 | 3300046809 | Bacteria | 25017 |
| 754 | Ga0495600_0034115 | 3300046809 | Bacteria | 3304 |
| 755 | Ga0495600_0077880 | 3300046809 | Bacteria | 2165 |
| 756 | Ga0495600_0090278 | 3300046809 | Bacteria | 1998 |
| 757 | Ga0495600_0115809 | 3300046809 | Bacteria | 1744 |
| 758 | Ga0495660_0110928 | 3300046810 | Bacteria | 1400 |
| 759 | Ga0495581_0000001 | 3300047315 | Bacteria | 104278 |
| 760 | Ga0495604_0001626 | 3300047317 | Bacteria | 18533 |
| 761 | Ga0495604_0012158 | 3300047317 | Bacteria | 6843 |
| 762 | Ga0495604_0122700 | 3300047317 | Bacteria | 1878 |
| 763 | Ga0495604_0137754 | 3300047317 | Bacteria | 1747 |
| 764 | Ga0495604_0258591 | 3300047317 | Bacteria | 1184 |
| 765 | Ga0495636_0109567 | 3300047318 | Bacteria | 1214 |
| 766 | Ga0495674_0004772 | 3300047319 | Bacteria | 13038 |
| 767 | Ga0495674_0042623 | 3300047319 | Bacteria | 4047 |
| 768 | Ga0495674_0067171 | 3300047319 | Bacteria | 3107 |
| 769 | Ga0495674_0179196 | 3300047319 | Bacteria | 1765 |
| 770 | Ga0495674_0198232 | 3300047319 | Bacteria | 1666 |
| 771 | Ga0495672_0026120 | 3300047320 | Bacteria | 3729 |
| 772 | Ga0495672_0049694 | 3300047320 | Bacteria | 2481 |
| 773 | Ga0495676_0412234 | 3300047321 | Bacteria | 895 |
| 774 | Ga0495680_0002491 | 3300047322 | Bacteria | 18828 |
| 775 | Ga0495680_0003717 | 3300047322 | Bacteria | 14884 |
| 776 | Ga0495680_0195468 | 3300047322 | Bacteria | 1453 |
| 777 | Ga0495680_0204651 | 3300047322 | Bacteria | 1415 |
| 778 | Ga0495680_0225576 | 3300047322 | Bacteria | 1336 |
| 779 | Ga0495675_0000559 | 3300047444 | Bacteria | 24018 |
| 780 | Ga0495675_0056331 | 3300047444 | Bacteria | 2492 |
| 781 | Ga0495675_0064556 | 3300047444 | Bacteria | 2316 |
| 782 | Ga0495677_0048996 | 3300047445 | Bacteria | 1552 |
| 783 | Ga0495684_0002496 | 3300047471 | Bacteria | 14666 |
| 784 | Ga0495684_0122620 | 3300047471 | Bacteria | 1956 |
| 785 | Ga0495686_0152628 | 3300047472 | Bacteria | 1355 |
| 786 | Ga0495593_0000003 | 3300047673 | Bacteria | 120744 |
| 787 | Ga0495602_0007241 | 3300048088 | Bacteria | 11617 |
| 788 | Ga0495602_0016927 | 3300048088 | Bacteria | 7315 |
| 789 | Ga0495602_0347889 | 3300048088 | Bacteria | 1070 |
| 790 | Ga0496100_0042026 | 3300048903 | Bacteria | 2917 |
| 791 | Ga0496100_0278027 | 3300048903 | Bacteria | 1247 |
| 792 | Ga0496101_0008766 | 3300048904 | Bacteria | 6618 |
| 793 | Ga0496101_0087397 | 3300048904 | Bacteria | 2314 |
| 794 | Ga0496101_0280255 | 3300048904 | Bacteria | 1303 |
| 795 | Ga0496101_0295873 | 3300048904 | Bacteria | 1267 |
| 796 | Ga0496101_0307595 | 3300048904 | Bacteria | 1242 |
| 797 | Ga0496102_0007744 | 3300048905 | Bacteria | 9178 |
| 798 | Ga0496102_0033402 | 3300048905 | Bacteria | 4623 |
| 799 | Ga0496102_0089596 | 3300048905 | Bacteria | 2846 |
| 800 | Ga0496102_0174595 | 3300048905 | Bacteria | 2023 |
| 801 | Ga0496102_0562135 | 3300048905 | Bacteria | 1063 |
| 802 | Ga0496103_0015210 | 3300048906 | Bacteria | 4574 |
| 803 | Ga0496103_0067466 | 3300048906 | Bacteria | 2234 |
| 804 | Ga0496103_0286640 | 3300048906 | Bacteria | 1059 |
| 805 | Ga0496104_0000814 | 3300048907 | Bacteria | 26822 |
| 806 | Ga0496104_0133856 | 3300048907 | Bacteria | 2381 |
| 807 | Ga0496104_0138493 | 3300048907 | Bacteria | 2339 |
| 808 | Ga0496105_0028013 | 3300048908 | Bacteria | 4606 |
| 809 | Ga0496105_0042793 | 3300048908 | Bacteria | 3734 |
| 810 | Ga0496105_0180447 | 3300048908 | Bacteria | 1729 |
| 811 | Ga0496105_0202576 | 3300048908 | Bacteria | 1619 |
| 812 | Ga0496105_0462577 | 3300048908 | Bacteria | 1000 |
| 813 | Ga0496106_0001821 | 3300048909 | Bacteria | 15941 |
| 814 | Ga0496106_0006645 | 3300048909 | Bacteria | 8562 |
| 815 | Ga0496106_0028171 | 3300048909 | Bacteria | 4184 |
| 816 | Ga0496106_0089720 | 3300048909 | Bacteria | 2371 |
| 817 | Ga0496107_0014152 | 3300048910 | Bacteria | 5585 |
| 818 | Ga0496107_0305870 | 3300048910 | Bacteria | 1183 |
| 819 | Ga0496108_0026124 | 3300048911 | Bacteria | 4816 |
| 820 | Ga0496108_0029443 | 3300048911 | Bacteria | 4547 |
| 821 | Ga0496108_0062527 | 3300048911 | Bacteria | 3135 |
| 822 | Ga0496108_0121964 | 3300048911 | Bacteria | 2236 |
| 823 | Ga0496109_0092100 | 3300048912 | Bacteria | 2803 |
| 824 | Ga0496109_0101418 | 3300048912 | Bacteria | 2671 |
| 825 | Ga0496109_0141535 | 3300048912 | Bacteria | 2249 |
| 826 | Ga0496109_0766832 | 3300048912 | Bacteria | 902 |
| 827 | Ga0496110_0017878 | 3300048913 | Bacteria | 5935 |
| 828 | Ga0496110_0113103 | 3300048913 | Bacteria | 2441 |
| 829 | Ga0496110_0172008 | 3300048913 | Bacteria | 1965 |
| 830 | Ga0496111_0006299 | 3300048914 | Bacteria | 7696 |
| 831 | Ga0496111_0059392 | 3300048914 | Bacteria | 2771 |
| 832 | Ga0496111_0148946 | 3300048914 | Bacteria | 1735 |
| 833 | Ga0496111_0200343 | 3300048914 | Bacteria | 1484 |
| 834 | Ga0496112_0000056 | 3300048915 | Bacteria | 77708 |
| 835 | Ga0496112_0012397 | 3300048915 | Bacteria | 7835 |
| 836 | Ga0496112_0071779 | 3300048915 | Bacteria | 3422 |
| 837 | Ga0496112_0107010 | 3300048915 | Bacteria | 2766 |
| 838 | Ga0496112_0196985 | 3300048915 | Bacteria | 1975 |
| 839 | Ga0496112_0303095 | 3300048915 | Bacteria | 1543 |
| 840 | Ga0496112_0334774 | 3300048915 | Unclassified | 1457 |
| 841 | Ga0496113_0035177 | 3300048916 | Bacteria | 3662 |
| 842 | Ga0496113_0070355 | 3300048916 | Bacteria | 2659 |
| 843 | Ga0496113_0111452 | 3300048916 | Bacteria | 2130 |
| 844 | Ga0496114_0018625 | 3300048917 | Bacteria | 5616 |
| 845 | Ga0496114_0110500 | 3300048917 | Bacteria | 2355 |
| 846 | Ga0496114_0291075 | 3300048917 | Bacteria | 1441 |
| 847 | Ga0496115_0056755 | 3300048918 | Bacteria | 3147 |
| 848 | Ga0496115_0071469 | 3300048918 | Bacteria | 2814 |
| 849 | Ga0496115_0101085 | 3300048918 | Bacteria | 2364 |
| 850 | Ga0496115_0169715 | 3300048918 | Bacteria | 1804 |
| 851 | Ga0496115_0270088 | 3300048918 | Bacteria | 1397 |
| 852 | Ga0496115_0479874 | 3300048918 | Bacteria | 1001 |
| 853 | Ga0496116_0004380 | 3300048919 | Bacteria | 13500 |
| 854 | Ga0496116_0079738 | 3300048919 | Bacteria | 2036 |
| 855 | Ga0496116_0137327 | 3300048919 | Bacteria | 1382 |
| 856 | Ga0496116_0142709 | 3300048919 | Bacteria | 1344 |
| 857 | Ga0496116_0180711 | 3300048919 | Bacteria | 1130 |
| 858 | Ga0496117_0020299 | 3300048920 | Bacteria | 5420 |
| 859 | Ga0496117_0051785 | 3300048920 | Bacteria | 2899 |
| 860 | Ga0496117_0226139 | 3300048920 | Bacteria | 1037 |
| 861 | Ga0496117_0247505 | 3300048920 | Bacteria | 974 |
| 862 | Ga0496118_0014405 | 3300048921 | Bacteria | 7406 |
| 863 | Ga0496118_0028018 | 3300048921 | Bacteria | 4755 |
| 864 | Ga0496118_0076364 | 3300048921 | Bacteria | 2383 |
| 865 | Ga0496118_0107622 | 3300048921 | Bacteria | 1861 |
| 866 | Ga0496118_0152010 | 3300048921 | Bacteria | 1447 |
| 867 | Ga0496118_0162401 | 3300048921 | Bacteria | 1379 |
| 868 | Ga0496119_0018586 | 3300048922 | Bacteria | 5165 |
| 869 | Ga0496119_0054319 | 3300048922 | Bacteria | 2439 |
| 870 | Ga0496119_0105419 | 3300048922 | Bacteria | 1575 |
| 871 | Ga0496120_0060460 | 3300048923 | Bacteria | 2119 |
| 872 | Ga0496121_0000041 | 3300048924 | Bacteria | 346686 |
| 873 | Ga0496121_0004032 | 3300048924 | Bacteria | 20180 |
| 874 | Ga0496121_0008304 | 3300048924 | Bacteria | 12279 |
| 875 | Ga0496121_0018644 | 3300048924 | Bacteria | 6985 |
| 876 | Ga0496121_0032854 | 3300048924 | Bacteria | 4708 |
| 877 | Ga0496121_0038847 | 3300048924 | Bacteria | 4206 |
| 878 | Ga0496121_0055416 | 3300048924 | Bacteria | 3303 |
| 879 | Ga0496121_0064419 | 3300048924 | Bacteria | 2989 |
| 880 | Ga0496121_0091987 | 3300048924 | Bacteria | 2366 |
| 881 | Ga0496121_0093399 | 3300048924 | Bacteria | 2342 |
| 882 | Ga0496121_0113856 | 3300048924 | Bacteria | 2057 |
| 883 | Ga0496121_0122293 | 3300048924 | Bacteria | 1963 |
| 884 | Ga0496121_0245325 | 3300048924 | Bacteria | 1245 |
| 885 | Ga0496121_0337810 | 3300048924 | Bacteria | 1008 |
| 886 | Ga0496121_0427860 | 3300048924 | Bacteria | 859 |
| 887 | Ga0496122_0071472 | 3300048925 | Bacteria | 2473 |
| 888 | Ga0496122_0101806 | 3300048925 | Bacteria | 1917 |
| 889 | Ga0496122_0193843 | 3300048925 | Bacteria | 1196 |
| 890 | Ga0496124_0000624 | 3300048927 | Bacteria | 58976 |
| 891 | Ga0496124_0026227 | 3300048927 | Bacteria | 5260 |
| 892 | Ga0496124_0043676 | 3300048927 | Bacteria | 3852 |
| 893 | Ga0496124_0104201 | 3300048927 | Bacteria | 2294 |
| 894 | Ga0496124_0216707 | 3300048927 | Bacteria | 1443 |
| 895 | Ga0496124_0271149 | 3300048927 | Bacteria | 1243 |
| 896 | Ga0496124_0306678 | 3300048927 | Bacteria | 1144 |
| 897 | Ga0496124_0391827 | 3300048927 | Bacteria | 967 |
| 898 | Ga0496125_0000504 | 3300048928 | Bacteria | 67902 |
| 899 | Ga0496125_0000796 | 3300048928 | Bacteria | 51436 |
| 900 | Ga0496125_0010698 | 3300048928 | Bacteria | 9254 |
| 901 | Ga0496125_0017985 | 3300048928 | Bacteria | 6718 |
| 902 | Ga0496125_0039233 | 3300048928 | Bacteria | 4081 |
| 903 | Ga0496125_0111327 | 3300048928 | Bacteria | 1981 |
| 904 | Ga0496125_0142052 | 3300048928 | Bacteria | 1667 |
| 905 | Ga0496125_0158568 | 3300048928 | Bacteria | 1541 |
| 906 | Ga0496126_0002321 | 3300048929 | Bacteria | 26096 |
| 907 | Ga0496126_0004392 | 3300048929 | Bacteria | 16903 |
| 908 | Ga0496126_0012650 | 3300048929 | Bacteria | 8635 |
| 909 | Ga0496126_0014901 | 3300048929 | Bacteria | 7841 |
| 910 | Ga0496126_0020311 | 3300048929 | Bacteria | 6518 |
| 911 | Ga0496126_0029521 | 3300048929 | Bacteria | 5209 |
| 912 | Ga0496126_0040235 | 3300048929 | Bacteria | 4334 |
| 913 | Ga0496126_0041504 | 3300048929 | Bacteria | 4257 |
| 914 | Ga0496126_0065716 | 3300048929 | Bacteria | 3245 |
| 915 | Ga0496126_0079115 | 3300048929 | Bacteria | 2911 |
| 916 | Ga0496126_0087192 | 3300048929 | Bacteria | 2750 |
| 917 | Ga0496126_0088238 | 3300048929 | Bacteria | 2732 |
| 918 | Ga0496126_0107949 | 3300048929 | Bacteria | 2427 |
| 919 | Ga0496126_0158823 | 3300048929 | Bacteria | 1933 |
| 920 | Ga0496126_0201022 | 3300048929 | Bacteria | 1683 |
| 921 | Ga0496126_0477612 | 3300048929 | Bacteria | 999 |
| 922 | Ga0496126_0606091 | 3300048929 | Bacteria | 862 |
| 923 | Ga0501031_0006881 | 3300049568 | Bacteria | 7421 |
| 924 | Ga0501032_0000198 | 3300049569 | Bacteria | 50120 |
| 925 | Ga0501033_0000091 | 3300049570 | Bacteria | 85666 |
| 926 | Ga0501034_0000039 | 3300049571 | Bacteria | 237357 |
| 927 | Ga0501036_0000347 | 3300049572 | Bacteria | 32588 |
| 928 | Ga0501036_0514610 | 3300049572 | Bacteria | 995 |
| 929 | Ga0501037_0002330 | 3300049573 | Bacteria | 13717 |
| 930 | Ga0501038_0000133 | 3300049574 | Bacteria | 63587 |
| 931 | Ga0501038_0196450 | 3300049574 | Bacteria | 1621 |
| 932 | Ga0501038_0198166 | 3300049574 | Bacteria | 1613 |
| 933 | Ga0501039_0000550 | 3300049575 | Bacteria | 27148 |
| 934 | Ga0501039_0326622 | 3300049575 | Bacteria | 1206 |
| 935 | Ga0501039_0342782 | 3300049575 | Bacteria | 1174 |
| 936 | Ga0501041_0084197 | 3300049577 | Bacteria | 1960 |
| 937 | Ga0501043_0000233 | 3300049579 | Bacteria | 50329 |
| 938 | Ga0501046_0000218 | 3300049580 | Bacteria | 59989 |
| 939 | Ga0501046_0040825 | 3300049580 | Bacteria | 3706 |
| 940 | Ga0501046_0091190 | 3300049580 | Bacteria | 2344 |
| 941 | Ga0501046_0194684 | 3300049580 | Bacteria | 1511 |
| 942 | Ga0501046_0213456 | 3300049580 | Bacteria | 1432 |
| 943 | Ga0501047_0004248 | 3300049581 | Bacteria | 13487 |
| 944 | Ga0501047_0140570 | 3300049581 | Bacteria | 2293 |
| 945 | Ga0501047_0459864 | 3300049581 | Bacteria | 1101 |
| 946 | Ga0501067_0000906 | 3300049583 | Bacteria | 15938 |
| 947 | Ga0501067_0088804 | 3300049583 | Bacteria | 1715 |
| 948 | Ga0501067_0135773 | 3300049583 | Bacteria | 1370 |
| 949 | Ga0501067_0200997 | 3300049583 | Bacteria | 1110 |
| 950 | Ga0501068_0020770 | 3300049584 | Bacteria | 3831 |
| 951 | Ga0501068_0250435 | 3300049584 | Bacteria | 1129 |
| 952 | Ga0501069_0001622 | 3300049585 | Bacteria | 11144 |
| 953 | Ga0501069_0061378 | 3300049585 | Bacteria | 2099 |
| 954 | Ga0501070_0004601 | 3300049586 | Bacteria | 11831 |
| 955 | Ga0501070_0295893 | 3300049586 | Bacteria | 1319 |
| 956 | Ga0501071_0077327 | 3300049587 | Bacteria | 2431 |
| 957 | Ga0501072_0001868 | 3300049588 | Bacteria | 15689 |
| 958 | Ga0501072_0101896 | 3300049588 | Bacteria | 2282 |
| 959 | Ga0501072_0223820 | 3300049588 | Bacteria | 1499 |
| 960 | Ga0501073_0000118 | 3300049589 | Bacteria | 50886 |
| 961 | Ga0501074_0000724 | 3300049590 | Bacteria | 20696 |
| 962 | Ga0501075_0064417 | 3300049591 | Bacteria | 2765 |
| 963 | Ga0501075_0144795 | 3300049591 | Bacteria | 1811 |
| 964 | Ga0501076_0316338 | 3300049592 | Bacteria | 1280 |
| 965 | Ga0501077_0014711 | 3300049593 | Bacteria | 4917 |
| 966 | Ga0501077_0036219 | 3300049593 | Bacteria | 3143 |
| 967 | Ga0501077_0151859 | 3300049593 | Bacteria | 1470 |
| 968 | Ga0501077_0206056 | 3300049593 | Bacteria | 1250 |
| 969 | Ga0501079_0003049 | 3300049741 | Bacteria | 12258 |
| 970 | Ga0501079_0099269 | 3300049741 | Bacteria | 2256 |
| 971 | Ga0501079_0140690 | 3300049741 | Bacteria | 1880 |
| 972 | Ga0501080_0000124 | 3300049742 | Bacteria | 54519 |
| 973 | Ga0501080_0113336 | 3300049742 | Bacteria | 2514 |
| 974 | Ga0501081_0029563 | 3300049743 | Bacteria | 3704 |
| 975 | Ga0501081_0091209 | 3300049743 | Bacteria | 2143 |
| 976 | Ga0501081_0140374 | 3300049743 | Bacteria | 1731 |
| 977 | Ga0501083_0000184 | 3300049744 | Bacteria | 40201 |
| 978 | Ga0501035_0000052 | 3300049822 | Bacteria | 143038 |
| 979 | Ga0501035_0103700 | 3300049822 | Bacteria | 2495 |
| 980 | Ga0501044_0001974 | 3300049823 | Bacteria | 23731 |
| 981 | nmdc:mga03n38_13382_c1 | 3300050490 | Bacteria | 3115 |
| 982 | nmdc:mga03n38_3689_c1 | 3300050490 | Bacteria | 4955 |
| 983 | nmdc:mga00v17_183550_c1 | 3300050491 | Bacteria | 1350 |
| 984 | nmdc:mga00v17_40538_c1 | 3300050491 | Bacteria | 2794 |
| 985 | nmdc:mga00v17_78350_c1 | 3300050491 | Bacteria | 2059 |
| 986 | nmdc:mga00v17_8048_c1 | 3300050491 | Bacteria | 5658 |
| 987 | nmdc:mga0yw44_21029_c1 | 3300050492 | Bacteria | 3634 |
| 988 | nmdc:mga0yw44_5628_c1 | 3300050492 | Bacteria | 5959 |
| 989 | nmdc:mga0yw44_5904_c1 | 3300050492 | Bacteria | 5852 |
| 990 | nmdc:mga0yw44_7624_c1 | 3300050492 | Bacteria | 5335 |
| 991 | nmdc:mga0k408_12428_c1 | 3300050493 | Bacteria | 4655 |
| 992 | nmdc:mga0k408_242671_c1 | 3300050493 | Bacteria | 1076 |
| 993 | nmdc:mga06z11_1471_c1 | 3300050494 | Bacteria | 8772 |
| 994 | nmdc:mga06z11_223503_c1 | 3300050494 | Bacteria | 1101 |
| 995 | nmdc:mga06z11_28232_c1 | 3300050494 | Bacteria | 2691 |
| 996 | nmdc:mga06z11_314908_c1 | 3300050494 | Bacteria | 933 |
| 997 | nmdc:mga07m45_41598_c1 | 3300050496 | Bacteria | 2574 |
| 998 | nmdc:mga07m45_5905_c1 | 3300050496 | Bacteria | 6144 |
| 999 | nmdc:mga07m45_65054_c1 | 3300050496 | Bacteria | 2070 |
| 1000 | nmdc:mga05p37_108066_c1 | 3300050507 | Bacteria | 2484 |
| 1001 | nmdc:mga05p37_117698_c1 | 3300050507 | Bacteria | 3265 |
| 1002 | nmdc:mga05p37_583626_c1 | 3300050507 | Bacteria | 1265 |
| 1003 | nmdc:mga05p37_67138_c1 | 3300050507 | Bacteria | 4412 |
| 1004 | nmdc:mga06r32_175088_c1 | 3300050510 | Bacteria | 2130 |
| 1005 | nmdc:mga06r32_279243_c1 | 3300050510 | Bacteria | 1657 |
| 1006 | nmdc:mga06r32_398955_c1 | 3300050510 | Bacteria | 1358 |
| 1007 | nmdc:mga08y16_1102_c1 | 3300050511 | Bacteria | 26611 |
| 1008 | nmdc:mga08y16_18538_c1 | 3300050511 | Bacteria | 7333 |
| 1009 | nmdc:mga08y16_311002_c1 | 3300050511 | Unclassified | 1623 |
| 1010 | nmdc:mga08y16_761801_c1 | 3300050511 | Bacteria | 963 |
| 1011 | nmdc:mga0n895_25454_c1 | 3300050512 | Bacteria | 5591 |
| 1012 | nmdc:mga0n895_3720_c1 | 3300050512 | Bacteria | 12340 |
| 1013 | nmdc:mga0n895_93916_c1 | 3300050512 | Bacteria | 3003 |
| 1014 | nmdc:mga0rr50_34020_c1 | 3300050513 | Bacteria | 3646 |
| 1015 | nmdc:mga08x19_54648_c1 | 3300050514 | Bacteria | 2571 |
| 1016 | nmdc:mga0a205_185816_c1 | 3300050515 | Bacteria | 1971 |
| 1017 | nmdc:mga0a205_212352_c1 | 3300050515 | Bacteria | 1823 |
| 1018 | nmdc:mga0a205_386917_c1 | 3300050515 | Bacteria | 1263 |
| 1019 | nmdc:mga0a205_67245_c1 | 3300050515 | Bacteria | 3462 |
| 1020 | nmdc:mga0sz30_135139_c1 | 3300050516 | Bacteria | 1088 |
| 1021 | nmdc:mga0sz30_1426_c1 | 3300050516 | Bacteria | 8537 |
| 1022 | nmdc:mga0sz30_8078_c3 | 3300050516 | Bacteria | 2472 |
| 1023 | Ga0495601_0117644 | 3300053077 | Bacteria | 1724 |
| 1024 | Ga0495601_0200200 | 3300053077 | Bacteria | 1305 |
| 1025 | Ga0495612_0017385 | 3300053078 | Bacteria | 2880 |
| 1026 | Ga0495612_0042894 | 3300053078 | Bacteria | 1847 |
| 1027 | Ga0495612_0135655 | 3300053078 | Bacteria | 1065 |
| 1028 | Ga0500635_0052959 | 3300053080 | Bacteria | 1394 |
| 1029 | Ga0500635_0056847 | 3300053080 | Bacteria | 1355 |
| 1030 | Ga0500635_0124232 | 3300053080 | Bacteria | 968 |
| 1031 | Ga0495595_0000340 | 3300053084 | Bacteria | 17922 |
| 1032 | Ga0495619_0000979 | 3300053085 | Bacteria | 18695 |
| 1033 | Ga0495619_0017593 | 3300053085 | Bacteria | 4528 |
| 1034 | Ga0495619_0070485 | 3300053085 | Bacteria | 2337 |
| 1035 | Ga0495619_0088082 | 3300053085 | Bacteria | 2100 |
| 1036 | Ga0495619_0155187 | 3300053085 | Bacteria | 1579 |
| 1037 | Ga0495619_0452407 | 3300053085 | Bacteria | 885 |
| 1038 | Ga0500643_001180 | 3300053087 | Bacteria | 15589 |
| 1039 | Ga0500643_014154 | 3300053087 | Bacteria | 2785 |
| 1040 | Ga0500644_0065825 | 3300053088 | Bacteria | 1291 |
| 1041 | Ga0500581_092293 | 3300053089 | Bacteria | 1498 |
| 1042 | Ga0500647_0070748 | 3300053091 | Bacteria | 1677 |
| 1043 | Ga0500583_0015298 | 3300053092 | Bacteria | 3031 |
| 1044 | Ga0500583_0111862 | 3300053092 | Bacteria | 1345 |
| 1045 | Ga0500651_0121168 | 3300053093 | Bacteria | 1588 |
| 1046 | Ga0500651_0173889 | 3300053093 | Bacteria | 1282 |
| 1047 | Ga0500566_0000112 | 3300053094 | Bacteria | 41687 |
| 1048 | Ga0500566_0011652 | 3300053094 | Bacteria | 5177 |
| 1049 | Ga0500640_037684 | 3300053095 | Bacteria | 2124 |
| 1050 | Ga0500641_0002755 | 3300053096 | Bacteria | 6210 |
| 1051 | Ga0500641_0091096 | 3300053096 | Bacteria | 1301 |
| 1052 | Ga0500648_051462 | 3300053097 | Bacteria | 2337 |
| 1053 | Ga0500650_0122839 | 3300053098 | Bacteria | 1209 |
| 1054 | Ga0500554_105126 | 3300053102 | Bacteria | 946 |
| 1055 | Ga0500556_0000002 | 3300053104 | Bacteria | 773626 |
| 1056 | Ga0500556_0006793 | 3300053104 | Bacteria | 3256 |
| 1057 | Ga0500557_000003 | 3300053105 | Bacteria | 228429 |
| 1058 | Ga0500562_008373 | 3300053108 | Bacteria | 2613 |
| 1059 | Ga0500562_011085 | 3300053108 | Bacteria | 2287 |
| 1060 | Ga0500569_003333 | 3300053109 | Bacteria | 3271 |
| 1061 | Ga0500572_000239 | 3300053111 | Bacteria | 19483 |
| 1062 | Ga0500572_014724 | 3300053111 | Bacteria | 1959 |
| 1063 | Ga0500592_001499 | 3300053116 | Bacteria | 3781 |
| 1064 | Ga0500593_080147 | 3300053117 | Bacteria | 1401 |
| 1065 | Ga0500595_000684 | 3300053119 | Bacteria | 20289 |
| 1066 | Ga0500595_000750 | 3300053119 | Bacteria | 19098 |
| 1067 | Ga0500595_003552 | 3300053119 | Bacteria | 7244 |
| 1068 | Ga0500595_010235 | 3300053119 | Bacteria | 3736 |
| 1069 | Ga0500607_054105 | 3300053121 | Bacteria | 2126 |
| 1070 | Ga0500608_045787 | 3300053122 | Bacteria | 2101 |
| 1071 | Ga0500614_002291 | 3300053123 | Bacteria | 4298 |
| 1072 | Ga0500642_0000026 | 3300053130 | Bacteria | 127731 |
| 1073 | Ga0500642_0000466 | 3300053130 | Bacteria | 12659 |
| 1074 | Ga0500642_0016883 | 3300053130 | Bacteria | 2784 |
| 1075 | Ga0500652_008704 | 3300053131 | Bacteria | 3396 |
| 1076 | Ga0500652_162915 | 3300053131 | Bacteria | 921 |
| 1077 | Ga0500658_0022760 | 3300053134 | Bacteria | 2386 |
| 1078 | Ga0500559_0000973 | 3300053136 | Bacteria | 17925 |
| 1079 | Ga0500559_0004017 | 3300053136 | Bacteria | 7065 |
| 1080 | Ga0500559_0010663 | 3300053136 | Bacteria | 3938 |
| 1081 | Ga0500559_0038875 | 3300053136 | Bacteria | 2068 |
| 1082 | Ga0500568_0004521 | 3300053139 | Bacteria | 7413 |
| 1083 | Ga0500568_0035015 | 3300053139 | Bacteria | 2051 |
| 1084 | Ga0500573_0006281 | 3300053140 | Bacteria | 6416 |
| 1085 | Ga0500577_0000075 | 3300053142 | Bacteria | 23037 |
| 1086 | Ga0500603_000112 | 3300053150 | Bacteria | 19031 |
| 1087 | Ga0500616_0000031 | 3300053153 | Bacteria | 415013 |
| 1088 | Ga0500619_048114 | 3300053154 | Bacteria | 1372 |
| 1089 | Ga0500620_004974 | 3300053155 | Bacteria | 3027 |
| 1090 | Ga0500622_0014162 | 3300053156 | Bacteria | 4286 |
| 1091 | Ga0500622_0015382 | 3300053156 | Bacteria | 4097 |
| 1092 | Ga0500630_141656 | 3300053159 | Bacteria | 1033 |
| 1093 | Ga0500638_000692 | 3300053162 | Bacteria | 8958 |
| 1094 | Ga0500639_000061 | 3300053163 | Bacteria | 49500 |
| 1095 | Ga0500636_0000284 | 3300053177 | Bacteria | 28033 |
| 1096 | Ga0500636_0002778 | 3300053177 | Bacteria | 9765 |
| 1097 | Ga0500636_0004433 | 3300053177 | Bacteria | 7944 |
| 1098 | Ga0500636_0022086 | 3300053177 | Bacteria | 3765 |
| 1099 | Ga0500636_0024532 | 3300053177 | Bacteria | 3566 |
| 1100 | Ga0500636_0082027 | 3300053177 | Bacteria | 1856 |
| 1101 | Ga0500637_0003838 | 3300053178 | Bacteria | 6998 |
| 1102 | Ga0500637_0012608 | 3300053178 | Bacteria | 4411 |
| 1103 | Ga0500637_0180348 | 3300053178 | Bacteria | 1210 |
| 1104 | Ga0500625_048108 | 3300053729 | Bacteria | 1981 |
| 1105 | Ga0500645_039475 | 3300053730 | Bacteria | 1398 |
| 1106 | Ga0500645_048342 | 3300053730 | Bacteria | 1246 |
| 1107 | Ga0500609_008652 | 3300053731 | Bacteria | 1374 |
| 1108 | Ga0500596_000112 | 3300053735 | Bacteria | 11453 |
| 1109 | Ga0500596_002552 | 3300053735 | Bacteria | 3581 |
| 1110 | Ga0500601_000250 | 3300053737 | Bacteria | 10375 |
| 1111 | Ga0500601_010449 | 3300053737 | Bacteria | 1039 |
| 1112 | Ga0501084_0007035 | 3300054114 | Bacteria | 9275 |
| 1113 | Ga0501084_0007987 | 3300054114 | Bacteria | 8712 |
| 1114 | Ga0501084_0061045 | 3300054114 | Bacteria | 3156 |
| 1115 | Ga0501082_0007549 | 3300060353 | Bacteria | 9383 |
| 1116 | Ga0501082_0126954 | 3300060353 | Bacteria | 2212 |
| 1117 | Ga0501082_0196486 | 3300060353 | Bacteria | 1755 |
| 1118 | Ga0501082_0275958 | 3300060353 | Bacteria | 1463 |
| 1119 | Ga0530510_0244774 | 3300061734 | Bacteria | 1336 |
| 1120 | Ga0530510_0399081 | 3300061734 | Bacteria | 1036 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006871 | Ga0075434_100110443 | Ga0075434_1001104433 | 260 |
| 2 | 3300053177 | Ga0500636_0004433 | Ga0500636_0004433_4878_5672 | 264 |
| 3 | 3300039438 | Ga0436360_0380976 | Ga0436360_0380976_25_822 | 265 |
| 4 | 3300048917 | Ga0496114_0110500 | Ga0496114_0110500_199_996 | 265 |
| 5 | 3300049575 | Ga0501039_0342782 | Ga0501039_0342782_13_810 | 265 |
| 6 | 3300049581 | Ga0501047_0140570 | Ga0501047_0140570_253_1050 | 265 |
| 7 | 3300039437 | Ga0436365_1602790 | Ga0436365_1602790_151_951 | 266 |
| 8 | 3300044719 | Ga0466971_0052717 | Ga0466971_0052717_1022_1822 | 266 |
| 9 | 3300045049 | Ga0466959_0181674 | Ga0466959_0181674_367_1167 | 266 |
| 10 | 3300045976 | Ga0466967_0754349 | Ga0466967_0754349_119_919 | 266 |
| 11 | iso_pu_bacteria | 2508501128 | 2509152224 | 266 |
| 12 | iso_pu_bacteria | 2513237141 | 2513894148 | 266 |
| 13 | 3300007265 | Ga0099794_10049565 | Ga0099794_100495652 | 267 |
| 14 | 3300007788 | Ga0099795_10111071 | Ga0099795_101110711 | 267 |
| 15 | 3300009093 | Ga0105240_10125198 | Ga0105240_101251982 | 267 |
| 16 | 3300009093 | Ga0105240_10137254 | Ga0105240_101372543 | 267 |
| 17 | 3300009093 | Ga0105240_10620993 | Ga0105240_106209932 | 267 |
| 18 | 3300009101 | Ga0105247_10378481 | Ga0105247_103784811 | 267 |
| 19 | 3300009545 | Ga0105237_10014975 | Ga0105237_100149756 | 267 |
| 20 | 3300009545 | Ga0105237_10130594 | Ga0105237_101305942 | 267 |
| 21 | 3300010159 | Ga0099796_10057120 | Ga0099796_100571202 | 267 |
| 22 | 3300010159 | Ga0099796_10111847 | Ga0099796_101118471 | 267 |
| 23 | 3300010375 | Ga0105239_10096516 | Ga0105239_100965162 | 267 |
| 24 | 3300010375 | Ga0105239_10121472 | Ga0105239_101214724 | 267 |
| 25 | 3300010375 | Ga0105239_10262961 | Ga0105239_102629612 | 267 |
| 26 | 3300011119 | Ga0105246_10034865 | Ga0105246_100348652 | 267 |
| 27 | 3300011119 | Ga0105246_10329520 | Ga0105246_103295202 | 267 |
| 28 | 3300013104 | Ga0157370_10735882 | Ga0157370_107358821 | 267 |
| 29 | 3300013105 | Ga0157369_10090974 | Ga0157369_100909742 | 267 |
| 30 | 3300013296 | Ga0157374_10154517 | Ga0157374_101545172 | 267 |
| 31 | 3300013297 | Ga0157378_10103216 | Ga0157378_101032162 | 267 |
| 32 | 3300013297 | Ga0157378_10490949 | Ga0157378_104909492 | 267 |
| 33 | 3300013306 | Ga0163162_10035253 | Ga0163162_100352534 | 267 |
| 34 | 3300013307 | Ga0157372_10399832 | Ga0157372_103998321 | 267 |
| 35 | 3300013308 | Ga0157375_10026770 | Ga0157375_100267705 | 267 |
| 36 | 3300014325 | Ga0163163_10112738 | Ga0163163_101127382 | 267 |
| 37 | 3300014969 | Ga0157376_10004024 | Ga0157376_100040243 | 267 |
| 38 | 3300022467 | Ga0224712_10125695 | Ga0224712_101256951 | 267 |
| 39 | 3300025295 | Ga0209564_1000468 | Ga0209564_100046828 | 267 |
| 40 | 3300025939 | Ga0207665_10535148 | Ga0207665_105351481 | 267 |
| 41 | 3300034819 | Ga0373958_0046442 | Ga0373958_0046442_36_839 | 267 |
| 42 | 3300035083 | Ga0373926_0057375 | Ga0373926_0057375_600_1403 | 267 |
| 43 | 3300035083 | Ga0373926_0072531 | Ga0373926_0072531_147_950 | 267 |
| 44 | 3300035086 | Ga0373934_0076243 | Ga0373934_0076243_378_1181 | 267 |
| 45 | 3300035111 | Ga0373923_0020786 | Ga0373923_0020786_1002_1805 | 267 |
| 46 | 3300035111 | Ga0373923_0057129 | Ga0373923_0057129_836_1639 | 267 |
| 47 | 3300035113 | Ga0373936_0002958 | Ga0373936_0002958_4318_5121 | 267 |
| 48 | 3300035113 | Ga0373936_0011793 | Ga0373936_0011793_1558_2361 | 267 |
| 49 | 3300035116 | Ga0373945_0008932 | Ga0373945_0008932_2427_3230 | 267 |
| 50 | 3300035117 | Ga0373953_0100611 | Ga0373953_0100611_26_829 | 267 |
| 51 | 3300035119 | Ga0373956_0024352 | Ga0373956_0024352_1769_2572 | 267 |
| 52 | 3300035120 | Ga0373957_0014654 | Ga0373957_0014654_1858_2661 | 267 |
| 53 | 3300035170 | Ga0373943_0001227 | Ga0373943_0001227_7707_8510 | 267 |
| 54 | 3300035170 | Ga0373943_0093998 | Ga0373943_0093998_667_1470 | 267 |
| 55 | 3300035170 | Ga0373943_0125121 | Ga0373943_0125121_275_1078 | 267 |
| 56 | 3300035171 | Ga0373946_0042723 | Ga0373946_0042723_559_1362 | 267 |
| 57 | 3300035171 | Ga0373946_0052240 | Ga0373946_0052240_565_1368 | 267 |
| 58 | 3300035172 | Ga0373955_0078074 | Ga0373955_0078074_688_1491 | 267 |
| 59 | 3300035172 | Ga0373955_0220554 | Ga0373955_0220554_131_934 | 267 |
| 60 | 3300035242 | Ga0373962_0052088 | Ga0373962_0052088_328_1131 | 267 |
| 61 | 3300035410 | Ga0373924_0005755 | Ga0373924_0005755_1330_2133 | 267 |
| 62 | 3300035692 | Ga0373935_0020771 | Ga0373935_0020771_2194_2997 | 267 |
| 63 | 3300035692 | Ga0373935_0038824 | Ga0373935_0038824_976_1779 | 267 |
| 64 | 3300035692 | Ga0373935_0118261 | Ga0373935_0118261_793_1596 | 267 |
| 65 | 3300035695 | Ga0373927_0000674 | Ga0373927_0000674_4066_4869 | 267 |
| 66 | 3300035695 | Ga0373927_0015921 | Ga0373927_0015921_4003_4806 | 267 |
| 67 | 3300035695 | Ga0373927_0035148 | Ga0373927_0035148_2254_3057 | 267 |
| 68 | 3300035695 | Ga0373927_0075233 | Ga0373927_0075233_1322_2125 | 267 |
| 69 | 3300035695 | Ga0373927_0113202 | Ga0373927_0113202_934_1737 | 267 |
| 70 | 3300035695 | Ga0373927_0119071 | Ga0373927_0119071_220_1023 | 267 |
| 71 | 3300035695 | Ga0373927_0142055 | Ga0373927_0142055_390_1193 | 267 |
| 72 | 3300035725 | Ga0373947_0007856 | Ga0373947_0007856_1748_2551 | 267 |
| 73 | 3300035725 | Ga0373947_0017156 | Ga0373947_0017156_2705_3508 | 267 |
| 74 | 3300035725 | Ga0373947_0017819 | Ga0373947_0017819_518_1321 | 267 |
| 75 | 3300035725 | Ga0373947_0177458 | Ga0373947_0177458_392_1195 | 267 |
| 76 | 3300036401 | Ga0373937_0034649 | Ga0373937_0034649_880_1683 | 267 |
| 77 | 3300036401 | Ga0373937_0276384 | Ga0373937_0276384_174_977 | 267 |
| 78 | 3300037068 | Ga0373925_0006535 | Ga0373925_0006535_4078_4881 | 267 |
| 79 | 3300037068 | Ga0373925_0059832 | Ga0373925_0059832_588_1391 | 267 |
| 80 | 3300037418 | Ga0395900_0053426 | Ga0395900_0053426_315_1118 | 267 |
| 81 | 3300037466 | Ga0395898_0029984 | Ga0395898_0029984_3895_4698 | 267 |
| 82 | 3300037853 | Ga0436364_0263012 | Ga0436364_0263012_4049_4852 | 267 |
| 83 | 3300039437 | Ga0436365_1424648 | Ga0436365_1424648_14132_14935 | 267 |
| 84 | 3300039437 | Ga0436365_1446446 | Ga0436365_1446446_785_1588 | 267 |
| 85 | 3300039447 | Ga0436361_0487707 | Ga0436361_0487707_743_1546 | 267 |
| 86 | 3300039450 | Ga0436363_0460428 | Ga0436363_0460428_134_937 | 267 |
| 87 | 3300039453 | Ga0436362_0232091 | Ga0436362_0232091_1144_1947 | 267 |
| 88 | 3300041453 | Ga0451797_1443236 | Ga0451797_1443236_279_1082 | 267 |
| 89 | 3300042006 | Ga0439432_080205 | Ga0439432_080205_164_967 | 267 |
| 90 | 3300044694 | Ga0466963_0048209 | Ga0466963_0048209_709_1512 | 267 |
| 91 | 3300045049 | Ga0466959_0384090 | Ga0466959_0384090_28_834 | 267 |
| 92 | 3300046454 | Ga0495592_0019071 | Ga0495592_0019071_40_843 | 267 |
| 93 | 3300046455 | Ga0495603_0000003 | Ga0495603_0000003_72248_73051 | 267 |
| 94 | 3300046455 | Ga0495603_0039407 | Ga0495603_0039407_646_1449 | 267 |
| 95 | 3300046459 | Ga0495629_0000133 | Ga0495629_0000133_17329_18132 | 267 |
| 96 | 3300046462 | Ga0495651_0033676 | Ga0495651_0033676_2981_3784 | 267 |
| 97 | 3300046472 | Ga0495580_0001841 | Ga0495580_0001841_8980_9783 | 267 |
| 98 | 3300046472 | Ga0495580_0072337 | Ga0495580_0072337_1487_2290 | 267 |
| 99 | 3300046472 | Ga0495580_0073070 | Ga0495580_0073070_538_1341 | 267 |
| 100 | 3300046473 | Ga0495582_0000016 | Ga0495582_0000016_71067_71870 | 267 |
| 101 | 3300046473 | Ga0495582_0057394 | Ga0495582_0057394_317_1120 | 267 |
| 102 | 3300046475 | Ga0495639_0000014 | Ga0495639_0000014_36197_37000 | 267 |
| 103 | 3300046475 | Ga0495639_0024053 | Ga0495639_0024053_1807_2610 | 267 |
| 104 | 3300046475 | Ga0495639_0191102 | Ga0495639_0191102_184_987 | 267 |
| 105 | 3300046476 | Ga0495662_0064038 | Ga0495662_0064038_206_1009 | 267 |
| 106 | 3300046476 | Ga0495662_0248390 | Ga0495662_0248390_36_839 | 267 |
| 107 | 3300046477 | Ga0495664_0033576 | Ga0495664_0033576_2137_2940 | 267 |
| 108 | 3300046477 | Ga0495664_0047199 | Ga0495664_0047199_187_990 | 267 |
| 109 | 3300046477 | Ga0495664_0066500 | Ga0495664_0066500_260_1063 | 267 |
| 110 | 3300046499 | Ga0495594_0000051 | Ga0495594_0000051_35398_36201 | 267 |
| 111 | 3300046499 | Ga0495594_0053859 | Ga0495594_0053859_1133_1936 | 267 |
| 112 | 3300046499 | Ga0495594_0109366 | Ga0495594_0109366_33_836 | 267 |
| 113 | 3300046507 | Ga0495606_0000196 | Ga0495606_0000196_36685_37488 | 267 |
| 114 | 3300046517 | Ga0495630_0023371 | Ga0495630_0023371_388_1191 | 267 |
| 115 | 3300046517 | Ga0495630_0050601 | Ga0495630_0050601_1037_1840 | 267 |
| 116 | 3300046524 | Ga0495648_0001270 | Ga0495648_0001270_11232_12035 | 267 |
| 117 | 3300046524 | Ga0495648_0010219 | Ga0495648_0010219_721_1524 | 267 |
| 118 | 3300046526 | Ga0495666_0019511 | Ga0495666_0019511_758_1561 | 267 |
| 119 | 3300046526 | Ga0495666_0094409 | Ga0495666_0094409_564_1367 | 267 |
| 120 | 3300046526 | Ga0495666_0124020 | Ga0495666_0124020_306_1109 | 267 |
| 121 | 3300046531 | Ga0495665_0000477 | Ga0495665_0000477_18077_18880 | 267 |
| 122 | 3300046533 | Ga0495640_0001817 | Ga0495640_0001817_12561_13364 | 267 |
| 123 | 3300046533 | Ga0495640_0042158 | Ga0495640_0042158_2368_3171 | 267 |
| 124 | 3300046543 | Ga0495645_0013562 | Ga0495645_0013562_2763_3566 | 267 |
| 125 | 3300046543 | Ga0495645_0095231 | Ga0495645_0095231_1016_1819 | 267 |
| 126 | 3300046557 | Ga0495622_0009328 | Ga0495622_0009328_2421_3224 | 267 |
| 127 | 3300046557 | Ga0495622_0040568 | Ga0495622_0040568_1066_1869 | 267 |
| 128 | 3300046559 | Ga0495667_0050784 | Ga0495667_0050784_119_922 | 267 |
| 129 | 3300046559 | Ga0495667_0200973 | Ga0495667_0200973_267_1070 | 267 |
| 130 | 3300046642 | Ga0495634_0000064 | Ga0495634_0000064_5300_6103 | 267 |
| 131 | 3300046642 | Ga0495634_0092885 | Ga0495634_0092885_437_1240 | 267 |
| 132 | 3300046663 | Ga0495635_0000792 | Ga0495635_0000792_19421_20224 | 267 |
| 133 | 3300046674 | Ga0495588_0004419 | Ga0495588_0004419_1847_2650 | 267 |
| 134 | 3300046678 | Ga0495599_0021677 | Ga0495599_0021677_2536_3339 | 267 |
| 135 | 3300046678 | Ga0495599_0091379 | Ga0495599_0091379_122_925 | 267 |
| 136 | 3300046679 | Ga0495623_0114482 | Ga0495623_0114482_242_1045 | 267 |
| 137 | 3300046679 | Ga0495623_0168901 | Ga0495623_0168901_254_1057 | 267 |
| 138 | 3300046679 | Ga0495623_0190517 | Ga0495623_0190517_174_977 | 267 |
| 139 | 3300046683 | Ga0495658_0005113 | Ga0495658_0005113_4114_4917 | 267 |
| 140 | 3300046683 | Ga0495658_0136993 | Ga0495658_0136993_419_1222 | 267 |
| 141 | 3300046689 | Ga0495613_0034122 | Ga0495613_0034122_701_1504 | 267 |
| 142 | 3300046689 | Ga0495613_0057842 | Ga0495613_0057842_1292_2095 | 267 |
| 143 | 3300046689 | Ga0495613_0243446 | Ga0495613_0243446_25_828 | 267 |
| 144 | 3300046690 | Ga0495624_0000505 | Ga0495624_0000505_25802_26605 | 267 |
| 145 | 3300046809 | Ga0495600_0090278 | Ga0495600_0090278_402_1205 | 267 |
| 146 | 3300047315 | Ga0495581_0000001 | Ga0495581_0000001_84544_85347 | 267 |
| 147 | 3300047319 | Ga0495674_0004772 | Ga0495674_0004772_6813_7616 | 267 |
| 148 | 3300047319 | Ga0495674_0179196 | Ga0495674_0179196_389_1192 | 267 |
| 149 | 3300047319 | Ga0495674_0198232 | Ga0495674_0198232_220_1023 | 267 |
| 150 | 3300047320 | Ga0495672_0026120 | Ga0495672_0026120_1187_1990 | 267 |
| 151 | 3300047320 | Ga0495672_0049694 | Ga0495672_0049694_805_1608 | 267 |
| 152 | 3300047322 | Ga0495680_0204651 | Ga0495680_0204651_431_1234 | 267 |
| 153 | 3300047322 | Ga0495680_0225576 | Ga0495680_0225576_420_1223 | 267 |
| 154 | 3300047471 | Ga0495684_0122620 | Ga0495684_0122620_973_1776 | 267 |
| 155 | 3300047673 | Ga0495593_0000003 | Ga0495593_0000003_108322_109125 | 267 |
| 156 | 3300048088 | Ga0495602_0347889 | Ga0495602_0347889_74_877 | 267 |
| 157 | 3300048903 | Ga0496100_0042026 | Ga0496100_0042026_1870_2673 | 267 |
| 158 | 3300048904 | Ga0496101_0008766 | Ga0496101_0008766_555_1358 | 267 |
| 159 | 3300048905 | Ga0496102_0007744 | Ga0496102_0007744_7339_8142 | 267 |
| 160 | 3300048905 | Ga0496102_0174595 | Ga0496102_0174595_376_1179 | 267 |
| 161 | 3300048906 | Ga0496103_0067466 | Ga0496103_0067466_1372_2178 | 267 |
| 162 | 3300048908 | Ga0496105_0028013 | Ga0496105_0028013_78_881 | 267 |
| 163 | 3300048908 | Ga0496105_0462577 | Ga0496105_0462577_110_913 | 267 |
| 164 | 3300048909 | Ga0496106_0006645 | Ga0496106_0006645_2150_2953 | 267 |
| 165 | 3300048909 | Ga0496106_0028171 | Ga0496106_0028171_974_1777 | 267 |
| 166 | 3300048909 | Ga0496106_0089720 | Ga0496106_0089720_587_1390 | 267 |
| 167 | 3300048910 | Ga0496107_0014152 | Ga0496107_0014152_1285_2088 | 267 |
| 168 | 3300048911 | Ga0496108_0062527 | Ga0496108_0062527_527_1330 | 267 |
| 169 | 3300048912 | Ga0496109_0101418 | Ga0496109_0101418_1742_2545 | 267 |
| 170 | 3300048912 | Ga0496109_0766832 | Ga0496109_0766832_77_880 | 267 |
| 171 | 3300048913 | Ga0496110_0113103 | Ga0496110_0113103_598_1401 | 267 |
| 172 | 3300048913 | Ga0496110_0172008 | Ga0496110_0172008_992_1795 | 267 |
| 173 | 3300048914 | Ga0496111_0059392 | Ga0496111_0059392_257_1060 | 267 |
| 174 | 3300048915 | Ga0496112_0071779 | Ga0496112_0071779_624_1427 | 267 |
| 175 | 3300048915 | Ga0496112_0107010 | Ga0496112_0107010_1677_2480 | 267 |
| 176 | 3300048915 | Ga0496112_0196985 | Ga0496112_0196985_931_1734 | 267 |
| 177 | 3300048916 | Ga0496113_0070355 | Ga0496113_0070355_1081_1884 | 267 |
| 178 | 3300048917 | Ga0496114_0018625 | Ga0496114_0018625_533_1336 | 267 |
| 179 | 3300048918 | Ga0496115_0056755 | Ga0496115_0056755_1524_2327 | 267 |
| 180 | 3300048918 | Ga0496115_0071469 | Ga0496115_0071469_1992_2795 | 267 |
| 181 | 3300048919 | Ga0496116_0079738 | Ga0496116_0079738_507_1310 | 267 |
| 182 | 3300048921 | Ga0496118_0014405 | Ga0496118_0014405_1460_2263 | 267 |
| 183 | 3300048922 | Ga0496119_0105419 | Ga0496119_0105419_208_1011 | 267 |
| 184 | 3300048924 | Ga0496121_0000041 | Ga0496121_0000041_105252_106055 | 267 |
| 185 | 3300048924 | Ga0496121_0018644 | Ga0496121_0018644_4913_5716 | 267 |
| 186 | 3300048924 | Ga0496121_0091987 | Ga0496121_0091987_219_1022 | 267 |
| 187 | 3300048924 | Ga0496121_0113856 | Ga0496121_0113856_637_1440 | 267 |
| 188 | 3300048924 | Ga0496121_0122293 | Ga0496121_0122293_1146_1949 | 267 |
| 189 | 3300048927 | Ga0496124_0000624 | Ga0496124_0000624_10072_10875 | 267 |
| 190 | 3300048927 | Ga0496124_0216707 | Ga0496124_0216707_402_1208 | 267 |
| 191 | 3300048927 | Ga0496124_0271149 | Ga0496124_0271149_315_1118 | 267 |
| 192 | 3300048928 | Ga0496125_0000504 | Ga0496125_0000504_11128_11931 | 267 |
| 193 | 3300048928 | Ga0496125_0010698 | Ga0496125_0010698_5935_6738 | 267 |
| 194 | 3300048928 | Ga0496125_0111327 | Ga0496125_0111327_626_1429 | 267 |
| 195 | 3300048928 | Ga0496125_0158568 | Ga0496125_0158568_46_849 | 267 |
| 196 | 3300048929 | Ga0496126_0014901 | Ga0496126_0014901_1077_1880 | 267 |
| 197 | 3300048929 | Ga0496126_0029521 | Ga0496126_0029521_2341_3144 | 267 |
| 198 | 3300048929 | Ga0496126_0065716 | Ga0496126_0065716_1889_2692 | 267 |
| 199 | 3300048929 | Ga0496126_0107949 | Ga0496126_0107949_1250_2053 | 267 |
| 200 | 3300048929 | Ga0496126_0606091 | Ga0496126_0606091_30_833 | 267 |
| 201 | 3300049568 | Ga0501031_0006881 | Ga0501031_0006881_921_1724 | 267 |
| 202 | 3300049569 | Ga0501032_0000198 | Ga0501032_0000198_28861_29664 | 267 |
| 203 | 3300049570 | Ga0501033_0000091 | Ga0501033_0000091_60716_61519 | 267 |
| 204 | 3300049571 | Ga0501034_0000039 | Ga0501034_0000039_91083_91886 | 267 |
| 205 | 3300049572 | Ga0501036_0000347 | Ga0501036_0000347_19567_20370 | 267 |
| 206 | 3300049573 | Ga0501037_0002330 | Ga0501037_0002330_5688_6491 | 267 |
| 207 | 3300049574 | Ga0501038_0000133 | Ga0501038_0000133_50933_51736 | 267 |
| 208 | 3300049575 | Ga0501039_0000550 | Ga0501039_0000550_9347_10150 | 267 |
| 209 | 3300049579 | Ga0501043_0000233 | Ga0501043_0000233_29960_30763 | 267 |
| 210 | 3300049580 | Ga0501046_0000218 | Ga0501046_0000218_4586_5389 | 267 |
| 211 | 3300049581 | Ga0501047_0004248 | Ga0501047_0004248_6472_7275 | 267 |
| 212 | 3300049583 | Ga0501067_0000906 | Ga0501067_0000906_14214_15017 | 267 |
| 213 | 3300049584 | Ga0501068_0020770 | Ga0501068_0020770_89_892 | 267 |
| 214 | 3300049585 | Ga0501069_0001622 | Ga0501069_0001622_10165_10968 | 267 |
| 215 | 3300049586 | Ga0501070_0004601 | Ga0501070_0004601_8129_8932 | 267 |
| 216 | 3300049588 | Ga0501072_0001868 | Ga0501072_0001868_5518_6321 | 267 |
| 217 | 3300049589 | Ga0501073_0000118 | Ga0501073_0000118_30517_31320 | 267 |
| 218 | 3300049590 | Ga0501074_0000724 | Ga0501074_0000724_16318_17121 | 267 |
| 219 | 3300049592 | Ga0501076_0316338 | Ga0501076_0316338_359_1162 | 267 |
| 220 | 3300049741 | Ga0501079_0003049 | Ga0501079_0003049_3426_4229 | 267 |
| 221 | 3300049742 | Ga0501080_0000124 | Ga0501080_0000124_52534_53337 | 267 |
| 222 | 3300049744 | Ga0501083_0000184 | Ga0501083_0000184_16596_17399 | 267 |
| 223 | 3300049822 | Ga0501035_0000052 | Ga0501035_0000052_108737_109540 | 267 |
| 224 | 3300049823 | Ga0501044_0001974 | Ga0501044_0001974_3362_4165 | 267 |
| 225 | 3300050494 | nmdc:mga06z11_223503_c1 | nmdc:mga06z11_223503_c1_34_837 | 267 |
| 226 | 3300053077 | Ga0495601_0117644 | Ga0495601_0117644_533_1336 | 267 |
| 227 | 3300053077 | Ga0495601_0200200 | Ga0495601_0200200_320_1123 | 267 |
| 228 | 3300053078 | Ga0495612_0017385 | Ga0495612_0017385_1772_2575 | 267 |
| 229 | 3300053080 | Ga0500635_0124232 | Ga0500635_0124232_81_884 | 267 |
| 230 | 3300053085 | Ga0495619_0017593 | Ga0495619_0017593_2026_2829 | 267 |
| 231 | 3300053085 | Ga0495619_0070485 | Ga0495619_0070485_1290_2093 | 267 |
| 232 | 3300053085 | Ga0495619_0088082 | Ga0495619_0088082_475_1278 | 267 |
| 233 | 3300053085 | Ga0495619_0155187 | Ga0495619_0155187_339_1142 | 267 |
| 234 | 3300053085 | Ga0495619_0452407 | Ga0495619_0452407_40_843 | 267 |
| 235 | 3300053094 | Ga0500566_0011652 | Ga0500566_0011652_3340_4143 | 267 |
| 236 | 3300053097 | Ga0500648_051462 | Ga0500648_051462_597_1400 | 267 |
| 237 | 3300053111 | Ga0500572_000239 | Ga0500572_000239_12513_13316 | 267 |
| 238 | 3300053136 | Ga0500559_0000973 | Ga0500559_0000973_158_961 | 267 |
| 239 | 3300053136 | Ga0500559_0004017 | Ga0500559_0004017_5965_6768 | 267 |
| 240 | 3300053136 | Ga0500559_0038875 | Ga0500559_0038875_769_1572 | 267 |
| 241 | 3300053140 | Ga0500573_0006281 | Ga0500573_0006281_2759_3562 | 267 |
| 242 | 3300053142 | Ga0500577_0000075 | Ga0500577_0000075_188_991 | 267 |
| 243 | 3300053154 | Ga0500619_048114 | Ga0500619_048114_554_1357 | 267 |
| 244 | 3300053177 | Ga0500636_0002778 | Ga0500636_0002778_729_1532 | 267 |
| 245 | 3300053177 | Ga0500636_0022086 | Ga0500636_0022086_89_892 | 267 |
| 246 | 3300053177 | Ga0500636_0024532 | Ga0500636_0024532_1307_2110 | 267 |
| 247 | 3300053177 | Ga0500636_0082027 | Ga0500636_0082027_698_1501 | 267 |
| 248 | 3300053178 | Ga0500637_0180348 | Ga0500637_0180348_154_957 | 267 |
| 249 | 3300053735 | Ga0500596_000112 | Ga0500596_000112_6261_7064 | 267 |
| 250 | 3300053735 | Ga0500596_002552 | Ga0500596_002552_2517_3320 | 267 |
| 251 | 3300054114 | Ga0501084_0007987 | Ga0501084_0007987_4786_5589 | 267 |
| 252 | 3300060353 | Ga0501082_0007549 | Ga0501082_0007549_8474_9277 | 267 |
| 253 | iso_pu_bacteria | 2857524615 | 2857530155 | 267 |
| 254 | 3300009093 | Ga0105240_10348521 | Ga0105240_103485211 | 268 |
| 255 | 3300009553 | Ga0105249_10566284 | Ga0105249_105662842 | 268 |
| 256 | 3300013104 | Ga0157370_10117592 | Ga0157370_101175923 | 268 |
| 257 | 3300025913 | Ga0207695_10574822 | Ga0207695_105748221 | 268 |
| 258 | 3300035118 | Ga0373954_0056760 | Ga0373954_0056760_584_1393 | 268 |
| 259 | 3300035119 | Ga0373956_0017608 | Ga0373956_0017608_487_1296 | 268 |
| 260 | 3300035172 | Ga0373955_0257773 | Ga0373955_0257773_70_879 | 268 |
| 261 | 3300035724 | Ga0373933_0000525 | Ga0373933_0000525_10741_11547 | 268 |
| 262 | 3300037068 | Ga0373925_0444934 | Ga0373925_0444934_139_948 | 268 |
| 263 | 3300046455 | Ga0495603_0092670 | Ga0495603_0092670_77_883 | 268 |
| 264 | 3300046514 | Ga0495618_0198417 | Ga0495618_0198417_177_986 | 268 |
| 265 | 3300046515 | Ga0495620_0053851 | Ga0495620_0053851_844_1650 | 268 |
| 266 | 3300046516 | Ga0495628_0097639 | Ga0495628_0097639_255_1064 | 268 |
| 267 | 3300046517 | Ga0495630_0234467 | Ga0495630_0234467_127_936 | 268 |
| 268 | 3300046529 | Ga0495652_0138526 | Ga0495652_0138526_753_1562 | 268 |
| 269 | 3300046533 | Ga0495640_0137894 | Ga0495640_0137894_724_1533 | 268 |
| 270 | 3300046535 | Ga0495586_0261762 | Ga0495586_0261762_10_819 | 268 |
| 271 | 3300046536 | Ga0495587_0146093 | Ga0495587_0146093_156_965 | 268 |
| 272 | 3300046543 | Ga0495645_0010074 | Ga0495645_0010074_5018_5827 | 268 |
| 273 | 3300046642 | Ga0495634_0149944 | Ga0495634_0149944_395_1204 | 268 |
| 274 | 3300046663 | Ga0495635_0369391 | Ga0495635_0369391_44_853 | 268 |
| 275 | 3300046809 | Ga0495600_0077880 | Ga0495600_0077880_160_969 | 268 |
| 276 | 3300047317 | Ga0495604_0137754 | Ga0495604_0137754_610_1419 | 268 |
| 277 | 3300047321 | Ga0495676_0412234 | Ga0495676_0412234_24_830 | 268 |
| 278 | 3300047322 | Ga0495680_0195468 | Ga0495680_0195468_328_1137 | 268 |
| 279 | 3300047444 | Ga0495675_0064556 | Ga0495675_0064556_982_1791 | 268 |
| 280 | 3300048924 | Ga0496121_0337810 | Ga0496121_0337810_122_928 | 268 |
| 281 | 3300048927 | Ga0496124_0043676 | Ga0496124_0043676_2911_3717 | 268 |
| 282 | 3300048929 | Ga0496126_0041504 | Ga0496126_0041504_2235_3041 | 268 |
| 283 | 3300048929 | Ga0496126_0201022 | Ga0496126_0201022_123_929 | 268 |
| 284 | 3300053078 | Ga0495612_0042894 | Ga0495612_0042894_771_1580 | 268 |
| 285 | 3300053092 | Ga0500583_0111862 | Ga0500583_0111862_484_1290 | 268 |
| 286 | 3300053102 | Ga0500554_105126 | Ga0500554_105126_51_857 | 268 |
| 287 | 3300053119 | Ga0500595_000684 | Ga0500595_000684_4223_5029 | 268 |
| 288 | 3300053162 | Ga0500638_000692 | Ga0500638_000692_263_1069 | 268 |
| 289 | 3300053178 | Ga0500637_0003838 | Ga0500637_0003838_1542_2348 | 268 |
| 290 | iso_pu_bacteria | 2524023210 | 2524468256 | 268 |
| 291 | iso_pu_bacteria | 2602042107 | 2603861384 | 268 |
| 292 | iso_pu_bacteria | 2874604998 | 2874607207 | 268 |
| 293 | iso_pu_bacteria | 2885383462 | 2885391954 | 268 |
| 294 | iso_pu_bacteria | 2893066018 | 2893066048 | 268 |
| 295 | iso_pu_bacteria | 2903768456 | 2903774851 | 268 |
| 296 | iso_pu_bacteria | 2919073203 | 2919079573 | 268 |
| 297 | iso_pu_bacteria | 2922386360 | 2922386928 | 268 |
| 298 | iso_pu_bacteria | 8006964411 | 8006968866 | 268 |
| 299 | iso_pu_bacteria | 8056673599 | 8056677522 | 268 |
| 300 | iso_pu_bacteria | 8056681323 | 8056687297 | 268 |
| 301 | 3300005436 | Ga0070713_100101671 | Ga0070713_1001016714 | 269 |
| 302 | 3300005437 | Ga0070710_10037034 | Ga0070710_100370342 | 269 |
| 303 | 3300005439 | Ga0070711_100165385 | Ga0070711_1001653852 | 269 |
| 304 | 3300005471 | Ga0070698_100275392 | Ga0070698_1002753923 | 269 |
| 305 | 3300005937 | Ga0081455_10000369 | Ga0081455_1000036929 | 269 |
| 306 | 3300005985 | Ga0081539_10006739 | Ga0081539_100067398 | 269 |
| 307 | 3300005985 | Ga0081539_10135549 | Ga0081539_101355491 | 269 |
| 308 | 3300006175 | Ga0070712_100040184 | Ga0070712_1000401844 | 269 |
| 309 | 3300006847 | Ga0075431_100395566 | Ga0075431_1003955662 | 269 |
| 310 | 3300009093 | Ga0105240_10297915 | Ga0105240_102979152 | 269 |
| 311 | 3300009098 | Ga0105245_10073655 | Ga0105245_100736552 | 269 |
| 312 | 3300009545 | Ga0105237_10201180 | Ga0105237_102011802 | 269 |
| 313 | 3300009553 | Ga0105249_10044779 | Ga0105249_100447794 | 269 |
| 314 | 3300011119 | Ga0105246_10020487 | Ga0105246_100204877 | 269 |
| 315 | 3300013296 | Ga0157374_10140035 | Ga0157374_101400352 | 269 |
| 316 | 3300013296 | Ga0157374_10331150 | Ga0157374_103311502 | 269 |
| 317 | 3300014969 | Ga0157376_10258921 | Ga0157376_102589212 | 269 |
| 318 | 3300025898 | Ga0207692_10111208 | Ga0207692_101112082 | 269 |
| 319 | 3300025910 | Ga0207684_10072538 | Ga0207684_100725382 | 269 |
| 320 | 3300025915 | Ga0207693_10038986 | Ga0207693_100389864 | 269 |
| 321 | 3300025928 | Ga0207700_10039891 | Ga0207700_100398912 | 269 |
| 322 | 3300036401 | Ga0373937_0663941 | Ga0373937_0663941_59_871 | 269 |
| 323 | 3300037418 | Ga0395900_0605898 | Ga0395900_0605898_32_844 | 269 |
| 324 | 3300038443 | Ga0395901_0128609 | Ga0395901_0128609_108_920 | 269 |
| 325 | 3300038443 | Ga0395901_0525841 | Ga0395901_0525841_323_1135 | 269 |
| 326 | 3300039447 | Ga0436361_0963296 | Ga0436361_0963296_23245_24057 | 269 |
| 327 | 3300042157 | Ga0439458_0042818 | Ga0439458_0042818_116_925 | 269 |
| 328 | 3300046455 | Ga0495603_0209466 | Ga0495603_0209466_266_1078 | 269 |
| 329 | 3300046457 | Ga0495590_0055792 | Ga0495590_0055792_123_932 | 269 |
| 330 | 3300046460 | Ga0495638_0081828 | Ga0495638_0081828_270_1079 | 269 |
| 331 | 3300046462 | Ga0495651_0104233 | Ga0495651_0104233_1167_1976 | 269 |
| 332 | 3300046472 | Ga0495580_0249664 | Ga0495580_0249664_228_1037 | 269 |
| 333 | 3300046474 | Ga0495605_0144212 | Ga0495605_0144212_198_1007 | 269 |
| 334 | 3300046492 | Ga0495585_0022317 | Ga0495585_0022317_652_1461 | 269 |
| 335 | 3300046492 | Ga0495585_0099114 | Ga0495585_0099114_84_893 | 269 |
| 336 | 3300046492 | Ga0495585_0177949 | Ga0495585_0177949_257_1066 | 269 |
| 337 | 3300046500 | Ga0495596_0060216 | Ga0495596_0060216_189_998 | 269 |
| 338 | 3300046506 | Ga0495583_0139981 | Ga0495583_0139981_173_982 | 269 |
| 339 | 3300046519 | Ga0495632_0038355 | Ga0495632_0038355_468_1277 | 269 |
| 340 | 3300046523 | Ga0495644_0079259 | Ga0495644_0079259_126_935 | 269 |
| 341 | 3300046538 | Ga0495609_0087916 | Ga0495609_0087916_307_1116 | 269 |
| 342 | 3300046615 | Ga0495656_0004171 | Ga0495656_0004171_1865_2674 | 269 |
| 343 | 3300046616 | Ga0495668_0030735 | Ga0495668_0030735_217_1026 | 269 |
| 344 | 3300046616 | Ga0495668_0151857 | Ga0495668_0151857_158_967 | 269 |
| 345 | 3300046616 | Ga0495668_0176457 | Ga0495668_0176457_113_922 | 269 |
| 346 | 3300046660 | Ga0495625_0078976 | Ga0495625_0078976_353_1162 | 269 |
| 347 | 3300046674 | Ga0495588_0068276 | Ga0495588_0068276_945_1754 | 269 |
| 348 | 3300046679 | Ga0495623_0102854 | Ga0495623_0102854_91_900 | 269 |
| 349 | 3300046683 | Ga0495658_0196172 | Ga0495658_0196172_89_901 | 269 |
| 350 | 3300046684 | Ga0495669_0005740 | Ga0495669_0005740_3691_4500 | 269 |
| 351 | 3300047318 | Ga0495636_0109567 | Ga0495636_0109567_187_996 | 269 |
| 352 | 3300047445 | Ga0495677_0048996 | Ga0495677_0048996_45_854 | 269 |
| 353 | 3300048904 | Ga0496101_0087397 | Ga0496101_0087397_72_881 | 269 |
| 354 | 3300048907 | Ga0496104_0138493 | Ga0496104_0138493_844_1653 | 269 |
| 355 | 3300048909 | Ga0496106_0001821 | Ga0496106_0001821_791_1657 | 269 |
| 356 | 3300048910 | Ga0496107_0305870 | Ga0496107_0305870_239_1048 | 269 |
| 357 | 3300048911 | Ga0496108_0026124 | Ga0496108_0026124_3560_4426 | 269 |
| 358 | 3300048911 | Ga0496108_0029443 | Ga0496108_0029443_1901_2713 | 269 |
| 359 | 3300048912 | Ga0496109_0092100 | Ga0496109_0092100_813_1679 | 269 |
| 360 | 3300048913 | Ga0496110_0017878 | Ga0496110_0017878_4310_5122 | 269 |
| 361 | 3300048914 | Ga0496111_0006299 | Ga0496111_0006299_862_1674 | 269 |
| 362 | 3300048914 | Ga0496111_0148946 | Ga0496111_0148946_373_1239 | 269 |
| 363 | 3300048915 | Ga0496112_0012397 | Ga0496112_0012397_813_1679 | 269 |
| 364 | 3300048915 | Ga0496112_0334774 | Ga0496112_0334774_445_1257 | 269 |
| 365 | 3300048916 | Ga0496113_0111452 | Ga0496113_0111452_244_1056 | 269 |
| 366 | 3300048918 | Ga0496115_0169715 | Ga0496115_0169715_43_855 | 269 |
| 367 | 3300048921 | Ga0496118_0162401 | Ga0496118_0162401_141_950 | 269 |
| 368 | 3300048924 | Ga0496121_0038847 | Ga0496121_0038847_3007_3816 | 269 |
| 369 | 3300048924 | Ga0496121_0093399 | Ga0496121_0093399_1520_2329 | 269 |
| 370 | 3300048924 | Ga0496121_0427860 | Ga0496121_0427860_14_823 | 269 |
| 371 | 3300048929 | Ga0496126_0002321 | Ga0496126_0002321_7220_8029 | 269 |
| 372 | 3300048929 | Ga0496126_0088238 | Ga0496126_0088238_25_834 | 269 |
| 373 | 3300048929 | Ga0496126_0158823 | Ga0496126_0158823_985_1794 | 269 |
| 374 | 3300049574 | Ga0501038_0198166 | Ga0501038_0198166_298_1107 | 269 |
| 375 | 3300049575 | Ga0501039_0326622 | Ga0501039_0326622_314_1123 | 269 |
| 376 | 3300049577 | Ga0501041_0084197 | Ga0501041_0084197_300_1109 | 269 |
| 377 | 3300049580 | Ga0501046_0040825 | Ga0501046_0040825_1902_2711 | 269 |
| 378 | 3300049580 | Ga0501046_0091190 | Ga0501046_0091190_830_1639 | 269 |
| 379 | 3300049583 | Ga0501067_0088804 | Ga0501067_0088804_814_1623 | 269 |
| 380 | 3300049583 | Ga0501067_0200997 | Ga0501067_0200997_53_865 | 269 |
| 381 | 3300049585 | Ga0501069_0061378 | Ga0501069_0061378_1266_2075 | 269 |
| 382 | 3300049588 | Ga0501072_0223820 | Ga0501072_0223820_119_928 | 269 |
| 383 | 3300049591 | Ga0501075_0144795 | Ga0501075_0144795_667_1476 | 269 |
| 384 | 3300049593 | Ga0501077_0014711 | Ga0501077_0014711_1066_1875 | 269 |
| 385 | 3300049593 | Ga0501077_0206056 | Ga0501077_0206056_365_1174 | 269 |
| 386 | 3300049741 | Ga0501079_0140690 | Ga0501079_0140690_595_1404 | 269 |
| 387 | 3300049743 | Ga0501081_0029563 | Ga0501081_0029563_1338_2147 | 269 |
| 388 | 3300049743 | Ga0501081_0140374 | Ga0501081_0140374_166_975 | 269 |
| 389 | 3300050490 | nmdc:mga03n38_3689_c1 | nmdc:mga03n38_3689_c1_3046_3855 | 269 |
| 390 | 3300050491 | nmdc:mga00v17_183550_c1 | nmdc:mga00v17_183550_c1_513_1322 | 269 |
| 391 | 3300050492 | nmdc:mga0yw44_5628_c1 | nmdc:mga0yw44_5628_c1_1716_2525 | 269 |
| 392 | 3300050493 | nmdc:mga0k408_242671_c1 | nmdc:mga0k408_242671_c1_106_915 | 269 |
| 393 | 3300050496 | nmdc:mga07m45_41598_c1 | nmdc:mga07m45_41598_c1_1427_2236 | 269 |
| 394 | 3300050507 | nmdc:mga05p37_583626_c1 | nmdc:mga05p37_583626_c1_217_1029 | 269 |
| 395 | 3300050507 | nmdc:mga05p37_67138_c1 | nmdc:mga05p37_67138_c1_974_1783 | 269 |
| 396 | 3300050510 | nmdc:mga06r32_279243_c1 | nmdc:mga06r32_279243_c1_477_1289 | 269 |
| 397 | 3300050516 | nmdc:mga0sz30_135139_c1 | nmdc:mga0sz30_135139_c1_176_985 | 269 |
| 398 | 3300053078 | Ga0495612_0135655 | Ga0495612_0135655_87_896 | 269 |
| 399 | 3300053093 | Ga0500651_0173889 | Ga0500651_0173889_269_1078 | 269 |
| 400 | 3300053096 | Ga0500641_0091096 | Ga0500641_0091096_366_1175 | 269 |
| 401 | 3300053730 | Ga0500645_039475 | Ga0500645_039475_532_1341 | 269 |
| 402 | 3300054114 | Ga0501084_0061045 | Ga0501084_0061045_2287_3096 | 269 |
| 403 | 3300060353 | Ga0501082_0126954 | Ga0501082_0126954_32_841 | 269 |
| 404 | 3300060353 | Ga0501082_0275958 | Ga0501082_0275958_300_1109 | 269 |
| 405 | 3300061734 | Ga0530510_0244774 | Ga0530510_0244774_90_899 | 269 |
| 406 | 3300061734 | Ga0530510_0399081 | Ga0530510_0399081_200_1009 | 269 |
| 407 | iso_pu_bacteria | 2513237096 | 2513654203 | 269 |
| 408 | iso_pu_bacteria | 2513237098 | 2513674879 | 269 |
| 409 | iso_pu_bacteria | 2513237137 | 2513856958 | 269 |
| 410 | iso_pu_bacteria | 2513237145 | 2513918543 | 269 |
| 411 | iso_pu_bacteria | 2517572143 | 2517891221 | 269 |
| 412 | iso_pu_bacteria | 2524023228 | 2524533584 | 269 |
| 413 | iso_pu_bacteria | 2667528175 | 2671123172 | 269 |
| 414 | iso_pu_bacteria | 2728368998 | 2728749923 | 269 |
| 415 | iso_pu_bacteria | 2791355197 | 2793066576 | 269 |
| 416 | iso_pu_bacteria | 2791355199 | 2793083899 | 269 |
| 417 | iso_pu_bacteria | 2879110137 | 2879114096 | 269 |
| 418 | iso_pu_bacteria | 2881665667 | 2881672199 | 269 |
| 419 | iso_pu_bacteria | 2885374607 | 2885383115 | 269 |
| 420 | iso_pu_bacteria | 2903748898 | 2903751216 | 269 |
| 421 | iso_pu_bacteria | 2904690495 | 2904694159 | 269 |
| 422 | iso_pu_bacteria | 2904699407 | 2904701124 | 269 |
| 423 | iso_pu_bacteria | 2906610324 | 2906616405 | 269 |
| 424 | iso_pu_bacteria | 2906635258 | 2906638140 | 269 |
| 425 | iso_pu_bacteria | 2906660503 | 2906662815 | 269 |
| 426 | iso_pu_bacteria | 2908739725 | 2908741549 | 269 |
| 427 | iso_pu_bacteria | 2908756301 | 2908759005 | 269 |
| 428 | iso_pu_bacteria | 2922361189 | 2922361838 | 269 |
| 429 | iso_pu_bacteria | 2922425934 | 2922431591 | 269 |
| 430 | iso_pu_bacteria | 2932801729 | 2932805556 | 269 |
| 431 | iso_pu_bacteria | 2935883170 | 2935885757 | 269 |
| 432 | iso_pu_bacteria | 3005474847 | 3005481383 | 269 |
| 433 | iso_pu_bacteria | 8006933436 | 8006939324 | 269 |
| 434 | iso_pu_bacteria | 8006973647 | 8006978981 | 269 |
| 435 | iso_pu_bacteria | 8019555841 | 8019565194 | 269 |
| 436 | iso_pu_bacteria | 8019565922 | 8019575294 | 269 |
| 437 | iso_pu_bacteria | 8056689827 | 8056690678 | 269 |
| 438 | 3300003911 | JGI25405J52794_10017435 | JGI25405J52794_100174352 | 270 |
| 439 | 3300005341 | Ga0070691_10014629 | Ga0070691_100146291 | 270 |
| 440 | 3300005439 | Ga0070711_100032926 | Ga0070711_1000329261 | 270 |
| 441 | 3300005536 | Ga0070697_100349224 | Ga0070697_1003492242 | 270 |
| 442 | 3300005937 | Ga0081455_10000014 | Ga0081455_1000001494 | 270 |
| 443 | 3300005983 | Ga0081540_1008008 | Ga0081540_10080083 | 270 |
| 444 | 3300006051 | Ga0075364_10093466 | Ga0075364_100934662 | 270 |
| 445 | 3300006058 | Ga0075432_10024821 | Ga0075432_100248213 | 270 |
| 446 | 3300006177 | Ga0075362_10008875 | Ga0075362_100088755 | 270 |
| 447 | 3300006852 | Ga0075433_10011738 | Ga0075433_100117383 | 270 |
| 448 | 3300006852 | Ga0075433_10339818 | Ga0075433_103398182 | 270 |
| 449 | 3300006871 | Ga0075434_100006402 | Ga0075434_1000064028 | 270 |
| 450 | 3300006871 | Ga0075434_100414574 | Ga0075434_1004145742 | 270 |
| 451 | 3300007076 | Ga0075435_100013816 | Ga0075435_1000138163 | 270 |
| 452 | 3300009094 | Ga0111539_10003490 | Ga0111539_100034903 | 270 |
| 453 | 3300009094 | Ga0111539_10009581 | Ga0111539_100095816 | 270 |
| 454 | 3300009147 | Ga0114129_10101542 | Ga0114129_101015423 | 270 |
| 455 | 3300009147 | Ga0114129_10285905 | Ga0114129_102859052 | 270 |
| 456 | 3300009551 | Ga0105238_10328097 | Ga0105238_103280972 | 270 |
| 457 | 3300012481 | Ga0157320_1002965 | Ga0157320_10029651 | 270 |
| 458 | 3300013100 | Ga0157373_10036645 | Ga0157373_100366452 | 270 |
| 459 | 3300014326 | Ga0157380_10088615 | Ga0157380_100886152 | 270 |
| 460 | 3300025909 | Ga0207705_10144574 | Ga0207705_101445742 | 270 |
| 461 | 3300025916 | Ga0207663_10009791 | Ga0207663_100097914 | 270 |
| 462 | 3300025919 | Ga0207657_10504955 | Ga0207657_105049551 | 270 |
| 463 | 3300027907 | Ga0207428_10042238 | Ga0207428_100422382 | 270 |
| 464 | 3300027907 | Ga0207428_10043309 | Ga0207428_100433093 | 270 |
| 465 | 3300034957 | Ga0373938_0014174 | Ga0373938_0014174_660_1472 | 270 |
| 466 | 3300035088 | Ga0373940_0004827 | Ga0373940_0004827_172_984 | 270 |
| 467 | 3300035114 | Ga0373939_0031764 | Ga0373939_0031764_674_1486 | 270 |
| 468 | 3300035207 | Ga0373942_0013102 | Ga0373942_0013102_96_908 | 270 |
| 469 | 3300035241 | Ga0373961_0017050 | Ga0373961_0017050_349_1161 | 270 |
| 470 | 3300035691 | Ga0373931_0001094 | Ga0373931_0001094_6226_7038 | 270 |
| 471 | 3300037312 | Ga0395899_0290610 | Ga0395899_0290610_57_869 | 270 |
| 472 | 3300039447 | Ga0436361_0085886 | Ga0436361_0085886_84_896 | 270 |
| 473 | 3300039447 | Ga0436361_0956174 | Ga0436361_0956174_1160_1972 | 270 |
| 474 | 3300039450 | Ga0436363_0594913 | Ga0436363_0594913_117_929 | 270 |
| 475 | 3300044735 | Ga0466968_0169503 | Ga0466968_0169503_34_846 | 270 |
| 476 | 3300048904 | Ga0496101_0295873 | Ga0496101_0295873_209_1021 | 270 |
| 477 | 3300048918 | Ga0496115_0101085 | Ga0496115_0101085_501_1313 | 270 |
| 478 | 3300049572 | Ga0501036_0514610 | Ga0501036_0514610_42_854 | 270 |
| 479 | 3300049574 | Ga0501038_0196450 | Ga0501038_0196450_94_990 | 270 |
| 480 | 3300049580 | Ga0501046_0194684 | Ga0501046_0194684_191_1048 | 270 |
| 481 | 3300049580 | Ga0501046_0213456 | Ga0501046_0213456_183_995 | 270 |
| 482 | 3300049581 | Ga0501047_0459864 | Ga0501047_0459864_94_906 | 270 |
| 483 | 3300049583 | Ga0501067_0135773 | Ga0501067_0135773_315_1127 | 270 |
| 484 | 3300049584 | Ga0501068_0250435 | Ga0501068_0250435_141_953 | 270 |
| 485 | 3300049586 | Ga0501070_0295893 | Ga0501070_0295893_193_1005 | 270 |
| 486 | 3300049587 | Ga0501071_0077327 | Ga0501071_0077327_20_832 | 270 |
| 487 | 3300049588 | Ga0501072_0101896 | Ga0501072_0101896_715_1572 | 270 |
| 488 | 3300049591 | Ga0501075_0064417 | Ga0501075_0064417_330_1187 | 270 |
| 489 | 3300049593 | Ga0501077_0036219 | Ga0501077_0036219_1226_2083 | 270 |
| 490 | 3300049593 | Ga0501077_0151859 | Ga0501077_0151859_507_1319 | 270 |
| 491 | 3300049741 | Ga0501079_0099269 | Ga0501079_0099269_1229_2086 | 270 |
| 492 | 3300049742 | Ga0501080_0113336 | Ga0501080_0113336_503_1360 | 270 |
| 493 | 3300049743 | Ga0501081_0091209 | Ga0501081_0091209_1186_1998 | 270 |
| 494 | 3300050491 | nmdc:mga00v17_78350_c1 | nmdc:mga00v17_78350_c1_509_1327 | 270 |
| 495 | 3300050492 | nmdc:mga0yw44_7624_c1 | nmdc:mga0yw44_7624_c1_707_1525 | 270 |
| 496 | 3300050510 | nmdc:mga06r32_398955_c1 | nmdc:mga06r32_398955_c1_332_1144 | 270 |
| 497 | 3300050511 | nmdc:mga08y16_1102_c1 | nmdc:mga08y16_1102_c1_12737_13549 | 270 |
| 498 | 3300050511 | nmdc:mga08y16_311002_c1 | nmdc:mga08y16_311002_c1_406_1218 | 270 |
| 499 | 3300050512 | nmdc:mga0n895_3720_c1 | nmdc:mga0n895_3720_c1_4260_5072 | 270 |
| 500 | 3300050513 | nmdc:mga0rr50_34020_c1 | nmdc:mga0rr50_34020_c1_625_1437 | 270 |
| 501 | 3300050514 | nmdc:mga08x19_54648_c1 | nmdc:mga08x19_54648_c1_1391_2203 | 270 |
| 502 | 3300050515 | nmdc:mga0a205_185816_c1 | nmdc:mga0a205_185816_c1_256_1068 | 270 |
| 503 | 3300050515 | nmdc:mga0a205_212352_c1 | nmdc:mga0a205_212352_c1_800_1612 | 270 |
| 504 | 3300050515 | nmdc:mga0a205_67245_c1 | nmdc:mga0a205_67245_c1_748_1560 | 270 |
| 505 | 3300054114 | Ga0501084_0007035 | Ga0501084_0007035_1285_2142 | 270 |
| 506 | 3300060353 | Ga0501082_0196486 | Ga0501082_0196486_339_1151 | 270 |
| 507 | iso_pu_bacteria | 2507262055 | 2507507545 | 270 |
| 508 | iso_pu_bacteria | 2508501009 | 2508541663 | 270 |
| 509 | iso_pu_bacteria | 2508501042 | 2508692799 | 270 |
| 510 | iso_pu_bacteria | 2511231028 | 2511394841 | 270 |
| 511 | iso_pu_bacteria | 2513237092 | 2513621740 | 270 |
| 512 | iso_pu_bacteria | 2513237094 | 2513636816 | 270 |
| 513 | iso_pu_bacteria | 2513237095 | 2513651237 | 270 |
| 514 | iso_pu_bacteria | 2513237101 | 2513697142 | 270 |
| 515 | iso_pu_bacteria | 2513237102 | 2513700862 | 270 |
| 516 | iso_pu_bacteria | 2513237139 | 2513878766 | 270 |
| 517 | iso_pu_bacteria | 2513237161 | 2514011807 | 270 |
| 518 | iso_pu_bacteria | 2515154112 | 2515626192 | 270 |
| 519 | iso_pu_bacteria | 2517093001 | 2517104293 | 270 |
| 520 | iso_pu_bacteria | 2524023205 | 2524436160 | 270 |
| 521 | iso_pu_bacteria | 2528768022 | 2528848856 | 270 |
| 522 | iso_pu_bacteria | 2617270735 | 2617346920 | 270 |
| 523 | iso_pu_bacteria | 2617270741 | 2617372849 | 270 |
| 524 | iso_pu_bacteria | 2721755755 | 2723843583 | 270 |
| 525 | iso_pu_bacteria | 2744054633 | 2745080884 | 270 |
| 526 | iso_pu_bacteria | 2791355196 | 2793060992 | 270 |
| 527 | iso_pu_bacteria | 2802429603 | 2805921415 | 270 |
| 528 | iso_pu_bacteria | 2816332527 | 2818236684 | 270 |
| 529 | iso_pu_bacteria | 2824600985 | 2824602901 | 270 |
| 530 | iso_pu_bacteria | 2824609381 | 2824611876 | 270 |
| 531 | iso_pu_bacteria | 2824617872 | 2824621489 | 270 |
| 532 | iso_pu_bacteria | 2824626560 | 2824630601 | 270 |
| 533 | iso_pu_bacteria | 2824635225 | 2824638695 | 270 |
| 534 | iso_pu_bacteria | 2824644064 | 2824650110 | 270 |
| 535 | iso_pu_bacteria | 2824653114 | 2824660932 | 270 |
| 536 | iso_pu_bacteria | 2824661429 | 2824664486 | 270 |
| 537 | iso_pu_bacteria | 2824671348 | 2824672227 | 270 |
| 538 | iso_pu_bacteria | 2824679649 | 2824682173 | 270 |
| 539 | iso_pu_bacteria | 2824687955 | 2824688890 | 270 |
| 540 | iso_pu_bacteria | 2824696289 | 2824697727 | 270 |
| 541 | iso_pu_bacteria | 2824704595 | 2824709232 | 270 |
| 542 | iso_pu_bacteria | 2824714736 | 2824719044 | 270 |
| 543 | iso_pu_bacteria | 2824723954 | 2824730403 | 270 |
| 544 | iso_pu_bacteria | 2824732956 | 2824733931 | 270 |
| 545 | iso_pu_bacteria | 2824746037 | 2824748363 | 270 |
| 546 | iso_pu_bacteria | 2824753945 | 2824758005 | 270 |
| 547 | iso_pu_bacteria | 2824763712 | 2824766460 | 270 |
| 548 | iso_pu_bacteria | 2824773399 | 2824776583 | 270 |
| 549 | iso_pu_bacteria | 2838122688 | 2838129339 | 270 |
| 550 | iso_pu_bacteria | 2841941048 | 2841947998 | 270 |
| 551 | iso_pu_bacteria | 2841949485 | 2841953597 | 270 |
| 552 | iso_pu_bacteria | 2841957949 | 2841962793 | 270 |
| 553 | iso_pu_bacteria | 2841966195 | 2841972998 | 270 |
| 554 | iso_pu_bacteria | 2841974524 | 2841978331 | 270 |
| 555 | iso_pu_bacteria | 2841983080 | 2841990544 | 270 |
| 556 | iso_pu_bacteria | 2842038055 | 2842040769 | 270 |
| 557 | iso_pu_bacteria | 2842045827 | 2842046285 | 270 |
| 558 | iso_pu_bacteria | 2844315083 | 2844320145 | 270 |
| 559 | iso_pu_bacteria | 2847930680 | 2847937444 | 270 |
| 560 | iso_pu_bacteria | 2847939898 | 2847947869 | 270 |
| 561 | iso_pu_bacteria | 2849076700 | 2849078278 | 270 |
| 562 | iso_pu_bacteria | 2857509624 | 2857512661 | 270 |
| 563 | iso_pu_bacteria | 2874590934 | 2874598659 | 270 |
| 564 | iso_pu_bacteria | 2874612657 | 2874614453 | 270 |
| 565 | iso_pu_bacteria | 2874620515 | 2874628194 | 270 |
| 566 | iso_pu_bacteria | 2874628541 | 2874630201 | 270 |
| 567 | iso_pu_bacteria | 2874645413 | 2874652114 | 270 |
| 568 | iso_pu_bacteria | 2876771140 | 2876778698 | 270 |
| 569 | iso_pu_bacteria | 2876818435 | 2876823502 | 270 |
| 570 | iso_pu_bacteria | 2879074833 | 2879082491 | 270 |
| 571 | iso_pu_bacteria | 2879083081 | 2879084857 | 270 |
| 572 | iso_pu_bacteria | 2879099564 | 2879107835 | 270 |
| 573 | iso_pu_bacteria | 2879127579 | 2879131729 | 270 |
| 574 | iso_pu_bacteria | 2879142872 | 2879150065 | 270 |
| 575 | iso_pu_bacteria | 2881364244 | 2881371340 | 270 |
| 576 | iso_pu_bacteria | 2885366525 | 2885370086 | 270 |
| 577 | iso_pu_bacteria | 2885409591 | 2885415614 | 270 |
| 578 | iso_pu_bacteria | 2888378607 | 2888385586 | 270 |
| 579 | iso_pu_bacteria | 2888388044 | 2888392665 | 270 |
| 580 | iso_pu_bacteria | 2888419890 | 2888425713 | 270 |
| 581 | iso_pu_bacteria | 2889033259 | 2889037901 | 270 |
| 582 | iso_pu_bacteria | 2903727486 | 2903731261 | 270 |
| 583 | iso_pu_bacteria | 2904666416 | 2904674188 | 270 |
| 584 | iso_pu_bacteria | 2904711408 | 2904711842 | 270 |
| 585 | iso_pu_bacteria | 2906602504 | 2906609970 | 270 |
| 586 | iso_pu_bacteria | 2906626472 | 2906627724 | 270 |
| 587 | iso_pu_bacteria | 2906643746 | 2906649604 | 270 |
| 588 | iso_pu_bacteria | 2908775508 | 2908781296 | 270 |
| 589 | iso_pu_bacteria | 2922368715 | 2922375840 | 270 |
| 590 | iso_pu_bacteria | 2922393267 | 2922396951 | 270 |
| 591 | iso_pu_bacteria | 2929615660 | 2929621154 | 270 |
| 592 | iso_pu_bacteria | 2929624759 | 2929626015 | 270 |
| 593 | iso_pu_bacteria | 2932784394 | 2932785106 | 270 |
| 594 | iso_pu_bacteria | 2932794094 | 2932795029 | 270 |
| 595 | iso_pu_bacteria | 2932809354 | 2932810134 | 270 |
| 596 | iso_pu_bacteria | 2932818245 | 2932821707 | 270 |
| 597 | iso_pu_bacteria | 2932828146 | 2932828943 | 270 |
| 598 | iso_pu_bacteria | 2933577622 | 2933582977 | 270 |
| 599 | iso_pu_bacteria | 2935608549 | 2935609947 | 270 |
| 600 | iso_pu_bacteria | 2935616580 | 2935619638 | 270 |
| 601 | iso_pu_bacteria | 2935630451 | 2935636109 | 270 |
| 602 | iso_pu_bacteria | 2935638405 | 2935638618 | 270 |
| 603 | iso_pu_bacteria | 2935648319 | 2935652021 | 270 |
| 604 | iso_pu_bacteria | 2935656913 | 2935660006 | 270 |
| 605 | iso_pu_bacteria | 2935665750 | 2935666530 | 270 |
| 606 | iso_pu_bacteria | 2935675223 | 2935676427 | 270 |
| 607 | iso_pu_bacteria | 2935684952 | 2935691057 | 270 |
| 608 | iso_pu_bacteria | 2935694250 | 2935694509 | 270 |
| 609 | iso_pu_bacteria | 2935703347 | 2935703624 | 270 |
| 610 | iso_pu_bacteria | 2935713505 | 2935718438 | 270 |
| 611 | iso_pu_bacteria | 2935722832 | 2935727582 | 270 |
| 612 | iso_pu_bacteria | 2935732158 | 2935736285 | 270 |
| 613 | iso_pu_bacteria | 2935741537 | 2935745665 | 270 |
| 614 | iso_pu_bacteria | 2935750917 | 2935756046 | 270 |
| 615 | iso_pu_bacteria | 2935760218 | 2935760694 | 270 |
| 616 | iso_pu_bacteria | 2935769743 | 2935776105 | 270 |
| 617 | iso_pu_bacteria | 2935777560 | 2935785140 | 270 |
| 618 | iso_pu_bacteria | 2935785616 | 2935791882 | 270 |
| 619 | iso_pu_bacteria | 2935793552 | 2935800308 | 270 |
| 620 | iso_pu_bacteria | 2935801545 | 2935801761 | 270 |
| 621 | iso_pu_bacteria | 2935810662 | 2935814823 | 270 |
| 622 | iso_pu_bacteria | 2935819856 | 2935823107 | 270 |
| 623 | iso_pu_bacteria | 2935827899 | 2935828112 | 270 |
| 624 | iso_pu_bacteria | 2935837841 | 2935842317 | 270 |
| 625 | iso_pu_bacteria | 2935847175 | 2935848689 | 270 |
| 626 | iso_pu_bacteria | 2935855204 | 2935858047 | 270 |
| 627 | iso_pu_bacteria | 2935864058 | 2935867951 | 270 |
| 628 | iso_pu_bacteria | 2935873716 | 2935874025 | 270 |
| 629 | iso_pu_bacteria | 2935908558 | 2935909505 | 270 |
| 630 | iso_pu_bacteria | 2935916978 | 2935917229 | 270 |
| 631 | iso_pu_bacteria | 2935926038 | 2935926986 | 270 |
| 632 | iso_pu_bacteria | 2935934488 | 2935937170 | 270 |
| 633 | iso_pu_bacteria | 2935942939 | 2935944527 | 270 |
| 634 | iso_pu_bacteria | 2935951376 | 2935952964 | 270 |
| 635 | iso_pu_bacteria | 2935959822 | 2935962848 | 270 |
| 636 | iso_pu_bacteria | 2935967501 | 2935969804 | 270 |
| 637 | iso_pu_bacteria | 2935975950 | 2935976401 | 270 |
| 638 | iso_pu_bacteria | 2935984226 | 2935987151 | 270 |
| 639 | iso_pu_bacteria | 2935992306 | 2935993050 | 270 |
| 640 | iso_pu_bacteria | 2936002035 | 2936002962 | 270 |
| 641 | iso_pu_bacteria | 2936011229 | 2936014422 | 270 |
| 642 | iso_pu_bacteria | 2936019824 | 2936023738 | 270 |
| 643 | iso_pu_bacteria | 2936028420 | 2936031381 | 270 |
| 644 | iso_pu_bacteria | 2936037263 | 2936040534 | 270 |
| 645 | iso_pu_bacteria | 2936046547 | 2936049528 | 270 |
| 646 | iso_pu_bacteria | 2936055302 | 2936061257 | 270 |
| 647 | iso_pu_bacteria | 2940556831 | 2940561979 | 270 |
| 648 | iso_pu_bacteria | 2941507105 | 2941512740 | 270 |
| 649 | iso_pu_bacteria | 2941515067 | 2941520693 | 270 |
| 650 | iso_pu_bacteria | 2941523033 | 2941528708 | 270 |
| 651 | iso_pu_bacteria | 2941531003 | 2941531325 | 270 |
| 652 | iso_pu_bacteria | 2941538514 | 2941542366 | 270 |
| 653 | iso_pu_bacteria | 3005483717 | 3005485520 | 270 |
| 654 | iso_pu_bacteria | 3005506211 | 3005508323 | 270 |
| 655 | iso_pu_bacteria | 3005587118 | 3005588182 | 270 |
| 656 | iso_pu_bacteria | 3005594810 | 3005600447 | 270 |
| 657 | iso_pu_bacteria | 3005710791 | 3005715925 | 270 |
| 658 | iso_pu_bacteria | 3005718088 | 3005723283 | 270 |
| 659 | iso_pu_bacteria | 8006926726 | 8006933186 | 270 |
| 660 | iso_pu_bacteria | 8006984368 | 8006984548 | 270 |
| 661 | iso_pu_bacteria | 8006994254 | 8006997173 | 270 |
| 662 | iso_pu_bacteria | 8016511872 | 8016520518 | 270 |
| 663 | iso_pu_bacteria | 8016522445 | 8016528566 | 270 |
| 664 | iso_pu_bacteria | 8016530956 | 8016533733 | 270 |
| 665 | iso_pu_bacteria | 8016539877 | 8016546952 | 270 |
| 666 | iso_pu_bacteria | 8016548790 | 8016555162 | 270 |
| 667 | iso_pu_bacteria | 8016557553 | 8016563533 | 270 |
| 668 | iso_pu_bacteria | 8016566248 | 8016572064 | 270 |
| 669 | iso_pu_bacteria | 8016575299 | 8016576265 | 270 |
| 670 | iso_pu_bacteria | 8016583857 | 8016594496 | 270 |
| 671 | iso_pu_bacteria | 8016613128 | 8016615740 | 270 |
| 672 | iso_pu_bacteria | 8016630954 | 8016639046 | 270 |
| 673 | iso_pu_bacteria | 8017057580 | 8017065056 | 270 |
| 674 | iso_pu_bacteria | 8019530166 | 8019533509 | 270 |
| 675 | iso_pu_bacteria | 8019538911 | 8019546168 | 270 |
| 676 | iso_pu_bacteria | 8019547302 | 8019552542 | 270 |
| 677 | iso_pu_bacteria | 8019576017 | 8019584440 | 270 |
| 678 | iso_pu_bacteria | 8019586578 | 8019592212 | 270 |
| 679 | iso_pu_bacteria | 8019597564 | 8019599073 | 270 |
| 680 | iso_pu_bacteria | 8019608314 | 8019609289 | 270 |
| 681 | iso_pu_bacteria | 8019619141 | 8019619941 | 270 |
| 682 | iso_pu_bacteria | 8019629233 | 8019633171 | 270 |
| 683 | iso_pu_bacteria | 8019638758 | 8019646727 | 270 |
| 684 | iso_pu_bacteria | 8019648815 | 8019649498 | 270 |
| 685 | iso_pu_bacteria | 8019668869 | 8019670610 | 270 |
| 686 | iso_pu_bacteria | 8019678201 | 8019685624 | 270 |
| 687 | iso_pu_bacteria | 8019687851 | 8019691195 | 270 |
| 688 | iso_pu_bacteria | 8055742211 | 8055744984 | 270 |
| 689 | iso_pu_bacteria | 8056967851 | 8056974940 | 270 |
| 690 | 3300005341 | Ga0070691_10100882 | Ga0070691_101008821 | 271 |
| 691 | 3300005458 | Ga0070681_10227941 | Ga0070681_102279412 | 271 |
| 692 | 3300005535 | Ga0070684_100309590 | Ga0070684_1003095901 | 271 |
| 693 | 3300005563 | Ga0068855_100329202 | Ga0068855_1003292022 | 271 |
| 694 | 3300006844 | Ga0075428_100110072 | Ga0075428_1001100722 | 271 |
| 695 | 3300006852 | Ga0075433_10627769 | Ga0075433_106277691 | 271 |
| 696 | 3300007076 | Ga0075435_100043817 | Ga0075435_1000438175 | 271 |
| 697 | 3300009094 | Ga0111539_10013311 | Ga0111539_100133115 | 271 |
| 698 | 3300009094 | Ga0111539_10447984 | Ga0111539_104479842 | 271 |
| 699 | 3300009101 | Ga0105247_10025114 | Ga0105247_100251144 | 271 |
| 700 | 3300009147 | Ga0114129_10082645 | Ga0114129_100826452 | 271 |
| 701 | 3300025912 | Ga0207707_10201329 | Ga0207707_102013292 | 271 |
| 702 | 3300025917 | Ga0207660_10155323 | Ga0207660_101553232 | 271 |
| 703 | 3300025949 | Ga0207667_10278883 | Ga0207667_102788832 | 271 |
| 704 | 3300026035 | Ga0207703_10433103 | Ga0207703_104331032 | 271 |
| 705 | 3300026067 | Ga0207678_10108291 | Ga0207678_101082912 | 271 |
| 706 | 3300035170 | Ga0373943_0254186 | Ga0373943_0254186_80_895 | 271 |
| 707 | 3300035691 | Ga0373931_0078187 | Ga0373931_0078187_863_1678 | 271 |
| 708 | 3300035695 | Ga0373927_0071305 | Ga0373927_0071305_1282_2097 | 271 |
| 709 | 3300035725 | Ga0373947_0044567 | Ga0373947_0044567_1671_2486 | 271 |
| 710 | 3300046460 | Ga0495638_0059404 | Ga0495638_0059404_35_850 | 271 |
| 711 | 3300046460 | Ga0495638_0176631 | Ga0495638_0176631_122_937 | 271 |
| 712 | 3300046506 | Ga0495583_0069229 | Ga0495583_0069229_568_1383 | 271 |
| 713 | 3300046512 | Ga0495610_0054123 | Ga0495610_0054123_106_921 | 271 |
| 714 | 3300046513 | Ga0495616_0147570 | Ga0495616_0147570_63_878 | 271 |
| 715 | 3300046665 | Ga0495661_0110791 | Ga0495661_0110791_146_961 | 271 |
| 716 | 3300047317 | Ga0495604_0258591 | Ga0495604_0258591_329_1144 | 271 |
| 717 | 3300048903 | Ga0496100_0278027 | Ga0496100_0278027_33_848 | 271 |
| 718 | 3300048904 | Ga0496101_0280255 | Ga0496101_0280255_164_979 | 271 |
| 719 | 3300048905 | Ga0496102_0089596 | Ga0496102_0089596_1266_2081 | 271 |
| 720 | 3300048906 | Ga0496103_0286640 | Ga0496103_0286640_146_961 | 271 |
| 721 | 3300048907 | Ga0496104_0000814 | Ga0496104_0000814_20376_21191 | 271 |
| 722 | 3300048908 | Ga0496105_0180447 | Ga0496105_0180447_453_1268 | 271 |
| 723 | 3300048914 | Ga0496111_0200343 | Ga0496111_0200343_539_1354 | 271 |
| 724 | 3300048915 | Ga0496112_0303095 | Ga0496112_0303095_158_973 | 271 |
| 725 | 3300048916 | Ga0496113_0035177 | Ga0496113_0035177_1922_2737 | 271 |
| 726 | 3300048919 | Ga0496116_0180711 | Ga0496116_0180711_163_978 | 271 |
| 727 | 3300048920 | Ga0496117_0226139 | Ga0496117_0226139_90_905 | 271 |
| 728 | 3300048920 | Ga0496117_0247505 | Ga0496117_0247505_139_954 | 271 |
| 729 | 3300048921 | Ga0496118_0107622 | Ga0496118_0107622_1034_1849 | 271 |
| 730 | 3300048924 | Ga0496121_0008304 | Ga0496121_0008304_6404_7219 | 271 |
| 731 | 3300048925 | Ga0496122_0101806 | Ga0496122_0101806_68_883 | 271 |
| 732 | 3300048928 | Ga0496125_0017985 | Ga0496125_0017985_134_949 | 271 |
| 733 | 3300048929 | Ga0496126_0040235 | Ga0496126_0040235_1104_1919 | 271 |
| 734 | 3300050507 | nmdc:mga05p37_108066_c1 | nmdc:mga05p37_108066_c1_12_827 | 271 |
| 735 | 3300050511 | nmdc:mga08y16_18538_c1 | nmdc:mga08y16_18538_c1_5074_5889 | 271 |
| 736 | 3300050512 | nmdc:mga0n895_25454_c1 | nmdc:mga0n895_25454_c1_4413_5228 | 271 |
| 737 | 3300053087 | Ga0500643_014154 | Ga0500643_014154_241_1056 | 271 |
| 738 | 3300053089 | Ga0500581_092293 | Ga0500581_092293_475_1290 | 271 |
| 739 | 3300053096 | Ga0500641_0002755 | Ga0500641_0002755_1235_2050 | 271 |
| 740 | 3300053098 | Ga0500650_0122839 | Ga0500650_0122839_329_1144 | 271 |
| 741 | 3300053104 | Ga0500556_0000002 | Ga0500556_0000002_71158_71973 | 271 |
| 742 | 3300053108 | Ga0500562_011085 | Ga0500562_011085_1260_2075 | 271 |
| 743 | 3300053116 | Ga0500592_001499 | Ga0500592_001499_2158_2973 | 271 |
| 744 | 3300053117 | Ga0500593_080147 | Ga0500593_080147_44_859 | 271 |
| 745 | 3300053130 | Ga0500642_0000026 | Ga0500642_0000026_79107_79922 | 271 |
| 746 | 3300053131 | Ga0500652_008704 | Ga0500652_008704_601_1416 | 271 |
| 747 | 3300053134 | Ga0500658_0022760 | Ga0500658_0022760_459_1274 | 271 |
| 748 | 3300053139 | Ga0500568_0004521 | Ga0500568_0004521_4677_5492 | 271 |
| 749 | 3300053153 | Ga0500616_0000031 | Ga0500616_0000031_79794_80609 | 271 |
| 750 | 3300053156 | Ga0500622_0014162 | Ga0500622_0014162_1236_2051 | 271 |
| 751 | 3300053730 | Ga0500645_048342 | Ga0500645_048342_151_966 | 271 |
| 752 | 3300003203 | JGI25406J46586_10000391 | JGI25406J46586_1000039115 | 272 |
| 753 | 3300003763 | Ga0055529_1007225 | Ga0055529_10072252 | 272 |
| 754 | 3300005329 | Ga0070683_100045511 | Ga0070683_1000455114 | 272 |
| 755 | 3300005329 | Ga0070683_100660745 | Ga0070683_1006607451 | 272 |
| 756 | 3300005331 | Ga0070670_100578246 | Ga0070670_1005782461 | 272 |
| 757 | 3300005334 | Ga0068869_100380863 | Ga0068869_1003808631 | 272 |
| 758 | 3300005336 | Ga0070680_100156869 | Ga0070680_1001568692 | 272 |
| 759 | 3300005336 | Ga0070680_100407405 | Ga0070680_1004074052 | 272 |
| 760 | 3300005336 | Ga0070680_100458882 | Ga0070680_1004588821 | 272 |
| 761 | 3300005340 | Ga0070689_100260611 | Ga0070689_1002606112 | 272 |
| 762 | 3300005344 | Ga0070661_100038481 | Ga0070661_1000384812 | 272 |
| 763 | 3300005366 | Ga0070659_100306358 | Ga0070659_1003063582 | 272 |
| 764 | 3300005434 | Ga0070709_10001342 | Ga0070709_100013428 | 272 |
| 765 | 3300005434 | Ga0070709_10003187 | Ga0070709_100031872 | 272 |
| 766 | 3300005435 | Ga0070714_100000835 | Ga0070714_10000083517 | 272 |
| 767 | 3300005435 | Ga0070714_100057465 | Ga0070714_1000574652 | 272 |
| 768 | 3300005435 | Ga0070714_100085911 | Ga0070714_1000859113 | 272 |
| 769 | 3300005436 | Ga0070713_100001417 | Ga0070713_1000014177 | 272 |
| 770 | 3300005436 | Ga0070713_100039204 | Ga0070713_1000392042 | 272 |
| 771 | 3300005436 | Ga0070713_100229081 | Ga0070713_1002290812 | 272 |
| 772 | 3300005437 | Ga0070710_10003269 | Ga0070710_100032697 | 272 |
| 773 | 3300005439 | Ga0070711_100016093 | Ga0070711_1000160934 | 272 |
| 774 | 3300005439 | Ga0070711_100177074 | Ga0070711_1001770742 | 272 |
| 775 | 3300005445 | Ga0070708_100212960 | Ga0070708_1002129602 | 272 |
| 776 | 3300005455 | Ga0070663_100014922 | Ga0070663_1000149224 | 272 |
| 777 | 3300005455 | Ga0070663_100085015 | Ga0070663_1000850152 | 272 |
| 778 | 3300005455 | Ga0070663_100118823 | Ga0070663_1001188232 | 272 |
| 779 | 3300005471 | Ga0070698_100215997 | Ga0070698_1002159972 | 272 |
| 780 | 3300005530 | Ga0070679_100146885 | Ga0070679_1001468852 | 272 |
| 781 | 3300005530 | Ga0070679_100621503 | Ga0070679_1006215032 | 272 |
| 782 | 3300005535 | Ga0070684_100045561 | Ga0070684_1000455611 | 272 |
| 783 | 3300005535 | Ga0070684_100076539 | Ga0070684_1000765392 | 272 |
| 784 | 3300005539 | Ga0068853_100004923 | Ga0068853_1000049237 | 272 |
| 785 | 3300005539 | Ga0068853_100600809 | Ga0068853_1006008091 | 272 |
| 786 | 3300005563 | Ga0068855_100050346 | Ga0068855_1000503463 | 272 |
| 787 | 3300005564 | Ga0070664_100156737 | Ga0070664_1001567371 | 272 |
| 788 | 3300005577 | Ga0068857_100365703 | Ga0068857_1003657031 | 272 |
| 789 | 3300005578 | Ga0068854_100229165 | Ga0068854_1002291652 | 272 |
| 790 | 3300005614 | Ga0068856_100014918 | Ga0068856_1000149185 | 272 |
| 791 | 3300005616 | Ga0068852_100029496 | Ga0068852_1000294964 | 272 |
| 792 | 3300005616 | Ga0068852_100034169 | Ga0068852_1000341693 | 272 |
| 793 | 3300005618 | Ga0068864_100110930 | Ga0068864_1001109303 | 272 |
| 794 | 3300005719 | Ga0068861_100018069 | Ga0068861_1000180692 | 272 |
| 795 | 3300005834 | Ga0068851_10076308 | Ga0068851_100763082 | 272 |
| 796 | 3300005842 | Ga0068858_100597355 | Ga0068858_1005973552 | 272 |
| 797 | 3300005843 | Ga0068860_100005382 | Ga0068860_10000538210 | 272 |
| 798 | 3300005844 | Ga0068862_100100545 | Ga0068862_1001005452 | 272 |
| 799 | 3300005983 | Ga0081540_1058131 | Ga0081540_10581311 | 272 |
| 800 | 3300005985 | Ga0081539_10000325 | Ga0081539_100003255 | 272 |
| 801 | 3300006028 | Ga0070717_10006335 | Ga0070717_100063354 | 272 |
| 802 | 3300006028 | Ga0070717_10212075 | Ga0070717_102120752 | 272 |
| 803 | 3300006028 | Ga0070717_10432250 | Ga0070717_104322502 | 272 |
| 804 | 3300006048 | Ga0075363_100033836 | Ga0075363_1000338362 | 272 |
| 805 | 3300006048 | Ga0075363_100144990 | Ga0075363_1001449902 | 272 |
| 806 | 3300006051 | Ga0075364_10002466 | Ga0075364_100024664 | 272 |
| 807 | 3300006163 | Ga0070715_10005010 | Ga0070715_100050103 | 272 |
| 808 | 3300006163 | Ga0070715_10138035 | Ga0070715_101380352 | 272 |
| 809 | 3300006173 | Ga0070716_100001256 | Ga0070716_1000012566 | 272 |
| 810 | 3300006175 | Ga0070712_100180633 | Ga0070712_1001806332 | 272 |
| 811 | 3300006178 | Ga0075367_10000878 | Ga0075367_100008785 | 272 |
| 812 | 3300006237 | Ga0097621_100225723 | Ga0097621_1002257232 | 272 |
| 813 | 3300006846 | Ga0075430_100277398 | Ga0075430_1002773982 | 272 |
| 814 | 3300006847 | Ga0075431_100108804 | Ga0075431_1001088043 | 272 |
| 815 | 3300006881 | Ga0068865_100286329 | Ga0068865_1002863291 | 272 |
| 816 | 3300007788 | Ga0099795_10048119 | Ga0099795_100481192 | 272 |
| 817 | 3300009094 | Ga0111539_10227122 | Ga0111539_102271223 | 272 |
| 818 | 3300009147 | Ga0114129_10074974 | Ga0114129_100749743 | 272 |
| 819 | 3300009177 | Ga0105248_10061008 | Ga0105248_100610085 | 272 |
| 820 | 3300009545 | Ga0105237_10135379 | Ga0105237_101353791 | 272 |
| 821 | 3300009545 | Ga0105237_10449027 | Ga0105237_104490272 | 272 |
| 822 | 3300009551 | Ga0105238_10028458 | Ga0105238_100284583 | 272 |
| 823 | 3300010375 | Ga0105239_10101856 | Ga0105239_101018562 | 272 |
| 824 | 3300013104 | Ga0157370_10256451 | Ga0157370_102564511 | 272 |
| 825 | 3300013296 | Ga0157374_10189497 | Ga0157374_101894972 | 272 |
| 826 | 3300013307 | Ga0157372_10234507 | Ga0157372_102345072 | 272 |
| 827 | 3300021358 | Ga0213873_10013840 | Ga0213873_100138401 | 272 |
| 828 | 3300021384 | Ga0213876_10002392 | Ga0213876_100023927 | 272 |
| 829 | 3300021384 | Ga0213876_10014129 | Ga0213876_100141293 | 272 |
| 830 | 3300025253 | Ga0209677_100738 | Ga0209677_10073811 | 272 |
| 831 | 3300025254 | Ga0209148_1005612 | Ga0209148_10056122 | 272 |
| 832 | 3300025261 | Ga0209233_1001426 | Ga0209233_10014266 | 272 |
| 833 | 3300025272 | Ga0209455_1004780 | Ga0209455_10047802 | 272 |
| 834 | 3300025294 | Ga0209025_1028128 | Ga0209025_10281281 | 272 |
| 835 | 3300025295 | Ga0209564_1028155 | Ga0209564_10281552 | 272 |
| 836 | 3300025297 | Ga0209758_1001760 | Ga0209758_10017606 | 272 |
| 837 | 3300025321 | Ga0207656_10033874 | Ga0207656_100338742 | 272 |
| 838 | 3300025898 | Ga0207692_10127390 | Ga0207692_101273902 | 272 |
| 839 | 3300025905 | Ga0207685_10001301 | Ga0207685_100013011 | 272 |
| 840 | 3300025905 | Ga0207685_10146372 | Ga0207685_101463722 | 272 |
| 841 | 3300025906 | Ga0207699_10000605 | Ga0207699_1000060515 | 272 |
| 842 | 3300025910 | Ga0207684_10024711 | Ga0207684_100247112 | 272 |
| 843 | 3300025911 | Ga0207654_10251844 | Ga0207654_102518442 | 272 |
| 844 | 3300025912 | Ga0207707_10002844 | Ga0207707_100028444 | 272 |
| 845 | 3300025912 | Ga0207707_10074493 | Ga0207707_100744932 | 272 |
| 846 | 3300025912 | Ga0207707_10097433 | Ga0207707_100974332 | 272 |
| 847 | 3300025913 | Ga0207695_10083217 | Ga0207695_100832173 | 272 |
| 848 | 3300025914 | Ga0207671_10080342 | Ga0207671_100803422 | 272 |
| 849 | 3300025914 | Ga0207671_10129525 | Ga0207671_101295252 | 272 |
| 850 | 3300025914 | Ga0207671_10177288 | Ga0207671_101772882 | 272 |
| 851 | 3300025915 | Ga0207693_10000085 | Ga0207693_1000008516 | 272 |
| 852 | 3300025915 | Ga0207693_10050596 | Ga0207693_100505963 | 272 |
| 853 | 3300025916 | Ga0207663_10000228 | Ga0207663_100002285 | 272 |
| 854 | 3300025916 | Ga0207663_10298760 | Ga0207663_102987601 | 272 |
| 855 | 3300025917 | Ga0207660_10016204 | Ga0207660_100162043 | 272 |
| 856 | 3300025917 | Ga0207660_10071357 | Ga0207660_100713572 | 272 |
| 857 | 3300025917 | Ga0207660_10147962 | Ga0207660_101479623 | 272 |
| 858 | 3300025919 | Ga0207657_10003303 | Ga0207657_100033032 | 272 |
| 859 | 3300025921 | Ga0207652_10019545 | Ga0207652_100195453 | 272 |
| 860 | 3300025921 | Ga0207652_10112842 | Ga0207652_101128421 | 272 |
| 861 | 3300025921 | Ga0207652_10124493 | Ga0207652_101244932 | 272 |
| 862 | 3300025921 | Ga0207652_10141705 | Ga0207652_101417052 | 272 |
| 863 | 3300025921 | Ga0207652_10558798 | Ga0207652_105587982 | 272 |
| 864 | 3300025924 | Ga0207694_10034781 | Ga0207694_100347813 | 272 |
| 865 | 3300025924 | Ga0207694_10069219 | Ga0207694_100692193 | 272 |
| 866 | 3300025924 | Ga0207694_10239896 | Ga0207694_102398962 | 272 |
| 867 | 3300025927 | Ga0207687_10142287 | Ga0207687_101422872 | 272 |
| 868 | 3300025928 | Ga0207700_10077832 | Ga0207700_100778322 | 272 |
| 869 | 3300025928 | Ga0207700_10100760 | Ga0207700_101007602 | 272 |
| 870 | 3300025928 | Ga0207700_10156218 | Ga0207700_101562181 | 272 |
| 871 | 3300025928 | Ga0207700_10212150 | Ga0207700_102121502 | 272 |
| 872 | 3300025929 | Ga0207664_10038107 | Ga0207664_100381072 | 272 |
| 873 | 3300025929 | Ga0207664_10046277 | Ga0207664_100462773 | 272 |
| 874 | 3300025929 | Ga0207664_10774036 | Ga0207664_107740361 | 272 |
| 875 | 3300025934 | Ga0207686_10143902 | Ga0207686_101439022 | 272 |
| 876 | 3300025939 | Ga0207665_10000066 | Ga0207665_1000006621 | 272 |
| 877 | 3300025939 | Ga0207665_10138150 | Ga0207665_101381502 | 272 |
| 878 | 3300025939 | Ga0207665_10415338 | Ga0207665_104153381 | 272 |
| 879 | 3300025944 | Ga0207661_10004899 | Ga0207661_100048992 | 272 |
| 880 | 3300025944 | Ga0207661_10052115 | Ga0207661_100521153 | 272 |
| 881 | 3300025949 | Ga0207667_10036292 | Ga0207667_100362923 | 272 |
| 882 | 3300025949 | Ga0207667_10062046 | Ga0207667_100620463 | 272 |
| 883 | 3300025981 | Ga0207640_10043892 | Ga0207640_100438923 | 272 |
| 884 | 3300026035 | Ga0207703_10073038 | Ga0207703_100730382 | 272 |
| 885 | 3300026035 | Ga0207703_10454980 | Ga0207703_104549802 | 272 |
| 886 | 3300026041 | Ga0207639_10012204 | Ga0207639_100122043 | 272 |
| 887 | 3300026067 | Ga0207678_10006117 | Ga0207678_100061172 | 272 |
| 888 | 3300026067 | Ga0207678_10199304 | Ga0207678_101993042 | 272 |
| 889 | 3300026075 | Ga0207708_10327670 | Ga0207708_103276702 | 272 |
| 890 | 3300026078 | Ga0207702_10117738 | Ga0207702_101177382 | 272 |
| 891 | 3300026095 | Ga0207676_10132415 | Ga0207676_101324151 | 272 |
| 892 | 3300026116 | Ga0207674_10015966 | Ga0207674_100159664 | 272 |
| 893 | 3300026116 | Ga0207674_10283035 | Ga0207674_102830352 | 272 |
| 894 | 3300026118 | Ga0207675_100030458 | Ga0207675_1000304582 | 272 |
| 895 | 3300026121 | Ga0207683_10089790 | Ga0207683_100897902 | 272 |
| 896 | 3300026121 | Ga0207683_10320192 | Ga0207683_103201921 | 272 |
| 897 | 3300026142 | Ga0207698_10020158 | Ga0207698_100201582 | 272 |
| 898 | 3300027512 | Ga0209179_1018161 | Ga0209179_10181612 | 272 |
| 899 | 3300027671 | Ga0209588_1001117 | Ga0209588_10011172 | 272 |
| 900 | 3300028379 | Ga0268266_10036832 | Ga0268266_100368322 | 272 |
| 901 | 3300028379 | Ga0268266_10072341 | Ga0268266_100723412 | 272 |
| 902 | 3300028381 | Ga0268264_10000030 | Ga0268264_10000030332 | 272 |
| 903 | 3300028558 | Ga0265326_10003741 | Ga0265326_100037412 | 272 |
| 904 | 3300028563 | Ga0265319_1025011 | Ga0265319_10250112 | 272 |
| 905 | 3300028573 | Ga0265334_10017207 | Ga0265334_100172073 | 272 |
| 906 | 3300028573 | Ga0265334_10031321 | Ga0265334_100313211 | 272 |
| 907 | 3300028653 | Ga0265323_10011856 | Ga0265323_100118562 | 272 |
| 908 | 3300028666 | Ga0265336_10000251 | Ga0265336_100002513 | 272 |
| 909 | 3300028786 | Ga0307517_10000386 | Ga0307517_1000038652 | 272 |
| 910 | 3300028800 | Ga0265338_10000582 | Ga0265338_100005823 | 272 |
| 911 | 3300029957 | Ga0265324_10011006 | Ga0265324_100110062 | 272 |
| 912 | 3300030521 | Ga0307511_10190129 | Ga0307511_101901291 | 272 |
| 913 | 3300031235 | Ga0265330_10003655 | Ga0265330_100036552 | 272 |
| 914 | 3300031238 | Ga0265332_10033252 | Ga0265332_100332521 | 272 |
| 915 | 3300031239 | Ga0265328_10013263 | Ga0265328_100132633 | 272 |
| 916 | 3300031241 | Ga0265325_10015708 | Ga0265325_100157082 | 272 |
| 917 | 3300031247 | Ga0265340_10044318 | Ga0265340_100443181 | 272 |
| 918 | 3300031249 | Ga0265339_10002586 | Ga0265339_100025866 | 272 |
| 919 | 3300031249 | Ga0265339_10192092 | Ga0265339_101920922 | 272 |
| 920 | 3300031344 | Ga0265316_10098547 | Ga0265316_100985473 | 272 |
| 921 | 3300031344 | Ga0265316_10196275 | Ga0265316_101962751 | 272 |
| 922 | 3300031456 | Ga0307513_10177891 | Ga0307513_101778913 | 272 |
| 923 | 3300031507 | Ga0307509_10014321 | Ga0307509_100143214 | 272 |
| 924 | 3300031507 | Ga0307509_10150890 | Ga0307509_101508903 | 272 |
| 925 | 3300031595 | Ga0265313_10096495 | Ga0265313_100964952 | 272 |
| 926 | 3300031616 | Ga0307508_10000015 | Ga0307508_10000015102 | 272 |
| 927 | 3300031616 | Ga0307508_10134754 | Ga0307508_101347542 | 272 |
| 928 | 3300031711 | Ga0265314_10102592 | Ga0265314_101025922 | 272 |
| 929 | 3300031712 | Ga0265342_10002383 | Ga0265342_1000238315 | 272 |
| 930 | 3300031712 | Ga0265342_10104031 | Ga0265342_101040312 | 272 |
| 931 | 3300031712 | Ga0265342_10212757 | Ga0265342_102127571 | 272 |
| 932 | 3300031730 | Ga0307516_10007160 | Ga0307516_100071609 | 272 |
| 933 | 3300031730 | Ga0307516_10029862 | Ga0307516_100298624 | 272 |
| 934 | 3300031730 | Ga0307516_10069384 | Ga0307516_100693843 | 272 |
| 935 | 3300033179 | Ga0307507_10025778 | Ga0307507_100257783 | 272 |
| 936 | 3300033180 | Ga0307510_10024965 | Ga0307510_100249655 | 272 |
| 937 | 3300033180 | Ga0307510_10130587 | Ga0307510_101305872 | 272 |
| 938 | 3300035118 | Ga0373954_0000386 | Ga0373954_0000386_11909_12727 | 272 |
| 939 | 3300035119 | Ga0373956_0000925 | Ga0373956_0000925_7993_8811 | 272 |
| 940 | 3300035120 | Ga0373957_0000393 | Ga0373957_0000393_7220_8038 | 272 |
| 941 | 3300035172 | Ga0373955_0000286 | Ga0373955_0000286_1959_2777 | 272 |
| 942 | 3300035410 | Ga0373924_0031724 | Ga0373924_0031724_435_1253 | 272 |
| 943 | 3300035724 | Ga0373933_0000952 | Ga0373933_0000952_1523_2341 | 272 |
| 944 | 3300036401 | Ga0373937_0001493 | Ga0373937_0001493_8035_8853 | 272 |
| 945 | 3300039437 | Ga0436365_1009821 | Ga0436365_1009821_208_1026 | 272 |
| 946 | 3300039437 | Ga0436365_1058602 | Ga0436365_1058602_1947_2765 | 272 |
| 947 | 3300039450 | Ga0436363_1519808 | Ga0436363_1519808_1991_2809 | 272 |
| 948 | 3300045976 | Ga0466967_0125214 | Ga0466967_0125214_567_1385 | 272 |
| 949 | 3300046454 | Ga0495592_0001573 | Ga0495592_0001573_3248_4066 | 272 |
| 950 | 3300046459 | Ga0495629_0008978 | Ga0495629_0008978_5244_6062 | 272 |
| 951 | 3300046462 | Ga0495651_0001334 | Ga0495651_0001334_6968_7786 | 272 |
| 952 | 3300046462 | Ga0495651_0294207 | Ga0495651_0294207_142_972 | 272 |
| 953 | 3300046463 | Ga0495653_0001313 | Ga0495653_0001313_11919_12737 | 272 |
| 954 | 3300046511 | Ga0495608_0004038 | Ga0495608_0004038_1388_2206 | 272 |
| 955 | 3300046514 | Ga0495618_0090977 | Ga0495618_0090977_1114_1932 | 272 |
| 956 | 3300046516 | Ga0495628_0006135 | Ga0495628_0006135_7996_8814 | 272 |
| 957 | 3300046529 | Ga0495652_0002471 | Ga0495652_0002471_12209_13027 | 272 |
| 958 | 3300046536 | Ga0495587_0000862 | Ga0495587_0000862_10656_11474 | 272 |
| 959 | 3300046543 | Ga0495645_0060349 | Ga0495645_0060349_1271_2089 | 272 |
| 960 | 3300046559 | Ga0495667_0000424 | Ga0495667_0000424_15528_16346 | 272 |
| 961 | 3300046663 | Ga0495635_0004040 | Ga0495635_0004040_3090_3908 | 272 |
| 962 | 3300046675 | Ga0495657_0001449 | Ga0495657_0001449_11373_12191 | 272 |
| 963 | 3300046678 | Ga0495599_0000879 | Ga0495599_0000879_15087_15905 | 272 |
| 964 | 3300046679 | Ga0495623_0003211 | Ga0495623_0003211_1516_2334 | 272 |
| 965 | 3300046680 | Ga0495646_0002245 | Ga0495646_0002245_1266_2084 | 272 |
| 966 | 3300046689 | Ga0495613_0016887 | Ga0495613_0016887_1685_2503 | 272 |
| 967 | 3300046809 | Ga0495600_0000337 | Ga0495600_0000337_11373_12191 | 272 |
| 968 | 3300047317 | Ga0495604_0001626 | Ga0495604_0001626_3064_3882 | 272 |
| 969 | 3300047319 | Ga0495674_0042623 | Ga0495674_0042623_1938_2756 | 272 |
| 970 | 3300047322 | Ga0495680_0003717 | Ga0495680_0003717_8035_8853 | 272 |
| 971 | 3300047444 | Ga0495675_0000559 | Ga0495675_0000559_6234_7052 | 272 |
| 972 | 3300047471 | Ga0495684_0002496 | Ga0495684_0002496_10747_11565 | 272 |
| 973 | 3300048088 | Ga0495602_0007241 | Ga0495602_0007241_9520_10338 | 272 |
| 974 | 3300048915 | Ga0496112_0000056 | Ga0496112_0000056_76839_77657 | 272 |
| 975 | 3300048918 | Ga0496115_0270088 | Ga0496115_0270088_66_1034 | 272 |
| 976 | 3300048919 | Ga0496116_0004380 | Ga0496116_0004380_10771_11589 | 272 |
| 977 | 3300048920 | Ga0496117_0051785 | Ga0496117_0051785_642_1460 | 272 |
| 978 | 3300048921 | Ga0496118_0028018 | Ga0496118_0028018_2436_3254 | 272 |
| 979 | 3300048921 | Ga0496118_0152010 | Ga0496118_0152010_52_870 | 272 |
| 980 | 3300048924 | Ga0496121_0004032 | Ga0496121_0004032_2846_3664 | 272 |
| 981 | 3300048925 | Ga0496122_0071472 | Ga0496122_0071472_564_1382 | 272 |
| 982 | 3300048927 | Ga0496124_0391827 | Ga0496124_0391827_41_859 | 272 |
| 983 | 3300048928 | Ga0496125_0000796 | Ga0496125_0000796_8283_9248 | 272 |
| 984 | 3300048928 | Ga0496125_0039233 | Ga0496125_0039233_2454_3272 | 272 |
| 985 | 3300048929 | Ga0496126_0004392 | Ga0496126_0004392_1124_1948 | 272 |
| 986 | 3300048929 | Ga0496126_0012650 | Ga0496126_0012650_6123_6941 | 272 |
| 987 | 3300048929 | Ga0496126_0020311 | Ga0496126_0020311_3365_4183 | 272 |
| 988 | 3300049822 | Ga0501035_0103700 | Ga0501035_0103700_452_1270 | 272 |
| 989 | 3300050490 | nmdc:mga03n38_13382_c1 | nmdc:mga03n38_13382_c1_1292_2110 | 272 |
| 990 | 3300050491 | nmdc:mga00v17_8048_c1 | nmdc:mga00v17_8048_c1_4428_5246 | 272 |
| 991 | 3300050492 | nmdc:mga0yw44_5904_c1 | nmdc:mga0yw44_5904_c1_2509_3327 | 272 |
| 992 | 3300050494 | nmdc:mga06z11_1471_c1 | nmdc:mga06z11_1471_c1_1479_2297 | 272 |
| 993 | 3300050494 | nmdc:mga06z11_28232_c1 | nmdc:mga06z11_28232_c1_448_1266 | 272 |
| 994 | 3300050510 | nmdc:mga06r32_175088_c1 | nmdc:mga06r32_175088_c1_745_1563 | 272 |
| 995 | 3300050516 | nmdc:mga0sz30_1426_c1 | nmdc:mga0sz30_1426_c1_634_1452 | 272 |
| 996 | 3300053080 | Ga0500635_0052959 | Ga0500635_0052959_91_957 | 272 |
| 997 | 3300053084 | Ga0495595_0000340 | Ga0495595_0000340_5872_6690 | 272 |
| 998 | 3300053085 | Ga0495619_0000979 | Ga0495619_0000979_7095_7913 | 272 |
| 999 | 3300053088 | Ga0500644_0065825 | Ga0500644_0065825_463_1281 | 272 |
| 1000 | 3300053092 | Ga0500583_0015298 | Ga0500583_0015298_1134_1952 | 272 |
| 1001 | 3300053095 | Ga0500640_037684 | Ga0500640_037684_113_931 | 272 |
| 1002 | 3300053111 | Ga0500572_014724 | Ga0500572_014724_145_963 | 272 |
| 1003 | 3300053119 | Ga0500595_000750 | Ga0500595_000750_15298_16116 | 272 |
| 1004 | 3300053119 | Ga0500595_003552 | Ga0500595_003552_3776_4594 | 272 |
| 1005 | 3300053122 | Ga0500608_045787 | Ga0500608_045787_147_965 | 272 |
| 1006 | 3300053123 | Ga0500614_002291 | Ga0500614_002291_3413_4231 | 272 |
| 1007 | 3300053150 | Ga0500603_000112 | Ga0500603_000112_2215_3033 | 272 |
| 1008 | 3300053159 | Ga0500630_141656 | Ga0500630_141656_124_942 | 272 |
| 1009 | 3300053163 | Ga0500639_000061 | Ga0500639_000061_27148_27966 | 272 |
| 1010 | 3300053178 | Ga0500637_0012608 | Ga0500637_0012608_1889_2755 | 272 |
| 1011 | 3300053731 | Ga0500609_008652 | Ga0500609_008652_466_1284 | 272 |
| 1012 | 3300053737 | Ga0500601_010449 | Ga0500601_010449_144_962 | 272 |
| 1013 | 3300003215 | JGI25153J46596_10007259 | JGI25153J46596_100072591 | 273 |
| 1014 | 3300005289 | Ga0065704_10128417 | Ga0065704_101284172 | 273 |
| 1015 | 3300005338 | Ga0068868_100237116 | Ga0068868_1002371162 | 273 |
| 1016 | 3300005347 | Ga0070668_100234762 | Ga0070668_1002347622 | 273 |
| 1017 | 3300005347 | Ga0070668_100595673 | Ga0070668_1005956731 | 273 |
| 1018 | 3300005434 | Ga0070709_10009893 | Ga0070709_100098932 | 273 |
| 1019 | 3300005439 | Ga0070711_100014424 | Ga0070711_1000144244 | 273 |
| 1020 | 3300005458 | Ga0070681_10093437 | Ga0070681_100934373 | 273 |
| 1021 | 3300005530 | Ga0070679_100076306 | Ga0070679_1000763063 | 273 |
| 1022 | 3300005539 | Ga0068853_100186638 | Ga0068853_1001866381 | 273 |
| 1023 | 3300005563 | Ga0068855_100007753 | Ga0068855_10000775311 | 273 |
| 1024 | 3300005577 | Ga0068857_100412760 | Ga0068857_1004127602 | 273 |
| 1025 | 3300005617 | Ga0068859_100100285 | Ga0068859_1001002853 | 273 |
| 1026 | 3300005718 | Ga0068866_10176473 | Ga0068866_101764732 | 273 |
| 1027 | 3300005842 | Ga0068858_100469503 | Ga0068858_1004695031 | 273 |
| 1028 | 3300005843 | Ga0068860_100107636 | Ga0068860_1001076362 | 273 |
| 1029 | 3300005844 | Ga0068862_100444164 | Ga0068862_1004441642 | 273 |
| 1030 | 3300005937 | Ga0081455_10010826 | Ga0081455_100108268 | 273 |
| 1031 | 3300005937 | Ga0081455_10034101 | Ga0081455_100341012 | 273 |
| 1032 | 3300005937 | Ga0081455_10037309 | Ga0081455_100373092 | 273 |
| 1033 | 3300005983 | Ga0081540_1083771 | Ga0081540_10837712 | 273 |
| 1034 | 3300005985 | Ga0081539_10040159 | Ga0081539_100401592 | 273 |
| 1035 | 3300006175 | Ga0070712_100013561 | Ga0070712_1000135613 | 273 |
| 1036 | 3300006931 | Ga0097620_100100281 | Ga0097620_1001002813 | 273 |
| 1037 | 3300006941 | Ga0099825_1027434 | Ga0099825_10274342 | 273 |
| 1038 | 3300006942 | Ga0099824_1004802 | Ga0099824_100480210 | 273 |
| 1039 | 3300006943 | Ga0099822_1020900 | Ga0099822_10209004 | 273 |
| 1040 | 3300025261 | Ga0209233_1010624 | Ga0209233_10106242 | 273 |
| 1041 | 3300025291 | Ga0209675_1018221 | Ga0209675_10182212 | 273 |
| 1042 | 3300025292 | Ga0209676_1005128 | Ga0209676_10051286 | 273 |
| 1043 | 3300025297 | Ga0209758_1002930 | Ga0209758_10029307 | 273 |
| 1044 | 3300025907 | Ga0207645_10144098 | Ga0207645_101440981 | 273 |
| 1045 | 3300025912 | Ga0207707_10379058 | Ga0207707_103790581 | 273 |
| 1046 | 3300025913 | Ga0207695_10171179 | Ga0207695_101711791 | 273 |
| 1047 | 3300025917 | Ga0207660_10277392 | Ga0207660_102773922 | 273 |
| 1048 | 3300025921 | Ga0207652_10084932 | Ga0207652_100849323 | 273 |
| 1049 | 3300025942 | Ga0207689_10022048 | Ga0207689_100220483 | 273 |
| 1050 | 3300025949 | Ga0207667_10011021 | Ga0207667_100110215 | 273 |
| 1051 | 3300025986 | Ga0207658_10300048 | Ga0207658_103000482 | 273 |
| 1052 | 3300026041 | Ga0207639_10136294 | Ga0207639_101362943 | 273 |
| 1053 | 3300026078 | Ga0207702_10243733 | Ga0207702_102437332 | 273 |
| 1054 | 3300026118 | Ga0207675_100709820 | Ga0207675_1007098201 | 273 |
| 1055 | 3300026121 | Ga0207683_10740019 | Ga0207683_107400191 | 273 |
| 1056 | 3300027296 | Ga0209389_1000014 | Ga0209389_100001451 | 273 |
| 1057 | 3300027357 | Ga0209589_1000011 | Ga0209589_1000011107 | 273 |
| 1058 | 3300027357 | Ga0209589_1000020 | Ga0209589_100002051 | 273 |
| 1059 | 3300027361 | Ga0209489_100012 | Ga0209489_100012107 | 273 |
| 1060 | 3300027361 | Ga0209489_100060 | Ga0209489_10006010 | 273 |
| 1061 | 3300027363 | Ga0209700_100019 | Ga0209700_100019107 | 273 |
| 1062 | 3300028379 | Ga0268266_10578681 | Ga0268266_105786811 | 273 |
| 1063 | 3300028380 | Ga0268265_10250820 | Ga0268265_102508202 | 273 |
| 1064 | 3300028380 | Ga0268265_10771846 | Ga0268265_107718461 | 273 |
| 1065 | 3300033442 | Ga0315911_1000002 | Ga0315911_100000217 | 273 |
| 1066 | 3300037471 | Ga0395905_0347702 | Ga0395905_0347702_383_1204 | 273 |
| 1067 | 3300038443 | Ga0395901_0050417 | Ga0395901_0050417_3092_3913 | 273 |
| 1068 | 3300041503 | Ga0451847_0265692 | Ga0451847_0265692_236_1057 | 273 |
| 1069 | 3300044684 | Ga0466966_0000094 | Ga0466966_0000094_10472_11293 | 273 |
| 1070 | 3300044693 | Ga0466961_0001116 | Ga0466961_0001116_5280_6101 | 273 |
| 1071 | 3300045049 | Ga0466959_0001069 | Ga0466959_0001069_10357_11178 | 273 |
| 1072 | 3300048924 | Ga0496121_0064419 | Ga0496121_0064419_1128_1949 | 273 |
| 1073 | 3300050507 | nmdc:mga05p37_117698_c1 | nmdc:mga05p37_117698_c1_1026_1856 | 273 |
| 1074 | 3300002077 | JGI24744J21845_10003919 | JGI24744J21845_100039193 | 274 |
| 1075 | 3300003203 | JGI25406J46586_10005202 | JGI25406J46586_100052022 | 274 |
| 1076 | 3300003215 | JGI25153J46596_10013656 | JGI25153J46596_100136562 | 274 |
| 1077 | 3300003215 | JGI25153J46596_10015011 | JGI25153J46596_100150112 | 274 |
| 1078 | 3300003354 | JGI25160J50197_1003221 | JGI25160J50197_10032213 | 274 |
| 1079 | 3300003659 | JGI25404J52841_10004376 | JGI25404J52841_100043763 | 274 |
| 1080 | 3300003659 | JGI25404J52841_10005736 | JGI25404J52841_100057362 | 274 |
| 1081 | 3300003752 | Ga0055539_1010899 | Ga0055539_10108991 | 274 |
| 1082 | 3300003775 | Ga0055524_1031307 | Ga0055524_10313072 | 274 |
| 1083 | 3300003794 | Ga0055531_10006295 | Ga0055531_100062954 | 274 |
| 1084 | 3300004625 | Ga0055543_1004898 | Ga0055543_10048983 | 274 |
| 1085 | 3300005262 | Ga0065165_1000853 | Ga0065165_100085333 | 274 |
| 1086 | 3300005262 | Ga0065165_1005620 | Ga0065165_10056203 | 274 |
| 1087 | 3300005262 | Ga0065165_1012247 | Ga0065165_10122473 | 274 |
| 1088 | 3300005262 | Ga0065165_1016176 | Ga0065165_10161762 | 274 |
| 1089 | 3300005327 | Ga0070658_10061106 | Ga0070658_100611062 | 274 |
| 1090 | 3300005330 | Ga0070690_100035524 | Ga0070690_1000355242 | 274 |
| 1091 | 3300005331 | Ga0070670_100092410 | Ga0070670_1000924101 | 274 |
| 1092 | 3300005339 | Ga0070660_100288931 | Ga0070660_1002889312 | 274 |
| 1093 | 3300005353 | Ga0070669_100136290 | Ga0070669_1001362902 | 274 |
| 1094 | 3300005367 | Ga0070667_100392216 | Ga0070667_1003922161 | 274 |
| 1095 | 3300005441 | Ga0070700_100110292 | Ga0070700_1001102922 | 274 |
| 1096 | 3300005444 | Ga0070694_100325749 | Ga0070694_1003257491 | 274 |
| 1097 | 3300005455 | Ga0070663_100039003 | Ga0070663_1000390031 | 274 |
| 1098 | 3300005455 | Ga0070663_100256517 | Ga0070663_1002565172 | 274 |
| 1099 | 3300005456 | Ga0070678_100019205 | Ga0070678_1000192053 | 274 |
| 1100 | 3300005456 | Ga0070678_100027449 | Ga0070678_1000274492 | 274 |
| 1101 | 3300005471 | Ga0070698_100572178 | Ga0070698_1005721782 | 274 |
| 1102 | 3300005539 | Ga0068853_100111138 | Ga0068853_1001111382 | 274 |
| 1103 | 3300005539 | Ga0068853_100412430 | Ga0068853_1004124302 | 274 |
| 1104 | 3300005543 | Ga0070672_100024545 | Ga0070672_1000245453 | 274 |
| 1105 | 3300005548 | Ga0070665_100036968 | Ga0070665_1000369685 | 274 |
| 1106 | 3300005548 | Ga0070665_100152285 | Ga0070665_1001522853 | 274 |
| 1107 | 3300005548 | Ga0070665_100269149 | Ga0070665_1002691493 | 274 |
| 1108 | 3300005548 | Ga0070665_100344807 | Ga0070665_1003448072 | 274 |
| 1109 | 3300005563 | Ga0068855_100246139 | Ga0068855_1002461392 | 274 |
| 1110 | 3300005563 | Ga0068855_100725545 | Ga0068855_1007255451 | 274 |
| 1111 | 3300005616 | Ga0068852_100006728 | Ga0068852_1000067283 | 274 |
| 1112 | 3300005718 | Ga0068866_10016845 | Ga0068866_100168452 | 274 |
| 1113 | 3300005719 | Ga0068861_100192999 | Ga0068861_1001929992 | 274 |
| 1114 | 3300005719 | Ga0068861_100769040 | Ga0068861_1007690401 | 274 |
| 1115 | 3300005840 | Ga0068870_10085467 | Ga0068870_100854672 | 274 |
| 1116 | 3300005843 | Ga0068860_100159341 | Ga0068860_1001593412 | 274 |
| 1117 | 3300005844 | Ga0068862_100026953 | Ga0068862_1000269533 | 274 |
| 1118 | 3300005983 | Ga0081540_1004021 | Ga0081540_100402110 | 274 |
| 1119 | 3300005983 | Ga0081540_1004329 | Ga0081540_10043295 | 274 |
| 1120 | 3300005983 | Ga0081540_1008727 | Ga0081540_10087276 | 274 |
| 1121 | 3300005983 | Ga0081540_1022414 | Ga0081540_10224142 | 274 |
| 1122 | 3300005983 | Ga0081540_1032815 | Ga0081540_10328151 | 274 |
| 1123 | 3300005983 | Ga0081540_1065069 | Ga0081540_10650692 | 274 |
| 1124 | 3300005983 | Ga0081540_1099877 | Ga0081540_10998771 | 274 |
| 1125 | 3300005985 | Ga0081539_10000220 | Ga0081539_10000220123 | 274 |
| 1126 | 3300006038 | Ga0075365_10083535 | Ga0075365_100835352 | 274 |
| 1127 | 3300006048 | Ga0075363_100045543 | Ga0075363_1000455432 | 274 |
| 1128 | 3300006186 | Ga0075369_10015615 | Ga0075369_100156153 | 274 |
| 1129 | 3300006186 | Ga0075369_10024483 | Ga0075369_100244834 | 274 |
| 1130 | 3300006186 | Ga0075369_10074848 | Ga0075369_100748482 | 274 |
| 1131 | 3300006195 | Ga0075366_10285782 | Ga0075366_102857822 | 274 |
| 1132 | 3300006353 | Ga0075370_10029868 | Ga0075370_100298682 | 274 |
| 1133 | 3300006353 | Ga0075370_10084550 | Ga0075370_100845502 | 274 |
| 1134 | 3300006844 | Ga0075428_100140341 | Ga0075428_1001403413 | 274 |
| 1135 | 3300006846 | Ga0075430_100300599 | Ga0075430_1003005992 | 274 |
| 1136 | 3300006944 | Ga0099823_1036094 | Ga0099823_10360943 | 274 |
| 1137 | 3300009098 | Ga0105245_10358013 | Ga0105245_103580132 | 274 |
| 1138 | 3300009101 | Ga0105247_10035537 | Ga0105247_100355372 | 274 |
| 1139 | 3300009148 | Ga0105243_10144550 | Ga0105243_101445502 | 274 |
| 1140 | 3300009174 | Ga0105241_10048140 | Ga0105241_100481402 | 274 |
| 1141 | 3300009176 | Ga0105242_10268488 | Ga0105242_102684882 | 274 |
| 1142 | 3300009177 | Ga0105248_10812927 | Ga0105248_108129271 | 274 |
| 1143 | 3300009545 | Ga0105237_10069166 | Ga0105237_100691663 | 274 |
| 1144 | 3300009545 | Ga0105237_10758528 | Ga0105237_107585281 | 274 |
| 1145 | 3300013104 | Ga0157370_10203581 | Ga0157370_102035811 | 274 |
| 1146 | 3300013296 | Ga0157374_10149247 | Ga0157374_101492473 | 274 |
| 1147 | 3300014325 | Ga0163163_10030777 | Ga0163163_100307778 | 274 |
| 1148 | 3300017792 | Ga0163161_10016765 | Ga0163161_100167654 | 274 |
| 1149 | 3300021320 | Ga0214544_1000001 | Ga0214544_1000001639 | 274 |
| 1150 | 3300021321 | Ga0214542_1000037 | Ga0214542_100003724 | 274 |
| 1151 | 3300021321 | Ga0214542_1024295 | Ga0214542_10242952 | 274 |
| 1152 | 3300021324 | Ga0214545_1000003 | Ga0214545_1000003121 | 274 |
| 1153 | 3300021324 | Ga0214545_1019845 | Ga0214545_10198454 | 274 |
| 1154 | 3300021327 | Ga0214543_1000002 | Ga0214543_1000002644 | 274 |
| 1155 | 3300021327 | Ga0214543_1019910 | Ga0214543_10199104 | 274 |
| 1156 | 3300025253 | Ga0209677_108755 | Ga0209677_1087552 | 274 |
| 1157 | 3300025254 | Ga0209148_1000462 | Ga0209148_100046212 | 274 |
| 1158 | 3300025261 | Ga0209233_1011343 | Ga0209233_10113432 | 274 |
| 1159 | 3300025272 | Ga0209455_1000870 | Ga0209455_100087014 | 274 |
| 1160 | 3300025273 | Ga0209673_1038407 | Ga0209673_10384071 | 274 |
| 1161 | 3300025295 | Ga0209564_1006054 | Ga0209564_10060545 | 274 |
| 1162 | 3300025295 | Ga0209564_1008088 | Ga0209564_10080885 | 274 |
| 1163 | 3300025297 | Ga0209758_1000011 | Ga0209758_1000011442 | 274 |
| 1164 | 3300025297 | Ga0209758_1003253 | Ga0209758_100325314 | 274 |
| 1165 | 3300025297 | Ga0209758_1004985 | Ga0209758_100498511 | 274 |
| 1166 | 3300025297 | Ga0209758_1018571 | Ga0209758_10185712 | 274 |
| 1167 | 3300025297 | Ga0209758_1025749 | Ga0209758_10257492 | 274 |
| 1168 | 3300025297 | Ga0209758_1030236 | Ga0209758_10302362 | 274 |
| 1169 | 3300025299 | Ga0209256_1011489 | Ga0209256_10114892 | 274 |
| 1170 | 3300025302 | Ga0207426_1000270 | Ga0207426_100027099 | 274 |
| 1171 | 3300025302 | Ga0207426_1000292 | Ga0207426_100029249 | 274 |
| 1172 | 3300025302 | Ga0207426_1005288 | Ga0207426_10052884 | 274 |
| 1173 | 3300025302 | Ga0207426_1016172 | Ga0207426_10161722 | 274 |
| 1174 | 3300025303 | Ga0209051_1042029 | Ga0209051_10420292 | 274 |
| 1175 | 3300025304 | Ga0209257_1000654 | Ga0209257_100065444 | 274 |
| 1176 | 3300025315 | Ga0207697_10142617 | Ga0207697_101426171 | 274 |
| 1177 | 3300025321 | Ga0207656_10025546 | Ga0207656_100255462 | 274 |
| 1178 | 3300025899 | Ga0207642_10016713 | Ga0207642_100167132 | 274 |
| 1179 | 3300025904 | Ga0207647_10008237 | Ga0207647_100082373 | 274 |
| 1180 | 3300025908 | Ga0207643_10060820 | Ga0207643_100608203 | 274 |
| 1181 | 3300025909 | Ga0207705_10388082 | Ga0207705_103880822 | 274 |
| 1182 | 3300025911 | Ga0207654_10026874 | Ga0207654_100268743 | 274 |
| 1183 | 3300025911 | Ga0207654_10108455 | Ga0207654_101084551 | 274 |
| 1184 | 3300025911 | Ga0207654_10252555 | Ga0207654_102525552 | 274 |
| 1185 | 3300025913 | Ga0207695_10000008 | Ga0207695_10000008925 | 274 |
| 1186 | 3300025914 | Ga0207671_10002106 | Ga0207671_1000210612 | 274 |
| 1187 | 3300025914 | Ga0207671_10217102 | Ga0207671_102171022 | 274 |
| 1188 | 3300025915 | Ga0207693_10375159 | Ga0207693_103751592 | 274 |
| 1189 | 3300025919 | Ga0207657_10092304 | Ga0207657_100923041 | 274 |
| 1190 | 3300025919 | Ga0207657_10113268 | Ga0207657_101132682 | 274 |
| 1191 | 3300025923 | Ga0207681_10229485 | Ga0207681_102294852 | 274 |
| 1192 | 3300025928 | Ga0207700_10032159 | Ga0207700_100321592 | 274 |
| 1193 | 3300025932 | Ga0207690_10101306 | Ga0207690_101013062 | 274 |
| 1194 | 3300025933 | Ga0207706_10172113 | Ga0207706_101721132 | 274 |
| 1195 | 3300025934 | Ga0207686_10174492 | Ga0207686_101744922 | 274 |
| 1196 | 3300025937 | Ga0207669_10003695 | Ga0207669_100036954 | 274 |
| 1197 | 3300025938 | Ga0207704_10183035 | Ga0207704_101830352 | 274 |
| 1198 | 3300025942 | Ga0207689_10427735 | Ga0207689_104277351 | 274 |
| 1199 | 3300025945 | Ga0207679_10065955 | Ga0207679_100659552 | 274 |
| 1200 | 3300025949 | Ga0207667_10371601 | Ga0207667_103716011 | 274 |
| 1201 | 3300025981 | Ga0207640_10431227 | Ga0207640_104312272 | 274 |
| 1202 | 3300025986 | Ga0207658_10410917 | Ga0207658_104109172 | 274 |
| 1203 | 3300026035 | Ga0207703_10144412 | Ga0207703_101444122 | 274 |
| 1204 | 3300026067 | Ga0207678_10304404 | Ga0207678_103044041 | 274 |
| 1205 | 3300026075 | Ga0207708_10017997 | Ga0207708_100179974 | 274 |
| 1206 | 3300026078 | Ga0207702_10009707 | Ga0207702_100097075 | 274 |
| 1207 | 3300026089 | Ga0207648_10010213 | Ga0207648_100102134 | 274 |
| 1208 | 3300026089 | Ga0207648_10320125 | Ga0207648_103201252 | 274 |
| 1209 | 3300026095 | Ga0207676_10306967 | Ga0207676_103069672 | 274 |
| 1210 | 3300026116 | Ga0207674_10142681 | Ga0207674_101426812 | 274 |
| 1211 | 3300026118 | Ga0207675_100177736 | Ga0207675_1001777362 | 274 |
| 1212 | 3300026121 | Ga0207683_10010439 | Ga0207683_100104395 | 274 |
| 1213 | 3300026121 | Ga0207683_10112619 | Ga0207683_101126193 | 274 |
| 1214 | 3300027296 | Ga0209389_1000001 | Ga0209389_100000110 | 274 |
| 1215 | 3300027361 | Ga0209489_108402 | Ga0209489_10840210 | 274 |
| 1216 | 3300027363 | Ga0209700_100007 | Ga0209700_100007394 | 274 |
| 1217 | 3300028379 | Ga0268266_10007937 | Ga0268266_100079373 | 274 |
| 1218 | 3300028379 | Ga0268266_10010415 | Ga0268266_100104154 | 274 |
| 1219 | 3300028379 | Ga0268266_10119288 | Ga0268266_101192882 | 274 |
| 1220 | 3300028379 | Ga0268266_10411526 | Ga0268266_104115261 | 274 |
| 1221 | 3300028380 | Ga0268265_10108576 | Ga0268265_101085762 | 274 |
| 1222 | 3300028794 | Ga0307515_10192193 | Ga0307515_101921932 | 274 |
| 1223 | 3300030521 | Ga0307511_10141592 | Ga0307511_101415922 | 274 |
| 1224 | 3300031507 | Ga0307509_10236451 | Ga0307509_102364512 | 274 |
| 1225 | 3300031711 | Ga0265314_10026866 | Ga0265314_100268662 | 274 |
| 1226 | 3300032126 | Ga0307415_100176890 | Ga0307415_1001768901 | 274 |
| 1227 | 3300032126 | Ga0307415_100480536 | Ga0307415_1004805361 | 274 |
| 1228 | 3300033180 | Ga0307510_10002829 | Ga0307510_100028292 | 274 |
| 1229 | 3300033180 | Ga0307510_10003237 | Ga0307510_100032377 | 274 |
| 1230 | 3300033180 | Ga0307510_10110295 | Ga0307510_101102953 | 274 |
| 1231 | 3300037312 | Ga0395899_0287739 | Ga0395899_0287739_152_976 | 274 |
| 1232 | 3300037418 | Ga0395900_0001070 | Ga0395900_0001070_2530_3354 | 274 |
| 1233 | 3300037418 | Ga0395900_0196098 | Ga0395900_0196098_201_1025 | 274 |
| 1234 | 3300037466 | Ga0395898_0005530 | Ga0395898_0005530_11481_12305 | 274 |
| 1235 | 3300037471 | Ga0395905_0013406 | Ga0395905_0013406_2941_3765 | 274 |
| 1236 | 3300037471 | Ga0395905_0184583 | Ga0395905_0184583_941_1765 | 274 |
| 1237 | 3300038443 | Ga0395901_0645637 | Ga0395901_0645637_82_906 | 274 |
| 1238 | 3300044658 | Ga0466972_0000113 | Ga0466972_0000113_25905_26729 | 274 |
| 1239 | 3300044658 | Ga0466972_0016844 | Ga0466972_0016844_1653_2477 | 274 |
| 1240 | 3300044694 | Ga0466963_0043082 | Ga0466963_0043082_1252_2076 | 274 |
| 1241 | 3300044735 | Ga0466968_0000932 | Ga0466968_0000932_7978_8802 | 274 |
| 1242 | 3300044842 | Ga0466957_0028968 | Ga0466957_0028968_1220_2044 | 274 |
| 1243 | 3300044901 | Ga0466960_0005727 | Ga0466960_0005727_2955_3779 | 274 |
| 1244 | 3300045049 | Ga0466959_0380267 | Ga0466959_0380267_31_855 | 274 |
| 1245 | 3300045976 | Ga0466967_0171324 | Ga0466967_0171324_938_1762 | 274 |
| 1246 | 3300045976 | Ga0466967_0355512 | Ga0466967_0355512_31_855 | 274 |
| 1247 | 3300046454 | Ga0495592_0094756 | Ga0495592_0094756_133_957 | 274 |
| 1248 | 3300046459 | Ga0495629_0048748 | Ga0495629_0048748_1190_2014 | 274 |
| 1249 | 3300046460 | Ga0495638_0012007 | Ga0495638_0012007_2304_3128 | 274 |
| 1250 | 3300046462 | Ga0495651_0005934 | Ga0495651_0005934_3828_4652 | 274 |
| 1251 | 3300046462 | Ga0495651_0089633 | Ga0495651_0089633_961_1785 | 274 |
| 1252 | 3300046511 | Ga0495608_0091336 | Ga0495608_0091336_833_1657 | 274 |
| 1253 | 3300046513 | Ga0495616_0115270 | Ga0495616_0115270_89_913 | 274 |
| 1254 | 3300046517 | Ga0495630_0223644 | Ga0495630_0223644_86_910 | 274 |
| 1255 | 3300046519 | Ga0495632_0110939 | Ga0495632_0110939_37_861 | 274 |
| 1256 | 3300046522 | Ga0495643_0005620 | Ga0495643_0005620_652_1476 | 274 |
| 1257 | 3300046529 | Ga0495652_0101565 | Ga0495652_0101565_1146_1970 | 274 |
| 1258 | 3300046542 | Ga0495597_0024076 | Ga0495597_0024076_1733_2557 | 274 |
| 1259 | 3300046543 | Ga0495645_0037627 | Ga0495645_0037627_29_853 | 274 |
| 1260 | 3300046557 | Ga0495622_0006059 | Ga0495622_0006059_4218_5042 | 274 |
| 1261 | 3300046557 | Ga0495622_0155600 | Ga0495622_0155600_55_879 | 274 |
| 1262 | 3300046616 | Ga0495668_0038764 | Ga0495668_0038764_1696_2520 | 274 |
| 1263 | 3300046642 | Ga0495634_0157369 | Ga0495634_0157369_50_874 | 274 |
| 1264 | 3300046648 | Ga0495611_0056988 | Ga0495611_0056988_248_1072 | 274 |
| 1265 | 3300046660 | Ga0495625_0064674 | Ga0495625_0064674_1598_2422 | 274 |
| 1266 | 3300046663 | Ga0495635_0043702 | Ga0495635_0043702_1329_2153 | 274 |
| 1267 | 3300046665 | Ga0495661_0081560 | Ga0495661_0081560_207_1031 | 274 |
| 1268 | 3300046674 | Ga0495588_0032949 | Ga0495588_0032949_1432_2256 | 274 |
| 1269 | 3300046675 | Ga0495657_0005063 | Ga0495657_0005063_349_1173 | 274 |
| 1270 | 3300046675 | Ga0495657_0019734 | Ga0495657_0019734_1167_1991 | 274 |
| 1271 | 3300046678 | Ga0495599_0005399 | Ga0495599_0005399_259_1083 | 274 |
| 1272 | 3300046679 | Ga0495623_0010714 | Ga0495623_0010714_1902_2726 | 274 |
| 1273 | 3300046680 | Ga0495646_0044303 | Ga0495646_0044303_133_957 | 274 |
| 1274 | 3300046680 | Ga0495646_0058827 | Ga0495646_0058827_29_853 | 274 |
| 1275 | 3300046689 | Ga0495613_0194052 | Ga0495613_0194052_600_1424 | 274 |
| 1276 | 3300046690 | Ga0495624_0082485 | Ga0495624_0082485_978_1802 | 274 |
| 1277 | 3300046694 | Ga0495649_0034616 | Ga0495649_0034616_872_1696 | 274 |
| 1278 | 3300046694 | Ga0495649_0215346 | Ga0495649_0215346_55_879 | 274 |
| 1279 | 3300046809 | Ga0495600_0034115 | Ga0495600_0034115_1146_1970 | 274 |
| 1280 | 3300046809 | Ga0495600_0115809 | Ga0495600_0115809_721_1545 | 274 |
| 1281 | 3300046810 | Ga0495660_0110928 | Ga0495660_0110928_44_868 | 274 |
| 1282 | 3300047317 | Ga0495604_0012158 | Ga0495604_0012158_5887_6711 | 274 |
| 1283 | 3300047317 | Ga0495604_0122700 | Ga0495604_0122700_436_1260 | 274 |
| 1284 | 3300047319 | Ga0495674_0067171 | Ga0495674_0067171_426_1250 | 274 |
| 1285 | 3300047322 | Ga0495680_0002491 | Ga0495680_0002491_11652_12476 | 274 |
| 1286 | 3300047444 | Ga0495675_0056331 | Ga0495675_0056331_1167_1991 | 274 |
| 1287 | 3300047472 | Ga0495686_0152628 | Ga0495686_0152628_341_1165 | 274 |
| 1288 | 3300048088 | Ga0495602_0016927 | Ga0495602_0016927_1076_1900 | 274 |
| 1289 | 3300048904 | Ga0496101_0307595 | Ga0496101_0307595_15_839 | 274 |
| 1290 | 3300048905 | Ga0496102_0033402 | Ga0496102_0033402_297_1121 | 274 |
| 1291 | 3300048905 | Ga0496102_0562135 | Ga0496102_0562135_108_932 | 274 |
| 1292 | 3300048906 | Ga0496103_0015210 | Ga0496103_0015210_458_1282 | 274 |
| 1293 | 3300048907 | Ga0496104_0133856 | Ga0496104_0133856_940_1764 | 274 |
| 1294 | 3300048908 | Ga0496105_0042793 | Ga0496105_0042793_1686_2510 | 274 |
| 1295 | 3300048908 | Ga0496105_0202576 | Ga0496105_0202576_636_1460 | 274 |
| 1296 | 3300048911 | Ga0496108_0121964 | Ga0496108_0121964_1243_2067 | 274 |
| 1297 | 3300048912 | Ga0496109_0141535 | Ga0496109_0141535_838_1662 | 274 |
| 1298 | 3300048917 | Ga0496114_0291075 | Ga0496114_0291075_558_1382 | 274 |
| 1299 | 3300048918 | Ga0496115_0479874 | Ga0496115_0479874_88_912 | 274 |
| 1300 | 3300048919 | Ga0496116_0137327 | Ga0496116_0137327_54_878 | 274 |
| 1301 | 3300048919 | Ga0496116_0142709 | Ga0496116_0142709_205_1029 | 274 |
| 1302 | 3300048920 | Ga0496117_0020299 | Ga0496117_0020299_4264_5088 | 274 |
| 1303 | 3300048921 | Ga0496118_0076364 | Ga0496118_0076364_1362_2186 | 274 |
| 1304 | 3300048922 | Ga0496119_0018586 | Ga0496119_0018586_263_1087 | 274 |
| 1305 | 3300048922 | Ga0496119_0054319 | Ga0496119_0054319_1597_2421 | 274 |
| 1306 | 3300048923 | Ga0496120_0060460 | Ga0496120_0060460_99_923 | 274 |
| 1307 | 3300048924 | Ga0496121_0032854 | Ga0496121_0032854_1631_2455 | 274 |
| 1308 | 3300048924 | Ga0496121_0055416 | Ga0496121_0055416_2400_3224 | 274 |
| 1309 | 3300048924 | Ga0496121_0245325 | Ga0496121_0245325_12_836 | 274 |
| 1310 | 3300048925 | Ga0496122_0193843 | Ga0496122_0193843_17_841 | 274 |
| 1311 | 3300048927 | Ga0496124_0026227 | Ga0496124_0026227_184_1008 | 274 |
| 1312 | 3300048927 | Ga0496124_0104201 | Ga0496124_0104201_574_1398 | 274 |
| 1313 | 3300048927 | Ga0496124_0306678 | Ga0496124_0306678_50_874 | 274 |
| 1314 | 3300048928 | Ga0496125_0142052 | Ga0496125_0142052_574_1398 | 274 |
| 1315 | 3300048929 | Ga0496126_0079115 | Ga0496126_0079115_1525_2349 | 274 |
| 1316 | 3300048929 | Ga0496126_0087192 | Ga0496126_0087192_1003_1827 | 274 |
| 1317 | 3300048929 | Ga0496126_0477612 | Ga0496126_0477612_18_842 | 274 |
| 1318 | 3300050491 | nmdc:mga00v17_40538_c1 | nmdc:mga00v17_40538_c1_899_1723 | 274 |
| 1319 | 3300050492 | nmdc:mga0yw44_21029_c1 | nmdc:mga0yw44_21029_c1_1170_1994 | 274 |
| 1320 | 3300050493 | nmdc:mga0k408_12428_c1 | nmdc:mga0k408_12428_c1_3492_4316 | 274 |
| 1321 | 3300050494 | nmdc:mga06z11_314908_c1 | nmdc:mga06z11_314908_c1_90_914 | 274 |
| 1322 | 3300050496 | nmdc:mga07m45_5905_c1 | nmdc:mga07m45_5905_c1_3570_4394 | 274 |
| 1323 | 3300050496 | nmdc:mga07m45_65054_c1 | nmdc:mga07m45_65054_c1_670_1494 | 274 |
| 1324 | 3300050511 | nmdc:mga08y16_761801_c1 | nmdc:mga08y16_761801_c1_54_878 | 274 |
| 1325 | 3300050512 | nmdc:mga0n895_93916_c1 | nmdc:mga0n895_93916_c1_253_1086 | 274 |
| 1326 | 3300050515 | nmdc:mga0a205_386917_c1 | nmdc:mga0a205_386917_c1_153_977 | 274 |
| 1327 | 3300050516 | nmdc:mga0sz30_8078_c3 | nmdc:mga0sz30_8078_c3_795_1619 | 274 |
| 1328 | 3300053080 | Ga0500635_0056847 | Ga0500635_0056847_386_1210 | 274 |
| 1329 | 3300053087 | Ga0500643_001180 | Ga0500643_001180_1177_2001 | 274 |
| 1330 | 3300053091 | Ga0500647_0070748 | Ga0500647_0070748_68_892 | 274 |
| 1331 | 3300053093 | Ga0500651_0121168 | Ga0500651_0121168_520_1344 | 274 |
| 1332 | 3300053094 | Ga0500566_0000112 | Ga0500566_0000112_1095_1919 | 274 |
| 1333 | 3300053104 | Ga0500556_0006793 | Ga0500556_0006793_1464_2288 | 274 |
| 1334 | 3300053105 | Ga0500557_000003 | Ga0500557_000003_164892_165716 | 274 |
| 1335 | 3300053108 | Ga0500562_008373 | Ga0500562_008373_729_1553 | 274 |
| 1336 | 3300053109 | Ga0500569_003333 | Ga0500569_003333_80_904 | 274 |
| 1337 | 3300053119 | Ga0500595_010235 | Ga0500595_010235_1971_2795 | 274 |
| 1338 | 3300053121 | Ga0500607_054105 | Ga0500607_054105_945_1769 | 274 |
| 1339 | 3300053130 | Ga0500642_0000466 | Ga0500642_0000466_11129_11953 | 274 |
| 1340 | 3300053130 | Ga0500642_0016883 | Ga0500642_0016883_1897_2721 | 274 |
| 1341 | 3300053131 | Ga0500652_162915 | Ga0500652_162915_34_858 | 274 |
| 1342 | 3300053136 | Ga0500559_0010663 | Ga0500559_0010663_2903_3727 | 274 |
| 1343 | 3300053139 | Ga0500568_0035015 | Ga0500568_0035015_655_1479 | 274 |
| 1344 | 3300053155 | Ga0500620_004974 | Ga0500620_004974_1093_1917 | 274 |
| 1345 | 3300053156 | Ga0500622_0015382 | Ga0500622_0015382_1061_1885 | 274 |
| 1346 | 3300053177 | Ga0500636_0000284 | Ga0500636_0000284_15789_16613 | 274 |
| 1347 | 3300053729 | Ga0500625_048108 | Ga0500625_048108_1065_1889 | 274 |
| 1348 | 3300053737 | Ga0500601_000250 | Ga0500601_000250_1211_2035 | 274 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6mfh-assembly1.cif.gz_A | mutated uronate dehydrogenase | 0.9457 | 2 | 258 |
| 3rft-assembly1.cif.gz_A | crystal structure of uronate dehydrogenase from agrobacterium tumefaciens | 0.9434 | 1 | 258 |
| 3rfx-assembly1.cif.gz_A | crystal structure of uronate dehydrogenase from agrobacterium tumefaciens, y136a mutant complexed with nad | 0.9433 | 1 | 258 |
| 3ay3-assembly2.cif.gz_D | crystal structure of glucuronic acid dehydrogeanse from chromohalobacter salexigens | 0.9405 | 1 | 258 |
| 3rfx-assembly1.cif.gz_A | crystal structure of uronate dehydrogenase from agrobacterium tumefaciens, y136a mutant complexed with nad | 0.9157 | 1 | 258 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3rftA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9627 | 1 | 226 | 3.40.50.720 |
| 3rftA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9504 | 1 | 226 | 3.40.50.720 |
| 4id9A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8912 | 4 | 226 | 3.40.50.720 |
| 4id9A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8833 | 4 | 226 | 3.40.50.720 |
| af_I1KVW6_141_273_3.40.50.20 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8633 | 2 | 99 | 3.40.50.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A059WSP6-F1-model_v4 | NAD dependent epimerase/dehydratase family | 0.9968 | 6 | 190 |
|
| AF-A0A537RTH7-F1-model_v4 | NAD(P)-dependent oxidoreductase | 0.9957 | 1 | 188 |
|
| AF-A0A537RTH7-F1-model_v4 | NAD(P)-dependent oxidoreductase | 0.9904 | 1 | 188 |
|
| AF-A0A4Q5P446-F1-model_v4 | NAD(P)-dependent oxidoreductase | 0.9896 | 1 | 90 |
|
| AF-A0A516H2E7-F1-model_v4 | NAD(P)-dependent oxidoreductase | 0.989 | 1 | 267 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar