F493214
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1348 | 438 | 2692 | 114 |
Family's Representative Sequence
| Representative Sequence | 3300005444|Ga0070694_100795702|Ga0070694_1007957022 |
| Length | 111 |
| Sequence | MGVSRRQFTKEFKLAAVRRLEQGVSMAEAARALEVSANVLQRWRREFRQGPGNASPGNGKSEGRIAELERKIGQQSLEIDFLKGCLQRIEEQRMLQALTGNPPSTGRSRKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 79 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 80 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 86 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 87 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 88 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 89 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 94 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 95 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 109 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 112 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 113 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 125 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 129 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 130 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300019192 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 132 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 135 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 136 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 137 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 138 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 139 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 140 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 141 | 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 | Metagenome | Rhizosphere |
| 142 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 143 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 144 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 209 | 3300028010 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 | Metagenome | Rhizosphere |
| 210 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 211 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 215 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 216 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 217 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 218 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 219 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 220 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 221 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 222 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 223 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 224 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 225 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 226 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 227 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 228 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 229 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 230 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 231 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 232 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 233 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 234 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 235 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 236 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 237 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 238 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 239 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 240 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 241 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 242 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 243 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 244 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 245 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 246 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 247 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 248 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 249 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 250 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 251 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 252 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 253 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 254 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 255 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 256 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 257 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 258 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 259 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 260 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 261 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 262 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 263 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 264 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 265 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 266 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 267 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 268 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 269 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 270 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 271 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 272 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 273 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 274 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 275 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 276 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 277 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 278 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 279 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 280 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 281 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 282 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 283 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 284 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 285 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 286 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 287 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 288 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 289 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 290 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 291 | 3300038698 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 | Metagenome | Rhizosphere |
| 292 | 3300038699 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 | Metagenome | Rhizosphere |
| 293 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 294 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 295 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 296 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 297 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 298 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 299 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 300 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 301 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 302 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 303 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 304 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 305 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 306 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 307 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 308 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 309 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 310 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 311 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 312 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 313 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 314 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 315 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 316 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 392 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 393 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 394 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 395 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 396 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 397 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 398 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 399 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 400 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 401 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 402 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 403 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 404 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 405 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 406 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 407 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 408 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 410 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 411 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 413 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 414 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 415 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 416 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 417 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 420 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 421 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 422 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 424 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 425 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 426 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 427 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 428 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 429 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 434 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 435 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 436 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 437 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 438 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.11 |
| Metatranscriptomes | 0.89 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.07 |
| Nodule | 0 |
| Rhizoplane | 3.12 |
| Rhizosphere | 93.99 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 41.77 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070694_100795702 | 3300005444 | Bacteria | 775 |
| 2 | rootH2_10019593 | 3300003320 | Bacteria | 1506 |
| 3 | Ga0065707_10312566 | 3300005295 | Unclassified | 967 |
| 4 | Ga0065707_10424872 | 3300005295 | Bacteria | 804 |
| 5 | Ga0070658_10090249 | 3300005327 | Bacteria | 2524 |
| 6 | Ga0070658_10243496 | 3300005327 | Bacteria | 1524 |
| 7 | Ga0070676_10097515 | 3300005328 | Bacteria | 1811 |
| 8 | Ga0070676_10126376 | 3300005328 | Unclassified | 1612 |
| 9 | Ga0070676_10501287 | 3300005328 | Bacteria | 862 |
| 10 | Ga0070683_100254580 | 3300005329 | Bacteria | 1670 |
| 11 | Ga0070683_100255158 | 3300005329 | Unclassified | 1668 |
| 12 | Ga0070683_100377586 | 3300005329 | Bacteria | 1351 |
| 13 | Ga0070683_100585153 | 3300005329 | Bacteria | 1068 |
| 14 | Ga0070683_101044542 | 3300005329 | Unclassified | 784 |
| 15 | Ga0070683_101081087 | 3300005329 | Bacteria | 770 |
| 16 | Ga0070683_101333841 | 3300005329 | Bacteria | 689 |
| 17 | Ga0070683_102150426 | 3300005329 | Unclassified | 536 |
| 18 | Ga0070690_100139901 | 3300005330 | Bacteria | 1642 |
| 19 | Ga0070690_100167818 | 3300005330 | Bacteria | 1509 |
| 20 | Ga0070690_100853163 | 3300005330 | Bacteria | 710 |
| 21 | Ga0070670_100243461 | 3300005331 | Unclassified | 1566 |
| 22 | Ga0070670_100266887 | 3300005331 | Bacteria | 1493 |
| 23 | Ga0070670_100324165 | 3300005331 | Unclassified | 1350 |
| 24 | Ga0070670_100814584 | 3300005331 | Bacteria | 844 |
| 25 | Ga0070670_101115855 | 3300005331 | Unclassified | 719 |
| 26 | Ga0070677_10139931 | 3300005333 | Unclassified | 1115 |
| 27 | Ga0070677_10850500 | 3300005333 | Bacteria | 524 |
| 28 | Ga0068869_100255970 | 3300005334 | Bacteria | 1400 |
| 29 | Ga0068869_100358548 | 3300005334 | Unclassified | 1190 |
| 30 | Ga0070666_10102578 | 3300005335 | Bacteria | 1973 |
| 31 | Ga0070666_10149054 | 3300005335 | Bacteria | 1632 |
| 32 | Ga0070666_10558879 | 3300005335 | Unclassified | 833 |
| 33 | Ga0070666_10719474 | 3300005335 | Unclassified | 733 |
| 34 | Ga0070680_100172644 | 3300005336 | Bacteria | 1820 |
| 35 | Ga0070680_100438196 | 3300005336 | Bacteria | 1115 |
| 36 | Ga0070680_100799337 | 3300005336 | Bacteria | 813 |
| 37 | Ga0070680_101678222 | 3300005336 | Bacteria | 551 |
| 38 | Ga0070682_100158409 | 3300005337 | Bacteria | 1561 |
| 39 | Ga0070682_100437085 | 3300005337 | Bacteria | 999 |
| 40 | Ga0070682_100443281 | 3300005337 | Unclassified | 992 |
| 41 | Ga0070682_101471743 | 3300005337 | Unclassified | 585 |
| 42 | Ga0068868_100196458 | 3300005338 | Bacteria | 1680 |
| 43 | Ga0068868_100278662 | 3300005338 | Bacteria | 1415 |
| 44 | Ga0068868_100595738 | 3300005338 | Bacteria | 979 |
| 45 | Ga0068868_100976639 | 3300005338 | Bacteria | 774 |
| 46 | Ga0068868_101425537 | 3300005338 | Bacteria | 647 |
| 47 | Ga0068868_101688230 | 3300005338 | Bacteria | 597 |
| 48 | Ga0070660_100067740 | 3300005339 | Unclassified | 2782 |
| 49 | Ga0070660_101272793 | 3300005339 | Unclassified | 624 |
| 50 | Ga0070689_100088674 | 3300005340 | Unclassified | 2436 |
| 51 | Ga0070689_100595812 | 3300005340 | Bacteria | 957 |
| 52 | Ga0070689_100614582 | 3300005340 | Bacteria | 942 |
| 53 | Ga0070689_100783294 | 3300005340 | Unclassified | 838 |
| 54 | Ga0070689_101083559 | 3300005340 | Unclassified | 716 |
| 55 | Ga0070689_101484051 | 3300005340 | Bacteria | 614 |
| 56 | Ga0070689_102225973 | 3300005340 | Unclassified | 502 |
| 57 | Ga0070691_10073652 | 3300005341 | Unclassified | 1661 |
| 58 | Ga0070691_10283255 | 3300005341 | Unclassified | 900 |
| 59 | Ga0070687_100117577 | 3300005343 | Unclassified | 1515 |
| 60 | Ga0070687_100227091 | 3300005343 | Bacteria | 1147 |
| 61 | Ga0070687_101486298 | 3300005343 | Unclassified | 509 |
| 62 | Ga0070661_100305128 | 3300005344 | Bacteria | 1240 |
| 63 | Ga0070661_100671087 | 3300005344 | Bacteria | 843 |
| 64 | Ga0070692_10021329 | 3300005345 | Bacteria | 3151 |
| 65 | Ga0070692_10081767 | 3300005345 | Bacteria | 1741 |
| 66 | Ga0070668_100375465 | 3300005347 | Unclassified | 1209 |
| 67 | Ga0070668_100910521 | 3300005347 | Bacteria | 786 |
| 68 | Ga0070669_100165698 | 3300005353 | Unclassified | 1720 |
| 69 | Ga0070669_100256226 | 3300005353 | Bacteria | 1395 |
| 70 | Ga0070675_100162423 | 3300005354 | Bacteria | 1922 |
| 71 | Ga0070675_100782557 | 3300005354 | Bacteria | 872 |
| 72 | Ga0070671_100207715 | 3300005355 | Bacteria | 1661 |
| 73 | Ga0070671_100218506 | 3300005355 | Bacteria | 1617 |
| 74 | Ga0070671_101863423 | 3300005355 | Bacteria | 535 |
| 75 | Ga0070674_100844982 | 3300005356 | Bacteria | 794 |
| 76 | Ga0070674_100895490 | 3300005356 | Unclassified | 773 |
| 77 | Ga0070674_102022017 | 3300005356 | Unclassified | 525 |
| 78 | Ga0070673_100200879 | 3300005364 | Bacteria | 1717 |
| 79 | Ga0070673_100408403 | 3300005364 | Unclassified | 1215 |
| 80 | Ga0070673_100453571 | 3300005364 | Unclassified | 1154 |
| 81 | Ga0070673_100526464 | 3300005364 | Bacteria | 1072 |
| 82 | Ga0070688_100067818 | 3300005365 | Bacteria | 2273 |
| 83 | Ga0070688_100605909 | 3300005365 | Unclassified | 839 |
| 84 | Ga0070688_100949130 | 3300005365 | Unclassified | 681 |
| 85 | Ga0070688_101079487 | 3300005365 | Bacteria | 641 |
| 86 | Ga0070688_101113689 | 3300005365 | Unclassified | 632 |
| 87 | Ga0070688_101116347 | 3300005365 | Unclassified | 631 |
| 88 | Ga0070659_101053502 | 3300005366 | Bacteria | 715 |
| 89 | Ga0070659_101806970 | 3300005366 | Unclassified | 547 |
| 90 | Ga0070667_100385305 | 3300005367 | Unclassified | 1274 |
| 91 | Ga0070667_100632059 | 3300005367 | Bacteria | 988 |
| 92 | Ga0070667_100877097 | 3300005367 | Unclassified | 835 |
| 93 | Ga0070667_101873505 | 3300005367 | Unclassified | 565 |
| 94 | Ga0070703_10023800 | 3300005406 | Bacteria | 1805 |
| 95 | Ga0070709_10179236 | 3300005434 | Unclassified | 1487 |
| 96 | Ga0070709_10302971 | 3300005434 | Unclassified | 1168 |
| 97 | Ga0070709_10398710 | 3300005434 | Unclassified | 1027 |
| 98 | Ga0070709_10479541 | 3300005434 | Unclassified | 941 |
| 99 | Ga0070709_10652406 | 3300005434 | Bacteria | 815 |
| 100 | Ga0070709_10732287 | 3300005434 | Bacteria | 772 |
| 101 | Ga0070714_100106463 | 3300005435 | Bacteria | 2477 |
| 102 | Ga0070714_100315022 | 3300005435 | Unclassified | 1462 |
| 103 | Ga0070714_100587355 | 3300005435 | Unclassified | 1069 |
| 104 | Ga0070714_100718489 | 3300005435 | Unclassified | 965 |
| 105 | Ga0070714_100731636 | 3300005435 | Bacteria | 956 |
| 106 | Ga0070713_100088900 | 3300005436 | Plasmid | 2652 |
| 107 | Ga0070713_100095836 | 3300005436 | Bacteria | 2560 |
| 108 | Ga0070713_100104705 | 3300005436 | Bacteria | 2457 |
| 109 | Ga0070713_100219868 | 3300005436 | Bacteria | 1723 |
| 110 | Ga0070713_100265178 | 3300005436 | Unclassified | 1571 |
| 111 | Ga0070713_100311644 | 3300005436 | Bacteria | 1451 |
| 112 | Ga0070713_100688489 | 3300005436 | Bacteria | 975 |
| 113 | Ga0070713_100832360 | 3300005436 | Bacteria | 886 |
| 114 | Ga0070710_10016379 | 3300005437 | Bacteria | 3771 |
| 115 | Ga0070710_10090724 | 3300005437 | Unclassified | 1802 |
| 116 | Ga0070710_10103467 | 3300005437 | Bacteria | 1700 |
| 117 | Ga0070710_10919549 | 3300005437 | Unclassified | 633 |
| 118 | Ga0070701_10302305 | 3300005438 | Bacteria | 984 |
| 119 | Ga0070711_100077673 | 3300005439 | Unclassified | 2357 |
| 120 | Ga0070711_100094059 | 3300005439 | Unclassified | 2166 |
| 121 | Ga0070711_100100779 | 3300005439 | Bacteria | 2101 |
| 122 | Ga0070711_100120200 | 3300005439 | Bacteria | 1942 |
| 123 | Ga0070711_100242938 | 3300005439 | Unclassified | 1409 |
| 124 | Ga0070711_100286271 | 3300005439 | Bacteria | 1306 |
| 125 | Ga0070711_100317493 | 3300005439 | Bacteria | 1244 |
| 126 | Ga0070711_101074656 | 3300005439 | Bacteria | 692 |
| 127 | Ga0070700_100122773 | 3300005441 | Bacteria | 1743 |
| 128 | Ga0070700_100256017 | 3300005441 | Bacteria | 1258 |
| 129 | Ga0070700_100379627 | 3300005441 | Unclassified | 1056 |
| 130 | Ga0070700_100559382 | 3300005441 | Bacteria | 890 |
| 131 | Ga0070694_100139804 | 3300005444 | Bacteria | 1757 |
| 132 | Ga0070694_100154079 | 3300005444 | Unclassified | 1681 |
| 133 | Ga0070694_100358762 | 3300005444 | Bacteria | 1131 |
| 134 | Ga0070694_100676028 | 3300005444 | Bacteria | 838 |
| 135 | Ga0070708_100786513 | 3300005445 | Unclassified | 894 |
| 136 | Ga0070663_100663991 | 3300005455 | Unclassified | 883 |
| 137 | Ga0070678_100180964 | 3300005456 | Bacteria | 1725 |
| 138 | Ga0070678_100224785 | 3300005456 | Bacteria | 1562 |
| 139 | Ga0070662_100604219 | 3300005457 | Bacteria | 923 |
| 140 | Ga0070662_100770740 | 3300005457 | Bacteria | 817 |
| 141 | Ga0070681_10239358 | 3300005458 | Bacteria | 1729 |
| 142 | Ga0070681_10277846 | 3300005458 | Bacteria | 1586 |
| 143 | Ga0070681_11131692 | 3300005458 | Bacteria | 704 |
| 144 | Ga0068867_100117243 | 3300005459 | Unclassified | 2053 |
| 145 | Ga0068867_100198513 | 3300005459 | Bacteria | 1605 |
| 146 | Ga0068867_100215955 | 3300005459 | Bacteria | 1543 |
| 147 | Ga0068867_100225560 | 3300005459 | Unclassified | 1512 |
| 148 | Ga0068867_100236533 | 3300005459 | Bacteria | 1479 |
| 149 | Ga0068867_100290997 | 3300005459 | Unclassified | 1343 |
| 150 | Ga0068867_100564606 | 3300005459 | Unclassified | 988 |
| 151 | Ga0068867_101854706 | 3300005459 | Unclassified | 568 |
| 152 | Ga0070685_10106324 | 3300005466 | Bacteria | 1722 |
| 153 | Ga0070685_10265400 | 3300005466 | Bacteria | 1143 |
| 154 | Ga0070685_10310525 | 3300005466 | Bacteria | 1066 |
| 155 | Ga0070706_100249001 | 3300005467 | Bacteria | 1659 |
| 156 | Ga0070706_101328940 | 3300005467 | Bacteria | 659 |
| 157 | Ga0070706_101612158 | 3300005467 | Unclassified | 592 |
| 158 | Ga0070707_100133277 | 3300005468 | Bacteria | 2416 |
| 159 | Ga0070707_100202041 | 3300005468 | Bacteria | 1937 |
| 160 | Ga0070707_101692598 | 3300005468 | Unclassified | 600 |
| 161 | Ga0070698_100030971 | 3300005471 | Bacteria | 5548 |
| 162 | Ga0070698_100105817 | 3300005471 | Bacteria | 2783 |
| 163 | Ga0070699_100243343 | 3300005518 | Unclassified | 1606 |
| 164 | Ga0070699_100394632 | 3300005518 | Bacteria | 1250 |
| 165 | Ga0070699_100943086 | 3300005518 | Bacteria | 791 |
| 166 | Ga0070679_100153282 | 3300005530 | Bacteria | 2280 |
| 167 | Ga0070679_100175352 | 3300005530 | Bacteria | 2116 |
| 168 | Ga0070679_100269232 | 3300005530 | Bacteria | 1658 |
| 169 | Ga0070679_100640691 | 3300005530 | Bacteria | 1006 |
| 170 | Ga0070684_100144773 | 3300005535 | Unclassified | 2151 |
| 171 | Ga0070684_100171248 | 3300005535 | Bacteria | 1972 |
| 172 | Ga0070684_100491365 | 3300005535 | Bacteria | 1136 |
| 173 | Ga0070684_100662824 | 3300005535 | Bacteria | 972 |
| 174 | Ga0070697_100145930 | 3300005536 | Bacteria | 1991 |
| 175 | Ga0070697_100581325 | 3300005536 | Unclassified | 984 |
| 176 | Ga0068853_100309959 | 3300005539 | Unclassified | 1461 |
| 177 | Ga0068853_100765025 | 3300005539 | Unclassified | 923 |
| 178 | Ga0070672_100189191 | 3300005543 | Bacteria | 1718 |
| 179 | Ga0070672_100942103 | 3300005543 | Unclassified | 764 |
| 180 | Ga0070686_100152295 | 3300005544 | Bacteria | 1620 |
| 181 | Ga0070686_100220348 | 3300005544 | Bacteria | 1371 |
| 182 | Ga0070686_101303680 | 3300005544 | Bacteria | 606 |
| 183 | Ga0070686_101895520 | 3300005544 | Unclassified | 509 |
| 184 | Ga0070695_100039111 | 3300005545 | Bacteria | 2996 |
| 185 | Ga0070695_100646054 | 3300005545 | Bacteria | 835 |
| 186 | Ga0070695_100935580 | 3300005545 | Unclassified | 702 |
| 187 | Ga0070696_100806920 | 3300005546 | Unclassified | 773 |
| 188 | Ga0070693_100064576 | 3300005547 | Bacteria | 2137 |
| 189 | Ga0070665_100617069 | 3300005548 | Bacteria | 1097 |
| 190 | Ga0070704_100185939 | 3300005549 | Unclassified | 1666 |
| 191 | Ga0070704_100319998 | 3300005549 | Bacteria | 1299 |
| 192 | Ga0068855_100159747 | 3300005563 | Bacteria | 2559 |
| 193 | Ga0068855_100238584 | 3300005563 | Unclassified | 2032 |
| 194 | Ga0068855_100337773 | 3300005563 | Bacteria | 1662 |
| 195 | Ga0068855_100513584 | 3300005563 | Bacteria | 1301 |
| 196 | Ga0070664_100256553 | 3300005564 | Bacteria | 1573 |
| 197 | Ga0070664_100784083 | 3300005564 | Unclassified | 891 |
| 198 | Ga0070664_101719178 | 3300005564 | Unclassified | 595 |
| 199 | Ga0070664_102323147 | 3300005564 | Unclassified | 509 |
| 200 | Ga0068857_100097533 | 3300005577 | Bacteria | 2635 |
| 201 | Ga0068857_100220132 | 3300005577 | Bacteria | 1734 |
| 202 | Ga0068857_100572047 | 3300005577 | Bacteria | 1066 |
| 203 | Ga0068857_100899813 | 3300005577 | Bacteria | 849 |
| 204 | Ga0068857_100990227 | 3300005577 | Bacteria | 809 |
| 205 | Ga0068857_102330192 | 3300005577 | Unclassified | 526 |
| 206 | Ga0068857_102383982 | 3300005577 | Bacteria | 520 |
| 207 | Ga0068854_101440926 | 3300005578 | Unclassified | 624 |
| 208 | Ga0068856_100405581 | 3300005614 | Unclassified | 1383 |
| 209 | Ga0068856_100511306 | 3300005614 | Bacteria | 1222 |
| 210 | Ga0068856_102250685 | 3300005614 | Bacteria | 554 |
| 211 | Ga0068856_102662691 | 3300005614 | Unclassified | 506 |
| 212 | Ga0070702_100085064 | 3300005615 | Bacteria | 1903 |
| 213 | Ga0070702_100701026 | 3300005615 | Unclassified | 772 |
| 214 | Ga0068852_100275734 | 3300005616 | Bacteria | 1620 |
| 215 | Ga0068852_100356558 | 3300005616 | Unclassified | 1430 |
| 216 | Ga0068859_100190969 | 3300005617 | Bacteria | 2132 |
| 217 | Ga0068859_100198721 | 3300005617 | Unclassified | 2089 |
| 218 | Ga0068859_100228934 | 3300005617 | Bacteria | 1947 |
| 219 | Ga0068859_100408476 | 3300005617 | Unclassified | 1454 |
| 220 | Ga0068864_100088054 | 3300005618 | Bacteria | 2734 |
| 221 | Ga0068864_100179187 | 3300005618 | Unclassified | 1936 |
| 222 | Ga0068864_100188922 | 3300005618 | Bacteria | 1887 |
| 223 | Ga0068864_100431268 | 3300005618 | Unclassified | 1257 |
| 224 | Ga0068864_100966013 | 3300005618 | Bacteria | 844 |
| 225 | Ga0068864_101218103 | 3300005618 | Unclassified | 752 |
| 226 | Ga0068866_10092144 | 3300005718 | Bacteria | 1653 |
| 227 | Ga0068866_11453308 | 3300005718 | Unclassified | 503 |
| 228 | Ga0068861_100135034 | 3300005719 | Bacteria | 2006 |
| 229 | Ga0068861_100907894 | 3300005719 | Unclassified | 835 |
| 230 | Ga0068861_100915392 | 3300005719 | Unclassified | 831 |
| 231 | Ga0068861_101106539 | 3300005719 | Bacteria | 762 |
| 232 | Ga0068851_10436765 | 3300005834 | Bacteria | 776 |
| 233 | Ga0068870_10228309 | 3300005840 | Bacteria | 1143 |
| 234 | Ga0068870_10273020 | 3300005840 | Bacteria | 1057 |
| 235 | Ga0068870_10428028 | 3300005840 | Bacteria | 867 |
| 236 | Ga0068870_10533154 | 3300005840 | Unclassified | 788 |
| 237 | Ga0068870_11165600 | 3300005840 | Bacteria | 557 |
| 238 | Ga0068863_100148148 | 3300005841 | Unclassified | 2245 |
| 239 | Ga0068863_100219248 | 3300005841 | Bacteria | 1833 |
| 240 | Ga0068863_100322984 | 3300005841 | Bacteria | 1499 |
| 241 | Ga0068863_100473808 | 3300005841 | Unclassified | 1230 |
| 242 | Ga0068863_100672724 | 3300005841 | Unclassified | 1028 |
| 243 | Ga0068863_101059614 | 3300005841 | Bacteria | 815 |
| 244 | Ga0068858_100257695 | 3300005842 | Bacteria | 1658 |
| 245 | Ga0068858_100287445 | 3300005842 | Unclassified | 1567 |
| 246 | Ga0068858_100420804 | 3300005842 | Unclassified | 1285 |
| 247 | Ga0068858_100866120 | 3300005842 | Bacteria | 883 |
| 248 | Ga0068858_101098186 | 3300005842 | Bacteria | 781 |
| 249 | Ga0068858_101226131 | 3300005842 | Unclassified | 738 |
| 250 | Ga0068858_101314760 | 3300005842 | Unclassified | 712 |
| 251 | Ga0068858_101362461 | 3300005842 | Bacteria | 699 |
| 252 | Ga0068858_101389252 | 3300005842 | Bacteria | 692 |
| 253 | Ga0068860_100035145 | 3300005843 | Plasmid | 4809 |
| 254 | Ga0068860_100199240 | 3300005843 | Unclassified | 1940 |
| 255 | Ga0068860_100310269 | 3300005843 | Bacteria | 1547 |
| 256 | Ga0068860_100682132 | 3300005843 | Bacteria | 1037 |
| 257 | Ga0068860_100932439 | 3300005843 | Bacteria | 885 |
| 258 | Ga0068860_101039340 | 3300005843 | Bacteria | 838 |
| 259 | Ga0068860_101216290 | 3300005843 | Bacteria | 774 |
| 260 | Ga0068860_102076000 | 3300005843 | Unclassified | 590 |
| 261 | Ga0068860_102568716 | 3300005843 | Unclassified | 529 |
| 262 | Ga0068860_102685979 | 3300005843 | Unclassified | 517 |
| 263 | Ga0068862_100203615 | 3300005844 | Bacteria | 1786 |
| 264 | Ga0068862_100432704 | 3300005844 | Unclassified | 1237 |
| 265 | Ga0068862_100645227 | 3300005844 | Bacteria | 1021 |
| 266 | Ga0081455_10101229 | 3300005937 | Bacteria | 2313 |
| 267 | Ga0081540_1033379 | 3300005983 | Bacteria | 2796 |
| 268 | Ga0081540_1066203 | 3300005983 | Bacteria | 1694 |
| 269 | Ga0081539_10073386 | 3300005985 | Unclassified | 1825 |
| 270 | Ga0070717_10027450 | 3300006028 | Unclassified | 4550 |
| 271 | Ga0070717_10099738 | 3300006028 | Unclassified | 2464 |
| 272 | Ga0070717_10193838 | 3300006028 | Bacteria | 1776 |
| 273 | Ga0070717_10377582 | 3300006028 | Unclassified | 1270 |
| 274 | Ga0070717_11038357 | 3300006028 | Bacteria | 746 |
| 275 | Ga0070717_11177496 | 3300006028 | Unclassified | 698 |
| 276 | Ga0070717_11183531 | 3300006028 | Bacteria | 696 |
| 277 | Ga0070717_12004391 | 3300006028 | Unclassified | 522 |
| 278 | Ga0070715_10063053 | 3300006163 | Bacteria | 1633 |
| 279 | Ga0070715_10138153 | 3300006163 | Unclassified | 1180 |
| 280 | Ga0070715_10911953 | 3300006163 | Unclassified | 542 |
| 281 | Ga0070716_100129967 | 3300006173 | Unclassified | 1591 |
| 282 | Ga0070712_100150702 | 3300006175 | Unclassified | 1785 |
| 283 | Ga0070712_100187594 | 3300006175 | Bacteria | 1616 |
| 284 | Ga0070712_100579727 | 3300006175 | Unclassified | 948 |
| 285 | Ga0070712_100873180 | 3300006175 | Unclassified | 775 |
| 286 | Ga0097621_100111535 | 3300006237 | Bacteria | 2311 |
| 287 | Ga0097621_100230851 | 3300006237 | Unclassified | 1615 |
| 288 | Ga0097621_100858478 | 3300006237 | Bacteria | 844 |
| 289 | Ga0097621_101472383 | 3300006237 | Unclassified | 646 |
| 290 | Ga0068871_100186788 | 3300006358 | Bacteria | 1784 |
| 291 | Ga0068871_100202089 | 3300006358 | Unclassified | 1716 |
| 292 | Ga0068871_100221910 | 3300006358 | Bacteria | 1638 |
| 293 | Ga0068871_100237380 | 3300006358 | Unclassified | 1584 |
| 294 | Ga0075430_100006302 | 3300006846 | Bacteria | 10007 |
| 295 | Ga0075430_100174426 | 3300006846 | Bacteria | 1789 |
| 296 | Ga0075431_100260280 | 3300006847 | Bacteria | 1761 |
| 297 | Ga0075433_11466287 | 3300006852 | Bacteria | 590 |
| 298 | Ga0075433_11605961 | 3300006852 | Unclassified | 561 |
| 299 | Ga0075433_11720452 | 3300006852 | Bacteria | 540 |
| 300 | Ga0075434_100186478 | 3300006871 | Bacteria | 2095 |
| 301 | Ga0075434_100360950 | 3300006871 | Unclassified | 1474 |
| 302 | Ga0075434_101075942 | 3300006871 | Unclassified | 818 |
| 303 | Ga0068865_100070380 | 3300006881 | Bacteria | 2479 |
| 304 | Ga0068865_100154340 | 3300006881 | Bacteria | 1745 |
| 305 | Ga0068865_100191178 | 3300006881 | Bacteria | 1583 |
| 306 | Ga0068865_100203506 | 3300006881 | Bacteria | 1538 |
| 307 | Ga0075436_100056353 | 3300006914 | Unclassified | 2714 |
| 308 | Ga0075436_100088804 | 3300006914 | Unclassified | 2147 |
| 309 | Ga0075436_100107357 | 3300006914 | Bacteria | 1947 |
| 310 | Ga0075436_100165844 | 3300006914 | Bacteria | 1558 |
| 311 | Ga0075436_100740198 | 3300006914 | Bacteria | 730 |
| 312 | Ga0075436_100814563 | 3300006914 | Unclassified | 696 |
| 313 | Ga0097620_100190974 | 3300006931 | Bacteria | 2132 |
| 314 | Ga0097620_100198717 | 3300006931 | Unclassified | 2089 |
| 315 | Ga0097620_100228940 | 3300006931 | Bacteria | 1947 |
| 316 | Ga0097620_100408513 | 3300006931 | Unclassified | 1454 |
| 317 | Ga0075435_100199776 | 3300007076 | Bacteria | 1694 |
| 318 | Ga0075435_100249277 | 3300007076 | Unclassified | 1511 |
| 319 | Ga0075435_100460648 | 3300007076 | Bacteria | 1097 |
| 320 | Ga0075435_100766392 | 3300007076 | Bacteria | 840 |
| 321 | Ga0075435_100770013 | 3300007076 | Unclassified | 837 |
| 322 | Ga0075435_100902380 | 3300007076 | Bacteria | 771 |
| 323 | Ga0075435_101825140 | 3300007076 | Unclassified | 534 |
| 324 | Ga0099794_10280510 | 3300007265 | Bacteria | 861 |
| 325 | Ga0099794_10381298 | 3300007265 | Unclassified | 735 |
| 326 | Ga0099794_10630882 | 3300007265 | Unclassified | 568 |
| 327 | Ga0099795_10112849 | 3300007788 | Bacteria | 1079 |
| 328 | Ga0099795_10382726 | 3300007788 | Bacteria | 635 |
| 329 | Ga0099795_10652013 | 3300007788 | Unclassified | 504 |
| 330 | Ga0105240_10165955 | 3300009093 | Bacteria | 2619 |
| 331 | Ga0105240_10239435 | 3300009093 | Unclassified | 2104 |
| 332 | Ga0105240_10418502 | 3300009093 | Unclassified | 1506 |
| 333 | Ga0105240_11347290 | 3300009093 | Bacteria | 751 |
| 334 | Ga0105240_11726396 | 3300009093 | Bacteria | 653 |
| 335 | Ga0111539_10318583 | 3300009094 | Bacteria | 1810 |
| 336 | Ga0111539_10483571 | 3300009094 | Bacteria | 1442 |
| 337 | Ga0105245_10114395 | 3300009098 | Unclassified | 2513 |
| 338 | Ga0105245_10293307 | 3300009098 | Unclassified | 1594 |
| 339 | Ga0105245_10803926 | 3300009098 | Bacteria | 978 |
| 340 | Ga0105247_10085547 | 3300009101 | Bacteria | 1994 |
| 341 | Ga0105247_10366933 | 3300009101 | Unclassified | 1017 |
| 342 | Ga0105247_11292613 | 3300009101 | Bacteria | 585 |
| 343 | Ga0105247_11487625 | 3300009101 | Unclassified | 552 |
| 344 | Ga0114129_10866601 | 3300009147 | Bacteria | 1147 |
| 345 | Ga0114129_11606148 | 3300009147 | Bacteria | 796 |
| 346 | Ga0105243_10800815 | 3300009148 | Unclassified | 929 |
| 347 | Ga0105243_11760321 | 3300009148 | Unclassified | 650 |
| 348 | Ga0105243_12179909 | 3300009148 | Unclassified | 591 |
| 349 | Ga0105243_12589498 | 3300009148 | Unclassified | 547 |
| 350 | Ga0105241_10024438 | 3300009174 | Bacteria | 4486 |
| 351 | Ga0105241_10496156 | 3300009174 | Bacteria | 1088 |
| 352 | Ga0105241_11072036 | 3300009174 | Bacteria | 757 |
| 353 | Ga0105241_11340128 | 3300009174 | Bacteria | 683 |
| 354 | Ga0105242_10046378 | 3300009176 | Unclassified | 3526 |
| 355 | Ga0105242_10368939 | 3300009176 | Bacteria | 1331 |
| 356 | Ga0105242_10377419 | 3300009176 | Bacteria | 1317 |
| 357 | Ga0105242_12496489 | 3300009176 | Bacteria | 565 |
| 358 | Ga0105248_10220362 | 3300009177 | Unclassified | 2136 |
| 359 | Ga0105248_10265752 | 3300009177 | Unclassified | 1931 |
| 360 | Ga0105248_10290224 | 3300009177 | Bacteria | 1842 |
| 361 | Ga0105248_10385839 | 3300009177 | Unclassified | 1577 |
| 362 | Ga0105248_10397141 | 3300009177 | Bacteria | 1553 |
| 363 | Ga0105248_10407594 | 3300009177 | Bacteria | 1531 |
| 364 | Ga0105248_10415288 | 3300009177 | Bacteria | 1515 |
| 365 | Ga0105248_10455856 | 3300009177 | Bacteria | 1441 |
| 366 | Ga0105248_11486618 | 3300009177 | Bacteria | 767 |
| 367 | Ga0105248_12238571 | 3300009177 | Unclassified | 622 |
| 368 | Ga0105248_12544323 | 3300009177 | Unclassified | 583 |
| 369 | Ga0105237_10096816 | 3300009545 | Plasmid | 2942 |
| 370 | Ga0105237_10200297 | 3300009545 | Unclassified | 1996 |
| 371 | Ga0105237_10600093 | 3300009545 | Bacteria | 1108 |
| 372 | Ga0105237_11127203 | 3300009545 | Bacteria | 791 |
| 373 | Ga0105237_11149230 | 3300009545 | Bacteria | 783 |
| 374 | Ga0105237_12109784 | 3300009545 | Bacteria | 573 |
| 375 | Ga0105237_12190071 | 3300009545 | Unclassified | 562 |
| 376 | Ga0105237_12208514 | 3300009545 | Bacteria | 560 |
| 377 | Ga0105237_12345561 | 3300009545 | Bacteria | 544 |
| 378 | Ga0105238_10677696 | 3300009551 | Bacteria | 1042 |
| 379 | Ga0105238_10882561 | 3300009551 | Bacteria | 912 |
| 380 | Ga0105238_12457063 | 3300009551 | Unclassified | 557 |
| 381 | Ga0105238_12911438 | 3300009551 | Bacteria | 515 |
| 382 | Ga0105249_10282430 | 3300009553 | Unclassified | 1658 |
| 383 | Ga0105249_10295868 | 3300009553 | Unclassified | 1622 |
| 384 | Ga0105249_10346852 | 3300009553 | Bacteria | 1503 |
| 385 | Ga0099796_10019664 | 3300010159 | Bacteria | 2051 |
| 386 | Ga0099796_10078309 | 3300010159 | Bacteria | 1207 |
| 387 | Ga0105239_10173381 | 3300010375 | Bacteria | 2412 |
| 388 | Ga0105239_10174984 | 3300010375 | Bacteria | 2400 |
| 389 | Ga0105239_10209269 | 3300010375 | Unclassified | 2186 |
| 390 | Ga0105239_10250192 | 3300010375 | Unclassified | 1990 |
| 391 | Ga0105239_11447132 | 3300010375 | Unclassified | 794 |
| 392 | Ga0105239_12977737 | 3300010375 | Bacteria | 552 |
| 393 | Ga0105246_10137623 | 3300011119 | Bacteria | 1832 |
| 394 | Ga0157313_1047248 | 3300012503 | Bacteria | 549 |
| 395 | Ga0157338_1055320 | 3300012515 | Bacteria | 581 |
| 396 | Ga0157373_10141151 | 3300013100 | Bacteria | 1694 |
| 397 | Ga0157373_11001582 | 3300013100 | Bacteria | 624 |
| 398 | Ga0157371_10119239 | 3300013102 | Bacteria | 1876 |
| 399 | Ga0157370_10163687 | 3300013104 | Unclassified | 2069 |
| 400 | Ga0157370_10185813 | 3300013104 | Bacteria | 1930 |
| 401 | Ga0157370_10260844 | 3300013104 | Unclassified | 1602 |
| 402 | Ga0157370_10457258 | 3300013104 | Bacteria | 1173 |
| 403 | Ga0157370_11079448 | 3300013104 | Unclassified | 726 |
| 404 | Ga0157369_10076223 | 3300013105 | Unclassified | 3594 |
| 405 | Ga0157369_10311897 | 3300013105 | Bacteria | 1636 |
| 406 | Ga0157369_10638902 | 3300013105 | Unclassified | 1098 |
| 407 | Ga0157374_10057534 | 3300013296 | Bacteria | 3631 |
| 408 | Ga0157374_10179247 | 3300013296 | Bacteria | 2069 |
| 409 | Ga0157374_10286021 | 3300013296 | Unclassified | 1628 |
| 410 | Ga0157374_10939654 | 3300013296 | Bacteria | 883 |
| 411 | Ga0157378_10035380 | 3300013297 | Unclassified | 4417 |
| 412 | Ga0157378_10041054 | 3300013297 | Bacteria | 4104 |
| 413 | Ga0157378_10174516 | 3300013297 | Bacteria | 2018 |
| 414 | Ga0157378_10200209 | 3300013297 | Bacteria | 1888 |
| 415 | Ga0157378_10221472 | 3300013297 | Bacteria | 1799 |
| 416 | Ga0157378_10240162 | 3300013297 | Bacteria | 1730 |
| 417 | Ga0163162_10135549 | 3300013306 | Bacteria | 2573 |
| 418 | Ga0163162_10298588 | 3300013306 | Bacteria | 1743 |
| 419 | Ga0163162_10306630 | 3300013306 | Bacteria | 1720 |
| 420 | Ga0163162_10358259 | 3300013306 | Bacteria | 1592 |
| 421 | Ga0163162_10361154 | 3300013306 | Bacteria | 1585 |
| 422 | Ga0163162_10738173 | 3300013306 | Bacteria | 1104 |
| 423 | Ga0163162_12634380 | 3300013306 | Bacteria | 579 |
| 424 | Ga0163162_12847473 | 3300013306 | Bacteria | 557 |
| 425 | Ga0157372_10045113 | 3300013307 | Unclassified | 4888 |
| 426 | Ga0157372_10172680 | 3300013307 | Bacteria | 2501 |
| 427 | Ga0157372_10347077 | 3300013307 | Unclassified | 1729 |
| 428 | Ga0157372_10521588 | 3300013307 | Bacteria | 1385 |
| 429 | Ga0157372_12570623 | 3300013307 | Unclassified | 584 |
| 430 | Ga0157375_10217987 | 3300013308 | Bacteria | 2066 |
| 431 | Ga0157375_10240094 | 3300013308 | Unclassified | 1972 |
| 432 | Ga0157375_10344366 | 3300013308 | Bacteria | 1656 |
| 433 | Ga0157375_10951138 | 3300013308 | Bacteria | 1001 |
| 434 | Ga0157375_11066969 | 3300013308 | Bacteria | 945 |
| 435 | Ga0157375_11803869 | 3300013308 | Bacteria | 725 |
| 436 | Ga0163163_10043172 | 3300014325 | Bacteria | 4419 |
| 437 | Ga0163163_10154625 | 3300014325 | Unclassified | 2338 |
| 438 | Ga0163163_10162439 | 3300014325 | Unclassified | 2279 |
| 439 | Ga0163163_10313352 | 3300014325 | Bacteria | 1622 |
| 440 | Ga0163163_10383068 | 3300014325 | Unclassified | 1464 |
| 441 | Ga0163163_10396584 | 3300014325 | Bacteria | 1438 |
| 442 | Ga0163163_10553316 | 3300014325 | Bacteria | 1213 |
| 443 | Ga0157380_10467510 | 3300014326 | Unclassified | 1216 |
| 444 | Ga0157380_10557236 | 3300014326 | Unclassified | 1125 |
| 445 | Ga0182008_10199114 | 3300014497 | Unclassified | 1019 |
| 446 | Ga0182008_10395257 | 3300014497 | Unclassified | 741 |
| 447 | Ga0182008_10407232 | 3300014497 | Bacteria | 732 |
| 448 | Ga0157377_10075977 | 3300014745 | Bacteria | 1952 |
| 449 | Ga0157377_10534213 | 3300014745 | Bacteria | 826 |
| 450 | Ga0157379_10140220 | 3300014968 | Bacteria | 2179 |
| 451 | Ga0157379_10261945 | 3300014968 | Bacteria | 1571 |
| 452 | Ga0157379_10386776 | 3300014968 | Bacteria | 1284 |
| 453 | Ga0157379_10585084 | 3300014968 | Unclassified | 1041 |
| 454 | Ga0157379_11159565 | 3300014968 | Unclassified | 742 |
| 455 | Ga0157376_10110389 | 3300014969 | Bacteria | 2419 |
| 456 | Ga0157376_10111642 | 3300014969 | Bacteria | 2407 |
| 457 | Ga0157376_10200717 | 3300014969 | Unclassified | 1835 |
| 458 | Ga0157376_10276427 | 3300014969 | Unclassified | 1580 |
| 459 | Ga0157376_10495366 | 3300014969 | Unclassified | 1200 |
| 460 | Ga0157376_11111578 | 3300014969 | Bacteria | 816 |
| 461 | Ga0157376_11760645 | 3300014969 | Bacteria | 655 |
| 462 | Ga0157376_11822436 | 3300014969 | Bacteria | 645 |
| 463 | Ga0157376_12100470 | 3300014969 | Bacteria | 603 |
| 464 | Ga0182007_10036515 | 3300015262 | Bacteria | 1653 |
| 465 | Ga0182007_10094327 | 3300015262 | Unclassified | 987 |
| 466 | Ga0182007_10095888 | 3300015262 | Unclassified | 979 |
| 467 | Ga0182007_10366714 | 3300015262 | Unclassified | 544 |
| 468 | Ga0182005_1200171 | 3300015265 | Unclassified | 600 |
| 469 | Ga0182005_1225957 | 3300015265 | Bacteria | 571 |
| 470 | Ga0163161_10137538 | 3300017792 | Bacteria | 1847 |
| 471 | Ga0163161_10540054 | 3300017792 | Unclassified | 954 |
| 472 | Ga0184603_125222 | 3300019192 | Unclassified | 537 |
| 473 | Ga0206354_10761836 | 3300020081 | Bacteria | 609 |
| 474 | Ga0206353_10354678 | 3300020082 | Bacteria | 1222 |
| 475 | Ga0213873_10017049 | 3300021358 | Bacteria | 1651 |
| 476 | Ga0213873_10093100 | 3300021358 | Unclassified | 858 |
| 477 | Ga0213874_10067698 | 3300021377 | Bacteria | 1132 |
| 478 | Ga0213874_10298762 | 3300021377 | Unclassified | 605 |
| 479 | Ga0213874_10358174 | 3300021377 | Unclassified | 560 |
| 480 | Ga0213876_10066954 | 3300021384 | Bacteria | 1896 |
| 481 | Ga0213876_10077757 | 3300021384 | Unclassified | 1753 |
| 482 | Ga0213876_10221270 | 3300021384 | Unclassified | 1006 |
| 483 | Ga0213876_10271027 | 3300021384 | Unclassified | 902 |
| 484 | Ga0213875_10012748 | 3300021388 | Unclassified | 4140 |
| 485 | Ga0213875_10042763 | 3300021388 | Bacteria | 2128 |
| 486 | Ga0213875_10173169 | 3300021388 | Bacteria | 1014 |
| 487 | Ga0213871_10271881 | 3300021441 | Unclassified | 542 |
| 488 | Ga0224570_104894 | 3300022730 | Bacteria | 818 |
| 489 | Ga0224570_113752 | 3300022730 | Bacteria | 525 |
| 490 | Ga0224569_108471 | 3300022732 | Bacteria | 735 |
| 491 | Ga0224571_107668 | 3300022734 | Unclassified | 730 |
| 492 | Ga0224571_108736 | 3300022734 | Bacteria | 690 |
| 493 | Ga0224572_1007890 | 3300024225 | Bacteria | 1959 |
| 494 | Ga0228598_1004219 | 3300024227 | Unclassified | 3048 |
| 495 | Ga0228598_1029259 | 3300024227 | Unclassified | 1083 |
| 496 | Ga0228598_1034620 | 3300024227 | Unclassified | 996 |
| 497 | Ga0228598_1136222 | 3300024227 | Unclassified | 500 |
| 498 | Ga0207697_10090668 | 3300025315 | Unclassified | 1295 |
| 499 | Ga0207697_10322497 | 3300025315 | Unclassified | 686 |
| 500 | Ga0207653_10032260 | 3300025885 | Bacteria | 1694 |
| 501 | Ga0207682_10159911 | 3300025893 | Unclassified | 1020 |
| 502 | Ga0207692_10072863 | 3300025898 | Bacteria | 1815 |
| 503 | Ga0207692_10089729 | 3300025898 | Unclassified | 1664 |
| 504 | Ga0207692_10103590 | 3300025898 | Bacteria | 1567 |
| 505 | Ga0207692_10105018 | 3300025898 | Unclassified | 1558 |
| 506 | Ga0207692_10106130 | 3300025898 | Viruses | 1551 |
| 507 | Ga0207692_10397185 | 3300025898 | Unclassified | 859 |
| 508 | Ga0207710_10150651 | 3300025900 | Bacteria | 1128 |
| 509 | Ga0207688_10094492 | 3300025901 | Bacteria | 1720 |
| 510 | Ga0207688_10514730 | 3300025901 | Unclassified | 750 |
| 511 | Ga0207680_10129543 | 3300025903 | Bacteria | 1661 |
| 512 | Ga0207680_10151714 | 3300025903 | Bacteria | 1545 |
| 513 | Ga0207647_10054704 | 3300025904 | Bacteria | 2455 |
| 514 | Ga0207685_10061599 | 3300025905 | Bacteria | 1488 |
| 515 | Ga0207685_10109511 | 3300025905 | Unclassified | 1195 |
| 516 | Ga0207685_10693394 | 3300025905 | Unclassified | 554 |
| 517 | Ga0207699_10382123 | 3300025906 | Unclassified | 1000 |
| 518 | Ga0207699_10431022 | 3300025906 | Unclassified | 943 |
| 519 | Ga0207699_10489725 | 3300025906 | Unclassified | 886 |
| 520 | Ga0207699_10495627 | 3300025906 | Bacteria | 881 |
| 521 | Ga0207699_10501495 | 3300025906 | Unclassified | 876 |
| 522 | Ga0207699_10581462 | 3300025906 | Bacteria | 814 |
| 523 | Ga0207645_10103583 | 3300025907 | Bacteria | 1838 |
| 524 | Ga0207645_10470070 | 3300025907 | Unclassified | 850 |
| 525 | Ga0207645_10994169 | 3300025907 | Unclassified | 568 |
| 526 | Ga0207643_10911574 | 3300025908 | Unclassified | 569 |
| 527 | Ga0207705_10095106 | 3300025909 | Bacteria | 2186 |
| 528 | Ga0207684_10221037 | 3300025910 | Bacteria | 1634 |
| 529 | Ga0207684_10740372 | 3300025910 | Unclassified | 834 |
| 530 | Ga0207684_10905622 | 3300025910 | Bacteria | 741 |
| 531 | Ga0207654_10132791 | 3300025911 | Bacteria | 1578 |
| 532 | Ga0207707_10182385 | 3300025912 | Bacteria | 1832 |
| 533 | Ga0207707_10363851 | 3300025912 | Bacteria | 1245 |
| 534 | Ga0207707_10967658 | 3300025912 | Bacteria | 700 |
| 535 | Ga0207695_10012851 | 3300025913 | Bacteria | 10023 |
| 536 | Ga0207695_10218747 | 3300025913 | Unclassified | 1813 |
| 537 | Ga0207671_10205132 | 3300025914 | Bacteria | 1540 |
| 538 | Ga0207671_11112975 | 3300025914 | Bacteria | 620 |
| 539 | Ga0207671_11163758 | 3300025914 | Bacteria | 604 |
| 540 | Ga0207693_10172230 | 3300025915 | Unclassified | 1704 |
| 541 | Ga0207693_10192218 | 3300025915 | Bacteria | 1606 |
| 542 | Ga0207693_10256043 | 3300025915 | Unclassified | 1373 |
| 543 | Ga0207693_10901237 | 3300025915 | Bacteria | 678 |
| 544 | Ga0207663_10056288 | 3300025916 | Unclassified | 2472 |
| 545 | Ga0207663_10131272 | 3300025916 | Unclassified | 1731 |
| 546 | Ga0207663_10145699 | 3300025916 | Unclassified | 1655 |
| 547 | Ga0207663_10161843 | 3300025916 | Bacteria | 1581 |
| 548 | Ga0207663_10161878 | 3300025916 | Bacteria | 1581 |
| 549 | Ga0207663_10174818 | 3300025916 | Bacteria | 1529 |
| 550 | Ga0207663_10187897 | 3300025916 | Bacteria | 1481 |
| 551 | Ga0207663_10331073 | 3300025916 | Bacteria | 1147 |
| 552 | Ga0207663_10930763 | 3300025916 | Unclassified | 696 |
| 553 | Ga0207660_10194751 | 3300025917 | Bacteria | 1580 |
| 554 | Ga0207660_10805380 | 3300025917 | Bacteria | 767 |
| 555 | Ga0207660_10850562 | 3300025917 | Bacteria | 744 |
| 556 | Ga0207662_10115135 | 3300025918 | Unclassified | 1680 |
| 557 | Ga0207662_10636562 | 3300025918 | Bacteria | 744 |
| 558 | Ga0207662_10800955 | 3300025918 | Unclassified | 664 |
| 559 | Ga0207657_10511267 | 3300025919 | Bacteria | 940 |
| 560 | Ga0207652_10258082 | 3300025921 | Bacteria | 1572 |
| 561 | Ga0207652_10388672 | 3300025921 | Unclassified | 1259 |
| 562 | Ga0207652_10646151 | 3300025921 | Unclassified | 946 |
| 563 | Ga0207652_10717008 | 3300025921 | Bacteria | 892 |
| 564 | Ga0207646_10086816 | 3300025922 | Bacteria | 2800 |
| 565 | Ga0207646_10142852 | 3300025922 | Bacteria | 2156 |
| 566 | Ga0207646_11568551 | 3300025922 | Unclassified | 569 |
| 567 | Ga0207681_10134340 | 3300025923 | Bacteria | 1833 |
| 568 | Ga0207650_10220786 | 3300025925 | Bacteria | 1525 |
| 569 | Ga0207650_10282534 | 3300025925 | Unclassified | 1352 |
| 570 | Ga0207650_10965102 | 3300025925 | Bacteria | 725 |
| 571 | Ga0207659_10167651 | 3300025926 | Bacteria | 1730 |
| 572 | Ga0207659_10774877 | 3300025926 | Bacteria | 823 |
| 573 | Ga0207687_10179725 | 3300025927 | Unclassified | 1638 |
| 574 | Ga0207700_10173950 | 3300025928 | Unclassified | 1798 |
| 575 | Ga0207700_10189154 | 3300025928 | Bacteria | 1729 |
| 576 | Ga0207700_10216343 | 3300025928 | Unclassified | 1622 |
| 577 | Ga0207700_10237311 | 3300025928 | Bacteria | 1553 |
| 578 | Ga0207700_10255638 | 3300025928 | Unclassified | 1498 |
| 579 | Ga0207700_10309765 | 3300025928 | Unclassified | 1365 |
| 580 | Ga0207700_10355011 | 3300025928 | Bacteria | 1277 |
| 581 | Ga0207700_10700203 | 3300025928 | Bacteria | 904 |
| 582 | Ga0207700_10711809 | 3300025928 | Unclassified | 897 |
| 583 | Ga0207700_11570425 | 3300025928 | Bacteria | 583 |
| 584 | Ga0207664_10098366 | 3300025929 | Bacteria | 2412 |
| 585 | Ga0207664_10697174 | 3300025929 | Bacteria | 913 |
| 586 | Ga0207664_10880503 | 3300025929 | Unclassified | 804 |
| 587 | Ga0207664_11981211 | 3300025929 | Unclassified | 505 |
| 588 | Ga0207644_10150883 | 3300025931 | Bacteria | 1798 |
| 589 | Ga0207644_10721418 | 3300025931 | Unclassified | 832 |
| 590 | Ga0207644_11430460 | 3300025931 | Unclassified | 581 |
| 591 | Ga0207644_11729115 | 3300025931 | Unclassified | 524 |
| 592 | Ga0207690_10125894 | 3300025932 | Bacteria | 1868 |
| 593 | Ga0207706_10204782 | 3300025933 | Bacteria | 1730 |
| 594 | Ga0207686_10161402 | 3300025934 | Bacteria | 1571 |
| 595 | Ga0207709_10120476 | 3300025935 | Bacteria | 1771 |
| 596 | Ga0207709_10382840 | 3300025935 | Bacteria | 1071 |
| 597 | Ga0207709_11558753 | 3300025935 | Bacteria | 548 |
| 598 | Ga0207709_11749410 | 3300025935 | Unclassified | 517 |
| 599 | Ga0207670_10216299 | 3300025936 | Unclassified | 1464 |
| 600 | Ga0207670_10550316 | 3300025936 | Bacteria | 943 |
| 601 | Ga0207670_11727573 | 3300025936 | Unclassified | 532 |
| 602 | Ga0207669_11228613 | 3300025937 | Bacteria | 635 |
| 603 | Ga0207704_10167141 | 3300025938 | Bacteria | 1573 |
| 604 | Ga0207704_10266330 | 3300025938 | Bacteria | 1295 |
| 605 | Ga0207704_10627340 | 3300025938 | Bacteria | 883 |
| 606 | Ga0207665_10338198 | 3300025939 | Bacteria | 1133 |
| 607 | Ga0207691_10217312 | 3300025940 | Bacteria | 1658 |
| 608 | Ga0207691_11738066 | 3300025940 | Unclassified | 504 |
| 609 | Ga0207711_10229053 | 3300025941 | Bacteria | 1702 |
| 610 | Ga0207711_10672889 | 3300025941 | Unclassified | 965 |
| 611 | Ga0207711_11187286 | 3300025941 | Bacteria | 705 |
| 612 | Ga0207711_11437720 | 3300025941 | Unclassified | 632 |
| 613 | Ga0207689_10206997 | 3300025942 | Bacteria | 1620 |
| 614 | Ga0207689_10334417 | 3300025942 | Bacteria | 1258 |
| 615 | Ga0207689_10369728 | 3300025942 | Bacteria | 1193 |
| 616 | Ga0207689_10403125 | 3300025942 | Unclassified | 1140 |
| 617 | Ga0207689_11225325 | 3300025942 | Bacteria | 631 |
| 618 | Ga0207661_10200988 | 3300025944 | Bacteria | 1752 |
| 619 | Ga0207661_10210949 | 3300025944 | Bacteria | 1712 |
| 620 | Ga0207661_10258097 | 3300025944 | Bacteria | 1551 |
| 621 | Ga0207661_10498001 | 3300025944 | Bacteria | 1113 |
| 622 | Ga0207661_11450949 | 3300025944 | Unclassified | 629 |
| 623 | Ga0207661_11781291 | 3300025944 | Bacteria | 561 |
| 624 | Ga0207679_10469349 | 3300025945 | Bacteria | 1119 |
| 625 | Ga0207679_11680737 | 3300025945 | Bacteria | 581 |
| 626 | Ga0207667_10075615 | 3300025949 | Bacteria | 3496 |
| 627 | Ga0207667_10237660 | 3300025949 | Bacteria | 1865 |
| 628 | Ga0207667_10238674 | 3300025949 | Unclassified | 1861 |
| 629 | Ga0207651_10668389 | 3300025960 | Bacteria | 913 |
| 630 | Ga0207651_10727106 | 3300025960 | Bacteria | 876 |
| 631 | Ga0207651_11654854 | 3300025960 | Unclassified | 576 |
| 632 | Ga0207712_10318697 | 3300025961 | Bacteria | 1282 |
| 633 | Ga0207712_10588512 | 3300025961 | Bacteria | 961 |
| 634 | Ga0207712_11392017 | 3300025961 | Bacteria | 628 |
| 635 | Ga0207712_11883393 | 3300025961 | Unclassified | 536 |
| 636 | Ga0207668_10344512 | 3300025972 | Unclassified | 1244 |
| 637 | Ga0207668_10828868 | 3300025972 | Bacteria | 820 |
| 638 | Ga0207640_10548130 | 3300025981 | Bacteria | 971 |
| 639 | Ga0207640_10817922 | 3300025981 | Bacteria | 808 |
| 640 | Ga0207640_11681344 | 3300025981 | Unclassified | 573 |
| 641 | Ga0207658_10231958 | 3300025986 | Unclassified | 1559 |
| 642 | Ga0207658_10530336 | 3300025986 | Bacteria | 1052 |
| 643 | Ga0207658_10793658 | 3300025986 | Bacteria | 859 |
| 644 | Ga0207658_11673567 | 3300025986 | Bacteria | 581 |
| 645 | Ga0207677_10358786 | 3300026023 | Unclassified | 1224 |
| 646 | Ga0207677_10606846 | 3300026023 | Bacteria | 961 |
| 647 | Ga0207703_10102945 | 3300026035 | Unclassified | 2423 |
| 648 | Ga0207703_10184207 | 3300026035 | Unclassified | 1845 |
| 649 | Ga0207703_10523819 | 3300026035 | Bacteria | 1115 |
| 650 | Ga0207703_11538728 | 3300026035 | Unclassified | 640 |
| 651 | Ga0207703_12051252 | 3300026035 | Bacteria | 548 |
| 652 | Ga0207703_12086083 | 3300026035 | Unclassified | 543 |
| 653 | Ga0207639_10129270 | 3300026041 | Bacteria | 2089 |
| 654 | Ga0207639_10286271 | 3300026041 | Unclassified | 1451 |
| 655 | Ga0207678_10168121 | 3300026067 | Bacteria | 1872 |
| 656 | Ga0207708_10091441 | 3300026075 | Unclassified | 2347 |
| 657 | Ga0207708_10444485 | 3300026075 | Unclassified | 1079 |
| 658 | Ga0207702_10524462 | 3300026078 | Bacteria | 1157 |
| 659 | Ga0207702_11902280 | 3300026078 | Unclassified | 586 |
| 660 | Ga0207641_10105703 | 3300026088 | Bacteria | 2487 |
| 661 | Ga0207641_10159008 | 3300026088 | Bacteria | 2052 |
| 662 | Ga0207641_11089325 | 3300026088 | Unclassified | 797 |
| 663 | Ga0207641_11132234 | 3300026088 | Unclassified | 781 |
| 664 | Ga0207641_11504366 | 3300026088 | Bacteria | 675 |
| 665 | Ga0207641_11559372 | 3300026088 | Unclassified | 662 |
| 666 | Ga0207641_11762497 | 3300026088 | Unclassified | 621 |
| 667 | Ga0207648_10106944 | 3300026089 | Bacteria | 2455 |
| 668 | Ga0207648_10210151 | 3300026089 | Bacteria | 1727 |
| 669 | Ga0207648_10236828 | 3300026089 | Unclassified | 1625 |
| 670 | Ga0207648_10275173 | 3300026089 | Bacteria | 1505 |
| 671 | Ga0207648_10383847 | 3300026089 | Unclassified | 1270 |
| 672 | Ga0207676_10033728 | 3300026095 | Bacteria | 3870 |
| 673 | Ga0207676_10052499 | 3300026095 | Bacteria | 3187 |
| 674 | Ga0207676_10229537 | 3300026095 | Bacteria | 1658 |
| 675 | Ga0207676_10238311 | 3300026095 | Unclassified | 1630 |
| 676 | Ga0207676_10805840 | 3300026095 | Bacteria | 916 |
| 677 | Ga0207676_10956029 | 3300026095 | Unclassified | 842 |
| 678 | Ga0207676_11513022 | 3300026095 | Bacteria | 668 |
| 679 | Ga0207674_10038672 | 3300026116 | Bacteria | 4948 |
| 680 | Ga0207674_10094859 | 3300026116 | Bacteria | 2970 |
| 681 | Ga0207674_10254144 | 3300026116 | Bacteria | 1704 |
| 682 | Ga0207674_10528809 | 3300026116 | Bacteria | 1139 |
| 683 | Ga0207674_11324542 | 3300026116 | Unclassified | 690 |
| 684 | Ga0207675_100117114 | 3300026118 | Bacteria | 2518 |
| 685 | Ga0207675_100157607 | 3300026118 | Bacteria | 2164 |
| 686 | Ga0207675_100838518 | 3300026118 | Unclassified | 934 |
| 687 | Ga0207683_10216291 | 3300026121 | Bacteria | 1745 |
| 688 | Ga0207683_10250653 | 3300026121 | Unclassified | 1616 |
| 689 | Ga0207683_10478754 | 3300026121 | Bacteria | 1149 |
| 690 | Ga0209984_1069922 | 3300027424 | Unclassified | 524 |
| 691 | Ga0207428_10280518 | 3300027907 | Bacteria | 1237 |
| 692 | Ga0265358_102348 | 3300028010 | Unclassified | 635 |
| 693 | Ga0265357_1002150 | 3300028023 | Unclassified | 1573 |
| 694 | Ga0268266_10327005 | 3300028379 | Bacteria | 1436 |
| 695 | Ga0268266_10742230 | 3300028379 | Bacteria | 947 |
| 696 | Ga0268265_10202966 | 3300028380 | Bacteria | 1721 |
| 697 | Ga0268265_10976886 | 3300028380 | Archaea | 835 |
| 698 | Ga0268265_12181259 | 3300028380 | Unclassified | 561 |
| 699 | Ga0268264_10048894 | 3300028381 | Plasmid | 3518 |
| 700 | Ga0268264_10494169 | 3300028381 | Bacteria | 1192 |
| 701 | Ga0268264_10887513 | 3300028381 | Bacteria | 894 |
| 702 | Ga0265337_1127848 | 3300028556 | Bacteria | 689 |
| 703 | Ga0265326_10154306 | 3300028558 | Bacteria | 656 |
| 704 | Ga0265326_10179234 | 3300028558 | Unclassified | 607 |
| 705 | Ga0265334_10045646 | 3300028573 | Bacteria | 1696 |
| 706 | Ga0265318_10019789 | 3300028577 | Bacteria | 2725 |
| 707 | Ga0265318_10347926 | 3300028577 | Unclassified | 541 |
| 708 | Ga0265338_10081582 | 3300028800 | Bacteria | 2711 |
| 709 | Ga0265324_10046047 | 3300029957 | Bacteria | 1501 |
| 710 | Ga0265763_1000974 | 3300030763 | Unclassified | 1929 |
| 711 | Ga0265763_1014950 | 3300030763 | Unclassified | 766 |
| 712 | Ga0265770_1025376 | 3300030878 | Bacteria | 964 |
| 713 | Ga0265773_1007507 | 3300031018 | Unclassified | 852 |
| 714 | Ga0265773_1026540 | 3300031018 | Bacteria | 600 |
| 715 | Ga0265773_1030272 | 3300031018 | Unclassified | 578 |
| 716 | Ga0265760_10029909 | 3300031090 | Bacteria | 1603 |
| 717 | Ga0265760_10048933 | 3300031090 | Bacteria | 1270 |
| 718 | Ga0265332_10045225 | 3300031238 | Bacteria | 1897 |
| 719 | Ga0265320_10023992 | 3300031240 | Bacteria | 3235 |
| 720 | Ga0265320_10197441 | 3300031240 | Bacteria | 899 |
| 721 | Ga0265325_10021188 | 3300031241 | Bacteria | 3576 |
| 722 | Ga0265325_10036381 | 3300031241 | Unclassified | 2608 |
| 723 | Ga0265325_10087364 | 3300031241 | Bacteria | 1541 |
| 724 | Ga0265325_10361498 | 3300031241 | Unclassified | 640 |
| 725 | Ga0265329_10036623 | 3300031242 | Bacteria | 1581 |
| 726 | Ga0265329_10039944 | 3300031242 | Unclassified | 1506 |
| 727 | Ga0265340_10018462 | 3300031247 | Bacteria | 3596 |
| 728 | Ga0265340_10056110 | 3300031247 | Bacteria | 1895 |
| 729 | Ga0265340_10288567 | 3300031247 | Unclassified | 728 |
| 730 | Ga0265339_10089387 | 3300031249 | Bacteria | 1616 |
| 731 | Ga0265339_10202452 | 3300031249 | Unclassified | 978 |
| 732 | Ga0265339_10419510 | 3300031249 | Unclassified | 624 |
| 733 | Ga0265331_10008223 | 3300031250 | Bacteria | 5950 |
| 734 | Ga0265331_10047061 | 3300031250 | Bacteria | 2077 |
| 735 | Ga0265331_10066113 | 3300031250 | Bacteria | 1698 |
| 736 | Ga0265316_10071272 | 3300031344 | Bacteria | 2679 |
| 737 | Ga0265316_10111892 | 3300031344 | Bacteria | 2067 |
| 738 | Ga0265316_10158251 | 3300031344 | Bacteria | 1694 |
| 739 | Ga0265316_10179733 | 3300031344 | Unclassified | 1575 |
| 740 | Ga0265316_10317869 | 3300031344 | Bacteria | 1131 |
| 741 | Ga0265316_10769562 | 3300031344 | Unclassified | 676 |
| 742 | Ga0307513_10503864 | 3300031456 | Unclassified | 928 |
| 743 | Ga0307509_10192877 | 3300031507 | Bacteria | 1886 |
| 744 | Ga0307408_100171742 | 3300031548 | Unclassified | 1732 |
| 745 | Ga0307408_101718523 | 3300031548 | Unclassified | 598 |
| 746 | Ga0307408_102478803 | 3300031548 | Unclassified | 504 |
| 747 | Ga0265313_10067889 | 3300031595 | Bacteria | 1648 |
| 748 | Ga0265313_10072462 | 3300031595 | Unclassified | 1583 |
| 749 | Ga0265313_10152807 | 3300031595 | Unclassified | 985 |
| 750 | Ga0265313_10232636 | 3300031595 | Unclassified | 756 |
| 751 | Ga0316579_10200400 | 3300031691 | Bacteria | 965 |
| 752 | Ga0265314_10091281 | 3300031711 | Bacteria | 1982 |
| 753 | Ga0265314_10104417 | 3300031711 | Bacteria | 1814 |
| 754 | Ga0265314_10277548 | 3300031711 | Unclassified | 949 |
| 755 | Ga0265342_10045669 | 3300031712 | Bacteria | 2636 |
| 756 | Ga0265342_10103776 | 3300031712 | Bacteria | 1616 |
| 757 | Ga0265342_10109150 | 3300031712 | Bacteria | 1567 |
| 758 | Ga0265342_10327864 | 3300031712 | Unclassified | 801 |
| 759 | Ga0316576_10865741 | 3300031727 | Bacteria | 648 |
| 760 | Ga0316578_10297407 | 3300031728 | Bacteria | 965 |
| 761 | Ga0316578_10384034 | 3300031728 | Bacteria | 833 |
| 762 | Ga0307405_10850155 | 3300031731 | Bacteria | 768 |
| 763 | Ga0307413_10205119 | 3300031824 | Bacteria | 1427 |
| 764 | Ga0307406_10190468 | 3300031901 | Bacteria | 1501 |
| 765 | Ga0307416_103445736 | 3300032002 | Unclassified | 529 |
| 766 | Ga0307414_10268243 | 3300032004 | Bacteria | 1428 |
| 767 | Ga0307415_100842179 | 3300032126 | Unclassified | 841 |
| 768 | Ga0307415_101204404 | 3300032126 | Bacteria | 714 |
| 769 | Ga0316583_10048061 | 3300032133 | Bacteria | 1503 |
| 770 | Ga0316585_10152259 | 3300032137 | Bacteria | 763 |
| 771 | Ga0316580_10236608 | 3300032139 | Bacteria | 564 |
| 772 | Ga0373930_0178518 | 3300034816 | Bacteria | 544 |
| 773 | Ga0373948_0006590 | 3300034817 | Bacteria | 1925 |
| 774 | Ga0373958_0018314 | 3300034819 | Unclassified | 1268 |
| 775 | Ga0373926_0029752 | 3300035083 | Bacteria | 1920 |
| 776 | Ga0373926_0058993 | 3300035083 | Bacteria | 1396 |
| 777 | Ga0373926_0169953 | 3300035083 | Unclassified | 834 |
| 778 | Ga0373926_0305979 | 3300035083 | Unclassified | 621 |
| 779 | Ga0373926_0417452 | 3300035083 | Unclassified | 531 |
| 780 | Ga0373928_0031764 | 3300035084 | Bacteria | 1174 |
| 781 | Ga0373934_0056287 | 3300035086 | Bacteria | 1564 |
| 782 | Ga0373934_0120260 | 3300035086 | Bacteria | 1068 |
| 783 | Ga0373934_0214321 | 3300035086 | Bacteria | 794 |
| 784 | Ga0373934_0403362 | 3300035086 | Bacteria | 571 |
| 785 | Ga0373940_0017912 | 3300035088 | Bacteria | 1770 |
| 786 | Ga0373940_0122140 | 3300035088 | Bacteria | 809 |
| 787 | Ga0373940_0261451 | 3300035088 | Bacteria | 586 |
| 788 | Ga0373944_0034547 | 3300035089 | Bacteria | 1537 |
| 789 | Ga0373944_0053332 | 3300035089 | Unclassified | 1279 |
| 790 | Ga0373944_0379762 | 3300035089 | Unclassified | 542 |
| 791 | Ga0373951_0024048 | 3300035091 | Bacteria | 1409 |
| 792 | Ga0373923_0050163 | 3300035111 | Unclassified | 1747 |
| 793 | Ga0373923_0103177 | 3300035111 | Bacteria | 1260 |
| 794 | Ga0373923_0215028 | 3300035111 | Bacteria | 892 |
| 795 | Ga0373923_0334022 | 3300035111 | Bacteria | 721 |
| 796 | Ga0373936_0035029 | 3300035113 | Bacteria | 1997 |
| 797 | Ga0373936_0047428 | 3300035113 | Unclassified | 1732 |
| 798 | Ga0373936_0052791 | 3300035113 | Bacteria | 1647 |
| 799 | Ga0373936_0071750 | 3300035113 | Bacteria | 1428 |
| 800 | Ga0373939_0023225 | 3300035114 | Bacteria | 1716 |
| 801 | Ga0373939_0480420 | 3300035114 | Unclassified | 528 |
| 802 | Ga0373941_0360454 | 3300035115 | Unclassified | 593 |
| 803 | Ga0373945_0032406 | 3300035116 | Unclassified | 1851 |
| 804 | Ga0373945_0042883 | 3300035116 | Bacteria | 1640 |
| 805 | Ga0373945_0135124 | 3300035116 | Bacteria | 991 |
| 806 | Ga0373945_0271003 | 3300035116 | Bacteria | 721 |
| 807 | Ga0373945_0288544 | 3300035116 | Unclassified | 700 |
| 808 | Ga0373953_0101957 | 3300035117 | Bacteria | 1208 |
| 809 | Ga0373953_0248117 | 3300035117 | Bacteria | 773 |
| 810 | Ga0373954_0058937 | 3300035118 | Bacteria | 1809 |
| 811 | Ga0373954_0067001 | 3300035118 | Bacteria | 1700 |
| 812 | Ga0373954_0301776 | 3300035118 | Unclassified | 790 |
| 813 | Ga0373954_0302306 | 3300035118 | Unclassified | 789 |
| 814 | Ga0373954_0313587 | 3300035118 | Bacteria | 774 |
| 815 | Ga0373956_0062666 | 3300035119 | Bacteria | 1685 |
| 816 | Ga0373957_0036225 | 3300035120 | Bacteria | 1837 |
| 817 | Ga0373957_0063014 | 3300035120 | Bacteria | 1439 |
| 818 | Ga0373957_0477088 | 3300035120 | Unclassified | 541 |
| 819 | Ga0373960_0169024 | 3300035121 | Unclassified | 757 |
| 820 | Ga0373943_0005342 | 3300035170 | Bacteria | 5777 |
| 821 | Ga0373943_0062330 | 3300035170 | Bacteria | 1866 |
| 822 | Ga0373943_0085884 | 3300035170 | Bacteria | 1621 |
| 823 | Ga0373943_0132596 | 3300035170 | Bacteria | 1334 |
| 824 | Ga0373943_0280747 | 3300035170 | Bacteria | 942 |
| 825 | Ga0373943_0771736 | 3300035170 | Unclassified | 571 |
| 826 | Ga0373946_0045696 | 3300035171 | Unclassified | 1812 |
| 827 | Ga0373946_0050571 | 3300035171 | Bacteria | 1736 |
| 828 | Ga0373946_0073382 | 3300035171 | Unclassified | 1483 |
| 829 | Ga0373946_0084732 | 3300035171 | Bacteria | 1394 |
| 830 | Ga0373946_0458532 | 3300035171 | Unclassified | 650 |
| 831 | Ga0373955_0073777 | 3300035172 | Unclassified | 1913 |
| 832 | Ga0373955_0183084 | 3300035172 | Bacteria | 1243 |
| 833 | Ga0373955_0279897 | 3300035172 | Unclassified | 1003 |
| 834 | Ga0373955_0437462 | 3300035172 | Bacteria | 796 |
| 835 | Ga0373955_0927482 | 3300035172 | Unclassified | 536 |
| 836 | Ga0373942_0205821 | 3300035207 | Unclassified | 654 |
| 837 | Ga0373961_0027719 | 3300035241 | Bacteria | 1557 |
| 838 | Ga0373961_0354585 | 3300035241 | Unclassified | 554 |
| 839 | Ga0373961_0420051 | 3300035241 | Unclassified | 516 |
| 840 | Ga0373962_0036670 | 3300035242 | Unclassified | 1366 |
| 841 | Ga0316574_0497551 | 3300035398 | Bacteria | 760 |
| 842 | Ga0373924_0015548 | 3300035410 | Bacteria | 2895 |
| 843 | Ga0373924_0043117 | 3300035410 | Bacteria | 1852 |
| 844 | Ga0373924_0239526 | 3300035410 | Unclassified | 802 |
| 845 | Ga0373924_0265291 | 3300035410 | Bacteria | 761 |
| 846 | Ga0373931_0289044 | 3300035691 | Bacteria | 1009 |
| 847 | Ga0373935_0038850 | 3300035692 | Bacteria | 2981 |
| 848 | Ga0373935_0140958 | 3300035692 | Bacteria | 1628 |
| 849 | Ga0373935_0142606 | 3300035692 | Unclassified | 1619 |
| 850 | Ga0373935_0159068 | 3300035692 | Bacteria | 1538 |
| 851 | Ga0373935_0165808 | 3300035692 | Bacteria | 1508 |
| 852 | Ga0373935_0425638 | 3300035692 | Unclassified | 956 |
| 853 | Ga0373935_0883003 | 3300035692 | Bacteria | 662 |
| 854 | Ga0373935_0941090 | 3300035692 | Bacteria | 641 |
| 855 | Ga0373935_1311400 | 3300035692 | Unclassified | 540 |
| 856 | Ga0373935_1419196 | 3300035692 | Unclassified | 519 |
| 857 | Ga0373927_0042204 | 3300035695 | Bacteria | 2956 |
| 858 | Ga0373927_0078118 | 3300035695 | Bacteria | 2144 |
| 859 | Ga0373927_0101162 | 3300035695 | Bacteria | 1874 |
| 860 | Ga0373927_0173311 | 3300035695 | Bacteria | 1414 |
| 861 | Ga0373927_0230975 | 3300035695 | Bacteria | 1215 |
| 862 | Ga0373927_0366855 | 3300035695 | Unclassified | 949 |
| 863 | Ga0373927_0386135 | 3300035695 | Unclassified | 923 |
| 864 | Ga0373927_0569199 | 3300035695 | Unclassified | 749 |
| 865 | Ga0373927_1152233 | 3300035695 | Unclassified | 511 |
| 866 | Ga0373927_1160304 | 3300035695 | Unclassified | 509 |
| 867 | Ga0373933_0134213 | 3300035724 | Bacteria | 1558 |
| 868 | Ga0373933_0150704 | 3300035724 | Bacteria | 1472 |
| 869 | Ga0373933_0384438 | 3300035724 | Unclassified | 914 |
| 870 | Ga0373933_0480877 | 3300035724 | Bacteria | 813 |
| 871 | Ga0373933_0552533 | 3300035724 | Unclassified | 755 |
| 872 | Ga0373933_0683348 | 3300035724 | Unclassified | 675 |
| 873 | Ga0373947_0063771 | 3300035725 | Bacteria | 2245 |
| 874 | Ga0373947_0063831 | 3300035725 | Unclassified | 2244 |
| 875 | Ga0373947_0092940 | 3300035725 | Unclassified | 1884 |
| 876 | Ga0373947_0097758 | 3300035725 | Bacteria | 1840 |
| 877 | Ga0373947_0361164 | 3300035725 | Bacteria | 975 |
| 878 | Ga0373947_0514809 | 3300035725 | Unclassified | 813 |
| 879 | Ga0373947_0621719 | 3300035725 | Unclassified | 736 |
| 880 | Ga0373947_0772279 | 3300035725 | Unclassified | 656 |
| 881 | Ga0373947_0831491 | 3300035725 | Bacteria | 630 |
| 882 | Ga0373947_1066726 | 3300035725 | Bacteria | 551 |
| 883 | Ga0373937_0091444 | 3300036401 | Bacteria | 2820 |
| 884 | Ga0373937_0182915 | 3300036401 | Bacteria | 1968 |
| 885 | Ga0373937_0206236 | 3300036401 | Bacteria | 1848 |
| 886 | Ga0373937_0257770 | 3300036401 | Bacteria | 1644 |
| 887 | Ga0373937_0303411 | 3300036401 | Unclassified | 1509 |
| 888 | Ga0373937_0488148 | 3300036401 | Bacteria | 1170 |
| 889 | Ga0373937_0828510 | 3300036401 | Unclassified | 873 |
| 890 | Ga0316582_0441920 | 3300036647 | Bacteria | 896 |
| 891 | Ga0316584_0159185 | 3300036712 | Bacteria | 1678 |
| 892 | Ga0373925_0023520 | 3300037068 | Bacteria | 4496 |
| 893 | Ga0373925_0125885 | 3300037068 | Bacteria | 1993 |
| 894 | Ga0373925_0164838 | 3300037068 | Bacteria | 1747 |
| 895 | Ga0373925_0182834 | 3300037068 | Unclassified | 1660 |
| 896 | Ga0373925_0211597 | 3300037068 | Bacteria | 1544 |
| 897 | Ga0373925_0397770 | 3300037068 | Bacteria | 1123 |
| 898 | Ga0373925_0475814 | 3300037068 | Unclassified | 1024 |
| 899 | Ga0373925_0617573 | 3300037068 | Unclassified | 893 |
| 900 | Ga0373925_0725810 | 3300037068 | Unclassified | 819 |
| 901 | Ga0373925_0833130 | 3300037068 | Bacteria | 760 |
| 902 | Ga0373925_1313273 | 3300037068 | Unclassified | 593 |
| 903 | Ga0395899_0552526 | 3300037312 | Unclassified | 740 |
| 904 | Ga0395900_0285917 | 3300037418 | Bacteria | 1639 |
| 905 | Ga0395900_1350078 | 3300037418 | Bacteria | 626 |
| 906 | Ga0395898_0320593 | 3300037466 | Bacteria | 1478 |
| 907 | Ga0395898_0332583 | 3300037466 | Bacteria | 1448 |
| 908 | Ga0395898_0582691 | 3300037466 | Unclassified | 1061 |
| 909 | Ga0436364_0189323 | 3300037853 | Bacteria | 13498 |
| 910 | Ga0436364_0216034 | 3300037853 | Bacteria | 1186 |
| 911 | Ga0436364_0297553 | 3300037853 | Unclassified | 4615 |
| 912 | Ga0436364_0605402 | 3300037853 | Bacteria | 1754 |
| 913 | Ga0436364_0916375 | 3300037853 | Bacteria | 2655 |
| 914 | Ga0436364_1110612 | 3300037853 | Unclassified | 1733 |
| 915 | Ga0436364_1355258 | 3300037853 | Unclassified | 918 |
| 916 | Ga0395901_0197385 | 3300038443 | Unclassified | 2110 |
| 917 | Ga0395901_0301739 | 3300038443 | Bacteria | 1660 |
| 918 | Ga0395901_0797814 | 3300038443 | Bacteria | 933 |
| 919 | Ga0242419_001291 | 3300038698 | Unclassified | 1523 |
| 920 | Ga0242422_01521 | 3300038699 | Unclassified | 1601 |
| 921 | Ga0242420_012461 | 3300038996 | Bacteria | 1440 |
| 922 | Ga0436365_0373323 | 3300039437 | Unclassified | 1331 |
| 923 | Ga0436365_0757888 | 3300039437 | Unclassified | 898 |
| 924 | Ga0436365_0858377 | 3300039437 | Bacteria | 2032 |
| 925 | Ga0436365_0870917 | 3300039437 | Bacteria | 2113 |
| 926 | Ga0436365_1169571 | 3300039437 | Unclassified | 723 |
| 927 | Ga0436365_1558697 | 3300039437 | Unclassified | 746 |
| 928 | Ga0436365_1597936 | 3300039437 | Bacteria | 715 |
| 929 | Ga0436365_1868933 | 3300039437 | Unclassified | 593 |
| 930 | Ga0436360_1050603 | 3300039438 | Bacteria | 1380 |
| 931 | Ga0436360_1296915 | 3300039438 | Bacteria | 1409 |
| 932 | Ga0436361_0024304 | 3300039447 | Bacteria | 3186 |
| 933 | Ga0436361_1045206 | 3300039447 | Unclassified | 1138 |
| 934 | Ga0436363_0200572 | 3300039450 | Bacteria | 1311 |
| 935 | Ga0436363_0284012 | 3300039450 | Bacteria | 718 |
| 936 | Ga0436363_0308973 | 3300039450 | Bacteria | 1738 |
| 937 | Ga0436363_0385728 | 3300039450 | Bacteria | 542 |
| 938 | Ga0436363_0769610 | 3300039450 | Unclassified | 564 |
| 939 | Ga0436363_0873113 | 3300039450 | Unclassified | 1006 |
| 940 | Ga0436363_1032696 | 3300039450 | Unclassified | 689 |
| 941 | Ga0436363_1288498 | 3300039450 | Bacteria | 905 |
| 942 | Ga0436363_1426428 | 3300039450 | Bacteria | 1400 |
| 943 | Ga0436363_1481309 | 3300039450 | Unclassified | 928 |
| 944 | Ga0436362_0348216 | 3300039453 | Unclassified | 751 |
| 945 | Ga0436362_0529678 | 3300039453 | Unclassified | 1484 |
| 946 | Ga0436362_0643801 | 3300039453 | Bacteria | 3144 |
| 947 | Ga0436362_0663136 | 3300039453 | Bacteria | 1720 |
| 948 | Ga0436362_0813421 | 3300039453 | Unclassified | 844 |
| 949 | Ga0436362_0848735 | 3300039453 | Unclassified | 821 |
| 950 | Ga0451804_0644598 | 3300041463 | Bacteria | 609 |
| 951 | Ga0439433_0046205 | 3300041999 | Bacteria | 1020 |
| 952 | Ga0439457_048269 | 3300042014 | Bacteria | 954 |
| 953 | Ga0450923_161943 | 3300042125 | Unclassified | 545 |
| 954 | Ga0439464_0139531 | 3300042439 | Bacteria | 754 |
| 955 | Ga0439464_0280669 | 3300042439 | Bacteria | 542 |
| 956 | Ga0451577_0868423 | 3300042876 | Bacteria | 813 |
| 957 | Ga0466969_0520089 | 3300044656 | Unclassified | 544 |
| 958 | Ga0453683_0790607 | 3300044673 | Unclassified | 624 |
| 959 | Ga0466963_0138162 | 3300044694 | Bacteria | 1687 |
| 960 | Ga0466963_0259175 | 3300044694 | Unclassified | 1221 |
| 961 | Ga0453684_0140846 | 3300044712 | Bacteria | 2880 |
| 962 | Ga0453684_0826314 | 3300044712 | Bacteria | 997 |
| 963 | Ga0466971_0298573 | 3300044719 | Unclassified | 773 |
| 964 | Ga0466971_0590366 | 3300044719 | Unclassified | 553 |
| 965 | Ga0466968_0304306 | 3300044735 | Unclassified | 767 |
| 966 | Ga0466957_0133467 | 3300044842 | Bacteria | 1593 |
| 967 | Ga0466957_0182135 | 3300044842 | Bacteria | 1372 |
| 968 | Ga0466959_0361644 | 3300045049 | Bacteria | 989 |
| 969 | Ga0451576_0211567 | 3300045051 | Unclassified | 2025 |
| 970 | Ga0451576_0357362 | 3300045051 | Bacteria | 1529 |
| 971 | Ga0451576_0365777 | 3300045051 | Bacteria | 1511 |
| 972 | Ga0451576_0828597 | 3300045051 | Bacteria | 971 |
| 973 | Ga0451576_2547565 | 3300045051 | Unclassified | 522 |
| 974 | Ga0466958_0149509 | 3300045836 | Bacteria | 1473 |
| 975 | Ga0466967_0042504 | 3300045976 | Bacteria | 3928 |
| 976 | Ga0466967_0168409 | 3300045976 | Bacteria | 2059 |
| 977 | Ga0466967_0279700 | 3300045976 | Unclassified | 1601 |
| 978 | Ga0466967_2430617 | 3300045976 | Unclassified | 519 |
| 979 | Ga0495617_237996 | 3300046452 | Bacteria | 563 |
| 980 | Ga0495592_0094298 | 3300046454 | Bacteria | 2142 |
| 981 | Ga0495592_0267364 | 3300046454 | Bacteria | 1123 |
| 982 | Ga0495603_0066587 | 3300046455 | Bacteria | 2121 |
| 983 | Ga0495603_0843651 | 3300046455 | Unclassified | 522 |
| 984 | Ga0495590_0350340 | 3300046457 | Bacteria | 561 |
| 985 | Ga0495590_0358401 | 3300046457 | Bacteria | 555 |
| 986 | Ga0495629_0126783 | 3300046459 | Bacteria | 1778 |
| 987 | Ga0495629_0141150 | 3300046459 | Bacteria | 1676 |
| 988 | Ga0495629_0143117 | 3300046459 | Bacteria | 1663 |
| 989 | Ga0495629_0152793 | 3300046459 | Unclassified | 1604 |
| 990 | Ga0495641_0168254 | 3300046461 | Bacteria | 981 |
| 991 | Ga0495641_0213794 | 3300046461 | Bacteria | 865 |
| 992 | Ga0495651_0111537 | 3300046462 | Unclassified | 2021 |
| 993 | Ga0495651_0210093 | 3300046462 | Bacteria | 1355 |
| 994 | Ga0495651_0728396 | 3300046462 | Bacteria | 616 |
| 995 | Ga0495653_0066192 | 3300046463 | Unclassified | 2718 |
| 996 | Ga0495653_0689601 | 3300046463 | Unclassified | 621 |
| 997 | Ga0495580_0052476 | 3300046472 | Bacteria | 2879 |
| 998 | Ga0495580_0054093 | 3300046472 | Unclassified | 2832 |
| 999 | Ga0495580_0102907 | 3300046472 | Bacteria | 1985 |
| 1000 | Ga0495580_0121886 | 3300046472 | Unclassified | 1810 |
| 1001 | Ga0495580_0131554 | 3300046472 | Bacteria | 1735 |
| 1002 | Ga0495580_0141809 | 3300046472 | Bacteria | 1665 |
| 1003 | Ga0495580_0157296 | 3300046472 | Bacteria | 1573 |
| 1004 | Ga0495580_0218089 | 3300046472 | Bacteria | 1311 |
| 1005 | Ga0495580_0253203 | 3300046472 | Bacteria | 1205 |
| 1006 | Ga0495580_0264266 | 3300046472 | Bacteria | 1176 |
| 1007 | Ga0495580_0335785 | 3300046472 | Unclassified | 1025 |
| 1008 | Ga0495580_0814665 | 3300046472 | Unclassified | 604 |
| 1009 | Ga0495582_0042775 | 3300046473 | Bacteria | 2494 |
| 1010 | Ga0495582_0045165 | 3300046473 | Unclassified | 2426 |
| 1011 | Ga0495582_0068163 | 3300046473 | Bacteria | 1966 |
| 1012 | Ga0495582_0071986 | 3300046473 | Unclassified | 1912 |
| 1013 | Ga0495582_0191039 | 3300046473 | Bacteria | 1168 |
| 1014 | Ga0495582_0532189 | 3300046473 | Unclassified | 679 |
| 1015 | Ga0495582_0786795 | 3300046473 | Unclassified | 550 |
| 1016 | Ga0495582_0853634 | 3300046473 | Bacteria | 526 |
| 1017 | Ga0495605_0069413 | 3300046474 | Unclassified | 1668 |
| 1018 | Ga0495639_0037624 | 3300046475 | Unclassified | 2169 |
| 1019 | Ga0495639_0043140 | 3300046475 | Bacteria | 2036 |
| 1020 | Ga0495639_0081466 | 3300046475 | Unclassified | 1508 |
| 1021 | Ga0495639_0083105 | 3300046475 | Unclassified | 1493 |
| 1022 | Ga0495662_0059571 | 3300046476 | Unclassified | 1843 |
| 1023 | Ga0495662_0064548 | 3300046476 | Bacteria | 1769 |
| 1024 | Ga0495662_0066294 | 3300046476 | Bacteria | 1746 |
| 1025 | Ga0495662_0074720 | 3300046476 | Bacteria | 1645 |
| 1026 | Ga0495662_0098760 | 3300046476 | Bacteria | 1427 |
| 1027 | Ga0495664_0064716 | 3300046477 | Unclassified | 2179 |
| 1028 | Ga0495664_0081231 | 3300046477 | Bacteria | 1943 |
| 1029 | Ga0495664_0088561 | 3300046477 | Bacteria | 1860 |
| 1030 | Ga0495664_0101495 | 3300046477 | Unclassified | 1733 |
| 1031 | Ga0495664_0130260 | 3300046477 | Unclassified | 1523 |
| 1032 | Ga0495664_0257313 | 3300046477 | Bacteria | 1055 |
| 1033 | Ga0495664_0401275 | 3300046477 | Unclassified | 823 |
| 1034 | Ga0495664_0844265 | 3300046477 | Unclassified | 537 |
| 1035 | Ga0495664_0847177 | 3300046477 | Unclassified | 536 |
| 1036 | Ga0495585_0078300 | 3300046492 | Unclassified | 1793 |
| 1037 | Ga0495585_0619685 | 3300046492 | Unclassified | 508 |
| 1038 | Ga0495594_0058463 | 3300046499 | Bacteria | 2130 |
| 1039 | Ga0495594_0062157 | 3300046499 | Unclassified | 2067 |
| 1040 | Ga0495594_0068756 | 3300046499 | Unclassified | 1967 |
| 1041 | Ga0495596_0045016 | 3300046500 | Unclassified | 1735 |
| 1042 | Ga0495607_0276234 | 3300046501 | Unclassified | 799 |
| 1043 | Ga0495583_0057899 | 3300046506 | Unclassified | 1742 |
| 1044 | Ga0495608_0112346 | 3300046511 | Unclassified | 1751 |
| 1045 | Ga0495608_0141485 | 3300046511 | Bacteria | 1535 |
| 1046 | Ga0495608_0472534 | 3300046511 | Bacteria | 761 |
| 1047 | Ga0495618_0094776 | 3300046514 | Unclassified | 1908 |
| 1048 | Ga0495618_0143918 | 3300046514 | Bacteria | 1524 |
| 1049 | Ga0495618_0516528 | 3300046514 | Unclassified | 718 |
| 1050 | Ga0495618_0556176 | 3300046514 | Unclassified | 686 |
| 1051 | Ga0495628_0022304 | 3300046516 | Bacteria | 5201 |
| 1052 | Ga0495628_0175452 | 3300046516 | Bacteria | 1623 |
| 1053 | Ga0495628_0180410 | 3300046516 | Unclassified | 1597 |
| 1054 | Ga0495628_0284396 | 3300046516 | Bacteria | 1227 |
| 1055 | Ga0495628_0529911 | 3300046516 | Unclassified | 848 |
| 1056 | Ga0495628_1160422 | 3300046516 | Bacteria | 525 |
| 1057 | Ga0495630_0066075 | 3300046517 | Bacteria | 2718 |
| 1058 | Ga0495630_0068196 | 3300046517 | Unclassified | 2674 |
| 1059 | Ga0495630_0116229 | 3300046517 | Unclassified | 2027 |
| 1060 | Ga0495630_0121282 | 3300046517 | Unclassified | 1983 |
| 1061 | Ga0495630_0157700 | 3300046517 | Bacteria | 1727 |
| 1062 | Ga0495630_0187858 | 3300046517 | Unclassified | 1576 |
| 1063 | Ga0495630_0212395 | 3300046517 | Bacteria | 1477 |
| 1064 | Ga0495630_0558737 | 3300046517 | Unclassified | 877 |
| 1065 | Ga0495644_0034145 | 3300046523 | Unclassified | 1920 |
| 1066 | Ga0495663_0007870 | 3300046525 | Unclassified | 2945 |
| 1067 | Ga0495666_0041955 | 3300046526 | Bacteria | 2213 |
| 1068 | Ga0495666_0080027 | 3300046526 | Bacteria | 1546 |
| 1069 | Ga0495666_0089989 | 3300046526 | Bacteria | 1448 |
| 1070 | Ga0495666_0284374 | 3300046526 | Bacteria | 749 |
| 1071 | Ga0495666_0451976 | 3300046526 | Bacteria | 575 |
| 1072 | Ga0495642_0014004 | 3300046528 | Unclassified | 3107 |
| 1073 | Ga0495642_0573705 | 3300046528 | Bacteria | 501 |
| 1074 | Ga0495652_0130044 | 3300046529 | Unclassified | 1994 |
| 1075 | Ga0495652_0149958 | 3300046529 | Unclassified | 1823 |
| 1076 | Ga0495652_0289633 | 3300046529 | Bacteria | 1195 |
| 1077 | Ga0495654_0063672 | 3300046530 | Unclassified | 1765 |
| 1078 | Ga0495665_0008900 | 3300046531 | Bacteria | 5445 |
| 1079 | Ga0495665_0028148 | 3300046531 | Bacteria | 3015 |
| 1080 | Ga0495665_0048843 | 3300046531 | Bacteria | 2243 |
| 1081 | Ga0495665_0086022 | 3300046531 | Unclassified | 1652 |
| 1082 | Ga0495665_0091930 | 3300046531 | Bacteria | 1594 |
| 1083 | Ga0495665_0113354 | 3300046531 | Unclassified | 1421 |
| 1084 | Ga0495665_0130349 | 3300046531 | Bacteria | 1316 |
| 1085 | Ga0495665_0317673 | 3300046531 | Bacteria | 795 |
| 1086 | Ga0495640_0097626 | 3300046533 | Unclassified | 1931 |
| 1087 | Ga0495640_0112510 | 3300046533 | Bacteria | 1777 |
| 1088 | Ga0495640_0127227 | 3300046533 | Bacteria | 1651 |
| 1089 | Ga0495640_0152977 | 3300046533 | Bacteria | 1481 |
| 1090 | Ga0495640_0167841 | 3300046533 | Bacteria | 1403 |
| 1091 | Ga0495640_0168245 | 3300046533 | Bacteria | 1401 |
| 1092 | Ga0495640_0623349 | 3300046533 | Unclassified | 650 |
| 1093 | Ga0495640_0731159 | 3300046533 | Unclassified | 592 |
| 1094 | Ga0495586_0059881 | 3300046535 | Bacteria | 2070 |
| 1095 | Ga0495586_0060754 | 3300046535 | Bacteria | 2055 |
| 1096 | Ga0495586_0091334 | 3300046535 | Bacteria | 1682 |
| 1097 | Ga0495586_0108047 | 3300046535 | Bacteria | 1547 |
| 1098 | Ga0495586_0206529 | 3300046535 | Bacteria | 1114 |
| 1099 | Ga0495586_0255388 | 3300046535 | Bacteria | 1000 |
| 1100 | Ga0495586_0346835 | 3300046535 | Unclassified | 852 |
| 1101 | Ga0495586_0429147 | 3300046535 | Bacteria | 761 |
| 1102 | Ga0495586_0716733 | 3300046535 | Unclassified | 577 |
| 1103 | Ga0495587_0037147 | 3300046536 | Bacteria | 2926 |
| 1104 | Ga0495587_0194590 | 3300046536 | Bacteria | 1147 |
| 1105 | Ga0495587_0380507 | 3300046536 | Unclassified | 785 |
| 1106 | Ga0495598_0022584 | 3300046537 | Unclassified | 1685 |
| 1107 | Ga0495609_0160794 | 3300046538 | Unclassified | 952 |
| 1108 | Ga0495621_0034996 | 3300046539 | Unclassified | 1737 |
| 1109 | Ga0495645_0117652 | 3300046543 | Bacteria | 1874 |
| 1110 | Ga0495645_0235435 | 3300046543 | Unclassified | 1224 |
| 1111 | Ga0495645_0254241 | 3300046543 | Bacteria | 1166 |
| 1112 | Ga0495645_0524353 | 3300046543 | Unclassified | 737 |
| 1113 | Ga0495645_0537120 | 3300046543 | Unclassified | 726 |
| 1114 | Ga0495622_0058232 | 3300046557 | Unclassified | 1790 |
| 1115 | Ga0495622_0065059 | 3300046557 | Bacteria | 1686 |
| 1116 | Ga0495633_0095586 | 3300046558 | Unclassified | 1380 |
| 1117 | Ga0495633_0503149 | 3300046558 | Unclassified | 546 |
| 1118 | Ga0495667_0122419 | 3300046559 | Unclassified | 1679 |
| 1119 | Ga0495667_0388113 | 3300046559 | Bacteria | 880 |
| 1120 | Ga0495667_0539059 | 3300046559 | Bacteria | 729 |
| 1121 | Ga0495656_0069228 | 3300046615 | Unclassified | 1562 |
| 1122 | Ga0495668_0096097 | 3300046616 | Unclassified | 1621 |
| 1123 | Ga0495634_0102272 | 3300046642 | Bacteria | 1850 |
| 1124 | Ga0495634_0109809 | 3300046642 | Unclassified | 1774 |
| 1125 | Ga0495634_0147535 | 3300046642 | Unclassified | 1489 |
| 1126 | Ga0495634_0154341 | 3300046642 | Bacteria | 1450 |
| 1127 | Ga0495634_0208912 | 3300046642 | Bacteria | 1209 |
| 1128 | Ga0495634_0316719 | 3300046642 | Bacteria | 940 |
| 1129 | Ga0495611_0486806 | 3300046648 | Unclassified | 561 |
| 1130 | Ga0495635_0091420 | 3300046663 | Bacteria | 2081 |
| 1131 | Ga0495635_0092632 | 3300046663 | Bacteria | 2066 |
| 1132 | Ga0495635_0114213 | 3300046663 | Unclassified | 1843 |
| 1133 | Ga0495635_0117323 | 3300046663 | Unclassified | 1816 |
| 1134 | Ga0495635_0136669 | 3300046663 | Unclassified | 1670 |
| 1135 | Ga0495635_0154984 | 3300046663 | Bacteria | 1559 |
| 1136 | Ga0495635_0547100 | 3300046663 | Bacteria | 759 |
| 1137 | Ga0495635_0704608 | 3300046663 | Unclassified | 654 |
| 1138 | Ga0495635_0729387 | 3300046663 | Bacteria | 641 |
| 1139 | Ga0495659_0035665 | 3300046664 | Unclassified | 1754 |
| 1140 | Ga0495661_0100522 | 3300046665 | Unclassified | 1628 |
| 1141 | Ga0495588_0189835 | 3300046674 | Bacteria | 1085 |
| 1142 | Ga0495588_0604549 | 3300046674 | Unclassified | 574 |
| 1143 | Ga0495588_0680707 | 3300046674 | Unclassified | 538 |
| 1144 | Ga0495657_0102608 | 3300046675 | Unclassified | 1820 |
| 1145 | Ga0495657_0121555 | 3300046675 | Bacteria | 1644 |
| 1146 | Ga0495657_0182336 | 3300046675 | Bacteria | 1288 |
| 1147 | Ga0495657_0575311 | 3300046675 | Unclassified | 653 |
| 1148 | Ga0495599_0039898 | 3300046678 | Unclassified | 2949 |
| 1149 | Ga0495599_0193726 | 3300046678 | Unclassified | 1250 |
| 1150 | Ga0495599_0373695 | 3300046678 | Bacteria | 852 |
| 1151 | Ga0495599_0562196 | 3300046678 | Unclassified | 667 |
| 1152 | Ga0495623_0110354 | 3300046679 | Bacteria | 1667 |
| 1153 | Ga0495646_0004591 | 3300046680 | Bacteria | 8705 |
| 1154 | Ga0495646_0086981 | 3300046680 | Unclassified | 1811 |
| 1155 | Ga0495646_0097564 | 3300046680 | Unclassified | 1688 |
| 1156 | Ga0495647_0056750 | 3300046681 | Bacteria | 1536 |
| 1157 | Ga0495647_0078238 | 3300046681 | Unclassified | 1336 |
| 1158 | Ga0495647_0196414 | 3300046681 | Bacteria | 883 |
| 1159 | Ga0495658_0077958 | 3300046683 | Bacteria | 1938 |
| 1160 | Ga0495658_0081558 | 3300046683 | Unclassified | 1899 |
| 1161 | Ga0495658_0096243 | 3300046683 | Bacteria | 1760 |
| 1162 | Ga0495658_0349708 | 3300046683 | Bacteria | 939 |
| 1163 | Ga0495658_0410369 | 3300046683 | Unclassified | 864 |
| 1164 | Ga0495658_0580725 | 3300046683 | Bacteria | 718 |
| 1165 | Ga0495669_0050589 | 3300046684 | Unclassified | 1863 |
| 1166 | Ga0495613_0111435 | 3300046689 | Unclassified | 1971 |
| 1167 | Ga0495613_0129151 | 3300046689 | Unclassified | 1810 |
| 1168 | Ga0495613_0169015 | 3300046689 | Bacteria | 1552 |
| 1169 | Ga0495613_0183424 | 3300046689 | Bacteria | 1481 |
| 1170 | Ga0495613_0261137 | 3300046689 | Unclassified | 1206 |
| 1171 | Ga0495613_0441688 | 3300046689 | Bacteria | 882 |
| 1172 | Ga0495624_0036211 | 3300046690 | Bacteria | 3184 |
| 1173 | Ga0495624_0094655 | 3300046690 | Bacteria | 1841 |
| 1174 | Ga0495624_0116782 | 3300046690 | Unclassified | 1639 |
| 1175 | Ga0495624_0122682 | 3300046690 | Bacteria | 1595 |
| 1176 | Ga0495624_0230621 | 3300046690 | Bacteria | 1121 |
| 1177 | Ga0495624_0299727 | 3300046690 | Unclassified | 969 |
| 1178 | Ga0495624_0706967 | 3300046690 | Bacteria | 598 |
| 1179 | Ga0495670_0027562 | 3300046691 | Unclassified | 2815 |
| 1180 | Ga0495670_0824965 | 3300046691 | Unclassified | 506 |
| 1181 | Ga0495671_0136822 | 3300046692 | Unclassified | 1194 |
| 1182 | Ga0495589_0065436 | 3300046794 | Bacteria | 1782 |
| 1183 | Ga0495589_0383231 | 3300046794 | Unclassified | 646 |
| 1184 | Ga0495600_0181981 | 3300046809 | Bacteria | 1354 |
| 1185 | Ga0495600_0434766 | 3300046809 | Unclassified | 813 |
| 1186 | Ga0495600_0460850 | 3300046809 | Unclassified | 785 |
| 1187 | Ga0495581_0083750 | 3300047315 | Bacteria | 1847 |
| 1188 | Ga0495581_0087770 | 3300047315 | Bacteria | 1803 |
| 1189 | Ga0495581_0099676 | 3300047315 | Unclassified | 1687 |
| 1190 | Ga0495581_0104814 | 3300047315 | Bacteria | 1643 |
| 1191 | Ga0495581_0124408 | 3300047315 | Bacteria | 1501 |
| 1192 | Ga0495581_0267652 | 3300047315 | Unclassified | 999 |
| 1193 | Ga0495604_0113732 | 3300047317 | Unclassified | 1969 |
| 1194 | Ga0495604_0123026 | 3300047317 | Unclassified | 1875 |
| 1195 | Ga0495604_0139121 | 3300047317 | Unclassified | 1736 |
| 1196 | Ga0495604_0226846 | 3300047317 | Bacteria | 1283 |
| 1197 | Ga0495604_0527544 | 3300047317 | Unclassified | 763 |
| 1198 | Ga0495636_0016495 | 3300047318 | Plasmid | 2951 |
| 1199 | Ga0495636_0231389 | 3300047318 | Unclassified | 850 |
| 1200 | Ga0495674_0055652 | 3300047319 | Bacteria | 3468 |
| 1201 | Ga0495674_0066700 | 3300047319 | Bacteria | 3121 |
| 1202 | Ga0495674_0106350 | 3300047319 | Unclassified | 2383 |
| 1203 | Ga0495674_0107711 | 3300047319 | Unclassified | 2365 |
| 1204 | Ga0495674_0179199 | 3300047319 | Bacteria | 1765 |
| 1205 | Ga0495674_0195763 | 3300047319 | Unclassified | 1678 |
| 1206 | Ga0495674_0196403 | 3300047319 | Unclassified | 1675 |
| 1207 | Ga0495674_0200727 | 3300047319 | Bacteria | 1654 |
| 1208 | Ga0495674_0213746 | 3300047319 | Unclassified | 1596 |
| 1209 | Ga0495674_0224798 | 3300047319 | Bacteria | 1551 |
| 1210 | Ga0495674_0268788 | 3300047319 | Unclassified | 1399 |
| 1211 | Ga0495674_0315963 | 3300047319 | Bacteria | 1273 |
| 1212 | Ga0495674_0374782 | 3300047319 | Unclassified | 1152 |
| 1213 | Ga0495674_0748934 | 3300047319 | Unclassified | 763 |
| 1214 | Ga0495676_0158225 | 3300047321 | Bacteria | 1605 |
| 1215 | Ga0495676_0611015 | 3300047321 | Bacteria | 709 |
| 1216 | Ga0495676_0817969 | 3300047321 | Unclassified | 599 |
| 1217 | Ga0495676_0824606 | 3300047321 | Unclassified | 596 |
| 1218 | Ga0495676_1106765 | 3300047321 | Unclassified | 503 |
| 1219 | Ga0495680_0110650 | 3300047322 | Bacteria | 2035 |
| 1220 | Ga0495680_0138257 | 3300047322 | Unclassified | 1784 |
| 1221 | Ga0495680_0486058 | 3300047322 | Unclassified | 840 |
| 1222 | Ga0495675_0057476 | 3300047444 | Unclassified | 2466 |
| 1223 | Ga0495675_0119152 | 3300047444 | Unclassified | 1644 |
| 1224 | Ga0495675_0120184 | 3300047444 | Unclassified | 1636 |
| 1225 | Ga0495675_0345266 | 3300047444 | Bacteria | 876 |
| 1226 | Ga0495677_0036661 | 3300047445 | Unclassified | 1791 |
| 1227 | Ga0495685_121768 | 3300047447 | Unclassified | 856 |
| 1228 | Ga0495684_0038477 | 3300047471 | Plasmid | 3668 |
| 1229 | Ga0495684_0067454 | 3300047471 | Bacteria | 2721 |
| 1230 | Ga0495684_0129830 | 3300047471 | Bacteria | 1893 |
| 1231 | Ga0495684_0138386 | 3300047471 | Bacteria | 1826 |
| 1232 | Ga0495684_0140684 | 3300047471 | Unclassified | 1809 |
| 1233 | Ga0495684_0150449 | 3300047471 | Bacteria | 1740 |
| 1234 | Ga0495684_0151657 | 3300047471 | Bacteria | 1732 |
| 1235 | Ga0495684_0155134 | 3300047471 | Unclassified | 1710 |
| 1236 | Ga0495684_0212067 | 3300047471 | Bacteria | 1423 |
| 1237 | Ga0495593_0062078 | 3300047673 | Bacteria | 1953 |
| 1238 | Ga0495593_0075734 | 3300047673 | Bacteria | 1744 |
| 1239 | Ga0495593_0165335 | 3300047673 | Bacteria | 1116 |
| 1240 | Ga0495593_0262948 | 3300047673 | Unclassified | 863 |
| 1241 | Ga0495602_0174068 | 3300048088 | Unclassified | 1667 |
| 1242 | Ga0495602_0330647 | 3300048088 | Bacteria | 1105 |
| 1243 | Ga0495602_0359032 | 3300048088 | Bacteria | 1049 |
| 1244 | Ga0495614_0044347 | 3300048089 | Unclassified | 1907 |
| 1245 | Ga0495614_0052564 | 3300048089 | Unclassified | 1746 |
| 1246 | Ga0495614_0057139 | 3300048089 | Bacteria | 1675 |
| 1247 | Ga0495614_0517985 | 3300048089 | Unclassified | 568 |
| 1248 | Ga0495615_0018395 | 3300048090 | Unclassified | 1537 |
| 1249 | Ga0496100_0144817 | 3300048903 | Bacteria | 1688 |
| 1250 | Ga0496100_0163490 | 3300048903 | Bacteria | 1597 |
| 1251 | Ga0496100_0320152 | 3300048903 | Bacteria | 1165 |
| 1252 | Ga0496101_0213827 | 3300048904 | Bacteria | 1494 |
| 1253 | Ga0496101_0444277 | 3300048904 | Unclassified | 1023 |
| 1254 | Ga0496101_1273096 | 3300048904 | Unclassified | 575 |
| 1255 | Ga0496102_0275645 | 3300048905 | Bacteria | 1585 |
| 1256 | Ga0496103_0825443 | 3300048906 | Bacteria | 584 |
| 1257 | Ga0496104_0253785 | 3300048907 | Bacteria | 1671 |
| 1258 | Ga0496104_0261260 | 3300048907 | Bacteria | 1644 |
| 1259 | Ga0496104_0414725 | 3300048907 | Bacteria | 1259 |
| 1260 | Ga0496104_1660085 | 3300048907 | Unclassified | 541 |
| 1261 | Ga0496105_0136542 | 3300048908 | Bacteria | 2020 |
| 1262 | Ga0496105_0610832 | 3300048908 | Bacteria | 845 |
| 1263 | Ga0496105_1105136 | 3300048908 | Bacteria | 588 |
| 1264 | Ga0496105_1372827 | 3300048908 | Unclassified | 513 |
| 1265 | Ga0496106_0289614 | 3300048909 | Unclassified | 1313 |
| 1266 | Ga0496106_0494843 | 3300048909 | Bacteria | 982 |
| 1267 | Ga0496107_0407376 | 3300048910 | Bacteria | 1011 |
| 1268 | Ga0496107_1109292 | 3300048910 | Unclassified | 571 |
| 1269 | Ga0496108_0186190 | 3300048911 | Bacteria | 1798 |
| 1270 | Ga0496108_0927476 | 3300048911 | Unclassified | 746 |
| 1271 | Ga0496108_0955121 | 3300048911 | Bacteria | 734 |
| 1272 | Ga0496109_0178894 | 3300048912 | Bacteria | 1991 |
| 1273 | Ga0496109_0546717 | 3300048912 | Unclassified | 1092 |
| 1274 | Ga0496110_0125823 | 3300048913 | Bacteria | 2312 |
| 1275 | Ga0496110_0219205 | 3300048913 | Unclassified | 1730 |
| 1276 | Ga0496110_1272925 | 3300048913 | Bacteria | 645 |
| 1277 | Ga0496110_1730027 | 3300048913 | Unclassified | 535 |
| 1278 | Ga0496111_0523684 | 3300048914 | Bacteria | 872 |
| 1279 | Ga0496112_0208027 | 3300048915 | Unclassified | 1914 |
| 1280 | Ga0496112_0245019 | 3300048915 | Bacteria | 1744 |
| 1281 | Ga0496112_0292712 | 3300048915 | Unclassified | 1574 |
| 1282 | Ga0496112_0909997 | 3300048915 | Bacteria | 801 |
| 1283 | Ga0496112_1721891 | 3300048915 | Unclassified | 539 |
| 1284 | Ga0496113_0326730 | 3300048916 | Unclassified | 1230 |
| 1285 | Ga0496113_0949663 | 3300048916 | Bacteria | 679 |
| 1286 | Ga0496114_0221029 | 3300048917 | Unclassified | 1663 |
| 1287 | Ga0496114_0236864 | 3300048917 | Bacteria | 1604 |
| 1288 | Ga0496114_0352336 | 3300048917 | Unclassified | 1302 |
| 1289 | Ga0496114_0839028 | 3300048917 | Unclassified | 799 |
| 1290 | Ga0501040_0492703 | 3300049576 | Bacteria | 883 |
| 1291 | Ga0501042_1198006 | 3300049578 | Unclassified | 554 |
| 1292 | Ga0501068_0241582 | 3300049584 | Bacteria | 1150 |
| 1293 | Ga0501073_0477376 | 3300049589 | Unclassified | 862 |
| 1294 | Ga0501075_0944707 | 3300049591 | Bacteria | 655 |
| 1295 | Ga0501076_1793744 | 3300049592 | Unclassified | 503 |
| 1296 | Ga0501209_096532 | 3300049656 | Unclassified | 863 |
| 1297 | Ga0501249_004867 | 3300049679 | Bacteria | 2736 |
| 1298 | Ga0501253_014799 | 3300049683 | Bacteria | 1270 |
| 1299 | Ga0501234_048066 | 3300049707 | Unclassified | 707 |
| 1300 | Ga0501245_162122 | 3300049708 | Bacteria | 502 |
| 1301 | Ga0501079_1311435 | 3300049741 | Bacteria | 570 |
| 1302 | Ga0501080_1377679 | 3300049742 | Bacteria | 602 |
| 1303 | Ga0501267_008906 | 3300049764 | Unclassified | 996 |
| 1304 | Ga0501272_061102 | 3300049769 | Unclassified | 538 |
| 1305 | Ga0501273_004652 | 3300049770 | Bacteria | 1516 |
| 1306 | Ga0501045_0417654 | 3300049824 | Bacteria | 998 |
| 1307 | nmdc:mga0qj67_121666_c1 | 3300050509 | Bacteria | 2112 |
| 1308 | nmdc:mga0qj67_14089_c1 | 3300050509 | Bacteria | 6038 |
| 1309 | nmdc:mga0qj67_177904_c1 | 3300050509 | Bacteria | 1728 |
| 1310 | nmdc:mga06r32_1481659_c1 | 3300050510 | Unclassified | 619 |
| 1311 | nmdc:mga06r32_600579_c1 | 3300050510 | Bacteria | 1071 |
| 1312 | nmdc:mga0n895_1050409_c1 | 3300050512 | Unclassified | 794 |
| 1313 | nmdc:mga0n895_1824489_c1 | 3300050512 | Bacteria | 568 |
| 1314 | nmdc:mga0n895_220586_c1 | 3300050512 | Bacteria | 1925 |
| 1315 | nmdc:mga0n895_278053_c1 | 3300050512 | Bacteria | 1698 |
| 1316 | nmdc:mga0n895_524098_c1 | 3300050512 | Bacteria | 1192 |
| 1317 | nmdc:mga0n895_762099_c1 | 3300050512 | Unclassified | 960 |
| 1318 | nmdc:mga0rr50_1861869_c1 | 3300050513 | Bacteria | 506 |
| 1319 | nmdc:mga0rr50_290616_c1 | 3300050513 | Bacteria | 1366 |
| 1320 | nmdc:mga0rr50_699334_c1 | 3300050513 | Bacteria | 865 |
| 1321 | nmdc:mga0rr50_70160_c1 | 3300050513 | Bacteria | 2670 |
| 1322 | nmdc:mga0rr50_855863_c1 | 3300050513 | Unclassified | 775 |
| 1323 | nmdc:mga08x19_116197_c1 | 3300050514 | Unclassified | 1789 |
| 1324 | nmdc:mga08x19_303409_c1 | 3300050514 | Unclassified | 1109 |
| 1325 | nmdc:mga08x19_425287_c1 | 3300050514 | Bacteria | 933 |
| 1326 | nmdc:mga08x19_73872_c1 | 3300050514 | Unclassified | 2227 |
| 1327 | nmdc:mga08x19_79574_c1 | 3300050514 | Unclassified | 2150 |
| 1328 | nmdc:mga08x19_98938_c1 | 3300050514 | Unclassified | 1933 |
| 1329 | nmdc:mga0a205_1104352_c1 | 3300050515 | Unclassified | 640 |
| 1330 | nmdc:mga0a205_1579910_c1 | 3300050515 | Unclassified | 504 |
| 1331 | Ga0495601_0336345 | 3300053077 | Bacteria | 982 |
| 1332 | Ga0495612_0048071 | 3300053078 | Bacteria | 1749 |
| 1333 | Ga0495612_0055027 | 3300053078 | Unclassified | 1639 |
| 1334 | Ga0495612_0065052 | 3300053078 | Bacteria | 1514 |
| 1335 | Ga0495612_0195584 | 3300053078 | Bacteria | 891 |
| 1336 | Ga0495612_0202831 | 3300053078 | Unclassified | 875 |
| 1337 | Ga0495595_0039308 | 3300053084 | Bacteria | 2158 |
| 1338 | Ga0495619_0152784 | 3300053085 | Bacteria | 1592 |
| 1339 | Ga0495619_0158566 | 3300053085 | Bacteria | 1562 |
| 1340 | Ga0495619_0606066 | 3300053085 | Unclassified | 749 |
| 1341 | Ga0500554_037236 | 3300053102 | Bacteria | 1474 |
| 1342 | Ga0590071_049483 | 3300059421 | Bacteria | 1018 |
| 1343 | Ga0590074_020411 | 3300059423 | Bacteria | 1140 |
| 1344 | Ga0590075_014976 | 3300059424 | Unclassified | 1900 |
| 1345 | Ga0590077_010083 | 3300059426 | Unclassified | 1941 |
| 1346 | Ga0587128_017394 | 3300059630 | Bacteria | 1065 |
| 1347 | Ga0070694_100795702 | |||
| 1348 | rootH2_10019593 | |||
| 1349 | Ga0065707_10312566 | |||
| 1350 | Ga0065707_10424872 | |||
| 1351 | Ga0070658_10090249 | |||
| 1352 | Ga0070658_10243496 | |||
| 1353 | Ga0070676_10097515 | |||
| 1354 | Ga0070676_10126376 | |||
| 1355 | Ga0070676_10501287 | |||
| 1356 | Ga0070683_100254580 | |||
| 1357 | Ga0070683_100255158 | |||
| 1358 | Ga0070683_100377586 | |||
| 1359 | Ga0070683_100585153 | |||
| 1360 | Ga0070683_101044542 | |||
| 1361 | Ga0070683_101081087 | |||
| 1362 | Ga0070683_101333841 | |||
| 1363 | Ga0070683_102150426 | |||
| 1364 | Ga0070690_100139901 | |||
| 1365 | Ga0070690_100167818 | |||
| 1366 | Ga0070690_100853163 | |||
| 1367 | Ga0070670_100243461 | |||
| 1368 | Ga0070670_100266887 | |||
| 1369 | Ga0070670_100324165 | |||
| 1370 | Ga0070670_100814584 | |||
| 1371 | Ga0070670_101115855 | |||
| 1372 | Ga0070677_10139931 | |||
| 1373 | Ga0070677_10850500 | |||
| 1374 | Ga0068869_100255970 | |||
| 1375 | Ga0068869_100358548 | |||
| 1376 | Ga0070666_10102578 | |||
| 1377 | Ga0070666_10149054 | |||
| 1378 | Ga0070666_10558879 | |||
| 1379 | Ga0070666_10719474 | |||
| 1380 | Ga0070680_100172644 | |||
| 1381 | Ga0070680_100438196 | |||
| 1382 | Ga0070680_100799337 | |||
| 1383 | Ga0070680_101678222 | |||
| 1384 | Ga0070682_100158409 | |||
| 1385 | Ga0070682_100437085 | |||
| 1386 | Ga0070682_100443281 | |||
| 1387 | Ga0070682_101471743 | |||
| 1388 | Ga0068868_100196458 | |||
| 1389 | Ga0068868_100278662 | |||
| 1390 | Ga0068868_100595738 | |||
| 1391 | Ga0068868_100976639 | |||
| 1392 | Ga0068868_101425537 | |||
| 1393 | Ga0068868_101688230 | |||
| 1394 | Ga0070660_100067740 | |||
| 1395 | Ga0070660_101272793 | |||
| 1396 | Ga0070689_100088674 | |||
| 1397 | Ga0070689_100595812 | |||
| 1398 | Ga0070689_100614582 | |||
| 1399 | Ga0070689_100783294 | |||
| 1400 | Ga0070689_101083559 | |||
| 1401 | Ga0070689_101484051 | |||
| 1402 | Ga0070689_102225973 | |||
| 1403 | Ga0070691_10073652 | |||
| 1404 | Ga0070691_10283255 | |||
| 1405 | Ga0070687_100117577 | |||
| 1406 | Ga0070687_100227091 | |||
| 1407 | Ga0070687_101486298 | |||
| 1408 | Ga0070661_100305128 | |||
| 1409 | Ga0070661_100671087 | |||
| 1410 | Ga0070692_10021329 | |||
| 1411 | Ga0070692_10081767 | |||
| 1412 | Ga0070668_100375465 | |||
| 1413 | Ga0070668_100910521 | |||
| 1414 | Ga0070669_100165698 | |||
| 1415 | Ga0070669_100256226 | |||
| 1416 | Ga0070675_100162423 | |||
| 1417 | Ga0070675_100782557 | |||
| 1418 | Ga0070671_100207715 | |||
| 1419 | Ga0070671_100218506 | |||
| 1420 | Ga0070671_101863423 | |||
| 1421 | Ga0070674_100844982 | |||
| 1422 | Ga0070674_100895490 | |||
| 1423 | Ga0070674_102022017 | |||
| 1424 | Ga0070673_100200879 | |||
| 1425 | Ga0070673_100408403 | |||
| 1426 | Ga0070673_100453571 | |||
| 1427 | Ga0070673_100526464 | |||
| 1428 | Ga0070688_100067818 | |||
| 1429 | Ga0070688_100605909 | |||
| 1430 | Ga0070688_100949130 | |||
| 1431 | Ga0070688_101079487 | |||
| 1432 | Ga0070688_101113689 | |||
| 1433 | Ga0070688_101116347 | |||
| 1434 | Ga0070659_101053502 | |||
| 1435 | Ga0070659_101806970 | |||
| 1436 | Ga0070667_100385305 | |||
| 1437 | Ga0070667_100632059 | |||
| 1438 | Ga0070667_100877097 | |||
| 1439 | Ga0070667_101873505 | |||
| 1440 | Ga0070703_10023800 | |||
| 1441 | Ga0070709_10179236 | |||
| 1442 | Ga0070709_10302971 | |||
| 1443 | Ga0070709_10398710 | |||
| 1444 | Ga0070709_10479541 | |||
| 1445 | Ga0070709_10652406 | |||
| 1446 | Ga0070709_10732287 | |||
| 1447 | Ga0070714_100106463 | |||
| 1448 | Ga0070714_100315022 | |||
| 1449 | Ga0070714_100587355 | |||
| 1450 | Ga0070714_100718489 | |||
| 1451 | Ga0070714_100731636 | |||
| 1452 | Ga0070713_100088900 | |||
| 1453 | Ga0070713_100095836 | |||
| 1454 | Ga0070713_100104705 | |||
| 1455 | Ga0070713_100219868 | |||
| 1456 | Ga0070713_100265178 | |||
| 1457 | Ga0070713_100311644 | |||
| 1458 | Ga0070713_100688489 | |||
| 1459 | Ga0070713_100832360 | |||
| 1460 | Ga0070710_10016379 | |||
| 1461 | Ga0070710_10090724 | |||
| 1462 | Ga0070710_10103467 | |||
| 1463 | Ga0070710_10919549 | |||
| 1464 | Ga0070701_10302305 | |||
| 1465 | Ga0070711_100077673 | |||
| 1466 | Ga0070711_100094059 | |||
| 1467 | Ga0070711_100100779 | |||
| 1468 | Ga0070711_100120200 | |||
| 1469 | Ga0070711_100242938 | |||
| 1470 | Ga0070711_100286271 | |||
| 1471 | Ga0070711_100317493 | |||
| 1472 | Ga0070711_101074656 | |||
| 1473 | Ga0070700_100122773 | |||
| 1474 | Ga0070700_100256017 | |||
| 1475 | Ga0070700_100379627 | |||
| 1476 | Ga0070700_100559382 | |||
| 1477 | Ga0070694_100139804 | |||
| 1478 | Ga0070694_100154079 | |||
| 1479 | Ga0070694_100358762 | |||
| 1480 | Ga0070694_100676028 | |||
| 1481 | Ga0070708_100786513 | |||
| 1482 | Ga0070663_100663991 | |||
| 1483 | Ga0070678_100180964 | |||
| 1484 | Ga0070678_100224785 | |||
| 1485 | Ga0070662_100604219 | |||
| 1486 | Ga0070662_100770740 | |||
| 1487 | Ga0070681_10239358 | |||
| 1488 | Ga0070681_10277846 | |||
| 1489 | Ga0070681_11131692 | |||
| 1490 | Ga0068867_100117243 | |||
| 1491 | Ga0068867_100198513 | |||
| 1492 | Ga0068867_100215955 | |||
| 1493 | Ga0068867_100225560 | |||
| 1494 | Ga0068867_100236533 | |||
| 1495 | Ga0068867_100290997 | |||
| 1496 | Ga0068867_100564606 | |||
| 1497 | Ga0068867_101854706 | |||
| 1498 | Ga0070685_10106324 | |||
| 1499 | Ga0070685_10265400 | |||
| 1500 | Ga0070685_10310525 | |||
| 1501 | Ga0070706_100249001 | |||
| 1502 | Ga0070706_101328940 | |||
| 1503 | Ga0070706_101612158 | |||
| 1504 | Ga0070707_100133277 | |||
| 1505 | Ga0070707_100202041 | |||
| 1506 | Ga0070707_101692598 | |||
| 1507 | Ga0070698_100030971 | |||
| 1508 | Ga0070698_100105817 | |||
| 1509 | Ga0070699_100243343 | |||
| 1510 | Ga0070699_100394632 | |||
| 1511 | Ga0070699_100943086 | |||
| 1512 | Ga0070679_100153282 | |||
| 1513 | Ga0070679_100175352 | |||
| 1514 | Ga0070679_100269232 | |||
| 1515 | Ga0070679_100640691 | |||
| 1516 | Ga0070684_100144773 | |||
| 1517 | Ga0070684_100171248 | |||
| 1518 | Ga0070684_100491365 | |||
| 1519 | Ga0070684_100662824 | |||
| 1520 | Ga0070697_100145930 | |||
| 1521 | Ga0070697_100581325 | |||
| 1522 | Ga0068853_100309959 | |||
| 1523 | Ga0068853_100765025 | |||
| 1524 | Ga0070672_100189191 | |||
| 1525 | Ga0070672_100942103 | |||
| 1526 | Ga0070686_100152295 | |||
| 1527 | Ga0070686_100220348 | |||
| 1528 | Ga0070686_101303680 | |||
| 1529 | Ga0070686_101895520 | |||
| 1530 | Ga0070695_100039111 | |||
| 1531 | Ga0070695_100646054 | |||
| 1532 | Ga0070695_100935580 | |||
| 1533 | Ga0070696_100806920 | |||
| 1534 | Ga0070693_100064576 | |||
| 1535 | Ga0070665_100617069 | |||
| 1536 | Ga0070704_100185939 | |||
| 1537 | Ga0070704_100319998 | |||
| 1538 | Ga0068855_100159747 | |||
| 1539 | Ga0068855_100238584 | |||
| 1540 | Ga0068855_100337773 | |||
| 1541 | Ga0068855_100513584 | |||
| 1542 | Ga0070664_100256553 | |||
| 1543 | Ga0070664_100784083 | |||
| 1544 | Ga0070664_101719178 | |||
| 1545 | Ga0070664_102323147 | |||
| 1546 | Ga0068857_100097533 | |||
| 1547 | Ga0068857_100220132 | |||
| 1548 | Ga0068857_100572047 | |||
| 1549 | Ga0068857_100899813 | |||
| 1550 | Ga0068857_100990227 | |||
| 1551 | Ga0068857_102330192 | |||
| 1552 | Ga0068857_102383982 | |||
| 1553 | Ga0068854_101440926 | |||
| 1554 | Ga0068856_100405581 | |||
| 1555 | Ga0068856_100511306 | |||
| 1556 | Ga0068856_102250685 | |||
| 1557 | Ga0068856_102662691 | |||
| 1558 | Ga0070702_100085064 | |||
| 1559 | Ga0070702_100701026 | |||
| 1560 | Ga0068852_100275734 | |||
| 1561 | Ga0068852_100356558 | |||
| 1562 | Ga0068859_100190969 | |||
| 1563 | Ga0068859_100198721 | |||
| 1564 | Ga0068859_100228934 | |||
| 1565 | Ga0068859_100408476 | |||
| 1566 | Ga0068864_100088054 | |||
| 1567 | Ga0068864_100179187 | |||
| 1568 | Ga0068864_100188922 | |||
| 1569 | Ga0068864_100431268 | |||
| 1570 | Ga0068864_100966013 | |||
| 1571 | Ga0068864_101218103 | |||
| 1572 | Ga0068866_10092144 | |||
| 1573 | Ga0068866_11453308 | |||
| 1574 | Ga0068861_100135034 | |||
| 1575 | Ga0068861_100907894 | |||
| 1576 | Ga0068861_100915392 | |||
| 1577 | Ga0068861_101106539 | |||
| 1578 | Ga0068851_10436765 | |||
| 1579 | Ga0068870_10228309 | |||
| 1580 | Ga0068870_10273020 | |||
| 1581 | Ga0068870_10428028 | |||
| 1582 | Ga0068870_10533154 | |||
| 1583 | Ga0068870_11165600 | |||
| 1584 | Ga0068863_100148148 | |||
| 1585 | Ga0068863_100219248 | |||
| 1586 | Ga0068863_100322984 | |||
| 1587 | Ga0068863_100473808 | |||
| 1588 | Ga0068863_100672724 | |||
| 1589 | Ga0068863_101059614 | |||
| 1590 | Ga0068858_100257695 | |||
| 1591 | Ga0068858_100287445 | |||
| 1592 | Ga0068858_100420804 | |||
| 1593 | Ga0068858_100866120 | |||
| 1594 | Ga0068858_101098186 | |||
| 1595 | Ga0068858_101226131 | |||
| 1596 | Ga0068858_101314760 | |||
| 1597 | Ga0068858_101362461 | |||
| 1598 | Ga0068858_101389252 | |||
| 1599 | Ga0068860_100035145 | |||
| 1600 | Ga0068860_100199240 | |||
| 1601 | Ga0068860_100310269 | |||
| 1602 | Ga0068860_100682132 | |||
| 1603 | Ga0068860_100932439 | |||
| 1604 | Ga0068860_101039340 | |||
| 1605 | Ga0068860_101216290 | |||
| 1606 | Ga0068860_102076000 | |||
| 1607 | Ga0068860_102568716 | |||
| 1608 | Ga0068860_102685979 | |||
| 1609 | Ga0068862_100203615 | |||
| 1610 | Ga0068862_100432704 | |||
| 1611 | Ga0068862_100645227 | |||
| 1612 | Ga0081455_10101229 | |||
| 1613 | Ga0081540_1033379 | |||
| 1614 | Ga0081540_1066203 | |||
| 1615 | Ga0081539_10073386 | |||
| 1616 | Ga0070717_10027450 | |||
| 1617 | Ga0070717_10099738 | |||
| 1618 | Ga0070717_10193838 | |||
| 1619 | Ga0070717_10377582 | |||
| 1620 | Ga0070717_11038357 | |||
| 1621 | Ga0070717_11177496 | |||
| 1622 | Ga0070717_11183531 | |||
| 1623 | Ga0070717_12004391 | |||
| 1624 | Ga0070715_10063053 | |||
| 1625 | Ga0070715_10138153 | |||
| 1626 | Ga0070715_10911953 | |||
| 1627 | Ga0070716_100129967 | |||
| 1628 | Ga0070712_100150702 | |||
| 1629 | Ga0070712_100187594 | |||
| 1630 | Ga0070712_100579727 | |||
| 1631 | Ga0070712_100873180 | |||
| 1632 | Ga0097621_100111535 | |||
| 1633 | Ga0097621_100230851 | |||
| 1634 | Ga0097621_100858478 | |||
| 1635 | Ga0097621_101472383 | |||
| 1636 | Ga0068871_100186788 | |||
| 1637 | Ga0068871_100202089 | |||
| 1638 | Ga0068871_100221910 | |||
| 1639 | Ga0068871_100237380 | |||
| 1640 | Ga0075430_100006302 | |||
| 1641 | Ga0075430_100174426 | |||
| 1642 | Ga0075431_100260280 | |||
| 1643 | Ga0075433_11466287 | |||
| 1644 | Ga0075433_11605961 | |||
| 1645 | Ga0075433_11720452 | |||
| 1646 | Ga0075434_100186478 | |||
| 1647 | Ga0075434_100360950 | |||
| 1648 | Ga0075434_101075942 | |||
| 1649 | Ga0068865_100070380 | |||
| 1650 | Ga0068865_100154340 | |||
| 1651 | Ga0068865_100191178 | |||
| 1652 | Ga0068865_100203506 | |||
| 1653 | Ga0075436_100056353 | |||
| 1654 | Ga0075436_100088804 | |||
| 1655 | Ga0075436_100107357 | |||
| 1656 | Ga0075436_100165844 | |||
| 1657 | Ga0075436_100740198 | |||
| 1658 | Ga0075436_100814563 | |||
| 1659 | Ga0097620_100190974 | |||
| 1660 | Ga0097620_100198717 | |||
| 1661 | Ga0097620_100228940 | |||
| 1662 | Ga0097620_100408513 | |||
| 1663 | Ga0075435_100199776 | |||
| 1664 | Ga0075435_100249277 | |||
| 1665 | Ga0075435_100460648 | |||
| 1666 | Ga0075435_100766392 | |||
| 1667 | Ga0075435_100770013 | |||
| 1668 | Ga0075435_100902380 | |||
| 1669 | Ga0075435_101825140 | |||
| 1670 | Ga0099794_10280510 | |||
| 1671 | Ga0099794_10381298 | |||
| 1672 | Ga0099794_10630882 | |||
| 1673 | Ga0099795_10112849 | |||
| 1674 | Ga0099795_10382726 | |||
| 1675 | Ga0099795_10652013 | |||
| 1676 | Ga0105240_10165955 | |||
| 1677 | Ga0105240_10239435 | |||
| 1678 | Ga0105240_10418502 | |||
| 1679 | Ga0105240_11347290 | |||
| 1680 | Ga0105240_11726396 | |||
| 1681 | Ga0111539_10318583 | |||
| 1682 | Ga0111539_10483571 | |||
| 1683 | Ga0105245_10114395 | |||
| 1684 | Ga0105245_10293307 | |||
| 1685 | Ga0105245_10803926 | |||
| 1686 | Ga0105247_10085547 | |||
| 1687 | Ga0105247_10366933 | |||
| 1688 | Ga0105247_11292613 | |||
| 1689 | Ga0105247_11487625 | |||
| 1690 | Ga0114129_10866601 | |||
| 1691 | Ga0114129_11606148 | |||
| 1692 | Ga0105243_10800815 | |||
| 1693 | Ga0105243_11760321 | |||
| 1694 | Ga0105243_12179909 | |||
| 1695 | Ga0105243_12589498 | |||
| 1696 | Ga0105241_10024438 | |||
| 1697 | Ga0105241_10496156 | |||
| 1698 | Ga0105241_11072036 | |||
| 1699 | Ga0105241_11340128 | |||
| 1700 | Ga0105242_10046378 | |||
| 1701 | Ga0105242_10368939 | |||
| 1702 | Ga0105242_10377419 | |||
| 1703 | Ga0105242_12496489 | |||
| 1704 | Ga0105248_10220362 | |||
| 1705 | Ga0105248_10265752 | |||
| 1706 | Ga0105248_10290224 | |||
| 1707 | Ga0105248_10385839 | |||
| 1708 | Ga0105248_10397141 | |||
| 1709 | Ga0105248_10407594 | |||
| 1710 | Ga0105248_10415288 | |||
| 1711 | Ga0105248_10455856 | |||
| 1712 | Ga0105248_11486618 | |||
| 1713 | Ga0105248_12238571 | |||
| 1714 | Ga0105248_12544323 | |||
| 1715 | Ga0105237_10096816 | |||
| 1716 | Ga0105237_10200297 | |||
| 1717 | Ga0105237_10600093 | |||
| 1718 | Ga0105237_11127203 | |||
| 1719 | Ga0105237_11149230 | |||
| 1720 | Ga0105237_12109784 | |||
| 1721 | Ga0105237_12190071 | |||
| 1722 | Ga0105237_12208514 | |||
| 1723 | Ga0105237_12345561 | |||
| 1724 | Ga0105238_10677696 | |||
| 1725 | Ga0105238_10882561 | |||
| 1726 | Ga0105238_12457063 | |||
| 1727 | Ga0105238_12911438 | |||
| 1728 | Ga0105249_10282430 | |||
| 1729 | Ga0105249_10295868 | |||
| 1730 | Ga0105249_10346852 | |||
| 1731 | Ga0099796_10019664 | |||
| 1732 | Ga0099796_10078309 | |||
| 1733 | Ga0105239_10173381 | |||
| 1734 | Ga0105239_10174984 | |||
| 1735 | Ga0105239_10209269 | |||
| 1736 | Ga0105239_10250192 | |||
| 1737 | Ga0105239_11447132 | |||
| 1738 | Ga0105239_12977737 | |||
| 1739 | Ga0105246_10137623 | |||
| 1740 | Ga0157313_1047248 | |||
| 1741 | Ga0157338_1055320 | |||
| 1742 | Ga0157373_10141151 | |||
| 1743 | Ga0157373_11001582 | |||
| 1744 | Ga0157371_10119239 | |||
| 1745 | Ga0157370_10163687 | |||
| 1746 | Ga0157370_10185813 | |||
| 1747 | Ga0157370_10260844 | |||
| 1748 | Ga0157370_10457258 | |||
| 1749 | Ga0157370_11079448 | |||
| 1750 | Ga0157369_10076223 | |||
| 1751 | Ga0157369_10311897 | |||
| 1752 | Ga0157369_10638902 | |||
| 1753 | Ga0157374_10057534 | |||
| 1754 | Ga0157374_10179247 | |||
| 1755 | Ga0157374_10286021 | |||
| 1756 | Ga0157374_10939654 | |||
| 1757 | Ga0157378_10035380 | |||
| 1758 | Ga0157378_10041054 | |||
| 1759 | Ga0157378_10174516 | |||
| 1760 | Ga0157378_10200209 | |||
| 1761 | Ga0157378_10221472 | |||
| 1762 | Ga0157378_10240162 | |||
| 1763 | Ga0163162_10135549 | |||
| 1764 | Ga0163162_10298588 | |||
| 1765 | Ga0163162_10306630 | |||
| 1766 | Ga0163162_10358259 | |||
| 1767 | Ga0163162_10361154 | |||
| 1768 | Ga0163162_10738173 | |||
| 1769 | Ga0163162_12634380 | |||
| 1770 | Ga0163162_12847473 | |||
| 1771 | Ga0157372_10045113 | |||
| 1772 | Ga0157372_10172680 | |||
| 1773 | Ga0157372_10347077 | |||
| 1774 | Ga0157372_10521588 | |||
| 1775 | Ga0157372_12570623 | |||
| 1776 | Ga0157375_10217987 | |||
| 1777 | Ga0157375_10240094 | |||
| 1778 | Ga0157375_10344366 | |||
| 1779 | Ga0157375_10951138 | |||
| 1780 | Ga0157375_11066969 | |||
| 1781 | Ga0157375_11803869 | |||
| 1782 | Ga0163163_10043172 | |||
| 1783 | Ga0163163_10154625 | |||
| 1784 | Ga0163163_10162439 | |||
| 1785 | Ga0163163_10313352 | |||
| 1786 | Ga0163163_10383068 | |||
| 1787 | Ga0163163_10396584 | |||
| 1788 | Ga0163163_10553316 | |||
| 1789 | Ga0157380_10467510 | |||
| 1790 | Ga0157380_10557236 | |||
| 1791 | Ga0182008_10199114 | |||
| 1792 | Ga0182008_10395257 | |||
| 1793 | Ga0182008_10407232 | |||
| 1794 | Ga0157377_10075977 | |||
| 1795 | Ga0157377_10534213 | |||
| 1796 | Ga0157379_10140220 | |||
| 1797 | Ga0157379_10261945 | |||
| 1798 | Ga0157379_10386776 | |||
| 1799 | Ga0157379_10585084 | |||
| 1800 | Ga0157379_11159565 | |||
| 1801 | Ga0157376_10110389 | |||
| 1802 | Ga0157376_10111642 | |||
| 1803 | Ga0157376_10200717 | |||
| 1804 | Ga0157376_10276427 | |||
| 1805 | Ga0157376_10495366 | |||
| 1806 | Ga0157376_11111578 | |||
| 1807 | Ga0157376_11760645 | |||
| 1808 | Ga0157376_11822436 | |||
| 1809 | Ga0157376_12100470 | |||
| 1810 | Ga0182007_10036515 | |||
| 1811 | Ga0182007_10094327 | |||
| 1812 | Ga0182007_10095888 | |||
| 1813 | Ga0182007_10366714 | |||
| 1814 | Ga0182005_1200171 | |||
| 1815 | Ga0182005_1225957 | |||
| 1816 | Ga0163161_10137538 | |||
| 1817 | Ga0163161_10540054 | |||
| 1818 | Ga0184603_125222 | |||
| 1819 | Ga0206354_10761836 | |||
| 1820 | Ga0206353_10354678 | |||
| 1821 | Ga0213873_10017049 | |||
| 1822 | Ga0213873_10093100 | |||
| 1823 | Ga0213874_10067698 | |||
| 1824 | Ga0213874_10298762 | |||
| 1825 | Ga0213874_10358174 | |||
| 1826 | Ga0213876_10066954 | |||
| 1827 | Ga0213876_10077757 | |||
| 1828 | Ga0213876_10221270 | |||
| 1829 | Ga0213876_10271027 | |||
| 1830 | Ga0213875_10012748 | |||
| 1831 | Ga0213875_10042763 | |||
| 1832 | Ga0213875_10173169 | |||
| 1833 | Ga0213871_10271881 | |||
| 1834 | Ga0224570_104894 | |||
| 1835 | Ga0224570_113752 | |||
| 1836 | Ga0224569_108471 | |||
| 1837 | Ga0224571_107668 | |||
| 1838 | Ga0224571_108736 | |||
| 1839 | Ga0224572_1007890 | |||
| 1840 | Ga0228598_1004219 | |||
| 1841 | Ga0228598_1029259 | |||
| 1842 | Ga0228598_1034620 | |||
| 1843 | Ga0228598_1136222 | |||
| 1844 | Ga0207697_10090668 | |||
| 1845 | Ga0207697_10322497 | |||
| 1846 | Ga0207653_10032260 | |||
| 1847 | Ga0207682_10159911 | |||
| 1848 | Ga0207692_10072863 | |||
| 1849 | Ga0207692_10089729 | |||
| 1850 | Ga0207692_10103590 | |||
| 1851 | Ga0207692_10105018 | |||
| 1852 | Ga0207692_10106130 | |||
| 1853 | Ga0207692_10397185 | |||
| 1854 | Ga0207710_10150651 | |||
| 1855 | Ga0207688_10094492 | |||
| 1856 | Ga0207688_10514730 | |||
| 1857 | Ga0207680_10129543 | |||
| 1858 | Ga0207680_10151714 | |||
| 1859 | Ga0207647_10054704 | |||
| 1860 | Ga0207685_10061599 | |||
| 1861 | Ga0207685_10109511 | |||
| 1862 | Ga0207685_10693394 | |||
| 1863 | Ga0207699_10382123 | |||
| 1864 | Ga0207699_10431022 | |||
| 1865 | Ga0207699_10489725 | |||
| 1866 | Ga0207699_10495627 | |||
| 1867 | Ga0207699_10501495 | |||
| 1868 | Ga0207699_10581462 | |||
| 1869 | Ga0207645_10103583 | |||
| 1870 | Ga0207645_10470070 | |||
| 1871 | Ga0207645_10994169 | |||
| 1872 | Ga0207643_10911574 | |||
| 1873 | Ga0207705_10095106 | |||
| 1874 | Ga0207684_10221037 | |||
| 1875 | Ga0207684_10740372 | |||
| 1876 | Ga0207684_10905622 | |||
| 1877 | Ga0207654_10132791 | |||
| 1878 | Ga0207707_10182385 | |||
| 1879 | Ga0207707_10363851 | |||
| 1880 | Ga0207707_10967658 | |||
| 1881 | Ga0207695_10012851 | |||
| 1882 | Ga0207695_10218747 | |||
| 1883 | Ga0207671_10205132 | |||
| 1884 | Ga0207671_11112975 | |||
| 1885 | Ga0207671_11163758 | |||
| 1886 | Ga0207693_10172230 | |||
| 1887 | Ga0207693_10192218 | |||
| 1888 | Ga0207693_10256043 | |||
| 1889 | Ga0207693_10901237 | |||
| 1890 | Ga0207663_10056288 | |||
| 1891 | Ga0207663_10131272 | |||
| 1892 | Ga0207663_10145699 | |||
| 1893 | Ga0207663_10161843 | |||
| 1894 | Ga0207663_10161878 | |||
| 1895 | Ga0207663_10174818 | |||
| 1896 | Ga0207663_10187897 | |||
| 1897 | Ga0207663_10331073 | |||
| 1898 | Ga0207663_10930763 | |||
| 1899 | Ga0207660_10194751 | |||
| 1900 | Ga0207660_10805380 | |||
| 1901 | Ga0207660_10850562 | |||
| 1902 | Ga0207662_10115135 | |||
| 1903 | Ga0207662_10636562 | |||
| 1904 | Ga0207662_10800955 | |||
| 1905 | Ga0207657_10511267 | |||
| 1906 | Ga0207652_10258082 | |||
| 1907 | Ga0207652_10388672 | |||
| 1908 | Ga0207652_10646151 | |||
| 1909 | Ga0207652_10717008 | |||
| 1910 | Ga0207646_10086816 | |||
| 1911 | Ga0207646_10142852 | |||
| 1912 | Ga0207646_11568551 | |||
| 1913 | Ga0207681_10134340 | |||
| 1914 | Ga0207650_10220786 | |||
| 1915 | Ga0207650_10282534 | |||
| 1916 | Ga0207650_10965102 | |||
| 1917 | Ga0207659_10167651 | |||
| 1918 | Ga0207659_10774877 | |||
| 1919 | Ga0207687_10179725 | |||
| 1920 | Ga0207700_10173950 | |||
| 1921 | Ga0207700_10189154 | |||
| 1922 | Ga0207700_10216343 | |||
| 1923 | Ga0207700_10237311 | |||
| 1924 | Ga0207700_10255638 | |||
| 1925 | Ga0207700_10309765 | |||
| 1926 | Ga0207700_10355011 | |||
| 1927 | Ga0207700_10700203 | |||
| 1928 | Ga0207700_10711809 | |||
| 1929 | Ga0207700_11570425 | |||
| 1930 | Ga0207664_10098366 | |||
| 1931 | Ga0207664_10697174 | |||
| 1932 | Ga0207664_10880503 | |||
| 1933 | Ga0207664_11981211 | |||
| 1934 | Ga0207644_10150883 | |||
| 1935 | Ga0207644_10721418 | |||
| 1936 | Ga0207644_11430460 | |||
| 1937 | Ga0207644_11729115 | |||
| 1938 | Ga0207690_10125894 | |||
| 1939 | Ga0207706_10204782 | |||
| 1940 | Ga0207686_10161402 | |||
| 1941 | Ga0207709_10120476 | |||
| 1942 | Ga0207709_10382840 | |||
| 1943 | Ga0207709_11558753 | |||
| 1944 | Ga0207709_11749410 | |||
| 1945 | Ga0207670_10216299 | |||
| 1946 | Ga0207670_10550316 | |||
| 1947 | Ga0207670_11727573 | |||
| 1948 | Ga0207669_11228613 | |||
| 1949 | Ga0207704_10167141 | |||
| 1950 | Ga0207704_10266330 | |||
| 1951 | Ga0207704_10627340 | |||
| 1952 | Ga0207665_10338198 | |||
| 1953 | Ga0207691_10217312 | |||
| 1954 | Ga0207691_11738066 | |||
| 1955 | Ga0207711_10229053 | |||
| 1956 | Ga0207711_10672889 | |||
| 1957 | Ga0207711_11187286 | |||
| 1958 | Ga0207711_11437720 | |||
| 1959 | Ga0207689_10206997 | |||
| 1960 | Ga0207689_10334417 | |||
| 1961 | Ga0207689_10369728 | |||
| 1962 | Ga0207689_10403125 | |||
| 1963 | Ga0207689_11225325 | |||
| 1964 | Ga0207661_10200988 | |||
| 1965 | Ga0207661_10210949 | |||
| 1966 | Ga0207661_10258097 | |||
| 1967 | Ga0207661_10498001 | |||
| 1968 | Ga0207661_11450949 | |||
| 1969 | Ga0207661_11781291 | |||
| 1970 | Ga0207679_10469349 | |||
| 1971 | Ga0207679_11680737 | |||
| 1972 | Ga0207667_10075615 | |||
| 1973 | Ga0207667_10237660 | |||
| 1974 | Ga0207667_10238674 | |||
| 1975 | Ga0207651_10668389 | |||
| 1976 | Ga0207651_10727106 | |||
| 1977 | Ga0207651_11654854 | |||
| 1978 | Ga0207712_10318697 | |||
| 1979 | Ga0207712_10588512 | |||
| 1980 | Ga0207712_11392017 | |||
| 1981 | Ga0207712_11883393 | |||
| 1982 | Ga0207668_10344512 | |||
| 1983 | Ga0207668_10828868 | |||
| 1984 | Ga0207640_10548130 | |||
| 1985 | Ga0207640_10817922 | |||
| 1986 | Ga0207640_11681344 | |||
| 1987 | Ga0207658_10231958 | |||
| 1988 | Ga0207658_10530336 | |||
| 1989 | Ga0207658_10793658 | |||
| 1990 | Ga0207658_11673567 | |||
| 1991 | Ga0207677_10358786 | |||
| 1992 | Ga0207677_10606846 | |||
| 1993 | Ga0207703_10102945 | |||
| 1994 | Ga0207703_10184207 | |||
| 1995 | Ga0207703_10523819 | |||
| 1996 | Ga0207703_11538728 | |||
| 1997 | Ga0207703_12051252 | |||
| 1998 | Ga0207703_12086083 | |||
| 1999 | Ga0207639_10129270 | |||
| 2000 | Ga0207639_10286271 | |||
| 2001 | Ga0207678_10168121 | |||
| 2002 | Ga0207708_10091441 | |||
| 2003 | Ga0207708_10444485 | |||
| 2004 | Ga0207702_10524462 | |||
| 2005 | Ga0207702_11902280 | |||
| 2006 | Ga0207641_10105703 | |||
| 2007 | Ga0207641_10159008 | |||
| 2008 | Ga0207641_11089325 | |||
| 2009 | Ga0207641_11132234 | |||
| 2010 | Ga0207641_11504366 | |||
| 2011 | Ga0207641_11559372 | |||
| 2012 | Ga0207641_11762497 | |||
| 2013 | Ga0207648_10106944 | |||
| 2014 | Ga0207648_10210151 | |||
| 2015 | Ga0207648_10236828 | |||
| 2016 | Ga0207648_10275173 | |||
| 2017 | Ga0207648_10383847 | |||
| 2018 | Ga0207676_10033728 | |||
| 2019 | Ga0207676_10052499 | |||
| 2020 | Ga0207676_10229537 | |||
| 2021 | Ga0207676_10238311 | |||
| 2022 | Ga0207676_10805840 | |||
| 2023 | Ga0207676_10956029 | |||
| 2024 | Ga0207676_11513022 | |||
| 2025 | Ga0207674_10038672 | |||
| 2026 | Ga0207674_10094859 | |||
| 2027 | Ga0207674_10254144 | |||
| 2028 | Ga0207674_10528809 | |||
| 2029 | Ga0207674_11324542 | |||
| 2030 | Ga0207675_100117114 | |||
| 2031 | Ga0207675_100157607 | |||
| 2032 | Ga0207675_100838518 | |||
| 2033 | Ga0207683_10216291 | |||
| 2034 | Ga0207683_10250653 | |||
| 2035 | Ga0207683_10478754 | |||
| 2036 | Ga0209984_1069922 | |||
| 2037 | Ga0207428_10280518 | |||
| 2038 | Ga0265358_102348 | |||
| 2039 | Ga0265357_1002150 | |||
| 2040 | Ga0268266_10327005 | |||
| 2041 | Ga0268266_10742230 | |||
| 2042 | Ga0268265_10202966 | |||
| 2043 | Ga0268265_10976886 | |||
| 2044 | Ga0268265_12181259 | |||
| 2045 | Ga0268264_10048894 | |||
| 2046 | Ga0268264_10494169 | |||
| 2047 | Ga0268264_10887513 | |||
| 2048 | Ga0265337_1127848 | |||
| 2049 | Ga0265326_10154306 | |||
| 2050 | Ga0265326_10179234 | |||
| 2051 | Ga0265334_10045646 | |||
| 2052 | Ga0265318_10019789 | |||
| 2053 | Ga0265318_10347926 | |||
| 2054 | Ga0265338_10081582 | |||
| 2055 | Ga0265324_10046047 | |||
| 2056 | Ga0265763_1000974 | |||
| 2057 | Ga0265763_1014950 | |||
| 2058 | Ga0265770_1025376 | |||
| 2059 | Ga0265773_1007507 | |||
| 2060 | Ga0265773_1026540 | |||
| 2061 | Ga0265773_1030272 | |||
| 2062 | Ga0265760_10029909 | |||
| 2063 | Ga0265760_10048933 | |||
| 2064 | Ga0265332_10045225 | |||
| 2065 | Ga0265320_10023992 | |||
| 2066 | Ga0265320_10197441 | |||
| 2067 | Ga0265325_10021188 | |||
| 2068 | Ga0265325_10036381 | |||
| 2069 | Ga0265325_10087364 | |||
| 2070 | Ga0265325_10361498 | |||
| 2071 | Ga0265329_10036623 | |||
| 2072 | Ga0265329_10039944 | |||
| 2073 | Ga0265340_10018462 | |||
| 2074 | Ga0265340_10056110 | |||
| 2075 | Ga0265340_10288567 | |||
| 2076 | Ga0265339_10089387 | |||
| 2077 | Ga0265339_10202452 | |||
| 2078 | Ga0265339_10419510 | |||
| 2079 | Ga0265331_10008223 | |||
| 2080 | Ga0265331_10047061 | |||
| 2081 | Ga0265331_10066113 | |||
| 2082 | Ga0265316_10071272 | |||
| 2083 | Ga0265316_10111892 | |||
| 2084 | Ga0265316_10158251 | |||
| 2085 | Ga0265316_10179733 | |||
| 2086 | Ga0265316_10317869 | |||
| 2087 | Ga0265316_10769562 | |||
| 2088 | Ga0307513_10503864 | |||
| 2089 | Ga0307509_10192877 | |||
| 2090 | Ga0307408_100171742 | |||
| 2091 | Ga0307408_101718523 | |||
| 2092 | Ga0307408_102478803 | |||
| 2093 | Ga0265313_10067889 | |||
| 2094 | Ga0265313_10072462 | |||
| 2095 | Ga0265313_10152807 | |||
| 2096 | Ga0265313_10232636 | |||
| 2097 | Ga0316579_10200400 | |||
| 2098 | Ga0265314_10091281 | |||
| 2099 | Ga0265314_10104417 | |||
| 2100 | Ga0265314_10277548 | |||
| 2101 | Ga0265342_10045669 | |||
| 2102 | Ga0265342_10103776 | |||
| 2103 | Ga0265342_10109150 | |||
| 2104 | Ga0265342_10327864 | |||
| 2105 | Ga0316576_10865741 | |||
| 2106 | Ga0316578_10297407 | |||
| 2107 | Ga0316578_10384034 | |||
| 2108 | Ga0307405_10850155 | |||
| 2109 | Ga0307413_10205119 | |||
| 2110 | Ga0307406_10190468 | |||
| 2111 | Ga0307416_103445736 | |||
| 2112 | Ga0307414_10268243 | |||
| 2113 | Ga0307415_100842179 | |||
| 2114 | Ga0307415_101204404 | |||
| 2115 | Ga0316583_10048061 | |||
| 2116 | Ga0316585_10152259 | |||
| 2117 | Ga0316580_10236608 | |||
| 2118 | Ga0373930_0178518 | |||
| 2119 | Ga0373948_0006590 | |||
| 2120 | Ga0373958_0018314 | |||
| 2121 | Ga0373926_0029752 | |||
| 2122 | Ga0373926_0058993 | |||
| 2123 | Ga0373926_0169953 | |||
| 2124 | Ga0373926_0305979 | |||
| 2125 | Ga0373926_0417452 | |||
| 2126 | Ga0373928_0031764 | |||
| 2127 | Ga0373934_0056287 | |||
| 2128 | Ga0373934_0120260 | |||
| 2129 | Ga0373934_0214321 | |||
| 2130 | Ga0373934_0403362 | |||
| 2131 | Ga0373940_0017912 | |||
| 2132 | Ga0373940_0122140 | |||
| 2133 | Ga0373940_0261451 | |||
| 2134 | Ga0373944_0034547 | |||
| 2135 | Ga0373944_0053332 | |||
| 2136 | Ga0373944_0379762 | |||
| 2137 | Ga0373951_0024048 | |||
| 2138 | Ga0373923_0050163 | |||
| 2139 | Ga0373923_0103177 | |||
| 2140 | Ga0373923_0215028 | |||
| 2141 | Ga0373923_0334022 | |||
| 2142 | Ga0373936_0035029 | |||
| 2143 | Ga0373936_0047428 | |||
| 2144 | Ga0373936_0052791 | |||
| 2145 | Ga0373936_0071750 | |||
| 2146 | Ga0373939_0023225 | |||
| 2147 | Ga0373939_0480420 | |||
| 2148 | Ga0373941_0360454 | |||
| 2149 | Ga0373945_0032406 | |||
| 2150 | Ga0373945_0042883 | |||
| 2151 | Ga0373945_0135124 | |||
| 2152 | Ga0373945_0271003 | |||
| 2153 | Ga0373945_0288544 | |||
| 2154 | Ga0373953_0101957 | |||
| 2155 | Ga0373953_0248117 | |||
| 2156 | Ga0373954_0058937 | |||
| 2157 | Ga0373954_0067001 | |||
| 2158 | Ga0373954_0301776 | |||
| 2159 | Ga0373954_0302306 | |||
| 2160 | Ga0373954_0313587 | |||
| 2161 | Ga0373956_0062666 | |||
| 2162 | Ga0373957_0036225 | |||
| 2163 | Ga0373957_0063014 | |||
| 2164 | Ga0373957_0477088 | |||
| 2165 | Ga0373960_0169024 | |||
| 2166 | Ga0373943_0005342 | |||
| 2167 | Ga0373943_0062330 | |||
| 2168 | Ga0373943_0085884 | |||
| 2169 | Ga0373943_0132596 | |||
| 2170 | Ga0373943_0280747 | |||
| 2171 | Ga0373943_0771736 | |||
| 2172 | Ga0373946_0045696 | |||
| 2173 | Ga0373946_0050571 | |||
| 2174 | Ga0373946_0073382 | |||
| 2175 | Ga0373946_0084732 | |||
| 2176 | Ga0373946_0458532 | |||
| 2177 | Ga0373955_0073777 | |||
| 2178 | Ga0373955_0183084 | |||
| 2179 | Ga0373955_0279897 | |||
| 2180 | Ga0373955_0437462 | |||
| 2181 | Ga0373955_0927482 | |||
| 2182 | Ga0373942_0205821 | |||
| 2183 | Ga0373961_0027719 | |||
| 2184 | Ga0373961_0354585 | |||
| 2185 | Ga0373961_0420051 | |||
| 2186 | Ga0373962_0036670 | |||
| 2187 | Ga0316574_0497551 | |||
| 2188 | Ga0373924_0015548 | |||
| 2189 | Ga0373924_0043117 | |||
| 2190 | Ga0373924_0239526 | |||
| 2191 | Ga0373924_0265291 | |||
| 2192 | Ga0373931_0289044 | |||
| 2193 | Ga0373935_0038850 | |||
| 2194 | Ga0373935_0140958 | |||
| 2195 | Ga0373935_0142606 | |||
| 2196 | Ga0373935_0159068 | |||
| 2197 | Ga0373935_0165808 | |||
| 2198 | Ga0373935_0425638 | |||
| 2199 | Ga0373935_0883003 | |||
| 2200 | Ga0373935_0941090 | |||
| 2201 | Ga0373935_1311400 | |||
| 2202 | Ga0373935_1419196 | |||
| 2203 | Ga0373927_0042204 | |||
| 2204 | Ga0373927_0078118 | |||
| 2205 | Ga0373927_0101162 | |||
| 2206 | Ga0373927_0173311 | |||
| 2207 | Ga0373927_0230975 | |||
| 2208 | Ga0373927_0366855 | |||
| 2209 | Ga0373927_0386135 | |||
| 2210 | Ga0373927_0569199 | |||
| 2211 | Ga0373927_1152233 | |||
| 2212 | Ga0373927_1160304 | |||
| 2213 | Ga0373933_0134213 | |||
| 2214 | Ga0373933_0150704 | |||
| 2215 | Ga0373933_0384438 | |||
| 2216 | Ga0373933_0480877 | |||
| 2217 | Ga0373933_0552533 | |||
| 2218 | Ga0373933_0683348 | |||
| 2219 | Ga0373947_0063771 | |||
| 2220 | Ga0373947_0063831 | |||
| 2221 | Ga0373947_0092940 | |||
| 2222 | Ga0373947_0097758 | |||
| 2223 | Ga0373947_0361164 | |||
| 2224 | Ga0373947_0514809 | |||
| 2225 | Ga0373947_0621719 | |||
| 2226 | Ga0373947_0772279 | |||
| 2227 | Ga0373947_0831491 | |||
| 2228 | Ga0373947_1066726 | |||
| 2229 | Ga0373937_0091444 | |||
| 2230 | Ga0373937_0182915 | |||
| 2231 | Ga0373937_0206236 | |||
| 2232 | Ga0373937_0257770 | |||
| 2233 | Ga0373937_0303411 | |||
| 2234 | Ga0373937_0488148 | |||
| 2235 | Ga0373937_0828510 | |||
| 2236 | Ga0316582_0441920 | |||
| 2237 | Ga0316584_0159185 | |||
| 2238 | Ga0373925_0023520 | |||
| 2239 | Ga0373925_0125885 | |||
| 2240 | Ga0373925_0164838 | |||
| 2241 | Ga0373925_0182834 | |||
| 2242 | Ga0373925_0211597 | |||
| 2243 | Ga0373925_0397770 | |||
| 2244 | Ga0373925_0475814 | |||
| 2245 | Ga0373925_0617573 | |||
| 2246 | Ga0373925_0725810 | |||
| 2247 | Ga0373925_0833130 | |||
| 2248 | Ga0373925_1313273 | |||
| 2249 | Ga0395899_0552526 | |||
| 2250 | Ga0395900_0285917 | |||
| 2251 | Ga0395900_1350078 | |||
| 2252 | Ga0395898_0320593 | |||
| 2253 | Ga0395898_0332583 | |||
| 2254 | Ga0395898_0582691 | |||
| 2255 | Ga0436364_0189323 | |||
| 2256 | Ga0436364_0216034 | |||
| 2257 | Ga0436364_0297553 | |||
| 2258 | Ga0436364_0605402 | |||
| 2259 | Ga0436364_0916375 | |||
| 2260 | Ga0436364_1110612 | |||
| 2261 | Ga0436364_1355258 | |||
| 2262 | Ga0395901_0197385 | |||
| 2263 | Ga0395901_0301739 | |||
| 2264 | Ga0395901_0797814 | |||
| 2265 | Ga0242419_001291 | |||
| 2266 | Ga0242422_01521 | |||
| 2267 | Ga0242420_012461 | |||
| 2268 | Ga0436365_0373323 | |||
| 2269 | Ga0436365_0757888 | |||
| 2270 | Ga0436365_0858377 | |||
| 2271 | Ga0436365_0870917 | |||
| 2272 | Ga0436365_1169571 | |||
| 2273 | Ga0436365_1558697 | |||
| 2274 | Ga0436365_1597936 | |||
| 2275 | Ga0436365_1868933 | |||
| 2276 | Ga0436360_1050603 | |||
| 2277 | Ga0436360_1296915 | |||
| 2278 | Ga0436361_0024304 | |||
| 2279 | Ga0436361_1045206 | |||
| 2280 | Ga0436363_0200572 | |||
| 2281 | Ga0436363_0284012 | |||
| 2282 | Ga0436363_0308973 | |||
| 2283 | Ga0436363_0385728 | |||
| 2284 | Ga0436363_0769610 | |||
| 2285 | Ga0436363_0873113 | |||
| 2286 | Ga0436363_1032696 | |||
| 2287 | Ga0436363_1288498 | |||
| 2288 | Ga0436363_1426428 | |||
| 2289 | Ga0436363_1481309 | |||
| 2290 | Ga0436362_0348216 | |||
| 2291 | Ga0436362_0529678 | |||
| 2292 | Ga0436362_0643801 | |||
| 2293 | Ga0436362_0663136 | |||
| 2294 | Ga0436362_0813421 | |||
| 2295 | Ga0436362_0848735 | |||
| 2296 | Ga0451804_0644598 | |||
| 2297 | Ga0439433_0046205 | |||
| 2298 | Ga0439457_048269 | |||
| 2299 | Ga0450923_161943 | |||
| 2300 | Ga0439464_0139531 | |||
| 2301 | Ga0439464_0280669 | |||
| 2302 | Ga0451577_0868423 | |||
| 2303 | Ga0466969_0520089 | |||
| 2304 | Ga0453683_0790607 | |||
| 2305 | Ga0466963_0138162 | |||
| 2306 | Ga0466963_0259175 | |||
| 2307 | Ga0453684_0140846 | |||
| 2308 | Ga0453684_0826314 | |||
| 2309 | Ga0466971_0298573 | |||
| 2310 | Ga0466971_0590366 | |||
| 2311 | Ga0466968_0304306 | |||
| 2312 | Ga0466957_0133467 | |||
| 2313 | Ga0466957_0182135 | |||
| 2314 | Ga0466959_0361644 | |||
| 2315 | Ga0451576_0211567 | |||
| 2316 | Ga0451576_0357362 | |||
| 2317 | Ga0451576_0365777 | |||
| 2318 | Ga0451576_0828597 | |||
| 2319 | Ga0451576_2547565 | |||
| 2320 | Ga0466958_0149509 | |||
| 2321 | Ga0466967_0042504 | |||
| 2322 | Ga0466967_0168409 | |||
| 2323 | Ga0466967_0279700 | |||
| 2324 | Ga0466967_2430617 | |||
| 2325 | Ga0495617_237996 | |||
| 2326 | Ga0495592_0094298 | |||
| 2327 | Ga0495592_0267364 | |||
| 2328 | Ga0495603_0066587 | |||
| 2329 | Ga0495603_0843651 | |||
| 2330 | Ga0495590_0350340 | |||
| 2331 | Ga0495590_0358401 | |||
| 2332 | Ga0495629_0126783 | |||
| 2333 | Ga0495629_0141150 | |||
| 2334 | Ga0495629_0143117 | |||
| 2335 | Ga0495629_0152793 | |||
| 2336 | Ga0495641_0168254 | |||
| 2337 | Ga0495641_0213794 | |||
| 2338 | Ga0495651_0111537 | |||
| 2339 | Ga0495651_0210093 | |||
| 2340 | Ga0495651_0728396 | |||
| 2341 | Ga0495653_0066192 | |||
| 2342 | Ga0495653_0689601 | |||
| 2343 | Ga0495580_0052476 | |||
| 2344 | Ga0495580_0054093 | |||
| 2345 | Ga0495580_0102907 | |||
| 2346 | Ga0495580_0121886 | |||
| 2347 | Ga0495580_0131554 | |||
| 2348 | Ga0495580_0141809 | |||
| 2349 | Ga0495580_0157296 | |||
| 2350 | Ga0495580_0218089 | |||
| 2351 | Ga0495580_0253203 | |||
| 2352 | Ga0495580_0264266 | |||
| 2353 | Ga0495580_0335785 | |||
| 2354 | Ga0495580_0814665 | |||
| 2355 | Ga0495582_0042775 | |||
| 2356 | Ga0495582_0045165 | |||
| 2357 | Ga0495582_0068163 | |||
| 2358 | Ga0495582_0071986 | |||
| 2359 | Ga0495582_0191039 | |||
| 2360 | Ga0495582_0532189 | |||
| 2361 | Ga0495582_0786795 | |||
| 2362 | Ga0495582_0853634 | |||
| 2363 | Ga0495605_0069413 | |||
| 2364 | Ga0495639_0037624 | |||
| 2365 | Ga0495639_0043140 | |||
| 2366 | Ga0495639_0081466 | |||
| 2367 | Ga0495639_0083105 | |||
| 2368 | Ga0495662_0059571 | |||
| 2369 | Ga0495662_0064548 | |||
| 2370 | Ga0495662_0066294 | |||
| 2371 | Ga0495662_0074720 | |||
| 2372 | Ga0495662_0098760 | |||
| 2373 | Ga0495664_0064716 | |||
| 2374 | Ga0495664_0081231 | |||
| 2375 | Ga0495664_0088561 | |||
| 2376 | Ga0495664_0101495 | |||
| 2377 | Ga0495664_0130260 | |||
| 2378 | Ga0495664_0257313 | |||
| 2379 | Ga0495664_0401275 | |||
| 2380 | Ga0495664_0844265 | |||
| 2381 | Ga0495664_0847177 | |||
| 2382 | Ga0495585_0078300 | |||
| 2383 | Ga0495585_0619685 | |||
| 2384 | Ga0495594_0058463 | |||
| 2385 | Ga0495594_0062157 | |||
| 2386 | Ga0495594_0068756 | |||
| 2387 | Ga0495596_0045016 | |||
| 2388 | Ga0495607_0276234 | |||
| 2389 | Ga0495583_0057899 | |||
| 2390 | Ga0495608_0112346 | |||
| 2391 | Ga0495608_0141485 | |||
| 2392 | Ga0495608_0472534 | |||
| 2393 | Ga0495618_0094776 | |||
| 2394 | Ga0495618_0143918 | |||
| 2395 | Ga0495618_0516528 | |||
| 2396 | Ga0495618_0556176 | |||
| 2397 | Ga0495628_0022304 | |||
| 2398 | Ga0495628_0175452 | |||
| 2399 | Ga0495628_0180410 | |||
| 2400 | Ga0495628_0284396 | |||
| 2401 | Ga0495628_0529911 | |||
| 2402 | Ga0495628_1160422 | |||
| 2403 | Ga0495630_0066075 | |||
| 2404 | Ga0495630_0068196 | |||
| 2405 | Ga0495630_0116229 | |||
| 2406 | Ga0495630_0121282 | |||
| 2407 | Ga0495630_0157700 | |||
| 2408 | Ga0495630_0187858 | |||
| 2409 | Ga0495630_0212395 | |||
| 2410 | Ga0495630_0558737 | |||
| 2411 | Ga0495644_0034145 | |||
| 2412 | Ga0495663_0007870 | |||
| 2413 | Ga0495666_0041955 | |||
| 2414 | Ga0495666_0080027 | |||
| 2415 | Ga0495666_0089989 | |||
| 2416 | Ga0495666_0284374 | |||
| 2417 | Ga0495666_0451976 | |||
| 2418 | Ga0495642_0014004 | |||
| 2419 | Ga0495642_0573705 | |||
| 2420 | Ga0495652_0130044 | |||
| 2421 | Ga0495652_0149958 | |||
| 2422 | Ga0495652_0289633 | |||
| 2423 | Ga0495654_0063672 | |||
| 2424 | Ga0495665_0008900 | |||
| 2425 | Ga0495665_0028148 | |||
| 2426 | Ga0495665_0048843 | |||
| 2427 | Ga0495665_0086022 | |||
| 2428 | Ga0495665_0091930 | |||
| 2429 | Ga0495665_0113354 | |||
| 2430 | Ga0495665_0130349 | |||
| 2431 | Ga0495665_0317673 | |||
| 2432 | Ga0495640_0097626 | |||
| 2433 | Ga0495640_0112510 | |||
| 2434 | Ga0495640_0127227 | |||
| 2435 | Ga0495640_0152977 | |||
| 2436 | Ga0495640_0167841 | |||
| 2437 | Ga0495640_0168245 | |||
| 2438 | Ga0495640_0623349 | |||
| 2439 | Ga0495640_0731159 | |||
| 2440 | Ga0495586_0059881 | |||
| 2441 | Ga0495586_0060754 | |||
| 2442 | Ga0495586_0091334 | |||
| 2443 | Ga0495586_0108047 | |||
| 2444 | Ga0495586_0206529 | |||
| 2445 | Ga0495586_0255388 | |||
| 2446 | Ga0495586_0346835 | |||
| 2447 | Ga0495586_0429147 | |||
| 2448 | Ga0495586_0716733 | |||
| 2449 | Ga0495587_0037147 | |||
| 2450 | Ga0495587_0194590 | |||
| 2451 | Ga0495587_0380507 | |||
| 2452 | Ga0495598_0022584 | |||
| 2453 | Ga0495609_0160794 | |||
| 2454 | Ga0495621_0034996 | |||
| 2455 | Ga0495645_0117652 | |||
| 2456 | Ga0495645_0235435 | |||
| 2457 | Ga0495645_0254241 | |||
| 2458 | Ga0495645_0524353 | |||
| 2459 | Ga0495645_0537120 | |||
| 2460 | Ga0495622_0058232 | |||
| 2461 | Ga0495622_0065059 | |||
| 2462 | Ga0495633_0095586 | |||
| 2463 | Ga0495633_0503149 | |||
| 2464 | Ga0495667_0122419 | |||
| 2465 | Ga0495667_0388113 | |||
| 2466 | Ga0495667_0539059 | |||
| 2467 | Ga0495656_0069228 | |||
| 2468 | Ga0495668_0096097 | |||
| 2469 | Ga0495634_0102272 | |||
| 2470 | Ga0495634_0109809 | |||
| 2471 | Ga0495634_0147535 | |||
| 2472 | Ga0495634_0154341 | |||
| 2473 | Ga0495634_0208912 | |||
| 2474 | Ga0495634_0316719 | |||
| 2475 | Ga0495611_0486806 | |||
| 2476 | Ga0495635_0091420 | |||
| 2477 | Ga0495635_0092632 | |||
| 2478 | Ga0495635_0114213 | |||
| 2479 | Ga0495635_0117323 | |||
| 2480 | Ga0495635_0136669 | |||
| 2481 | Ga0495635_0154984 | |||
| 2482 | Ga0495635_0547100 | |||
| 2483 | Ga0495635_0704608 | |||
| 2484 | Ga0495635_0729387 | |||
| 2485 | Ga0495659_0035665 | |||
| 2486 | Ga0495661_0100522 | |||
| 2487 | Ga0495588_0189835 | |||
| 2488 | Ga0495588_0604549 | |||
| 2489 | Ga0495588_0680707 | |||
| 2490 | Ga0495657_0102608 | |||
| 2491 | Ga0495657_0121555 | |||
| 2492 | Ga0495657_0182336 | |||
| 2493 | Ga0495657_0575311 | |||
| 2494 | Ga0495599_0039898 | |||
| 2495 | Ga0495599_0193726 | |||
| 2496 | Ga0495599_0373695 | |||
| 2497 | Ga0495599_0562196 | |||
| 2498 | Ga0495623_0110354 | |||
| 2499 | Ga0495646_0004591 | |||
| 2500 | Ga0495646_0086981 | |||
| 2501 | Ga0495646_0097564 | |||
| 2502 | Ga0495647_0056750 | |||
| 2503 | Ga0495647_0078238 | |||
| 2504 | Ga0495647_0196414 | |||
| 2505 | Ga0495658_0077958 | |||
| 2506 | Ga0495658_0081558 | |||
| 2507 | Ga0495658_0096243 | |||
| 2508 | Ga0495658_0349708 | |||
| 2509 | Ga0495658_0410369 | |||
| 2510 | Ga0495658_0580725 | |||
| 2511 | Ga0495669_0050589 | |||
| 2512 | Ga0495613_0111435 | |||
| 2513 | Ga0495613_0129151 | |||
| 2514 | Ga0495613_0169015 | |||
| 2515 | Ga0495613_0183424 | |||
| 2516 | Ga0495613_0261137 | |||
| 2517 | Ga0495613_0441688 | |||
| 2518 | Ga0495624_0036211 | |||
| 2519 | Ga0495624_0094655 | |||
| 2520 | Ga0495624_0116782 | |||
| 2521 | Ga0495624_0122682 | |||
| 2522 | Ga0495624_0230621 | |||
| 2523 | Ga0495624_0299727 | |||
| 2524 | Ga0495624_0706967 | |||
| 2525 | Ga0495670_0027562 | |||
| 2526 | Ga0495670_0824965 | |||
| 2527 | Ga0495671_0136822 | |||
| 2528 | Ga0495589_0065436 | |||
| 2529 | Ga0495589_0383231 | |||
| 2530 | Ga0495600_0181981 | |||
| 2531 | Ga0495600_0434766 | |||
| 2532 | Ga0495600_0460850 | |||
| 2533 | Ga0495581_0083750 | |||
| 2534 | Ga0495581_0087770 | |||
| 2535 | Ga0495581_0099676 | |||
| 2536 | Ga0495581_0104814 | |||
| 2537 | Ga0495581_0124408 | |||
| 2538 | Ga0495581_0267652 | |||
| 2539 | Ga0495604_0113732 | |||
| 2540 | Ga0495604_0123026 | |||
| 2541 | Ga0495604_0139121 | |||
| 2542 | Ga0495604_0226846 | |||
| 2543 | Ga0495604_0527544 | |||
| 2544 | Ga0495636_0016495 | |||
| 2545 | Ga0495636_0231389 | |||
| 2546 | Ga0495674_0055652 | |||
| 2547 | Ga0495674_0066700 | |||
| 2548 | Ga0495674_0106350 | |||
| 2549 | Ga0495674_0107711 | |||
| 2550 | Ga0495674_0179199 | |||
| 2551 | Ga0495674_0195763 | |||
| 2552 | Ga0495674_0196403 | |||
| 2553 | Ga0495674_0200727 | |||
| 2554 | Ga0495674_0213746 | |||
| 2555 | Ga0495674_0224798 | |||
| 2556 | Ga0495674_0268788 | |||
| 2557 | Ga0495674_0315963 | |||
| 2558 | Ga0495674_0374782 | |||
| 2559 | Ga0495674_0748934 | |||
| 2560 | Ga0495676_0158225 | |||
| 2561 | Ga0495676_0611015 | |||
| 2562 | Ga0495676_0817969 | |||
| 2563 | Ga0495676_0824606 | |||
| 2564 | Ga0495676_1106765 | |||
| 2565 | Ga0495680_0110650 | |||
| 2566 | Ga0495680_0138257 | |||
| 2567 | Ga0495680_0486058 | |||
| 2568 | Ga0495675_0057476 | |||
| 2569 | Ga0495675_0119152 | |||
| 2570 | Ga0495675_0120184 | |||
| 2571 | Ga0495675_0345266 | |||
| 2572 | Ga0495677_0036661 | |||
| 2573 | Ga0495685_121768 | |||
| 2574 | Ga0495684_0038477 | |||
| 2575 | Ga0495684_0067454 | |||
| 2576 | Ga0495684_0129830 | |||
| 2577 | Ga0495684_0138386 | |||
| 2578 | Ga0495684_0140684 | |||
| 2579 | Ga0495684_0150449 | |||
| 2580 | Ga0495684_0151657 | |||
| 2581 | Ga0495684_0155134 | |||
| 2582 | Ga0495684_0212067 | |||
| 2583 | Ga0495593_0062078 | |||
| 2584 | Ga0495593_0075734 | |||
| 2585 | Ga0495593_0165335 | |||
| 2586 | Ga0495593_0262948 | |||
| 2587 | Ga0495602_0174068 | |||
| 2588 | Ga0495602_0330647 | |||
| 2589 | Ga0495602_0359032 | |||
| 2590 | Ga0495614_0044347 | |||
| 2591 | Ga0495614_0052564 | |||
| 2592 | Ga0495614_0057139 | |||
| 2593 | Ga0495614_0517985 | |||
| 2594 | Ga0495615_0018395 | |||
| 2595 | Ga0496100_0144817 | |||
| 2596 | Ga0496100_0163490 | |||
| 2597 | Ga0496100_0320152 | |||
| 2598 | Ga0496101_0213827 | |||
| 2599 | Ga0496101_0444277 | |||
| 2600 | Ga0496101_1273096 | |||
| 2601 | Ga0496102_0275645 | |||
| 2602 | Ga0496103_0825443 | |||
| 2603 | Ga0496104_0253785 | |||
| 2604 | Ga0496104_0261260 | |||
| 2605 | Ga0496104_0414725 | |||
| 2606 | Ga0496104_1660085 | |||
| 2607 | Ga0496105_0136542 | |||
| 2608 | Ga0496105_0610832 | |||
| 2609 | Ga0496105_1105136 | |||
| 2610 | Ga0496105_1372827 | |||
| 2611 | Ga0496106_0289614 | |||
| 2612 | Ga0496106_0494843 | |||
| 2613 | Ga0496107_0407376 | |||
| 2614 | Ga0496107_1109292 | |||
| 2615 | Ga0496108_0186190 | |||
| 2616 | Ga0496108_0927476 | |||
| 2617 | Ga0496108_0955121 | |||
| 2618 | Ga0496109_0178894 | |||
| 2619 | Ga0496109_0546717 | |||
| 2620 | Ga0496110_0125823 | |||
| 2621 | Ga0496110_0219205 | |||
| 2622 | Ga0496110_1272925 | |||
| 2623 | Ga0496110_1730027 | |||
| 2624 | Ga0496111_0523684 | |||
| 2625 | Ga0496112_0208027 | |||
| 2626 | Ga0496112_0245019 | |||
| 2627 | Ga0496112_0292712 | |||
| 2628 | Ga0496112_0909997 | |||
| 2629 | Ga0496112_1721891 | |||
| 2630 | Ga0496113_0326730 | |||
| 2631 | Ga0496113_0949663 | |||
| 2632 | Ga0496114_0221029 | |||
| 2633 | Ga0496114_0236864 | |||
| 2634 | Ga0496114_0352336 | |||
| 2635 | Ga0496114_0839028 | |||
| 2636 | Ga0501040_0492703 | |||
| 2637 | Ga0501042_1198006 | |||
| 2638 | Ga0501068_0241582 | |||
| 2639 | Ga0501073_0477376 | |||
| 2640 | Ga0501075_0944707 | |||
| 2641 | Ga0501076_1793744 | |||
| 2642 | Ga0501209_096532 | |||
| 2643 | Ga0501249_004867 | |||
| 2644 | Ga0501253_014799 | |||
| 2645 | Ga0501234_048066 | |||
| 2646 | Ga0501245_162122 | |||
| 2647 | Ga0501079_1311435 | |||
| 2648 | Ga0501080_1377679 | |||
| 2649 | Ga0501267_008906 | |||
| 2650 | Ga0501272_061102 | |||
| 2651 | Ga0501273_004652 | |||
| 2652 | Ga0501045_0417654 | |||
| 2653 | nmdc:mga0qj67_121666_c1 | |||
| 2654 | nmdc:mga0qj67_14089_c1 | |||
| 2655 | nmdc:mga0qj67_177904_c1 | |||
| 2656 | nmdc:mga06r32_1481659_c1 | |||
| 2657 | nmdc:mga06r32_600579_c1 | |||
| 2658 | nmdc:mga0n895_1050409_c1 | |||
| 2659 | nmdc:mga0n895_1824489_c1 | |||
| 2660 | nmdc:mga0n895_220586_c1 | |||
| 2661 | nmdc:mga0n895_278053_c1 | |||
| 2662 | nmdc:mga0n895_524098_c1 | |||
| 2663 | nmdc:mga0n895_762099_c1 | |||
| 2664 | nmdc:mga0rr50_1861869_c1 | |||
| 2665 | nmdc:mga0rr50_290616_c1 | |||
| 2666 | nmdc:mga0rr50_699334_c1 | |||
| 2667 | nmdc:mga0rr50_70160_c1 | |||
| 2668 | nmdc:mga0rr50_855863_c1 | |||
| 2669 | nmdc:mga08x19_116197_c1 | |||
| 2670 | nmdc:mga08x19_303409_c1 | |||
| 2671 | nmdc:mga08x19_425287_c1 | |||
| 2672 | nmdc:mga08x19_73872_c1 | |||
| 2673 | nmdc:mga08x19_79574_c1 | |||
| 2674 | nmdc:mga08x19_98938_c1 | |||
| 2675 | nmdc:mga0a205_1104352_c1 | |||
| 2676 | nmdc:mga0a205_1579910_c1 | |||
| 2677 | Ga0495601_0336345 | |||
| 2678 | Ga0495612_0048071 | |||
| 2679 | Ga0495612_0055027 | |||
| 2680 | Ga0495612_0065052 | |||
| 2681 | Ga0495612_0195584 | |||
| 2682 | Ga0495612_0202831 | |||
| 2683 | Ga0495595_0039308 | |||
| 2684 | Ga0495619_0152784 | |||
| 2685 | Ga0495619_0158566 | |||
| 2686 | Ga0495619_0606066 | |||
| 2687 | Ga0500554_037236 | |||
| 2688 | Ga0590071_049483 | |||
| 2689 | Ga0590074_020411 | |||
| 2690 | Ga0590075_014976 | |||
| 2691 | Ga0590077_010083 | |||
| 2692 | Ga0587128_017394 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy