F493184

General Info

Members Datasets Scaffolds Average Seq Length
1344 381 1322 155

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2965320100|2965320309
Length 172
Sequence ILAHLWKMVRDSHPPRPHQHDMTTLKVGDKAPNFIAVDQDGNTHKLSDYKGKKLIVFFYPAANTPSCTIEACNLRDNYSELKNKGYELLGVSADTKKKQANFIAKHHLPFPLLADEDHAVINAFGVWGPKKFMGREFDGIHRTTFVIDEKGTIEKVIEKVKTKDHAAQILAA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
3 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
4 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
5 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
6 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
7 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
8 2738541278 Niastella sp. CF465 Isolate Unclassified
9 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
10 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
11 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
12 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
13 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
14 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
15 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
16 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
17 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
18 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
19 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
20 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
21 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
22 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
23 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
24 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
25 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
27 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
28 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
29 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
30 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
31 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
33 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
34 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
35 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
36 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
37 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
38 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
39 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
40 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
41 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
42 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
43 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
44 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
45 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
46 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
47 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
48 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
49 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
50 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
51 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
52 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
53 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
54 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
55 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
56 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
57 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
58 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
59 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
60 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
61 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
62 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
63 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
64 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
65 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
66 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
67 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
68 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
69 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
70 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
71 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
72 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
73 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
79 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
80 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
81 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
82 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
83 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
84 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
85 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
86 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
87 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
88 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
89 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
90 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
91 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
92 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
93 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
94 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
95 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
96 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
97 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
99 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
104 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
105 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
106 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
107 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
108 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
109 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
111 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
112 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
115 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
116 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
117 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
118 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
119 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
120 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
121 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
122 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
123 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
124 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
125 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
126 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
127 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
128 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
129 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
130 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
131 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
132 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
133 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
134 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
135 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
136 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
137 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
138 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
139 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
140 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
141 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
142 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
197 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
198 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
203 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
205 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
209 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
210 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
211 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
212 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
213 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
214 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
215 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
216 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
217 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
218 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
219 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
220 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
221 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
222 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
223 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
224 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
225 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
226 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
227 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
228 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
229 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
230 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
231 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
232 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
233 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
234 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
235 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
236 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
237 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
238 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
239 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
240 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
241 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
242 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
243 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
244 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
245 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
246 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
247 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
248 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
249 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
250 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
251 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
252 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
253 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
254 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
255 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
256 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
257 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
258 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
259 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
260 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
261 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
262 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
263 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
264 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
265 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
266 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
267 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
268 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
269 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
270 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
271 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
272 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
273 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
274 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
275 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
276 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
277 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
278 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
279 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
280 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
281 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
282 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
283 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
284 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
285 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
286 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
287 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
288 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
289 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
290 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
291 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
292 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
293 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
294 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
295 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
296 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
297 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
298 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
299 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
300 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
301 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
302 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
303 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
304 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
305 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
306 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
307 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
308 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
309 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
310 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
311 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
312 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
313 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
314 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
315 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
325 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
326 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
327 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
328 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
329 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
330 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
331 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
332 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
333 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
334 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
335 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
336 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
337 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
338 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
339 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
340 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
341 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
342 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
343 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
344 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
345 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
346 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
347 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
349 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
350 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
351 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
352 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
353 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
354 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
355 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
356 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
357 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
358 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
359 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
360 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
361 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
362 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
363 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
364 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
365 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
366 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
367 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
368 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
369 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
370 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
371 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
372 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
373 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
374 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
375 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
376 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
377 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
378 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
379 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
380 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
381 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.29
Metatranscriptomes 0.07
Isolates 1.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.12
Nodule 0.45
Rhizoplane 0.6
Rhizosphere 91.82
Stem 0
Stem Tuber 0
Unclassified 4.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1759593 2162886007 Bacteria 266684
2 ARSoilOldRDRAFT_c017796 3300000044 Bacteria 617
3 JGI24740J21852_10054664 3300001979 Bacteria 1126
4 JGI24739J22299_10164838 3300001989 Bacteria 653
5 JGI25154J39366_1007563 3300002738 Bacteria 1473
6 JGI25406J46586_10000862 3300003203 Bacteria 14305
7 rootH1_10108543 3300003316 Bacteria 2407
8 rootH1_10113575 3300003316 Unclassified 1285
9 rootH1_10191240 3300003316 Unclassified 1291
10 rootH2_10022538 3300003320 Bacteria 1022
11 rootH2_10096425 3300003320 Bacteria 4817
12 rootH2_10102887 3300003320 Bacteria 5250
13 rootH2_10119873 3300003320 Bacteria 4763
14 rootL2_10014693 3300003322 Bacteria 1157
15 rootL2_10016176 3300003322 Bacteria 1185
16 rootH1_10006077 3300003323 Bacteria 14451
17 rootH1_10062168 3300003323 Bacteria 3346
18 rootH1_10232417 3300003323 Bacteria 1188
19 JGI25160J50197_1002216 3300003354 Bacteria 9123
20 JGI25404J52841_10047105 3300003659 Unclassified 909
21 Ga0058863_11958113 3300004799 Bacteria 2677
22 Ga0065714_10074874 3300005288 Bacteria 2953
23 Ga0065704_10070133 3300005289 Bacteria 1266035
24 Ga0065704_10114609 3300005289 Bacteria 1887
25 Ga0065704_10303151 3300005289 Bacteria 881
26 Ga0065712_10112615 3300005290 Unclassified 1796
27 Ga0065712_10395154 3300005290 Unclassified 734
28 Ga0065715_10012842 3300005293 Bacteria 2148
29 Ga0065715_10141111 3300005293 Bacteria 1852
30 Ga0065715_10185400 3300005293 Unclassified 1448
31 Ga0065715_10354769 3300005293 Bacteria 936
32 Ga0065707_10655831 3300005295 Bacteria 661
33 Ga0070658_10063094 3300005327 Bacteria 3020
34 Ga0070658_10079396 3300005327 Bacteria 2694
35 Ga0070658_10084165 3300005327 Bacteria 2615
36 Ga0070658_10113860 3300005327 Bacteria 2243
37 Ga0070658_10129909 3300005327 Unclassified 2099
38 Ga0070658_10211278 3300005327 Bacteria 1639
39 Ga0070658_10807063 3300005327 Unclassified 815
40 Ga0070658_10953946 3300005327 Bacteria 746
41 Ga0070676_10014145 3300005328 Bacteria 4382
42 Ga0070676_10087673 3300005328 Bacteria 1900
43 Ga0070676_11049039 3300005328 Unclassified 614
44 Ga0070683_100005634 3300005329 Bacteria 10463
45 Ga0070683_100013202 3300005329 Bacteria 7195
46 Ga0070683_100030822 3300005329 Bacteria 4873
47 Ga0070683_100080846 3300005329 Bacteria 3042
48 Ga0070683_100145057 3300005329 Bacteria 2249
49 Ga0070683_100252445 3300005329 Bacteria 1677
50 Ga0070683_101009189 3300005329 Bacteria 799
51 Ga0070683_101035571 3300005329 Unclassified 788
52 Ga0070683_101329946 3300005329 Unclassified 691
53 Ga0070683_102024262 3300005329 Unclassified 553
54 Ga0070690_100017874 3300005330 Bacteria 4274
55 Ga0070690_100431552 3300005330 Bacteria 973
56 Ga0070670_100017762 3300005331 Bacteria 6104
57 Ga0070670_100091856 3300005331 Bacteria 2610
58 Ga0070670_100132893 3300005331 Bacteria 2150
59 Ga0070670_100137908 3300005331 Unclassified 2108
60 Ga0070670_100151167 3300005331 Bacteria 2009
61 Ga0070670_100252354 3300005331 Bacteria 1537
62 Ga0070670_100403005 3300005331 Bacteria 1208
63 Ga0070670_100461040 3300005331 Bacteria 1127
64 Ga0070670_100512070 3300005331 Bacteria 1068
65 Ga0070670_100622813 3300005331 Bacteria 967
66 Ga0070670_101026073 3300005331 Bacteria 751
67 Ga0070670_101121232 3300005331 Unclassified 718
68 Ga0070670_101613106 3300005331 Bacteria 596
69 Ga0070677_10369639 3300005333 Bacteria 748
70 Ga0068869_100002411 3300005334 Bacteria 11268
71 Ga0068869_100051235 3300005334 Bacteria 2995
72 Ga0068869_100081559 3300005334 Bacteria 2416
73 Ga0068869_100082431 3300005334 Bacteria 2404
74 Ga0068869_100225771 3300005334 Bacteria 1486
75 Ga0068869_100340091 3300005334 Bacteria 1221
76 Ga0068869_100484120 3300005334 Bacteria 1031
77 Ga0068869_100886571 3300005334 Bacteria 771
78 Ga0070666_10000039 3300005335 Bacteria 115360
79 Ga0070666_10027076 3300005335 Bacteria 3751
80 Ga0070666_10065218 3300005335 Bacteria 2471
81 Ga0070666_10141312 3300005335 Bacteria 1677
82 Ga0070666_10146949 3300005335 Bacteria 1643
83 Ga0070666_10584315 3300005335 Unclassified 814
84 Ga0070666_10792862 3300005335 Bacteria 697
85 Ga0070680_100000801 3300005336 Bacteria 22167
86 Ga0070680_100001989 3300005336 Bacteria 15039
87 Ga0070680_100017930 3300005336 Bacteria 5588
88 Ga0070680_100019631 3300005336 Bacteria 5360
89 Ga0070680_100099482 3300005336 Bacteria 2413
90 Ga0070680_100454961 3300005336 Bacteria 1093
91 Ga0070682_100000008 3300005337 Bacteria 322125
92 Ga0070682_100002487 3300005337 Bacteria 10181
93 Ga0070682_100034706 3300005337 Bacteria 3074
94 Ga0070682_100059364 3300005337 Bacteria 2416
95 Ga0070682_100393023 3300005337 Bacteria 1046
96 Ga0070682_101454741 3300005337 Bacteria 588
97 Ga0068868_100008123 3300005338 Bacteria 7508
98 Ga0068868_100012823 3300005338 Bacteria 6132
99 Ga0068868_100127037 3300005338 Bacteria 2084
100 Ga0068868_100222982 3300005338 Bacteria 1579
101 Ga0068868_100366233 3300005338 Unclassified 1237
102 Ga0068868_100402680 3300005338 Bacteria 1181
103 Ga0068868_100441393 3300005338 Bacteria 1130
104 Ga0068868_100883558 3300005338 Bacteria 811
105 Ga0068868_101684467 3300005338 Bacteria 597
106 Ga0070660_100005268 3300005339 Bacteria 8941
107 Ga0070660_100012662 3300005339 Bacteria 6029
108 Ga0070660_100015263 3300005339 Bacteria 5542
109 Ga0070660_100037813 3300005339 Bacteria 3659
110 Ga0070660_100070608 3300005339 Bacteria 2726
111 Ga0070660_100153670 3300005339 Bacteria 1852
112 Ga0070660_100174859 3300005339 Bacteria 1736
113 Ga0070660_100270087 3300005339 Unclassified 1390
114 Ga0070660_100465775 3300005339 Unclassified 1049
115 Ga0070689_100022550 3300005340 Unclassified 4702
116 Ga0070689_100405142 3300005340 Bacteria 1154
117 Ga0070691_10011757 3300005341 Bacteria 4004
118 Ga0070691_10054963 3300005341 Bacteria 1906
119 Ga0070691_10571208 3300005341 Bacteria 663
120 Ga0070661_100003941 3300005344 Bacteria 10211
121 Ga0070661_100010590 3300005344 Bacteria 6414
122 Ga0070661_100035826 3300005344 Bacteria 3606
123 Ga0070661_100169746 3300005344 Bacteria 1656
124 Ga0070661_100694681 3300005344 Bacteria 829
125 Ga0070668_100025535 3300005347 Bacteria 4480
126 Ga0070669_100000934 3300005353 Bacteria 21298
127 Ga0070669_100188508 3300005353 Bacteria 1617
128 Ga0070675_100002986 3300005354 Bacteria 12782
129 Ga0070675_100033560 3300005354 Bacteria 4162
130 Ga0070675_100343158 3300005354 Unclassified 1323
131 Ga0070675_100533980 3300005354 Unclassified 1059
132 Ga0070675_100829707 3300005354 Bacteria 846
133 Ga0070675_101027474 3300005354 Bacteria 757
134 Ga0070675_101120086 3300005354 Unclassified 724
135 Ga0070675_101217059 3300005354 Bacteria 693
136 Ga0070675_101307486 3300005354 Bacteria 668
137 Ga0070671_100004074 3300005355 Bacteria 11535
138 Ga0070671_100034534 3300005355 Bacteria 4186
139 Ga0070671_100036686 3300005355 Unclassified 4066
140 Ga0070671_100051414 3300005355 Bacteria 3427
141 Ga0070671_100302633 3300005355 Bacteria 1362
142 Ga0070671_100552464 3300005355 Bacteria 993
143 Ga0070671_100850219 3300005355 Bacteria 796
144 Ga0070673_100013205 3300005364 Bacteria 5702
145 Ga0070673_100022831 3300005364 Bacteria 4562
146 Ga0070673_100027981 3300005364 Unclassified 4186
147 Ga0070673_100059120 3300005364 Bacteria 3034
148 Ga0070673_100080738 3300005364 Bacteria 2636
149 Ga0070673_100088685 3300005364 Bacteria 2523
150 Ga0070673_100157373 3300005364 Unclassified 1929
151 Ga0070673_100567751 3300005364 Bacteria 1032
152 Ga0070673_102080714 3300005364 Bacteria 539
153 Ga0070688_100000510 3300005365 Bacteria 19613
154 Ga0070688_100103360 3300005365 Bacteria 1882
155 Ga0070688_101039309 3300005365 Unclassified 652
156 Ga0070659_100001018 3300005366 Bacteria 20559
157 Ga0070659_100013202 3300005366 Bacteria 6143
158 Ga0070659_100049494 3300005366 Bacteria 3305
159 Ga0070659_100056770 3300005366 Bacteria 3087
160 Ga0070659_100060026 3300005366 Bacteria 3004
161 Ga0070659_100198645 3300005366 Bacteria 1650
162 Ga0070659_100497160 3300005366 Bacteria 1039
163 Ga0070667_100019830 3300005367 Bacteria 5580
164 Ga0070667_100029437 3300005367 Bacteria 4575
165 Ga0070667_100057572 3300005367 Unclassified 3286
166 Ga0070667_100091710 3300005367 Bacteria 2613
167 Ga0070667_100100044 3300005367 Bacteria 2503
168 Ga0070667_100394970 3300005367 Bacteria 1258
169 Ga0070667_100668986 3300005367 Bacteria 959
170 Ga0070667_100950495 3300005367 Bacteria 801
171 Ga0070667_101601534 3300005367 Bacteria 612
172 Ga0070711_100362771 3300005439 Bacteria 1167
173 Ga0070663_100131263 3300005455 Bacteria 1902
174 Ga0070663_101205580 3300005455 Bacteria 665
175 Ga0070663_101459575 3300005455 Unclassified 607
176 Ga0070678_100050986 3300005456 Bacteria 2997
177 Ga0070678_100100405 3300005456 Bacteria 2241
178 Ga0070678_100180089 3300005456 Bacteria 1729
179 Ga0070678_100296641 3300005456 Bacteria 1372
180 Ga0070662_100004097 3300005457 Bacteria 9154
181 Ga0070662_100151914 3300005457 Bacteria 1803
182 Ga0070662_100214937 3300005457 Bacteria 1532
183 Ga0070681_10001223 3300005458 Bacteria 22355
184 Ga0070681_10003892 3300005458 Bacteria 14063
185 Ga0070681_10006547 3300005458 Bacteria 11339
186 Ga0070681_10026168 3300005458 Bacteria 5866
187 Ga0070681_10031707 3300005458 Bacteria 5305
188 Ga0070681_10152747 3300005458 Bacteria 2235
189 Ga0070681_10189548 3300005458 Bacteria 1976
190 Ga0070681_10834909 3300005458 Unclassified 839
191 Ga0070681_10969092 3300005458 Bacteria 770
192 Ga0070681_11318064 3300005458 Bacteria 645
193 Ga0068867_100007419 3300005459 Bacteria 7755
194 Ga0068867_100071452 3300005459 Bacteria 2596
195 Ga0068867_100240385 3300005459 Bacteria 1468
196 Ga0068867_100390076 3300005459 Bacteria 1172
197 Ga0068867_100483893 3300005459 Bacteria 1061
198 Ga0068867_100720947 3300005459 Bacteria 882
199 Ga0068867_101041402 3300005459 Bacteria 744
200 Ga0068867_101084100 3300005459 Bacteria 730
201 Ga0068867_101164400 3300005459 Bacteria 707
202 Ga0070685_10203752 3300005466 Bacteria 1287
203 Ga0070685_10984708 3300005466 Unclassified 632
204 Ga0070685_11494543 3300005466 Bacteria 520
205 Ga0070679_100000103 3300005530 Bacteria 66004
206 Ga0070679_100000622 3300005530 Bacteria 30157
207 Ga0070679_100009930 3300005530 Bacteria 9010
208 Ga0070679_100011551 3300005530 Bacteria 8419
209 Ga0070679_100012734 3300005530 Bacteria 8043
210 Ga0070679_100017710 3300005530 Bacteria 6897
211 Ga0070679_100034369 3300005530 Bacteria 5024
212 Ga0070679_100076993 3300005530 Bacteria 3324
213 Ga0070679_100092666 3300005530 Bacteria 3009
214 Ga0070679_100486223 3300005530 Bacteria 1178
215 Ga0070684_100019987 3300005535 Bacteria 5551
216 Ga0070684_100026424 3300005535 Bacteria 4891
217 Ga0070684_100031330 3300005535 Bacteria 4526
218 Ga0070684_100074647 3300005535 Unclassified 2989
219 Ga0070684_100270243 3300005535 Bacteria 1556
220 Ga0070684_100331356 3300005535 Bacteria 1399
221 Ga0070684_100344529 3300005535 Bacteria 1370
222 Ga0070684_100663216 3300005535 Bacteria 971
223 Ga0068853_100000422 3300005539 Bacteria 28780
224 Ga0068853_100004153 3300005539 Bacteria 11164
225 Ga0068853_100010199 3300005539 Bacteria 7594
226 Ga0068853_100014450 3300005539 Bacteria 6465
227 Ga0068853_100020518 3300005539 Bacteria 5495
228 Ga0068853_100030972 3300005539 Bacteria 4522
229 Ga0068853_100031538 3300005539 Bacteria 4483
230 Ga0068853_100046971 3300005539 Bacteria 3705
231 Ga0068853_100182218 3300005539 Bacteria 1905
232 Ga0068853_100226705 3300005539 Bacteria 1708
233 Ga0068853_100341781 3300005539 Bacteria 1391
234 Ga0068853_100589734 3300005539 Bacteria 1055
235 Ga0068853_100899317 3300005539 Bacteria 850
236 Ga0068853_101607231 3300005539 Bacteria 630
237 Ga0068853_101730659 3300005539 Bacteria 606
238 Ga0070672_100007724 3300005543 Bacteria 7325
239 Ga0070672_100234979 3300005543 Bacteria 1541
240 Ga0070672_101674274 3300005543 Unclassified 571
241 Ga0070686_100106223 3300005544 Bacteria 1905
242 Ga0070686_100208702 3300005544 Unclassified 1405
243 Ga0070693_100105797 3300005547 Bacteria 1722
244 Ga0070693_100497797 3300005547 Bacteria 864
245 Ga0070665_100000014 3300005548 Bacteria 484881
246 Ga0068855_100000145 3300005563 Bacteria 91452
247 Ga0068855_100006360 3300005563 Bacteria 14396
248 Ga0068855_100008021 3300005563 Bacteria 12754
249 Ga0068855_100008926 3300005563 Bacteria 12117
250 Ga0068855_100017900 3300005563 Bacteria 8514
251 Ga0068855_100025205 3300005563 Bacteria 7121
252 Ga0068855_100043979 3300005563 Bacteria 5288
253 Ga0068855_100052845 3300005563 Bacteria 4782
254 Ga0068855_100062983 3300005563 Bacteria 4329
255 Ga0068855_100066465 3300005563 Unclassified 4204
256 Ga0068855_100326943 3300005563 Bacteria 1693
257 Ga0068855_100369154 3300005563 Bacteria 1578
258 Ga0068855_100517272 3300005563 Bacteria 1295
259 Ga0068855_100599357 3300005563 Bacteria 1188
260 Ga0070664_100006443 3300005564 Bacteria 9465
261 Ga0070664_100009855 3300005564 Bacteria 7741
262 Ga0070664_100024727 3300005564 Bacteria 4972
263 Ga0070664_100102283 3300005564 Bacteria 2493
264 Ga0070664_100184681 3300005564 Bacteria 1855
265 Ga0070664_100383572 3300005564 Bacteria 1283
266 Ga0070664_100463596 3300005564 Bacteria 1164
267 Ga0068857_100000536 3300005577 Bacteria 27488
268 Ga0068857_100002416 3300005577 Bacteria 15233
269 Ga0068857_100042072 3300005577 Bacteria 4052
270 Ga0068857_100065486 3300005577 Unclassified 3231
271 Ga0068857_100137001 3300005577 Bacteria 2210
272 Ga0068857_100271210 3300005577 Bacteria 1559
273 Ga0068857_100291855 3300005577 Unclassified 1502
274 Ga0068857_100434273 3300005577 Bacteria 1226
275 Ga0068857_100747982 3300005577 Bacteria 931
276 Ga0068857_101025004 3300005577 Bacteria 795
277 Ga0068857_101066635 3300005577 Bacteria 779
278 Ga0068857_101713960 3300005577 Bacteria 614
279 Ga0068854_100007635 3300005578 Bacteria 6919
280 Ga0068854_100045340 3300005578 Unclassified 3126
281 Ga0068854_100094261 3300005578 Bacteria 2233
282 Ga0068854_100113247 3300005578 Bacteria 2049
283 Ga0068854_100220674 3300005578 Bacteria 1500
284 Ga0068854_100236417 3300005578 Bacteria 1453
285 Ga0068854_100274156 3300005578 Bacteria 1355
286 Ga0068854_100306711 3300005578 Bacteria 1286
287 Ga0068854_100641866 3300005578 Bacteria 911
288 Ga0068854_100870157 3300005578 Unclassified 790
289 Ga0068854_101319253 3300005578 Bacteria 650
290 Ga0068856_100009358 3300005614 Bacteria 9514
291 Ga0068856_100014081 3300005614 Bacteria 7732
292 Ga0068856_100103866 3300005614 Bacteria 2835
293 Ga0068856_100162962 3300005614 Bacteria 2241
294 Ga0068856_100452916 3300005614 Bacteria 1304
295 Ga0070702_100546531 3300005615 Bacteria 859
296 Ga0070702_100694602 3300005615 Unclassified 775
297 Ga0068852_100005736 3300005616 Bacteria 8906
298 Ga0068852_100006803 3300005616 Bacteria 8300
299 Ga0068852_100011198 3300005616 Bacteria 6738
300 Ga0068852_100014310 3300005616 Bacteria 6102
301 Ga0068852_100038402 3300005616 Bacteria 4024
302 Ga0068852_100045041 3300005616 Bacteria 3750
303 Ga0068852_100149566 3300005616 Bacteria 2170
304 Ga0068852_100153579 3300005616 Unclassified 2143
305 Ga0068852_100211184 3300005616 Bacteria 1841
306 Ga0068852_100484989 3300005616 Bacteria 1229
307 Ga0068852_100518328 3300005616 Unclassified 1189
308 Ga0068852_100532620 3300005616 Bacteria 1173
309 Ga0068852_100621766 3300005616 Bacteria 1086
310 Ga0068852_100814655 3300005616 Bacteria 948
311 Ga0068852_100849338 3300005616 Bacteria 928
312 Ga0068852_101363885 3300005616 Bacteria 731
313 Ga0068852_102291355 3300005616 Bacteria 561
314 Ga0068859_100000006 3300005617 Bacteria 421509
315 Ga0068859_100000735 3300005617 Bacteria 33019
316 Ga0068859_100019133 3300005617 Bacteria 6877
317 Ga0068859_100021602 3300005617 Bacteria 6460
318 Ga0068859_100036492 3300005617 Bacteria 4935
319 Ga0068859_100062271 3300005617 Bacteria 3760
320 Ga0068859_100129414 3300005617 Bacteria 2595
321 Ga0068859_100160171 3300005617 Bacteria 2329
322 Ga0068859_100649685 3300005617 Bacteria 1147
323 Ga0068859_102774942 3300005617 Bacteria 538
324 Ga0068864_100091301 3300005618 Bacteria 2686
325 Ga0068864_100095928 3300005618 Unclassified 2624
326 Ga0068864_100158528 3300005618 Unclassified 2056
327 Ga0068864_100185819 3300005618 Bacteria 1902
328 Ga0068864_100337144 3300005618 Bacteria 1420
329 Ga0068864_100563055 3300005618 Bacteria 1103
330 Ga0068864_100725783 3300005618 Bacteria 972
331 Ga0068864_100757795 3300005618 Bacteria 952
332 Ga0068864_101270336 3300005618 Unclassified 736
333 Ga0068864_101291842 3300005618 Bacteria 730
334 Ga0068866_10045706 3300005718 Bacteria 2198
335 Ga0068866_10434408 3300005718 Bacteria 855
336 Ga0068866_10487145 3300005718 Bacteria 813
337 Ga0068861_100014736 3300005719 Bacteria 5491
338 Ga0068861_100078004 3300005719 Bacteria 2586
339 Ga0068861_100203610 3300005719 Bacteria 1663
340 Ga0068861_100231191 3300005719 Bacteria 1568
341 Ga0068861_100447271 3300005719 Bacteria 1157
342 Ga0068861_100501420 3300005719 Unclassified 1097
343 Ga0068861_100854387 3300005719 Unclassified 858
344 Ga0068851_10000283 3300005834 Bacteria 23395
345 Ga0068851_10026058 3300005834 Bacteria 2871
346 Ga0068851_10110485 3300005834 Unclassified 1467
347 Ga0068851_10612306 3300005834 Bacteria 664
348 Ga0068851_10614862 3300005834 Bacteria 662
349 Ga0068851_10756525 3300005834 Unclassified 601
350 Ga0068870_10060235 3300005840 Unclassified 2037
351 Ga0068870_10348688 3300005840 Bacteria 949
352 Ga0068870_10428263 3300005840 Bacteria 867
353 Ga0068863_100001252 3300005841 Bacteria 25318
354 Ga0068863_100032647 3300005841 Bacteria 4961
355 Ga0068863_100086136 3300005841 Bacteria 2977
356 Ga0068863_100086798 3300005841 Unclassified 2965
357 Ga0068863_100120028 3300005841 Bacteria 2506
358 Ga0068863_100147721 3300005841 Bacteria 2249
359 Ga0068863_100564301 3300005841 Bacteria 1125
360 Ga0068863_101929757 3300005841 Bacteria 600
361 Ga0068858_100007555 3300005842 Bacteria 10505
362 Ga0068858_100043357 3300005842 Bacteria 4171
363 Ga0068858_100646809 3300005842 Bacteria 1027
364 Ga0068858_100983942 3300005842 Bacteria 826
365 Ga0068858_101215008 3300005842 Bacteria 741
366 Ga0068858_101278145 3300005842 Bacteria 722
367 Ga0068860_100000061 3300005843 Bacteria 192548
368 Ga0068860_100002984 3300005843 Bacteria 17484
369 Ga0068860_100003402 3300005843 Bacteria 16350
370 Ga0068860_100030317 3300005843 Bacteria 5203
371 Ga0068860_100061543 3300005843 Bacteria 3566
372 Ga0068860_100109399 3300005843 Bacteria 2641
373 Ga0068860_100154146 3300005843 Unclassified 2214
374 Ga0068860_100274698 3300005843 Bacteria 1645
375 Ga0068860_100333541 3300005843 Bacteria 1490
376 Ga0068860_100572169 3300005843 Bacteria 1133
377 Ga0068860_100860918 3300005843 Unclassified 921
378 Ga0068860_100982235 3300005843 Bacteria 862
379 Ga0068862_100002841 3300005844 Bacteria 15192
380 Ga0068862_100043662 3300005844 Bacteria 3822
381 Ga0068862_100542417 3300005844 Unclassified 1109
382 Ga0068862_101138861 3300005844 Bacteria 777
383 Ga0068862_101696117 3300005844 Bacteria 640
384 Ga0081540_1039023 3300005983 Bacteria 2494
385 Ga0081539_10000377 3300005985 Bacteria 97368
386 Ga0070717_10716314 3300006028 Bacteria 909
387 Ga0070712_100719718 3300006175 Bacteria 852
388 Ga0075366_10008429 3300006195 Bacteria 5732
389 Ga0075366_10053800 3300006195 Bacteria 2391
390 Ga0075366_10093664 3300006195 Bacteria 1800
391 Ga0075366_10666464 3300006195 Bacteria 646
392 Ga0075366_10717978 3300006195 Unclassified 621
393 Ga0075366_10877359 3300006195 Unclassified 559
394 Ga0097621_100008333 3300006237 Bacteria 7460
395 Ga0097621_100233447 3300006237 Bacteria 1606
396 Ga0097621_100638606 3300006237 Bacteria 976
397 Ga0097621_100909370 3300006237 Bacteria 820
398 Ga0097621_101601656 3300006237 Bacteria 619
399 Ga0068871_100000319 3300006358 Bacteria 33457
400 Ga0068871_100008771 3300006358 Bacteria 7280
401 Ga0068871_100055566 3300006358 Bacteria 3214
402 Ga0068871_100103677 3300006358 Bacteria 2385
403 Ga0068871_100145169 3300006358 Bacteria 2020
404 Ga0068871_100681690 3300006358 Unclassified 940
405 Ga0068871_100734479 3300006358 Bacteria 906
406 Ga0075429_100163273 3300006880 Unclassified 1951
407 Ga0068865_100075542 3300006881 Bacteria 2403
408 Ga0068865_100253078 3300006881 Bacteria 1391
409 Ga0068865_101404718 3300006881 Unclassified 623
410 Ga0075436_100630211 3300006914 Bacteria 791
411 Ga0097620_100000006 3300006931 Bacteria 421509
412 Ga0097620_100000735 3300006931 Bacteria 33019
413 Ga0097620_100019133 3300006931 Bacteria 6877
414 Ga0097620_100021602 3300006931 Bacteria 6460
415 Ga0097620_100036493 3300006931 Bacteria 4935
416 Ga0097620_100062272 3300006931 Bacteria 3760
417 Ga0097620_100129411 3300006931 Bacteria 2595
418 Ga0097620_100160177 3300006931 Bacteria 2329
419 Ga0097620_100649685 3300006931 Bacteria 1147
420 Ga0097620_102774752 3300006931 Bacteria 538
421 Ga0099824_1022466 3300006942 Bacteria 4152
422 Ga0079104_1000271 3300006946 Bacteria 67895
423 Ga0099826_10002269 3300006948 Bacteria 12296
424 Ga0075435_100431440 3300007076 Bacteria 1135
425 Ga0075435_100681528 3300007076 Bacteria 893
426 Ga0075435_100976727 3300007076 Unclassified 739
427 Ga0105250_10488187 3300009092 Bacteria 557
428 Ga0105240_10000198 3300009093 Bacteria 122388
429 Ga0105240_10013967 3300009093 Bacteria 10993
430 Ga0105240_10015957 3300009093 Bacteria 10186
431 Ga0105240_10016504 3300009093 Bacteria 9995
432 Ga0105240_10030173 3300009093 Bacteria 7052
433 Ga0105240_10031764 3300009093 Bacteria 6842
434 Ga0105240_10063722 3300009093 Bacteria 4583
435 Ga0105240_10065512 3300009093 Bacteria 4510
436 Ga0105240_10077023 3300009093 Bacteria 4110
437 Ga0105240_10300164 3300009093 Unclassified 1837
438 Ga0105240_10329619 3300009093 Bacteria 1737
439 Ga0105240_11034942 3300009093 Unclassified 876
440 Ga0105240_11168772 3300009093 Unclassified 816
441 Ga0111539_10000962 3300009094 Bacteria 37802
442 Ga0111539_10048499 3300009094 Bacteria 5070
443 Ga0111539_10513090 3300009094 Bacteria 1396
444 Ga0105245_10044369 3300009098 Unclassified 3968
445 Ga0105245_10087307 3300009098 Bacteria 2863
446 Ga0105245_11226622 3300009098 Bacteria 798
447 Ga0105247_10007950 3300009101 Bacteria 6481
448 Ga0105247_10049748 3300009101 Bacteria 2577
449 Ga0114129_10169682 3300009147 Unclassified 2975
450 Ga0105243_10464351 3300009148 Bacteria 1191
451 Ga0105241_10006910 3300009174 Bacteria 8353
452 Ga0105241_10020566 3300009174 Bacteria 4877
453 Ga0105241_10066448 3300009174 Bacteria 2788
454 Ga0105241_10077674 3300009174 Bacteria 2592
455 Ga0105241_10510077 3300009174 Bacteria 1074
456 Ga0105241_11038252 3300009174 Bacteria 769
457 Ga0105241_11217459 3300009174 Unclassified 714
458 Ga0105242_10014706 3300009176 Bacteria 6060
459 Ga0105242_10053731 3300009176 Bacteria 3290
460 Ga0105242_10136150 3300009176 Unclassified 2126
461 Ga0105242_10265859 3300009176 Unclassified 1551
462 Ga0105242_10428938 3300009176 Bacteria 1241
463 Ga0105242_10503307 3300009176 Bacteria 1153
464 Ga0105242_10516631 3300009176 Bacteria 1139
465 Ga0105242_10534996 3300009176 Unclassified 1121
466 Ga0105242_12941927 3300009176 Unclassified 527
467 Ga0105248_10100373 3300009177 Bacteria 3261
468 Ga0105237_10001982 3300009545 Bacteria 26058
469 Ga0105237_10005617 3300009545 Bacteria 14137
470 Ga0105237_10009021 3300009545 Bacteria 10719
471 Ga0105237_10011368 3300009545 Bacteria 9417
472 Ga0105237_10012986 3300009545 Bacteria 8744
473 Ga0105237_10015967 3300009545 Bacteria 7807
474 Ga0105237_10020785 3300009545 Bacteria 6762
475 Ga0105237_10023843 3300009545 Bacteria 6263
476 Ga0105237_10054802 3300009545 Bacteria 3995
477 Ga0105237_10228405 3300009545 Bacteria 1862
478 Ga0105237_10371442 3300009545 Unclassified 1435
479 Ga0105237_10606450 3300009545 Bacteria 1102
480 Ga0105237_10865989 3300009545 Bacteria 910
481 Ga0105237_11337957 3300009545 Bacteria 723
482 Ga0105238_10017486 3300009551 Bacteria 7289
483 Ga0105238_10181149 3300009551 Unclassified 2084
484 Ga0105238_10186391 3300009551 Bacteria 2051
485 Ga0105238_10302076 3300009551 Unclassified 1584
486 Ga0105238_10302706 3300009551 Bacteria 1583
487 Ga0105238_10962055 3300009551 Unclassified 874
488 Ga0105249_10002985 3300009553 Bacteria 14592
489 Ga0105249_10079783 3300009553 Unclassified 3039
490 Ga0105249_10123416 3300009553 Bacteria 2464
491 Ga0105249_10262607 3300009553 Bacteria 1716
492 Ga0105249_10679815 3300009553 Bacteria 1088
493 Ga0105249_11116968 3300009553 Bacteria 858
494 Ga0105249_11129543 3300009553 Bacteria 854
495 Ga0105239_10000019 3300010375 Bacteria 273836
496 Ga0105239_10011609 3300010375 Bacteria 9828
497 Ga0105239_10012014 3300010375 Bacteria 9656
498 Ga0105239_10013153 3300010375 Bacteria 9196
499 Ga0105239_10015448 3300010375 Bacteria 8457
500 Ga0105239_10027184 3300010375 Bacteria 6298
501 Ga0105239_10041345 3300010375 Bacteria 5053
502 Ga0105239_10086685 3300010375 Bacteria 3451
503 Ga0105239_10093938 3300010375 Bacteria 3312
504 Ga0105239_10105489 3300010375 Bacteria 3121
505 Ga0105239_10136751 3300010375 Bacteria 2728
506 Ga0105239_10232044 3300010375 Unclassified 2070
507 Ga0105239_10481427 3300010375 Bacteria 1410
508 Ga0105239_10619623 3300010375 Bacteria 1235
509 Ga0105239_11065702 3300010375 Unclassified 930
510 Ga0105239_11232637 3300010375 Bacteria 862
511 Ga0105239_12316313 3300010375 Bacteria 625
512 Ga0105246_10011345 3300011119 Bacteria 5531
513 Ga0105246_10580998 3300011119 Bacteria 965
514 Ga0105246_12126441 3300011119 Bacteria 544
515 Ga0157373_10000012 3300013100 Bacteria 188666
516 Ga0157373_10002874 3300013100 Bacteria 13027
517 Ga0157373_10008496 3300013100 Bacteria 7629
518 Ga0157373_10021650 3300013100 Bacteria 4665
519 Ga0157373_10046327 3300013100 Bacteria 3102
520 Ga0157373_10053248 3300013100 Bacteria 2877
521 Ga0157373_10185966 3300013100 Unclassified 1463
522 Ga0157373_10231563 3300013100 Bacteria 1305
523 Ga0157373_10280814 3300013100 Bacteria 1180
524 Ga0157373_10283310 3300013100 Unclassified 1175
525 Ga0157373_10283582 3300013100 Bacteria 1174
526 Ga0157373_10295618 3300013100 Bacteria 1149
527 Ga0157371_10000952 3300013102 Bacteria 32200
528 Ga0157371_10001122 3300013102 Bacteria 28959
529 Ga0157371_10002846 3300013102 Bacteria 16168
530 Ga0157371_10027570 3300013102 Bacteria 4119
531 Ga0157371_10028817 3300013102 Bacteria 4019
532 Ga0157371_10040326 3300013102 Bacteria 3335
533 Ga0157371_10041525 3300013102 Bacteria 3281
534 Ga0157371_10048689 3300013102 Bacteria 3013
535 Ga0157371_10066975 3300013102 Bacteria 2542
536 Ga0157371_10074646 3300013102 Bacteria 2401
537 Ga0157371_10076831 3300013102 Bacteria 2365
538 Ga0157371_10079122 3300013102 Bacteria 2329
539 Ga0157371_10130903 3300013102 Bacteria 1785
540 Ga0157371_10140954 3300013102 Bacteria 1717
541 Ga0157371_10168621 3300013102 Bacteria 1564
542 Ga0157371_10243713 3300013102 Bacteria 1293
543 Ga0157371_10295276 3300013102 Bacteria 1172
544 Ga0157371_10318258 3300013102 Bacteria 1129
545 Ga0157371_10703160 3300013102 Bacteria 757
546 Ga0157371_10745526 3300013102 Bacteria 735
547 Ga0157370_10000451 3300013104 Bacteria 51369
548 Ga0157370_10000628 3300013104 Bacteria 43950
549 Ga0157370_10002201 3300013104 Bacteria 23794
550 Ga0157370_10002697 3300013104 Bacteria 21279
551 Ga0157370_10003755 3300013104 Bacteria 17739
552 Ga0157370_10006791 3300013104 Bacteria 12551
553 Ga0157370_10047041 3300013104 Bacteria 4136
554 Ga0157370_10052446 3300013104 Bacteria 3894
555 Ga0157370_10078710 3300013104 Bacteria 3104
556 Ga0157370_10084917 3300013104 Bacteria 2974
557 Ga0157370_10090679 3300013104 Unclassified 2870
558 Ga0157370_10103881 3300013104 Bacteria 2660
559 Ga0157370_10228662 3300013104 Bacteria 1722
560 Ga0157370_10292857 3300013104 Bacteria 1503
561 Ga0157370_10391517 3300013104 Bacteria 1279
562 Ga0157370_10402205 3300013104 Bacteria 1260
563 Ga0157370_10498687 3300013104 Unclassified 1118
564 Ga0157370_10519839 3300013104 Bacteria 1092
565 Ga0157370_10939058 3300013104 Bacteria 784
566 Ga0157370_11143492 3300013104 Unclassified 703
567 Ga0157370_11919463 3300013104 Unclassified 531
568 Ga0157369_10010912 3300013105 Bacteria 10344
569 Ga0157369_10055924 3300013105 Bacteria 4258
570 Ga0157369_10067384 3300013105 Bacteria 3848
571 Ga0157369_10098649 3300013105 Bacteria 3114
572 Ga0157369_10159214 3300013105 Bacteria 2384
573 Ga0157369_10204129 3300013105 Bacteria 2073
574 Ga0157369_10226437 3300013105 Bacteria 1956
575 Ga0157369_10243622 3300013105 Bacteria 1877
576 Ga0157369_10267435 3300013105 Unclassified 1782
577 Ga0157369_10436813 3300013105 Bacteria 1356
578 Ga0157369_10768753 3300013105 Unclassified 990
579 Ga0157369_11336898 3300013105 Unclassified 730
580 Ga0157369_11710858 3300013105 Bacteria 639
581 Ga0157374_10000011 3300013296 Bacteria 466749
582 Ga0157374_10008439 3300013296 Bacteria 8803
583 Ga0157374_10013524 3300013296 Bacteria 7124
584 Ga0157374_10040149 3300013296 Bacteria 4308
585 Ga0157374_10110565 3300013296 Bacteria 2643
586 Ga0157374_10216940 3300013296 Bacteria 1877
587 Ga0157374_10283094 3300013296 Bacteria 1637
588 Ga0157374_10307497 3300013296 Bacteria 1569
589 Ga0157374_10812862 3300013296 Bacteria 951
590 Ga0157374_11122917 3300013296 Bacteria 807
591 Ga0157378_10003243 3300013297 Bacteria 14474
592 Ga0157378_10027043 3300013297 Bacteria 5061
593 Ga0157378_10041196 3300013297 Bacteria 4096
594 Ga0157378_10228507 3300013297 Bacteria 1772
595 Ga0157378_10233520 3300013297 Bacteria 1754
596 Ga0157378_10821083 3300013297 Bacteria 956
597 Ga0157378_11199688 3300013297 Bacteria 798
598 Ga0157378_11405307 3300013297 Bacteria 741
599 Ga0157378_11474637 3300013297 Bacteria 724
600 Ga0157378_11490077 3300013297 Bacteria 721
601 Ga0157378_11906018 3300013297 Bacteria 643
602 Ga0163162_10000112 3300013306 Bacteria 72032
603 Ga0163162_10000614 3300013306 Bacteria 33070
604 Ga0163162_10000913 3300013306 Bacteria 27444
605 Ga0163162_10001319 3300013306 Bacteria 23168
606 Ga0163162_10002392 3300013306 Bacteria 17651
607 Ga0163162_10015374 3300013306 Bacteria 7477
608 Ga0163162_10023043 3300013306 Bacteria 6142
609 Ga0163162_10035099 3300013306 Bacteria 4994
610 Ga0163162_10053588 3300013306 Bacteria 4055
611 Ga0163162_10144246 3300013306 Bacteria 2496
612 Ga0163162_10157063 3300013306 Bacteria 2395
613 Ga0163162_10177223 3300013306 Bacteria 2257
614 Ga0163162_10224020 3300013306 Bacteria 2010
615 Ga0163162_10357940 3300013306 Bacteria 1592
616 Ga0163162_10420505 3300013306 Bacteria 1469
617 Ga0163162_10819656 3300013306 Unclassified 1047
618 Ga0163162_10886818 3300013306 Bacteria 1006
619 Ga0163162_11111615 3300013306 Bacteria 896
620 Ga0157372_10000642 3300013307 Bacteria 38382
621 Ga0157372_10001903 3300013307 Bacteria 22652
622 Ga0157372_10003342 3300013307 Bacteria 17320
623 Ga0157372_10006578 3300013307 Bacteria 12366
624 Ga0157372_10009931 3300013307 Bacteria 10124
625 Ga0157372_10022298 3300013307 Bacteria 6850
626 Ga0157372_10049589 3300013307 Bacteria 4669
627 Ga0157372_10054021 3300013307 Bacteria 4479
628 Ga0157372_10065202 3300013307 Bacteria 4089
629 Ga0157372_10069651 3300013307 Bacteria 3956
630 Ga0157372_10083334 3300013307 Bacteria 3622
631 Ga0157372_10093125 3300013307 Bacteria 3429
632 Ga0157372_10172855 3300013307 Bacteria 2500
633 Ga0157372_10264813 3300013307 Bacteria 1996
634 Ga0157372_10283077 3300013307 Bacteria 1928
635 Ga0157372_10311534 3300013307 Bacteria 1832
636 Ga0157372_10374589 3300013307 Bacteria 1659
637 Ga0157372_10388377 3300013307 Bacteria 1626
638 Ga0157372_10488483 3300013307 Bacteria 1436
639 Ga0157372_10575956 3300013307 Bacteria 1312
640 Ga0157372_10910724 3300013307 Bacteria 1020
641 Ga0157372_10931406 3300013307 Unclassified 1007
642 Ga0157372_11173754 3300013307 Bacteria 887
643 Ga0157375_10000601 3300013308 Bacteria 31961
644 Ga0157375_10012310 3300013308 Bacteria 7586
645 Ga0157375_10022970 3300013308 Bacteria 5749
646 Ga0157375_10028715 3300013308 Bacteria 5220
647 Ga0157375_10674013 3300013308 Bacteria 1189
648 Ga0157375_12777891 3300013308 Bacteria 585
649 Ga0163163_10000690 3300014325 Bacteria 28697
650 Ga0163163_10006303 3300014325 Bacteria 10356
651 Ga0163163_10107682 3300014325 Bacteria 2814
652 Ga0163163_10113399 3300014325 Bacteria 2741
653 Ga0163163_10116364 3300014325 Unclassified 2704
654 Ga0163163_10181011 3300014325 Unclassified 2155
655 Ga0163163_10308086 3300014325 Bacteria 1636
656 Ga0163163_10414792 3300014325 Bacteria 1405
657 Ga0157380_10014204 3300014326 Bacteria 5823
658 Ga0157380_10085888 3300014326 Bacteria 2584
659 Ga0157380_10247952 3300014326 Bacteria 1610
660 Ga0157380_10580194 3300014326 Bacteria 1106
661 Ga0157380_11533395 3300014326 Bacteria 720
662 Ga0157380_11772287 3300014326 Bacteria 676
663 Ga0157377_10004274 3300014745 Bacteria 6550
664 Ga0157377_10123596 3300014745 Bacteria 1572
665 Ga0157377_10776138 3300014745 Bacteria 704
666 Ga0157379_10041837 3300014968 Bacteria 4090
667 Ga0157379_10086985 3300014968 Bacteria 2802
668 Ga0157379_10155677 3300014968 Bacteria 2062
669 Ga0157379_10394826 3300014968 Bacteria 1271
670 Ga0157379_10412309 3300014968 Bacteria 1243
671 Ga0157379_10671618 3300014968 Bacteria 971
672 Ga0157379_10923899 3300014968 Unclassified 829
673 Ga0157379_11923917 3300014968 Bacteria 583
674 Ga0157376_10000444 3300014969 Bacteria 26696
675 Ga0157376_10002197 3300014969 Bacteria 13158
676 Ga0157376_10003806 3300014969 Bacteria 10437
677 Ga0157376_10079302 3300014969 Bacteria 2814
678 Ga0157376_10082599 3300014969 Bacteria 2761
679 Ga0157376_10249085 3300014969 Bacteria 1658
680 Ga0157376_10333775 3300014969 Bacteria 1445
681 Ga0157376_10761157 3300014969 Bacteria 978
682 Ga0157376_12141406 3300014969 Bacteria 598
683 Ga0182006_1004104 3300015261 Bacteria 7253
684 Ga0182006_1068182 3300015261 Bacteria 1326
685 Ga0182006_1070382 3300015261 Bacteria 1299
686 Ga0182005_1207556 3300015265 Bacteria 591
687 Ga0163161_10014070 3300017792 Bacteria 5570
688 Ga0163161_10017711 3300017792 Bacteria 4991
689 Ga0163161_10017989 3300017792 Bacteria 4954
690 Ga0163161_10029789 3300017792 Bacteria 3879
691 Ga0163161_10091444 3300017792 Bacteria 2252
692 Ga0163161_10119903 3300017792 Bacteria 1976
693 Ga0163161_10430865 3300017792 Bacteria 1063
694 Ga0163161_10518465 3300017792 Bacteria 973
695 Ga0163161_10662237 3300017792 Unclassified 866
696 Ga0163161_11069434 3300017792 Bacteria 692
697 Ga0213876_10011635 3300021384 Bacteria 4697
698 Ga0209646_1000615 3300025246 Bacteria 13711
699 Ga0207426_1000026 3300025302 Bacteria 515228
700 Ga0207697_10340488 3300025315 Bacteria 666
701 Ga0207656_10000132 3300025321 Bacteria 27869
702 Ga0207656_10074719 3300025321 Bacteria 1513
703 Ga0207656_10175732 3300025321 Bacteria 1025
704 Ga0207656_10266838 3300025321 Bacteria 842
705 Ga0207656_10506713 3300025321 Unclassified 613
706 Ga0207682_10304172 3300025893 Bacteria 748
707 Ga0207710_10018757 3300025900 Unclassified 2944
708 Ga0207688_10376825 3300025901 Bacteria 877
709 Ga0207680_10000037 3300025903 Bacteria 72773
710 Ga0207680_10008931 3300025903 Bacteria 4943
711 Ga0207680_10662740 3300025903 Bacteria 747
712 Ga0207680_11131587 3300025903 Bacteria 559
713 Ga0207647_10000086 3300025904 Bacteria 71173
714 Ga0207647_10012136 3300025904 Bacteria 6012
715 Ga0207647_10065279 3300025904 Bacteria 2210
716 Ga0207647_10079256 3300025904 Unclassified 1972
717 Ga0207647_10094433 3300025904 Bacteria 1782
718 Ga0207647_10352870 3300025904 Unclassified 833
719 Ga0207647_10401203 3300025904 Bacteria 772
720 Ga0207685_10152165 3300025905 Bacteria 1048
721 Ga0207645_10013030 3300025907 Bacteria 5619
722 Ga0207645_10132267 3300025907 Bacteria 1624
723 Ga0207643_10013487 3300025908 Unclassified 4428
724 Ga0207643_10391408 3300025908 Bacteria 878
725 Ga0207643_10504190 3300025908 Bacteria 774
726 Ga0207705_10018887 3300025909 Bacteria 4929
727 Ga0207705_10019038 3300025909 Bacteria 4910
728 Ga0207705_10080317 3300025909 Bacteria 2376
729 Ga0207705_10104249 3300025909 Bacteria 2089
730 Ga0207705_10179161 3300025909 Bacteria 1599
731 Ga0207705_10208432 3300025909 Bacteria 1482
732 Ga0207705_10489519 3300025909 Bacteria 955
733 Ga0207705_10587618 3300025909 Unclassified 866
734 Ga0207705_11007036 3300025909 Bacteria 644
735 Ga0207705_11166358 3300025909 Bacteria 592
736 Ga0207654_10000603 3300025911 Bacteria 20269
737 Ga0207654_10001578 3300025911 Bacteria 11966
738 Ga0207654_10044014 3300025911 Bacteria 2533
739 Ga0207654_10048701 3300025911 Bacteria 2426
740 Ga0207654_10171803 3300025911 Bacteria 1408
741 Ga0207654_10344936 3300025911 Bacteria 1024
742 Ga0207707_10001095 3300025912 Bacteria 25842
743 Ga0207707_10003005 3300025912 Bacteria 14994
744 Ga0207707_10039720 3300025912 Bacteria 4113
745 Ga0207707_10151526 3300025912 Bacteria 2027
746 Ga0207707_10292415 3300025912 Bacteria 1409
747 Ga0207707_10469739 3300025912 Bacteria 1075
748 Ga0207707_10573862 3300025912 Bacteria 957
749 Ga0207707_10667748 3300025912 Unclassified 875
750 Ga0207707_10793583 3300025912 Bacteria 789
751 Ga0207695_10000212 3300025913 Bacteria 156450
752 Ga0207695_10000346 3300025913 Bacteria 107028
753 Ga0207695_10012325 3300025913 Bacteria 10271
754 Ga0207695_10012913 3300025913 Bacteria 9996
755 Ga0207695_10023689 3300025913 Bacteria 6928
756 Ga0207695_10024645 3300025913 Bacteria 6758
757 Ga0207695_10143899 3300025913 Bacteria 2330
758 Ga0207695_10152134 3300025913 Bacteria 2252
759 Ga0207695_10414904 3300025913 Bacteria 1231
760 Ga0207695_10552655 3300025913 Bacteria 1033
761 Ga0207695_11243858 3300025913 Bacteria 625
762 Ga0207671_10000248 3300025914 Bacteria 80829
763 Ga0207671_10003841 3300025914 Bacteria 14699
764 Ga0207671_10004209 3300025914 Bacteria 13867
765 Ga0207671_10004941 3300025914 Bacteria 12504
766 Ga0207671_10007992 3300025914 Bacteria 9058
767 Ga0207671_10010299 3300025914 Bacteria 7727
768 Ga0207671_10154787 3300025914 Bacteria 1773
769 Ga0207671_10173267 3300025914 Bacteria 1676
770 Ga0207671_10417167 3300025914 Bacteria 1068
771 Ga0207671_10808666 3300025914 Bacteria 743
772 Ga0207671_10950195 3300025914 Bacteria 678
773 Ga0207671_11073762 3300025914 Bacteria 633
774 Ga0207660_10010737 3300025917 Bacteria 5952
775 Ga0207660_10010923 3300025917 Bacteria 5903
776 Ga0207660_10021974 3300025917 Bacteria 4295
777 Ga0207660_10163629 3300025917 Bacteria 1718
778 Ga0207660_10205388 3300025917 Bacteria 1540
779 Ga0207660_10482738 3300025917 Bacteria 1004
780 Ga0207657_10012542 3300025919 Bacteria 8358
781 Ga0207657_10027470 3300025919 Bacteria 5212
782 Ga0207657_10040703 3300025919 Bacteria 4115
783 Ga0207657_10041096 3300025919 Bacteria 4091
784 Ga0207657_10104569 3300025919 Bacteria 2345
785 Ga0207657_10165810 3300025919 Bacteria 1792
786 Ga0207657_10366888 3300025919 Bacteria 1134
787 Ga0207649_10003473 3300025920 Bacteria 8611
788 Ga0207649_10013303 3300025920 Bacteria 4591
789 Ga0207649_10088573 3300025920 Bacteria 2021
790 Ga0207652_10000098 3300025921 Bacteria 94858
791 Ga0207652_10000187 3300025921 Bacteria 65282
792 Ga0207652_10004110 3300025921 Bacteria 11877
793 Ga0207652_10016975 3300025921 Bacteria 5954
794 Ga0207652_10017593 3300025921 Bacteria 5852
795 Ga0207652_10137261 3300025921 Bacteria 2185
796 Ga0207652_10595033 3300025921 Bacteria 992
797 Ga0207652_10956727 3300025921 Bacteria 754
798 Ga0207652_11232450 3300025921 Bacteria 650
799 Ga0207681_10003766 3300025923 Bacteria 9420
800 Ga0207694_10144872 3300025924 Bacteria 1912
801 Ga0207694_10736733 3300025924 Unclassified 832
802 Ga0207694_11199448 3300025924 Unclassified 642
803 Ga0207650_10029628 3300025925 Bacteria 3936
804 Ga0207650_10102447 3300025925 Bacteria 2206
805 Ga0207650_10113180 3300025925 Bacteria 2103
806 Ga0207650_10118765 3300025925 Bacteria 2056
807 Ga0207650_10172888 3300025925 Unclassified 1718
808 Ga0207650_10214898 3300025925 Bacteria 1545
809 Ga0207650_10218448 3300025925 Bacteria 1533
810 Ga0207650_10236092 3300025925 Bacteria 1476
811 Ga0207650_10280244 3300025925 Bacteria 1357
812 Ga0207650_10352943 3300025925 Bacteria 1210
813 Ga0207650_10388211 3300025925 Bacteria 1154
814 Ga0207650_11337743 3300025925 Bacteria 610
815 Ga0207659_10069228 3300025926 Unclassified 2569
816 Ga0207659_10530070 3300025926 Unclassified 999
817 Ga0207659_10627556 3300025926 Bacteria 917
818 Ga0207687_10238255 3300025927 Bacteria 1440
819 Ga0207687_11309720 3300025927 Unclassified 623
820 Ga0207644_10023065 3300025931 Unclassified 4258
821 Ga0207644_10092597 3300025931 Bacteria 2255
822 Ga0207644_10194911 3300025931 Bacteria 1595
823 Ga0207644_10316972 3300025931 Bacteria 1260
824 Ga0207644_10412530 3300025931 Unclassified 1105
825 Ga0207644_10444848 3300025931 Bacteria 1064
826 Ga0207644_10733144 3300025931 Bacteria 825
827 Ga0207690_10009616 3300025932 Bacteria 5739
828 Ga0207690_10025651 3300025932 Bacteria 3704
829 Ga0207690_10052960 3300025932 Bacteria 2721
830 Ga0207690_10109963 3300025932 Bacteria 1983
831 Ga0207690_10111840 3300025932 Bacteria 1969
832 Ga0207690_10214256 3300025932 Bacteria 1470
833 Ga0207690_10323946 3300025932 Bacteria 1212
834 Ga0207690_10446319 3300025932 Bacteria 1039
835 Ga0207690_11577169 3300025932 Unclassified 549
836 Ga0207706_10002794 3300025933 Bacteria 16962
837 Ga0207706_10004604 3300025933 Bacteria 12944
838 Ga0207706_10050692 3300025933 Bacteria 3668
839 Ga0207706_10395973 3300025933 Bacteria 1198
840 Ga0207706_11027027 3300025933 Bacteria 692
841 Ga0207686_10080916 3300025934 Unclassified 2119
842 Ga0207686_10441310 3300025934 Bacteria 999
843 Ga0207686_10837110 3300025934 Unclassified 739
844 Ga0207670_10026553 3300025936 Bacteria 3650
845 Ga0207669_10179454 3300025937 Bacteria 1516
846 Ga0207669_11095037 3300025937 Bacteria 672
847 Ga0207669_11106951 3300025937 Bacteria 669
848 Ga0207704_10064176 3300025938 Bacteria 2293
849 Ga0207704_10698521 3300025938 Bacteria 840
850 Ga0207691_10044889 3300025940 Bacteria 4066
851 Ga0207691_10231081 3300025940 Bacteria 1602
852 Ga0207691_10231473 3300025940 Bacteria 1600
853 Ga0207691_10369391 3300025940 Bacteria 1226
854 Ga0207689_10008996 3300025942 Bacteria 8650
855 Ga0207689_10010524 3300025942 Bacteria 7965
856 Ga0207689_10019882 3300025942 Bacteria 5657
857 Ga0207689_10038034 3300025942 Bacteria 3987
858 Ga0207689_10083353 3300025942 Bacteria 2629
859 Ga0207689_10116850 3300025942 Bacteria 2193
860 Ga0207689_10131150 3300025942 Bacteria 2063
861 Ga0207689_10309882 3300025942 Bacteria 1309
862 Ga0207689_10384479 3300025942 Bacteria 1169
863 Ga0207661_10005555 3300025944 Bacteria 8894
864 Ga0207661_10020210 3300025944 Bacteria 4972
865 Ga0207661_10143447 3300025944 Bacteria 2057
866 Ga0207661_10166174 3300025944 Bacteria 1918
867 Ga0207661_10329120 3300025944 Bacteria 1375
868 Ga0207661_10897967 3300025944 Bacteria 816
869 Ga0207661_10925058 3300025944 Bacteria 803
870 Ga0207661_11180483 3300025944 Bacteria 704
871 Ga0207661_11459269 3300025944 Bacteria 627
872 Ga0207661_11796899 3300025944 Unclassified 558
873 Ga0207679_10007220 3300025945 Bacteria 7040
874 Ga0207679_10028024 3300025945 Bacteria 3904
875 Ga0207679_10044269 3300025945 Bacteria 3211
876 Ga0207679_10199883 3300025945 Bacteria 1669
877 Ga0207679_10289072 3300025945 Bacteria 1409
878 Ga0207679_10345930 3300025945 Bacteria 1295
879 Ga0207667_10000414 3300025949 Bacteria 57815
880 Ga0207667_10000508 3300025949 Bacteria 51422
881 Ga0207667_10002151 3300025949 Bacteria 24703
882 Ga0207667_10010172 3300025949 Bacteria 11018
883 Ga0207667_10017202 3300025949 Bacteria 8148
884 Ga0207667_10018745 3300025949 Bacteria 7750
885 Ga0207667_10042007 3300025949 Bacteria 4863
886 Ga0207667_10065806 3300025949 Bacteria 3779
887 Ga0207667_10112170 3300025949 Unclassified 2812
888 Ga0207667_10245114 3300025949 Bacteria 1833
889 Ga0207667_10335983 3300025949 Bacteria 1542
890 Ga0207667_10445162 3300025949 Bacteria 1317
891 Ga0207667_10449798 3300025949 Bacteria 1309
892 Ga0207667_11042637 3300025949 Bacteria 803
893 Ga0207651_10054734 3300025960 Bacteria 2736
894 Ga0207651_10234627 3300025960 Bacteria 1492
895 Ga0207651_10352401 3300025960 Bacteria 1240
896 Ga0207651_10521355 3300025960 Bacteria 1030
897 Ga0207712_10003486 3300025961 Bacteria 9928
898 Ga0207712_10033824 3300025961 Bacteria 3458
899 Ga0207712_10139903 3300025961 Bacteria 1856
900 Ga0207712_10289941 3300025961 Unclassified 1339
901 Ga0207712_10376531 3300025961 Bacteria 1187
902 Ga0207712_11286511 3300025961 Bacteria 653
903 Ga0207668_10022839 3300025972 Bacteria 4010
904 Ga0207668_10513460 3300025972 Bacteria 1033
905 Ga0207640_10008730 3300025981 Bacteria 5639
906 Ga0207640_10038740 3300025981 Bacteria 3011
907 Ga0207640_10041625 3300025981 Bacteria 2923
908 Ga0207640_10087714 3300025981 Bacteria 2146
909 Ga0207640_10201658 3300025981 Bacteria 1508
910 Ga0207640_10218684 3300025981 Bacteria 1457
911 Ga0207640_10359763 3300025981 Bacteria 1172
912 Ga0207640_10821985 3300025981 Unclassified 806
913 Ga0207640_10882634 3300025981 Unclassified 780
914 Ga0207640_11331286 3300025981 Bacteria 642
915 Ga0207658_10025608 3300025986 Bacteria 4131
916 Ga0207658_10027875 3300025986 Bacteria 3973
917 Ga0207658_10041271 3300025986 Bacteria 3340
918 Ga0207658_10078943 3300025986 Unclassified 2516
919 Ga0207658_10334220 3300025986 Bacteria 1315
920 Ga0207658_10480479 3300025986 Bacteria 1104
921 Ga0207658_11334051 3300025986 Bacteria 656
922 Ga0207677_10010196 3300026023 Bacteria 5310
923 Ga0207677_10011773 3300026023 Bacteria 5001
924 Ga0207677_10016256 3300026023 Bacteria 4400
925 Ga0207677_10061897 3300026023 Bacteria 2594
926 Ga0207677_10095818 3300026023 Bacteria 2170
927 Ga0207677_10190694 3300026023 Bacteria 1621
928 Ga0207677_10205422 3300026023 Bacteria 1569
929 Ga0207677_10370480 3300026023 Unclassified 1206
930 Ga0207677_10589524 3300026023 Unclassified 974
931 Ga0207677_10604982 3300026023 Bacteria 962
932 Ga0207677_10948131 3300026023 Unclassified 778
933 Ga0207677_11257820 3300026023 Bacteria 679
934 Ga0207703_10081669 3300026035 Unclassified 2695
935 Ga0207703_10541075 3300026035 Bacteria 1097
936 Ga0207703_11189035 3300026035 Bacteria 733
937 Ga0207639_10023610 3300026041 Unclassified 4441
938 Ga0207639_10048758 3300026041 Bacteria 3207
939 Ga0207639_10049837 3300026041 Bacteria 3178
940 Ga0207639_10057966 3300026041 Bacteria 2976
941 Ga0207639_10059099 3300026041 Bacteria 2952
942 Ga0207639_10077014 3300026041 Bacteria 2628
943 Ga0207639_10203954 3300026041 Unclassified 1698
944 Ga0207639_10244613 3300026041 Bacteria 1562
945 Ga0207639_10289053 3300026041 Bacteria 1445
946 Ga0207639_10475086 3300026041 Bacteria 1138
947 Ga0207639_10661030 3300026041 Bacteria 967
948 Ga0207639_10842927 3300026041 Bacteria 855
949 Ga0207639_11198379 3300026041 Bacteria 713
950 Ga0207639_11490069 3300026041 Bacteria 635
951 Ga0207678_10068955 3300026067 Bacteria 3033
952 Ga0207708_10684310 3300026075 Bacteria 876
953 Ga0207708_10948449 3300026075 Unclassified 746
954 Ga0207702_10016072 3300026078 Bacteria 6195
955 Ga0207702_10025459 3300026078 Bacteria 4910
956 Ga0207702_10044287 3300026078 Bacteria 3740
957 Ga0207702_10111012 3300026078 Bacteria 2438
958 Ga0207702_10246690 3300026078 Bacteria 1675
959 Ga0207641_10000186 3300026088 Bacteria 86601
960 Ga0207641_10049636 3300026088 Bacteria 3547
961 Ga0207641_10053280 3300026088 Bacteria 3429
962 Ga0207641_10158359 3300026088 Bacteria 2056
963 Ga0207641_10277307 3300026088 Unclassified 1575
964 Ga0207641_10342402 3300026088 Bacteria 1423
965 Ga0207648_10005206 3300026089 Bacteria 13172
966 Ga0207648_10005571 3300026089 Bacteria 12669
967 Ga0207648_10008521 3300026089 Bacteria 9925
968 Ga0207648_10049595 3300026089 Bacteria 3673
969 Ga0207648_10213606 3300026089 Bacteria 1713
970 Ga0207648_10243008 3300026089 Unclassified 1603
971 Ga0207648_10269701 3300026089 Bacteria 1520
972 Ga0207648_10292519 3300026089 Bacteria 1459
973 Ga0207648_10420558 3300026089 Bacteria 1213
974 Ga0207648_10483197 3300026089 Bacteria 1131
975 Ga0207676_10009191 3300026095 Bacteria 7036
976 Ga0207676_10151138 3300026095 Bacteria 2000
977 Ga0207676_10183324 3300026095 Bacteria 1835
978 Ga0207676_10390576 3300026095 Bacteria 1298
979 Ga0207676_11119210 3300026095 Bacteria 779
980 Ga0207676_11257785 3300026095 Bacteria 734
981 Ga0207676_11344209 3300026095 Unclassified 710
982 Ga0207674_10001615 3300026116 Bacteria 29028
983 Ga0207674_10003228 3300026116 Bacteria 20079
984 Ga0207674_10009705 3300026116 Bacteria 10971
985 Ga0207674_10017319 3300026116 Bacteria 7861
986 Ga0207674_10115643 3300026116 Bacteria 2654
987 Ga0207674_10161757 3300026116 Bacteria 2193
988 Ga0207674_10250621 3300026116 Bacteria 1718
989 Ga0207674_10547226 3300026116 Bacteria 1118
990 Ga0207674_11026660 3300026116 Bacteria 794
991 Ga0207674_11032346 3300026116 Bacteria 791
992 Ga0207674_11910000 3300026116 Bacteria 560
993 Ga0207675_100000260 3300026118 Bacteria 50253
994 Ga0207675_100100049 3300026118 Bacteria 2731
995 Ga0207675_100422306 3300026118 Bacteria 1317
996 Ga0207675_100432829 3300026118 Unclassified 1301
997 Ga0207675_100487356 3300026118 Bacteria 1226
998 Ga0207675_100566034 3300026118 Bacteria 1137
999 Ga0207675_101084216 3300026118 Bacteria 820
1000 Ga0207675_101408724 3300026118 Bacteria 718
1001 Ga0207683_10076815 3300026121 Bacteria 2957
1002 Ga0207683_11572356 3300026121 Bacteria 607
1003 Ga0207683_11581786 3300026121 Bacteria 605
1004 Ga0207698_10000937 3300026142 Bacteria 16993
1005 Ga0207698_10007208 3300026142 Bacteria 6966
1006 Ga0207698_10036780 3300026142 Bacteria 3598
1007 Ga0207698_10041425 3300026142 Bacteria 3431
1008 Ga0207698_10070264 3300026142 Bacteria 2773
1009 Ga0207698_10089985 3300026142 Unclassified 2509
1010 Ga0207698_10128171 3300026142 Bacteria 2163
1011 Ga0207698_10207660 3300026142 Bacteria 1759
1012 Ga0207698_10212367 3300026142 Bacteria 1742
1013 Ga0207698_10804868 3300026142 Unclassified 942
1014 Ga0207698_11031882 3300026142 Unclassified 834
1015 Ga0207698_11243762 3300026142 Bacteria 759
1016 Ga0207698_11269255 3300026142 Unclassified 751
1017 Ga0207698_11394471 3300026142 Bacteria 716
1018 Ga0209281_1000396 3300027111 Bacteria 67930
1019 Ga0209489_116336 3300027361 Bacteria 4017
1020 Ga0209995_1008477 3300027471 Bacteria 1659
1021 Ga0209968_1004295 3300027526 Bacteria 2139
1022 Ga0209999_1017942 3300027543 Bacteria 1293
1023 Ga0209999_1038006 3300027543 Unclassified 900
1024 Ga0210002_1008487 3300027617 Bacteria 1565
1025 Ga0209282_1008316 3300027666 Bacteria 6540
1026 Ga0209974_10038738 3300027876 Bacteria 1584
1027 Ga0209974_10048504 3300027876 Unclassified 1424
1028 Ga0207428_10500513 3300027907 Unclassified 882
1029 Ga0268266_10000068 3300028379 Bacteria 241100
1030 Ga0268266_11533441 3300028379 Unclassified 642
1031 Ga0268266_11745549 3300028379 Bacteria 597
1032 Ga0268265_10034607 3300028380 Bacteria 3684
1033 Ga0268265_10130336 3300028380 Bacteria 2088
1034 Ga0268265_10335057 3300028380 Unclassified 1375
1035 Ga0268265_10497705 3300028380 Bacteria 1148
1036 Ga0268265_10833615 3300028380 Bacteria 901
1037 Ga0268265_12204435 3300028380 Bacteria 558
1038 Ga0268264_10000079 3300028381 Bacteria 249516
1039 Ga0268264_10003346 3300028381 Bacteria 13854
1040 Ga0268264_10013568 3300028381 Bacteria 6708
1041 Ga0268264_10017116 3300028381 Bacteria 5936
1042 Ga0268264_10023995 3300028381 Bacteria 4977
1043 Ga0268264_10082379 3300028381 Bacteria 2753
1044 Ga0268264_10168844 3300028381 Bacteria 1977
1045 Ga0268264_10482341 3300028381 Unclassified 1206
1046 Ga0268264_11047550 3300028381 Bacteria 823
1047 Ga0307517_10002947 3300028786 Bacteria 26911
1048 Ga0307515_10000001 3300028794 Bacteria 4259510
1049 Ga0307515_10000021 3300028794 Bacteria 406008
1050 Ga0265320_10111142 3300031240 Unclassified 1255
1051 Ga0265327_10000207 3300031251 Bacteria 123193
1052 Ga0265327_10005701 3300031251 Bacteria 10277
1053 Ga0307513_10039035 3300031456 Bacteria 5266
1054 Ga0307513_10106944 3300031456 Bacteria 2802
1055 Ga0307513_10157913 3300031456 Bacteria 2165
1056 Ga0307509_10024866 3300031507 Bacteria 6700
1057 Ga0307509_10187009 3300031507 Bacteria 1928
1058 Ga0307408_100000226 3300031548 Bacteria 60055
1059 Ga0307408_100002021 3300031548 Bacteria 14636
1060 Ga0265313_10038820 3300031595 Bacteria 2368
1061 Ga0307508_10185419 3300031616 Bacteria 1683
1062 Ga0265314_10031558 3300031711 Unclassified 3908
1063 Ga0307516_10003590 3300031730 Bacteria 19774
1064 Ga0307413_10000980 3300031824 Bacteria 10250
1065 Ga0307413_11002778 3300031824 Bacteria 716
1066 Ga0307410_10000055 3300031852 Bacteria 40536
1067 Ga0307406_10000009 3300031901 Bacteria 119997
1068 Ga0307407_10002591 3300031903 Bacteria 7133
1069 Ga0307407_10276756 3300031903 Unclassified 1161
1070 Ga0307412_10216516 3300031911 Unclassified 1465
1071 Ga0307416_100013659 3300032002 Bacteria 5529
1072 Ga0307414_10000001 3300032004 Bacteria 1352954
1073 Ga0307414_10179819 3300032004 Bacteria 1700
1074 Ga0307414_11227380 3300032004 Bacteria 694
1075 Ga0307411_10000005 3300032005 Bacteria 391311
1076 Ga0307510_10009449 3300033180 Bacteria 11612
1077 Ga0307510_10085677 3300033180 Bacteria 3026
1078 Ga0373950_0053927 3300034818 Bacteria 795
1079 Ga0373944_0125843 3300035089 Bacteria 887
1080 Ga0373923_0219856 3300035111 Bacteria 883
1081 Ga0373936_0101529 3300035113 Bacteria 1214
1082 Ga0373945_0167667 3300035116 Unclassified 898
1083 Ga0373953_0200254 3300035117 Bacteria 864
1084 Ga0316574_0027664 3300035398 Bacteria 3416
1085 Ga0316574_0036521 3300035398 Bacteria 3009
1086 Ga0373924_0016301 3300035410 Bacteria 2836
1087 Ga0373935_0512971 3300035692 Unclassified 871
1088 Ga0373927_0137380 3300035695 Bacteria 1598
1089 Ga0373947_0432023 3300035725 Bacteria 891
1090 Ga0373937_0286019 3300036401 Bacteria 1557
1091 Ga0395899_0005847 3300037312 Bacteria 9547
1092 Ga0395899_0108766 3300037312 Bacteria 1995
1093 Ga0395899_0133684 3300037312 Bacteria 1769
1094 Ga0395899_0146068 3300037312 Bacteria 1679
1095 Ga0395899_0188206 3300037312 Bacteria 1445
1096 Ga0395899_0189946 3300037312 Unclassified 1437
1097 Ga0395899_0376373 3300037312 Bacteria 944
1098 Ga0395899_0548865 3300037312 Bacteria 743
1099 Ga0395900_0001053 3300037418 Bacteria 35357
1100 Ga0395900_0024582 3300037418 Bacteria 6168
1101 Ga0395900_0056513 3300037418 Bacteria 4039
1102 Ga0395900_0092965 3300037418 Bacteria 3098
1103 Ga0395900_0094931 3300037418 Bacteria 3064
1104 Ga0395900_0125925 3300037418 Bacteria 2627
1105 Ga0395900_0139061 3300037418 Bacteria 2487
1106 Ga0395900_0951123 3300037418 Bacteria 780
1107 Ga0395898_0001255 3300037466 Bacteria 37709
1108 Ga0395898_0009393 3300037466 Bacteria 10271
1109 Ga0395898_0013305 3300037466 Bacteria 8473
1110 Ga0395898_0040554 3300037466 Bacteria 4603
1111 Ga0395898_0108657 3300037466 Bacteria 2659
1112 Ga0395898_0419425 3300037466 Bacteria 1275
1113 Ga0395905_0005445 3300037471 Bacteria 12995
1114 Ga0395905_0026031 3300037471 Bacteria 5516
1115 Ga0395905_0625759 3300037471 Bacteria 978
1116 Ga0395901_0012608 3300038443 Bacteria 8578
1117 Ga0395901_0015192 3300038443 Bacteria 7832
1118 Ga0395901_0017810 3300038443 Bacteria 7250
1119 Ga0395901_0032794 3300038443 Bacteria 5358
1120 Ga0436365_1125454 3300039437 Unclassified 772
1121 Ga0436365_1302212 3300039437 Bacteria 1319
1122 Ga0436365_1890468 3300039437 Bacteria 4997
1123 Ga0436363_0004136 3300039450 Bacteria 627
1124 Ga0439436_0002646 3300041404 Bacteria 5397
1125 Ga0439439_0025777 3300041406 Bacteria 1480
1126 Ga0439439_0052659 3300041406 Bacteria 1069
1127 Ga0439439_0182038 3300041406 Unclassified 606
1128 Ga0439466_0212465 3300041411 Bacteria 588
1129 Ga0439465_0005991 3300041413 Bacteria 3864
1130 Ga0451791_0515634 3300041451 Bacteria 701
1131 Ga0451793_0601848 3300041452 Bacteria 810
1132 Ga0451839_0454805 3300041496 Bacteria 577
1133 Ga0451841_0452700 3300041498 Unclassified 975
1134 Ga0451849_0650367 3300041505 Bacteria 857
1135 Ga0451853_2225719 3300041512 Bacteria 1329
1136 Ga0439433_0016338 3300041999 Bacteria 1644
1137 Ga0439449_0010209 3300042007 Bacteria 3547
1138 Ga0439449_0020085 3300042007 Bacteria 2503
1139 Ga0439449_0031510 3300042007 Unclassified 1976
1140 Ga0439457_000072 3300042014 Bacteria 22114
1141 Ga0439457_005986 3300042014 Unclassified 3006
1142 Ga0439462_0000326 3300042015 Bacteria 8900
1143 Ga0450894_009463 3300042131 Bacteria 1264
1144 Ga0450899_030081 3300042135 Bacteria 658
1145 Ga0451577_0002854 3300042876 Bacteria 19874
1146 Ga0451577_0231088 3300042876 Unclassified 1673
1147 Ga0451577_1072455 3300042876 Unclassified 722
1148 Ga0466969_0001643 3300044656 Bacteria 11991
1149 Ga0466972_0000204 3300044658 Bacteria 43459
1150 Ga0466972_0000997 3300044658 Bacteria 13620
1151 Ga0466972_0016147 3300044658 Bacteria 3732
1152 Ga0453683_0453588 3300044673 Unclassified 829
1153 Ga0466966_0000022 3300044684 Bacteria 112729
1154 Ga0466961_0092915 3300044693 Bacteria 1904
1155 Ga0466961_0328711 3300044693 Bacteria 932
1156 Ga0466963_0106044 3300044694 Bacteria 1927
1157 Ga0466964_0054878 3300044706 Unclassified 1644
1158 Ga0453684_0003119 3300044712 Bacteria 38168
1159 Ga0453684_0004342 3300044712 Bacteria 30126
1160 Ga0453684_0098167 3300044712 Bacteria 3592
1161 Ga0453684_0120656 3300044712 Bacteria 3166
1162 Ga0453684_0955610 3300044712 Bacteria 914
1163 Ga0466971_0028116 3300044719 Bacteria 2517
1164 Ga0466968_0170657 3300044735 Unclassified 1008
1165 Ga0466968_0511478 3300044735 Bacteria 599
1166 Ga0466968_0655450 3300044735 Bacteria 533
1167 Ga0466970_0133763 3300044765 Bacteria 1363
1168 Ga0466970_0213215 3300044765 Unclassified 1076
1169 Ga0466957_0000411 3300044842 Bacteria 20992
1170 Ga0466957_0011545 3300044842 Bacteria 5101
1171 Ga0466959_0028770 3300045049 Bacteria 4118
1172 Ga0466959_0057004 3300045049 Bacteria 2849
1173 Ga0466959_0941767 3300045049 Bacteria 576
1174 Ga0495629_0596565 3300046459 Bacteria 739
1175 Ga0495638_0014297 3300046460 Bacteria 5372
1176 Ga0495638_0444854 3300046460 Unclassified 663
1177 Ga0495580_0097568 3300046472 Unclassified 2044
1178 Ga0495606_0009699 3300046507 Bacteria 8103
1179 Ga0495606_0131709 3300046507 Bacteria 1486
1180 Ga0495608_0025157 3300046511 Bacteria 4064
1181 Ga0495630_0160724 3300046517 Bacteria 1710
1182 Ga0495630_1155992 3300046517 Bacteria 586
1183 Ga0495643_0012971 3300046522 Bacteria 5007
1184 Ga0495648_0003925 3300046524 Bacteria 12873
1185 Ga0495654_0067156 3300046530 Bacteria 1708
1186 Ga0495640_0473224 3300046533 Bacteria 764
1187 Ga0495587_0039031 3300046536 Bacteria 2845
1188 Ga0495621_0053204 3300046539 Bacteria 1453
1189 Ga0495668_0001067 3300046616 Bacteria 28949
1190 Ga0495611_0000435 3300046648 Bacteria 25748
1191 Ga0495611_0019835 3300046648 Unclassified 2890
1192 Ga0495625_0207884 3300046660 Bacteria 1288
1193 Ga0495625_0324267 3300046660 Unclassified 980
1194 Ga0495635_0058456 3300046663 Bacteria 2653
1195 Ga0495649_0082733 3300046694 Bacteria 1715
1196 Ga0495649_0446875 3300046694 Bacteria 646
1197 Ga0495600_0398349 3300046809 Bacteria 857
1198 Ga0495672_0018887 3300047320 Bacteria 4564
1199 Ga0495672_0057410 3300047320 Bacteria 2261
1200 Ga0495672_0117072 3300047320 Unclassified 1422
1201 Ga0495676_0491836 3300047321 Bacteria 806
1202 Ga0495680_0762038 3300047322 Bacteria 635
1203 Ga0495687_000058 3300047443 Bacteria 185830
1204 Ga0495675_0112045 3300047444 Bacteria 1703
1205 Ga0495686_0000005 3300047472 Bacteria 827143
1206 Ga0495686_0000843 3300047472 Bacteria 39372
1207 Ga0495686_0002207 3300047472 Bacteria 18912
1208 Ga0495686_0007602 3300047472 Bacteria 8094
1209 Ga0496101_0052642 3300048904 Bacteria 2936
1210 Ga0496104_1193583 3300048907 Bacteria 664
1211 Ga0496108_0709884 3300048911 Bacteria 872
1212 Ga0496110_1253146 3300048913 Bacteria 651
1213 Ga0496114_0129742 3300048917 Bacteria 2176
1214 Ga0496115_0530412 3300048918 Unclassified 943
1215 Ga0496116_0000041 3300048919 Bacteria 343299
1216 Ga0496117_0224436 3300048920 Bacteria 1043
1217 Ga0496118_0235661 3300048921 Bacteria 1052
1218 Ga0496121_0346271 3300048924 Bacteria 991
1219 Ga0496123_0115216 3300048926 Bacteria 1526
1220 Ga0496124_0004102 3300048927 Bacteria 17223
1221 Ga0496124_0245248 3300048927 Bacteria 1329
1222 Ga0496125_0000036 3300048928 Bacteria 335814
1223 Ga0496126_0003069 3300048929 Bacteria 21633
1224 Ga0501031_0036001 3300049568 Bacteria 3228
1225 Ga0501033_0442383 3300049570 Unclassified 904
1226 Ga0501034_0000007 3300049571 Bacteria 357805
1227 Ga0501034_0024166 3300049571 Bacteria 6182
1228 Ga0501034_0025167 3300049571 Bacteria 6058
1229 Ga0501034_0089489 3300049571 Bacteria 3076
1230 Ga0501037_0065379 3300049573 Bacteria 2650
1231 Ga0501037_0354932 3300049573 Bacteria 1011
1232 Ga0501037_0788292 3300049573 Bacteria 628
1233 Ga0501039_0018150 3300049575 Bacteria 5399
1234 Ga0501043_0327920 3300049579 Bacteria 1166
1235 Ga0501046_0152071 3300049580 Bacteria 1746
1236 Ga0501047_0006975 3300049581 Bacteria 10606
1237 Ga0501047_0314683 3300049581 Bacteria 1406
1238 Ga0501047_0478113 3300049581 Bacteria 1074
1239 Ga0501048_0094005 3300049582 Bacteria 2115
1240 Ga0501067_0019175 3300049583 Bacteria 3786
1241 Ga0501069_0174645 3300049585 Bacteria 1240
1242 Ga0501070_0155813 3300049586 Bacteria 1883
1243 Ga0501070_0166900 3300049586 Bacteria 1814
1244 Ga0501070_0266239 3300049586 Unclassified 1400
1245 Ga0501070_0347553 3300049586 Bacteria 1204
1246 Ga0501073_0004543 3300049589 Bacteria 10436
1247 Ga0501074_0046505 3300049590 Bacteria 3138
1248 Ga0501207_015667 3300049654 Bacteria 1169
1249 Ga0501238_034752 3300049671 Bacteria 734
1250 Ga0501239_003514 3300049672 Bacteria 1495
1251 Ga0501242_001699 3300049674 Bacteria 2249
1252 Ga0501243_014923 3300049675 Unclassified 1245
1253 Ga0501249_007759 3300049679 Bacteria 2223
1254 Ga0501249_031659 3300049679 Bacteria 1181
1255 Ga0501249_046257 3300049679 Bacteria 994
1256 Ga0501251_019078 3300049681 Bacteria 896
1257 Ga0501257_002258 3300049686 Bacteria 4040
1258 Ga0501257_011646 3300049686 Bacteria 2010
1259 Ga0501261_005982 3300049690 Unclassified 1543
1260 Ga0501219_000212 3300049703 Bacteria 10911
1261 Ga0501225_0000645 3300049705 Bacteria 10834
1262 Ga0501245_002542 3300049708 Bacteria 2440
1263 Ga0501245_071414 3300049708 Bacteria 654
1264 Ga0501079_0042264 3300049741 Bacteria 3521
1265 Ga0501080_0015789 3300049742 Bacteria 6965
1266 Ga0501080_0085121 3300049742 Bacteria 2938
1267 Ga0501080_0171520 3300049742 Bacteria 2001
1268 Ga0501083_0832508 3300049744 Bacteria 600
1269 Ga0501241_000639 3300049758 Bacteria 7520
1270 Ga0501266_000015 3300049763 Bacteria 177219
1271 Ga0501266_000855 3300049763 Bacteria 3964
1272 Ga0501266_035773 3300049763 Bacteria 723
1273 Ga0501280_002541 3300049776 Bacteria 3011
1274 Ga0501035_0125078 3300049822 Bacteria 2245
1275 Ga0501035_0554214 3300049822 Unclassified 941
1276 Ga0501044_0031379 3300049823 Bacteria 5593
1277 Ga0501044_0153371 3300049823 Bacteria 2285
1278 Ga0501044_0226711 3300049823 Bacteria 1818
1279 Ga0501044_0465915 3300049823 Bacteria 1168
1280 Ga0501284_00124 3300050005 Bacteria 11498
1281 Ga0501284_01766 3300050005 Bacteria 1161
1282 nmdc:mga0k408_45296_c1 3300050493 Bacteria 2538
1283 nmdc:mga0k408_625353_c1 3300050493 Unclassified 634
1284 nmdc:mga0k408_766902_c1 3300050493 Unclassified 563
1285 nmdc:mga05p37_134031_c1 3300050507 Unclassified 3039
1286 nmdc:mga08y16_109953_c1 3300050511 Unclassified 2870
1287 nmdc:mga0a205_1474798_c1 3300050515 Bacteria 528
1288 Ga0500578_0000010 3300053086 Bacteria 217642
1289 Ga0500644_0033577 3300053088 Bacteria 1648
1290 Ga0500644_0033859 3300053088 Bacteria 1644
1291 Ga0500581_314340 3300053089 Bacteria 615
1292 Ga0500646_0089291 3300053090 Bacteria 952
1293 Ga0500583_0000039 3300053092 Bacteria 87189
1294 Ga0500583_0001016 3300053092 Bacteria 7995
1295 Ga0500583_0001677 3300053092 Bacteria 6462
1296 Ga0500583_0331204 3300053092 Bacteria 741
1297 Ga0500641_0000030 3300053096 Bacteria 96500
1298 Ga0500641_0161484 3300053096 Bacteria 966
1299 Ga0500650_0034013 3300053098 Bacteria 2328
1300 Ga0500553_184268 3300053101 Bacteria 743
1301 Ga0500555_027387 3300053103 Bacteria 1626
1302 Ga0500556_0183675 3300053104 Bacteria 826
1303 Ga0500595_133509 3300053119 Unclassified 698
1304 Ga0500628_123697 3300053129 Bacteria 705
1305 Ga0500652_013910 3300053131 Bacteria 2863
1306 Ga0500655_040816 3300053133 Bacteria 910
1307 Ga0500658_0079874 3300053134 Bacteria 1397
1308 Ga0500559_0026090 3300053136 Bacteria 2488
1309 Ga0500559_0055493 3300053136 Bacteria 1757
1310 Ga0500568_0000343 3300053139 Bacteria 36347
1311 Ga0500568_0003967 3300053139 Bacteria 8047
1312 Ga0500568_0037756 3300053139 Bacteria 1958
1313 Ga0500589_039455 3300053147 Bacteria 2205
1314 Ga0500616_0009182 3300053153 Bacteria 6036
1315 Ga0500622_0002303 3300053156 Bacteria 13984
1316 Ga0500622_0055067 3300053156 Bacteria 2039
1317 Ga0500636_0134765 3300053177 Bacteria 1372
1318 Ga0500637_0390673 3300053178 Unclassified 726
1319 Ga0501084_0313137 3300054114 Bacteria 1325
1320 Ga0501082_0015936 3300060353 Bacteria 6465
1321 Ga0466962_0004388 3300061719 Bacteria 6765
1322 Ga0466962_0616151 3300061719 Bacteria 554

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003320 rootH2_10102887 rootH2_101028872 136
2 3300031824 Ga0307413_10000980 Ga0307413_1000098012 138
3 3300032004 Ga0307414_11227380 Ga0307414_112273801 138
4 3300032005 Ga0307411_10000005 Ga0307411_10000005245 138
5 3300046530 Ga0495654_0067156 Ga0495654_0067156_748_1200 138
6 3300049679 Ga0501249_007759 Ga0501249_007759_542_994 138
7 3300049679 Ga0501249_046257 Ga0501249_046257_375_827 138
8 3300049763 Ga0501266_000015 Ga0501266_000015_176573_177025 138
9 3300053136 Ga0500559_0055493 Ga0500559_0055493_1098_1550 138
10 3300044842 Ga0466957_0000411 Ga0466957_0000411_12784_13245 142
11 3300049581 Ga0501047_0314683 Ga0501047_0314683_825_1286 142
12 3300005535 Ga0070684_100074647 Ga0070684_1000746472 145
13 3300005563 Ga0068855_100326943 Ga0068855_1003269433 145
14 3300005578 Ga0068854_100045340 Ga0068854_1000453404 145
15 3300005616 Ga0068852_100211184 Ga0068852_1002111842 145
16 3300009093 Ga0105240_11168772 Ga0105240_111687722 145
17 3300009174 Ga0105241_11217459 Ga0105241_112174592 145
18 3300013100 Ga0157373_10053248 Ga0157373_100532484 145
19 3300013104 Ga0157370_10090679 Ga0157370_100906794 145
20 3300013105 Ga0157369_10768753 Ga0157369_107687532 145
21 3300013307 Ga0157372_10022298 Ga0157372_100222984 145
22 3300025913 Ga0207695_10000212 Ga0207695_1000021289 145
23 3300025944 Ga0207661_10143447 Ga0207661_101434472 145
24 3300025949 Ga0207667_10000414 Ga0207667_1000041416 145
25 3300025981 Ga0207640_10038740 Ga0207640_100387403 145
26 3300026142 Ga0207698_10089985 Ga0207698_100899854 145
27 3300028786 Ga0307517_10002947 Ga0307517_1000294719 146
28 iso_pu_bacteria 2513020052 2513234382 146
29 iso_pu_bacteria 2519899754 2520878466 146
30 iso_pu_bacteria 2643221600 2644011776 146
31 iso_pu_bacteria 2643221667 2644370161 146
32 iso_pu_bacteria 2643221716 2644641994 146
33 iso_pu_bacteria 2643221725 2644685574 146
34 iso_pu_bacteria 2802428842 2802653395 146
35 iso_pu_bacteria 2816332280 2817415487 146
36 iso_pu_bacteria 2857613821 2857614266 146
37 iso_pu_bacteria 2903895155 2903898262 146
38 iso_pu_bacteria 2904419702 2904423342 146
39 iso_pu_bacteria 2904555929 2904556329 146
40 iso_pu_bacteria 2919191525 2919193281 146
41 iso_pu_bacteria 2929150217 2929152732 146
42 iso_pu_bacteria 2958458903 2958462502 146
43 iso_pu_bacteria 2977268062 2977269426 146
44 iso_pu_bacteria 8054307821 8054312073 146
45 iso_pu_bacteria 8055419101 8055421123 146
46 iso_pu_bacteria 8055592153 8055594462 146
47 3300005466 Ga0070685_10984708 Ga0070685_109847081 147
48 3300005293 Ga0065715_10012842 Ga0065715_100128422 148
49 3300005329 Ga0070683_100030822 Ga0070683_1000308225 148
50 3300005329 Ga0070683_102024262 Ga0070683_1020242621 148
51 3300005331 Ga0070670_100132893 Ga0070670_1001328932 148
52 3300005331 Ga0070670_100151167 Ga0070670_1001511672 148
53 3300005337 Ga0070682_101454741 Ga0070682_1014547411 148
54 3300005344 Ga0070661_100035826 Ga0070661_1000358264 148
55 3300005355 Ga0070671_100552464 Ga0070671_1005524642 148
56 3300005364 Ga0070673_100080738 Ga0070673_1000807384 148
57 3300005365 Ga0070688_101039309 Ga0070688_1010393091 148
58 3300005466 Ga0070685_11494543 Ga0070685_114945431 148
59 3300005535 Ga0070684_100026424 Ga0070684_1000264243 148
60 3300005564 Ga0070664_100009855 Ga0070664_1000098555 148
61 3300005564 Ga0070664_100184681 Ga0070664_1001846811 148
62 3300005564 Ga0070664_100383572 Ga0070664_1003835722 148
63 3300005564 Ga0070664_100463596 Ga0070664_1004635962 148
64 3300005615 Ga0070702_100694602 Ga0070702_1006946021 148
65 3300005616 Ga0068852_100849338 Ga0068852_1008493381 148
66 3300005834 Ga0068851_10612306 Ga0068851_106123062 148
67 3300006195 Ga0075366_10008429 Ga0075366_100084295 148
68 3300006237 Ga0097621_100638606 Ga0097621_1006386061 148
69 3300006942 Ga0099824_1022466 Ga0099824_10224663 148
70 3300006946 Ga0079104_1000271 Ga0079104_100027117 148
71 3300006948 Ga0099826_10002269 Ga0099826_100022698 148
72 3300009092 Ga0105250_10488187 Ga0105250_104881871 148
73 3300013100 Ga0157373_10000012 Ga0157373_1000001262 148
74 3300013100 Ga0157373_10280814 Ga0157373_102808142 148
75 3300013102 Ga0157371_10048689 Ga0157371_100486892 148
76 3300013102 Ga0157371_10168621 Ga0157371_101686213 148
77 3300013102 Ga0157371_10318258 Ga0157371_103182581 148
78 3300013104 Ga0157370_10000451 Ga0157370_1000045116 148
79 3300013104 Ga0157370_10939058 Ga0157370_109390581 148
80 3300013307 Ga0157372_10575956 Ga0157372_105759562 148
81 3300013307 Ga0157372_10910724 Ga0157372_109107242 148
82 3300014325 Ga0163163_10006303 Ga0163163_100063036 148
83 3300015261 Ga0182006_1004104 Ga0182006_10041046 148
84 3300015261 Ga0182006_1068182 Ga0182006_10681821 148
85 3300015261 Ga0182006_1070382 Ga0182006_10703821 148
86 3300025321 Ga0207656_10175732 Ga0207656_101757322 148
87 3300025920 Ga0207649_10013303 Ga0207649_100133033 148
88 3300025925 Ga0207650_10029628 Ga0207650_100296281 148
89 3300025925 Ga0207650_10118765 Ga0207650_101187652 148
90 3300025931 Ga0207644_10316972 Ga0207644_103169721 148
91 3300025932 Ga0207690_11577169 Ga0207690_115771691 148
92 3300025940 Ga0207691_10231081 Ga0207691_102310813 148
93 3300025944 Ga0207661_10005555 Ga0207661_100055558 148
94 3300025944 Ga0207661_11796899 Ga0207661_117968991 148
95 3300025945 Ga0207679_10007220 Ga0207679_100072205 148
96 3300025945 Ga0207679_10345930 Ga0207679_103459302 148
97 3300026142 Ga0207698_10070264 Ga0207698_100702642 148
98 3300027111 Ga0209281_1000396 Ga0209281_100039615 148
99 3300027361 Ga0209489_116336 Ga0209489_1163363 148
100 3300027471 Ga0209995_1008477 Ga0209995_10084772 148
101 3300027526 Ga0209968_1004295 Ga0209968_10042952 148
102 3300027543 Ga0209999_1017942 Ga0209999_10179422 148
103 3300027617 Ga0210002_1008487 Ga0210002_10084872 148
104 3300027666 Ga0209282_1008316 Ga0209282_10083165 148
105 3300027876 Ga0209974_10038738 Ga0209974_100387382 148
106 3300031548 Ga0307408_100002021 Ga0307408_10000202112 148
107 3300031852 Ga0307410_10000055 Ga0307410_1000005512 148
108 3300031901 Ga0307406_10000009 Ga0307406_1000000995 148
109 3300031903 Ga0307407_10002591 Ga0307407_100025912 148
110 3300032002 Ga0307416_100013659 Ga0307416_1000136593 148
111 3300032004 Ga0307414_10000001 Ga0307414_10000001403 148
112 3300033180 Ga0307510_10085677 Ga0307510_100856772 148
113 3300041411 Ga0439466_0212465 Ga0439466_0212465_62_514 148
114 3300046660 Ga0495625_0207884 Ga0495625_0207884_706_1158 148
115 3300048919 Ga0496116_0000041 Ga0496116_0000041_263904_264356 148
116 3300048920 Ga0496117_0224436 Ga0496117_0224436_285_737 148
117 3300048921 Ga0496118_0235661 Ga0496118_0235661_198_650 148
118 3300048924 Ga0496121_0346271 Ga0496121_0346271_29_481 148
119 3300048926 Ga0496123_0115216 Ga0496123_0115216_722_1174 148
120 3300048927 Ga0496124_0004102 Ga0496124_0004102_1162_1614 148
121 3300048927 Ga0496124_0245248 Ga0496124_0245248_750_1202 148
122 3300048928 Ga0496125_0000036 Ga0496125_0000036_23380_23832 148
123 3300048929 Ga0496126_0003069 Ga0496126_0003069_14801_15253 148
124 3300049671 Ga0501238_034752 Ga0501238_034752_96_548 148
125 3300049763 Ga0501266_035773 Ga0501266_035773_67_519 148
126 3300049776 Ga0501280_002541 Ga0501280_002541_2512_2964 148
127 3300053088 Ga0500644_0033577 Ga0500644_0033577_176_628 148
128 3300053096 Ga0500641_0000030 Ga0500641_0000030_39945_40397 148
129 3300053156 Ga0500622_0055067 Ga0500622_0055067_1331_1783 148
130 3300003316 rootH1_10191240 rootH1_101912403 149
131 3300006195 Ga0075366_10053800 Ga0075366_100538002 149
132 3300006195 Ga0075366_10666464 Ga0075366_106664642 149
133 3300007076 Ga0075435_100681528 Ga0075435_1006815282 149
134 3300009147 Ga0114129_10169682 Ga0114129_101696821 149
135 3300013102 Ga0157371_10041525 Ga0157371_100415252 149
136 3300013104 Ga0157370_10002697 Ga0157370_100026979 149
137 3300013104 Ga0157370_10052446 Ga0157370_100524464 149
138 3300013105 Ga0157369_10098649 Ga0157369_100986494 149
139 3300013307 Ga0157372_10093125 Ga0157372_100931252 149
140 3300013307 Ga0157372_10172855 Ga0157372_101728554 149
141 3300013307 Ga0157372_10388377 Ga0157372_103883772 149
142 3300013307 Ga0157372_11173754 Ga0157372_111737541 149
143 3300031824 Ga0307413_11002778 Ga0307413_110027781 149
144 3300041498 Ga0451841_0452700 Ga0451841_0452700_117_572 149
145 3300041505 Ga0451849_0650367 Ga0451849_0650367_165_620 149
146 3300042876 Ga0451577_0231088 Ga0451577_0231088_227_685 149
147 3300044735 Ga0466968_0655450 Ga0466968_0655450_52_507 149
148 3300049758 Ga0501241_000639 Ga0501241_000639_2591_3046 149
149 3300050005 Ga0501284_01766 Ga0501284_01766_655_1110 149
150 3300050493 nmdc:mga0k408_45296_c1 nmdc:mga0k408_45296_c1_200_655 149
151 3300050507 nmdc:mga05p37_134031_c1 nmdc:mga05p37_134031_c1_2462_2917 149
152 3300053134 Ga0500658_0079874 Ga0500658_0079874_325_780 149
153 3300053147 Ga0500589_039455 Ga0500589_039455_1391_1846 149
154 iso_pu_bacteria 2738541278 2738724766 149
155 iso_pu_bacteria 2965320100 2965320309 149
156 3300005290 Ga0065712_10395154 Ga0065712_103951541 150
157 3300005458 Ga0070681_11318064 Ga0070681_113180641 150
158 3300006880 Ga0075429_100163273 Ga0075429_1001632732 150
159 3300009094 Ga0111539_10048499 Ga0111539_100484996 150
160 3300009176 Ga0105242_10265859 Ga0105242_102658592 150
161 3300013297 Ga0157378_10228507 Ga0157378_102285072 150
162 3300013306 Ga0163162_10886818 Ga0163162_108868181 150
163 3300017792 Ga0163161_11069434 Ga0163161_110694342 150
164 3300025937 Ga0207669_10179454 Ga0207669_101794542 150
165 3300027907 Ga0207428_10500513 Ga0207428_105005131 150
166 3300047472 Ga0495686_0002207 Ga0495686_0002207_14184_14642 150
167 3300053139 Ga0500568_0000343 Ga0500568_0000343_4904_5368 150
168 iso_pu_bacteria 2833640130 2833643536 150
169 3300002738 JGI25154J39366_1007563 JGI25154J39366_10075632 151
170 3300003320 rootH2_10022538 rootH2_100225381 151
171 3300003323 rootH1_10006077 rootH1_1000607712 151
172 3300003323 rootH1_10062168 rootH1_100621687 151
173 3300004799 Ga0058863_11958113 Ga0058863_119581134 151
174 3300005327 Ga0070658_10063094 Ga0070658_100630942 151
175 3300005327 Ga0070658_10079396 Ga0070658_100793962 151
176 3300005327 Ga0070658_10084165 Ga0070658_100841652 151
177 3300005327 Ga0070658_10113860 Ga0070658_101138604 151
178 3300005327 Ga0070658_10211278 Ga0070658_102112783 151
179 3300005327 Ga0070658_10807063 Ga0070658_108070632 151
180 3300005329 Ga0070683_100080846 Ga0070683_1000808464 151
181 3300005329 Ga0070683_100252445 Ga0070683_1002524453 151
182 3300005329 Ga0070683_101035571 Ga0070683_1010355712 151
183 3300005331 Ga0070670_100017762 Ga0070670_1000177625 151
184 3300005331 Ga0070670_100252354 Ga0070670_1002523542 151
185 3300005331 Ga0070670_101026073 Ga0070670_1010260731 151
186 3300005331 Ga0070670_101613106 Ga0070670_1016131061 151
187 3300005334 Ga0068869_100886571 Ga0068869_1008865711 151
188 3300005336 Ga0070680_100000801 Ga0070680_1000008016 151
189 3300005336 Ga0070680_100017930 Ga0070680_1000179302 151
190 3300005336 Ga0070680_100019631 Ga0070680_1000196315 151
191 3300005336 Ga0070680_100454961 Ga0070680_1004549612 151
192 3300005337 Ga0070682_100059364 Ga0070682_1000593642 151
193 3300005339 Ga0070660_100015263 Ga0070660_1000152632 151
194 3300005339 Ga0070660_100037813 Ga0070660_1000378131 151
195 3300005339 Ga0070660_100153670 Ga0070660_1001536702 151
196 3300005339 Ga0070660_100270087 Ga0070660_1002700872 151
197 3300005339 Ga0070660_100465775 Ga0070660_1004657752 151
198 3300005341 Ga0070691_10011757 Ga0070691_100117572 151
199 3300005355 Ga0070671_100036686 Ga0070671_1000366862 151
200 3300005364 Ga0070673_100027981 Ga0070673_1000279815 151
201 3300005366 Ga0070659_100001018 Ga0070659_10000101814 151
202 3300005366 Ga0070659_100056770 Ga0070659_1000567702 151
203 3300005367 Ga0070667_100019830 Ga0070667_1000198302 151
204 3300005367 Ga0070667_100100044 Ga0070667_1001000442 151
205 3300005367 Ga0070667_100950495 Ga0070667_1009504952 151
206 3300005439 Ga0070711_100362771 Ga0070711_1003627712 151
207 3300005455 Ga0070663_100131263 Ga0070663_1001312633 151
208 3300005458 Ga0070681_10001223 Ga0070681_100012232 151
209 3300005458 Ga0070681_10003892 Ga0070681_100038928 151
210 3300005458 Ga0070681_10189548 Ga0070681_101895482 151
211 3300005458 Ga0070681_10834909 Ga0070681_108349091 151
212 3300005459 Ga0068867_101041402 Ga0068867_1010414021 151
213 3300005530 Ga0070679_100000103 Ga0070679_10000010317 151
214 3300005530 Ga0070679_100000622 Ga0070679_1000006222 151
215 3300005530 Ga0070679_100009930 Ga0070679_10000993010 151
216 3300005530 Ga0070679_100012734 Ga0070679_1000127348 151
217 3300005530 Ga0070679_100017710 Ga0070679_1000177104 151
218 3300005539 Ga0068853_100031538 Ga0068853_1000315384 151
219 3300005539 Ga0068853_100182218 Ga0068853_1001822182 151
220 3300005539 Ga0068853_100226705 Ga0068853_1002267052 151
221 3300005563 Ga0068855_100000145 Ga0068855_10000014553 151
222 3300005563 Ga0068855_100052845 Ga0068855_1000528453 151
223 3300005563 Ga0068855_100369154 Ga0068855_1003691543 151
224 3300005577 Ga0068857_100271210 Ga0068857_1002712102 151
225 3300005577 Ga0068857_100747982 Ga0068857_1007479822 151
226 3300005577 Ga0068857_101025004 Ga0068857_1010250042 151
227 3300005578 Ga0068854_100007635 Ga0068854_1000076355 151
228 3300005578 Ga0068854_101319253 Ga0068854_1013192531 151
229 3300005614 Ga0068856_100009358 Ga0068856_1000093586 151
230 3300005614 Ga0068856_100103866 Ga0068856_1001038662 151
231 3300005614 Ga0068856_100452916 Ga0068856_1004529162 151
232 3300005616 Ga0068852_100005736 Ga0068852_10000573610 151
233 3300005616 Ga0068852_100006803 Ga0068852_1000068038 151
234 3300005616 Ga0068852_100014310 Ga0068852_1000143104 151
235 3300005616 Ga0068852_100814655 Ga0068852_1008146551 151
236 3300005617 Ga0068859_100021602 Ga0068859_1000216024 151
237 3300005617 Ga0068859_100062271 Ga0068859_1000622712 151
238 3300005618 Ga0068864_100091301 Ga0068864_1000913012 151
239 3300005841 Ga0068863_100120028 Ga0068863_1001200282 151
240 3300005843 Ga0068860_100002984 Ga0068860_10000298415 151
241 3300005843 Ga0068860_100061543 Ga0068860_1000615432 151
242 3300005843 Ga0068860_100274698 Ga0068860_1002746982 151
243 3300005843 Ga0068860_100860918 Ga0068860_1008609182 151
244 3300005844 Ga0068862_100043662 Ga0068862_1000436621 151
245 3300006175 Ga0070712_100719718 Ga0070712_1007197182 151
246 3300006195 Ga0075366_10717978 Ga0075366_107179781 151
247 3300006358 Ga0068871_100103677 Ga0068871_1001036773 151
248 3300006931 Ga0097620_100021602 Ga0097620_1000216024 151
249 3300006931 Ga0097620_100062272 Ga0097620_1000622722 151
250 3300009093 Ga0105240_10065512 Ga0105240_100655122 151
251 3300009093 Ga0105240_10300164 Ga0105240_103001642 151
252 3300009094 Ga0111539_10513090 Ga0111539_105130902 151
253 3300009174 Ga0105241_10020566 Ga0105241_100205667 151
254 3300009545 Ga0105237_10011368 Ga0105237_100113681 151
255 3300009545 Ga0105237_10020785 Ga0105237_100207854 151
256 3300009545 Ga0105237_10228405 Ga0105237_102284053 151
257 3300009545 Ga0105237_10606450 Ga0105237_106064502 151
258 3300009553 Ga0105249_10262607 Ga0105249_102626072 151
259 3300010375 Ga0105239_10012014 Ga0105239_100120145 151
260 3300010375 Ga0105239_10027184 Ga0105239_100271842 151
261 3300010375 Ga0105239_12316313 Ga0105239_123163131 151
262 3300011119 Ga0105246_10580998 Ga0105246_105809981 151
263 3300013100 Ga0157373_10008496 Ga0157373_100084966 151
264 3300013100 Ga0157373_10046327 Ga0157373_100463272 151
265 3300013100 Ga0157373_10231563 Ga0157373_102315632 151
266 3300013102 Ga0157371_10028817 Ga0157371_100288172 151
267 3300013102 Ga0157371_10040326 Ga0157371_100403262 151
268 3300013102 Ga0157371_10130903 Ga0157371_101309032 151
269 3300013102 Ga0157371_10703160 Ga0157371_107031602 151
270 3300013102 Ga0157371_10745526 Ga0157371_107455261 151
271 3300013104 Ga0157370_10000628 Ga0157370_1000062816 151
272 3300013104 Ga0157370_10078710 Ga0157370_100787103 151
273 3300013104 Ga0157370_10103881 Ga0157370_101038812 151
274 3300013104 Ga0157370_10228662 Ga0157370_102286622 151
275 3300013104 Ga0157370_10391517 Ga0157370_103915172 151
276 3300013104 Ga0157370_10402205 Ga0157370_104022052 151
277 3300013104 Ga0157370_11919463 Ga0157370_119194631 151
278 3300013105 Ga0157369_10010912 Ga0157369_100109124 151
279 3300013105 Ga0157369_10055924 Ga0157369_100559242 151
280 3300013105 Ga0157369_10204129 Ga0157369_102041292 151
281 3300013105 Ga0157369_10243622 Ga0157369_102436222 151
282 3300013105 Ga0157369_10267435 Ga0157369_102674351 151
283 3300013105 Ga0157369_10436813 Ga0157369_104368131 151
284 3300013105 Ga0157369_11336898 Ga0157369_113368982 151
285 3300013296 Ga0157374_10110565 Ga0157374_101105651 151
286 3300013296 Ga0157374_10216940 Ga0157374_102169402 151
287 3300013297 Ga0157378_10027043 Ga0157378_100270432 151
288 3300013297 Ga0157378_11199688 Ga0157378_111996881 151
289 3300013297 Ga0157378_11474637 Ga0157378_114746371 151
290 3300013297 Ga0157378_11490077 Ga0157378_114900772 151
291 3300013307 Ga0157372_10009931 Ga0157372_100099316 151
292 3300013307 Ga0157372_10054021 Ga0157372_100540213 151
293 3300013307 Ga0157372_10283077 Ga0157372_102830772 151
294 3300013307 Ga0157372_10311534 Ga0157372_103115343 151
295 3300013307 Ga0157372_10374589 Ga0157372_103745893 151
296 3300014325 Ga0163163_10107682 Ga0163163_101076824 151
297 3300014325 Ga0163163_10414792 Ga0163163_104147922 151
298 3300014326 Ga0157380_11772287 Ga0157380_117722872 151
299 3300025246 Ga0209646_1000615 Ga0209646_10006159 151
300 3300025903 Ga0207680_11131587 Ga0207680_111315871 151
301 3300025904 Ga0207647_10000086 Ga0207647_1000008648 151
302 3300025904 Ga0207647_10065279 Ga0207647_100652793 151
303 3300025909 Ga0207705_10018887 Ga0207705_100188874 151
304 3300025909 Ga0207705_10019038 Ga0207705_100190382 151
305 3300025909 Ga0207705_10080317 Ga0207705_100803172 151
306 3300025909 Ga0207705_10104249 Ga0207705_101042492 151
307 3300025909 Ga0207705_10179161 Ga0207705_101791611 151
308 3300025909 Ga0207705_10587618 Ga0207705_105876181 151
309 3300025911 Ga0207654_10044014 Ga0207654_100440142 151
310 3300025912 Ga0207707_10003005 Ga0207707_100030056 151
311 3300025912 Ga0207707_10151526 Ga0207707_101515262 151
312 3300025912 Ga0207707_10292415 Ga0207707_102924153 151
313 3300025912 Ga0207707_10667748 Ga0207707_106677481 151
314 3300025913 Ga0207695_10414904 Ga0207695_104149043 151
315 3300025913 Ga0207695_10552655 Ga0207695_105526552 151
316 3300025913 Ga0207695_11243858 Ga0207695_112438581 151
317 3300025914 Ga0207671_10950195 Ga0207671_109501952 151
318 3300025914 Ga0207671_11073762 Ga0207671_110737621 151
319 3300025917 Ga0207660_10010923 Ga0207660_100109236 151
320 3300025917 Ga0207660_10163629 Ga0207660_101636293 151
321 3300025917 Ga0207660_10205388 Ga0207660_102053882 151
322 3300025917 Ga0207660_10482738 Ga0207660_104827382 151
323 3300025919 Ga0207657_10027470 Ga0207657_100274705 151
324 3300025919 Ga0207657_10041096 Ga0207657_100410964 151
325 3300025919 Ga0207657_10104569 Ga0207657_101045693 151
326 3300025921 Ga0207652_10000098 Ga0207652_100000982 151
327 3300025921 Ga0207652_10000187 Ga0207652_1000018724 151
328 3300025921 Ga0207652_10137261 Ga0207652_101372612 151
329 3300025921 Ga0207652_10595033 Ga0207652_105950331 151
330 3300025921 Ga0207652_11232450 Ga0207652_112324501 151
331 3300025925 Ga0207650_10214898 Ga0207650_102148982 151
332 3300025925 Ga0207650_10236092 Ga0207650_102360922 151
333 3300025925 Ga0207650_10280244 Ga0207650_102802443 151
334 3300025931 Ga0207644_10023065 Ga0207644_100230655 151
335 3300025932 Ga0207690_10052960 Ga0207690_100529605 151
336 3300025932 Ga0207690_10109963 Ga0207690_101099632 151
337 3300025932 Ga0207690_10111840 Ga0207690_101118402 151
338 3300025933 Ga0207706_11027027 Ga0207706_110270272 151
339 3300025944 Ga0207661_10897967 Ga0207661_108979672 151
340 3300025944 Ga0207661_10925058 Ga0207661_109250582 151
341 3300025949 Ga0207667_10000508 Ga0207667_100005089 151
342 3300025949 Ga0207667_10042007 Ga0207667_100420073 151
343 3300025949 Ga0207667_10335983 Ga0207667_103359832 151
344 3300025949 Ga0207667_10449798 Ga0207667_104497983 151
345 3300025961 Ga0207712_10033824 Ga0207712_100338243 151
346 3300025981 Ga0207640_10008730 Ga0207640_100087304 151
347 3300025981 Ga0207640_10087714 Ga0207640_100877141 151
348 3300025986 Ga0207658_10027875 Ga0207658_100278754 151
349 3300025986 Ga0207658_10041271 Ga0207658_100412712 151
350 3300026023 Ga0207677_10010196 Ga0207677_100101964 151
351 3300026041 Ga0207639_10049837 Ga0207639_100498373 151
352 3300026041 Ga0207639_10059099 Ga0207639_100590992 151
353 3300026041 Ga0207639_10244613 Ga0207639_102446132 151
354 3300026067 Ga0207678_10068955 Ga0207678_100689552 151
355 3300026078 Ga0207702_10016072 Ga0207702_100160727 151
356 3300026078 Ga0207702_10246690 Ga0207702_102466903 151
357 3300026088 Ga0207641_10158359 Ga0207641_101583592 151
358 3300026089 Ga0207648_10292519 Ga0207648_102925192 151
359 3300026095 Ga0207676_10183324 Ga0207676_101833242 151
360 3300026116 Ga0207674_11026660 Ga0207674_110266602 151
361 3300026116 Ga0207674_11032346 Ga0207674_110323461 151
362 3300026142 Ga0207698_10000937 Ga0207698_100009374 151
363 3300026142 Ga0207698_10007208 Ga0207698_100072083 151
364 3300027543 Ga0209999_1038006 Ga0209999_10380061 151
365 3300027876 Ga0209974_10048504 Ga0209974_100485042 151
366 3300028379 Ga0268266_11745549 Ga0268266_117455491 151
367 3300028380 Ga0268265_10130336 Ga0268265_101303362 151
368 3300028381 Ga0268264_10003346 Ga0268264_1000334613 151
369 3300028381 Ga0268264_10013568 Ga0268264_100135686 151
370 3300028381 Ga0268264_10482341 Ga0268264_104823412 151
371 3300028794 Ga0307515_10000021 Ga0307515_1000002126 151
372 3300031456 Ga0307513_10039035 Ga0307513_100390352 151
373 3300031456 Ga0307513_10106944 Ga0307513_101069442 151
374 3300031507 Ga0307509_10024866 Ga0307509_100248661 151
375 3300034818 Ga0373950_0053927 Ga0373950_0053927_80_544 151
376 3300035116 Ga0373945_0167667 Ga0373945_0167667_149_610 151
377 3300035398 Ga0316574_0027664 Ga0316574_0027664_1981_2442 151
378 3300035398 Ga0316574_0036521 Ga0316574_0036521_781_1242 151
379 3300035695 Ga0373927_0137380 Ga0373927_0137380_1002_1463 151
380 3300037312 Ga0395899_0005847 Ga0395899_0005847_8498_8959 151
381 3300037312 Ga0395899_0108766 Ga0395899_0108766_1486_1947 151
382 3300037312 Ga0395899_0146068 Ga0395899_0146068_94_555 151
383 3300037312 Ga0395899_0548865 Ga0395899_0548865_244_708 151
384 3300037418 Ga0395900_0001053 Ga0395900_0001053_29793_30254 151
385 3300037418 Ga0395900_0056513 Ga0395900_0056513_1149_1610 151
386 3300037418 Ga0395900_0092965 Ga0395900_0092965_1823_2284 151
387 3300037418 Ga0395900_0094931 Ga0395900_0094931_2161_2625 151
388 3300037418 Ga0395900_0139061 Ga0395900_0139061_1518_1979 151
389 3300037466 Ga0395898_0001255 Ga0395898_0001255_26582_27043 151
390 3300037466 Ga0395898_0013305 Ga0395898_0013305_2323_2784 151
391 3300037466 Ga0395898_0040554 Ga0395898_0040554_2207_2668 151
392 3300037471 Ga0395905_0005445 Ga0395905_0005445_8409_8873 151
393 3300038443 Ga0395901_0015192 Ga0395901_0015192_7242_7703 151
394 3300038443 Ga0395901_0017810 Ga0395901_0017810_2905_3366 151
395 3300041404 Ga0439436_0002646 Ga0439436_0002646_4671_5132 151
396 3300041406 Ga0439439_0025777 Ga0439439_0025777_160_621 151
397 3300041406 Ga0439439_0182038 Ga0439439_0182038_95_556 151
398 3300041452 Ga0451793_0601848 Ga0451793_0601848_204_665 151
399 3300041496 Ga0451839_0454805 Ga0451839_0454805_58_519 151
400 3300041512 Ga0451853_2225719 Ga0451853_2225719_610_1071 151
401 3300041999 Ga0439433_0016338 Ga0439433_0016338_404_865 151
402 3300042007 Ga0439449_0010209 Ga0439449_0010209_1620_2081 151
403 3300042007 Ga0439449_0020085 Ga0439449_0020085_223_684 151
404 3300042014 Ga0439457_000072 Ga0439457_000072_19137_19598 151
405 3300042015 Ga0439462_0000326 Ga0439462_0000326_409_870 151
406 3300042131 Ga0450894_009463 Ga0450894_009463_659_1120 151
407 3300042135 Ga0450899_030081 Ga0450899_030081_118_579 151
408 3300044656 Ga0466969_0001643 Ga0466969_0001643_6063_6524 151
409 3300044658 Ga0466972_0000204 Ga0466972_0000204_2246_2707 151
410 3300044658 Ga0466972_0016147 Ga0466972_0016147_1286_1747 151
411 3300044673 Ga0453683_0453588 Ga0453683_0453588_291_755 151
412 3300044684 Ga0466966_0000022 Ga0466966_0000022_79651_80112 151
413 3300044693 Ga0466961_0092915 Ga0466961_0092915_767_1228 151
414 3300044693 Ga0466961_0328711 Ga0466961_0328711_382_846 151
415 3300044712 Ga0453684_0003119 Ga0453684_0003119_16059_16520 151
416 3300044712 Ga0453684_0098167 Ga0453684_0098167_2434_2898 151
417 3300044735 Ga0466968_0170657 Ga0466968_0170657_179_640 151
418 3300044842 Ga0466957_0011545 Ga0466957_0011545_4060_4521 151
419 3300045049 Ga0466959_0057004 Ga0466959_0057004_1733_2194 151
420 3300045049 Ga0466959_0941767 Ga0466959_0941767_88_552 151
421 3300046460 Ga0495638_0014297 Ga0495638_0014297_33_494 151
422 3300046460 Ga0495638_0444854 Ga0495638_0444854_134_595 151
423 3300046507 Ga0495606_0131709 Ga0495606_0131709_33_494 151
424 3300047472 Ga0495686_0000843 Ga0495686_0000843_1387_1848 151
425 3300047472 Ga0495686_0007602 Ga0495686_0007602_4335_4796 151
426 3300049581 Ga0501047_0006975 Ga0501047_0006975_6180_6641 151
427 3300049675 Ga0501243_014923 Ga0501243_014923_616_1080 151
428 3300049686 Ga0501257_011646 Ga0501257_011646_604_1065 151
429 3300049690 Ga0501261_005982 Ga0501261_005982_243_707 151
430 3300049703 Ga0501219_000212 Ga0501219_000212_8425_8892 151
431 3300049705 Ga0501225_0000645 Ga0501225_0000645_6623_7084 151
432 3300049708 Ga0501245_071414 Ga0501245_071414_144_608 151
433 3300049742 Ga0501080_0171520 Ga0501080_0171520_1375_1839 151
434 3300049823 Ga0501044_0031379 Ga0501044_0031379_2542_3003 151
435 3300049823 Ga0501044_0226711 Ga0501044_0226711_1288_1749 151
436 3300050005 Ga0501284_00124 Ga0501284_00124_5266_5733 151
437 3300050493 nmdc:mga0k408_766902_c1 nmdc:mga0k408_766902_c1_68_529 151
438 3300053086 Ga0500578_0000010 Ga0500578_0000010_42708_43169 151
439 3300053088 Ga0500644_0033859 Ga0500644_0033859_95_556 151
440 3300053089 Ga0500581_314340 Ga0500581_314340_94_555 151
441 3300053092 Ga0500583_0000039 Ga0500583_0000039_66941_67402 151
442 3300053092 Ga0500583_0001677 Ga0500583_0001677_2749_3210 151
443 3300053098 Ga0500650_0034013 Ga0500650_0034013_1738_2199 151
444 3300053103 Ga0500555_027387 Ga0500555_027387_551_1012 151
445 3300053104 Ga0500556_0183675 Ga0500556_0183675_95_556 151
446 3300053131 Ga0500652_013910 Ga0500652_013910_1603_2064 151
447 3300053177 Ga0500636_0134765 Ga0500636_0134765_613_1074 151
448 3300053178 Ga0500637_0390673 Ga0500637_0390673_140_601 151
449 3300061719 Ga0466962_0616151 Ga0466962_0616151_30_491 151
450 3300000044 ARSoilOldRDRAFT_c017796 ARSoilOldRDRAFT_0177962 152
451 3300001979 JGI24740J21852_10054664 JGI24740J21852_100546642 152
452 3300001989 JGI24739J22299_10164838 JGI24739J22299_101648382 152
453 3300003203 JGI25406J46586_10000862 JGI25406J46586_1000086214 152
454 3300003316 rootH1_10108543 rootH1_101085432 152
455 3300003316 rootH1_10113575 rootH1_101135752 152
456 3300003320 rootH2_10096425 rootH2_100964254 152
457 3300003320 rootH2_10119873 rootH2_101198734 152
458 3300003322 rootL2_10014693 rootL2_100146932 152
459 3300003322 rootL2_10016176 rootL2_100161761 152
460 3300003323 rootH1_10232417 rootH1_102324172 152
461 3300003354 JGI25160J50197_1002216 JGI25160J50197_10022166 152
462 3300003659 JGI25404J52841_10047105 JGI25404J52841_100471051 152
463 3300005288 Ga0065714_10074874 Ga0065714_100748742 152
464 3300005289 Ga0065704_10114609 Ga0065704_101146092 152
465 3300005289 Ga0065704_10303151 Ga0065704_103031512 152
466 3300005290 Ga0065712_10112615 Ga0065712_101126152 152
467 3300005293 Ga0065715_10141111 Ga0065715_101411112 152
468 3300005293 Ga0065715_10185400 Ga0065715_101854002 152
469 3300005293 Ga0065715_10354769 Ga0065715_103547692 152
470 3300005295 Ga0065707_10655831 Ga0065707_106558311 152
471 3300005327 Ga0070658_10129909 Ga0070658_101299092 152
472 3300005327 Ga0070658_10953946 Ga0070658_109539462 152
473 3300005328 Ga0070676_10014145 Ga0070676_100141454 152
474 3300005328 Ga0070676_10087673 Ga0070676_100876732 152
475 3300005328 Ga0070676_11049039 Ga0070676_110490391 152
476 3300005329 Ga0070683_100005634 Ga0070683_1000056344 152
477 3300005329 Ga0070683_100013202 Ga0070683_1000132025 152
478 3300005329 Ga0070683_100145057 Ga0070683_1001450571 152
479 3300005329 Ga0070683_101009189 Ga0070683_1010091891 152
480 3300005329 Ga0070683_101329946 Ga0070683_1013299462 152
481 3300005330 Ga0070690_100017874 Ga0070690_1000178743 152
482 3300005330 Ga0070690_100431552 Ga0070690_1004315522 152
483 3300005331 Ga0070670_100091856 Ga0070670_1000918562 152
484 3300005331 Ga0070670_100137908 Ga0070670_1001379082 152
485 3300005331 Ga0070670_100403005 Ga0070670_1004030052 152
486 3300005331 Ga0070670_100461040 Ga0070670_1004610402 152
487 3300005331 Ga0070670_100512070 Ga0070670_1005120701 152
488 3300005331 Ga0070670_100622813 Ga0070670_1006228131 152
489 3300005331 Ga0070670_101121232 Ga0070670_1011212322 152
490 3300005333 Ga0070677_10369639 Ga0070677_103696392 152
491 3300005334 Ga0068869_100002411 Ga0068869_1000024112 152
492 3300005334 Ga0068869_100051235 Ga0068869_1000512353 152
493 3300005334 Ga0068869_100081559 Ga0068869_1000815592 152
494 3300005334 Ga0068869_100082431 Ga0068869_1000824312 152
495 3300005334 Ga0068869_100225771 Ga0068869_1002257712 152
496 3300005334 Ga0068869_100340091 Ga0068869_1003400912 152
497 3300005334 Ga0068869_100484120 Ga0068869_1004841202 152
498 3300005335 Ga0070666_10000039 Ga0070666_1000003962 152
499 3300005335 Ga0070666_10027076 Ga0070666_100270762 152
500 3300005335 Ga0070666_10065218 Ga0070666_100652184 152
501 3300005335 Ga0070666_10141312 Ga0070666_101413122 152
502 3300005335 Ga0070666_10146949 Ga0070666_101469492 152
503 3300005335 Ga0070666_10584315 Ga0070666_105843152 152
504 3300005335 Ga0070666_10792862 Ga0070666_107928622 152
505 3300005336 Ga0070680_100001989 Ga0070680_1000019894 152
506 3300005336 Ga0070680_100099482 Ga0070680_1000994822 152
507 3300005337 Ga0070682_100000008 Ga0070682_10000000833 152
508 3300005337 Ga0070682_100002487 Ga0070682_10000248711 152
509 3300005337 Ga0070682_100034706 Ga0070682_1000347062 152
510 3300005337 Ga0070682_100393023 Ga0070682_1003930232 152
511 3300005338 Ga0068868_100008123 Ga0068868_1000081239 152
512 3300005338 Ga0068868_100012823 Ga0068868_1000128234 152
513 3300005338 Ga0068868_100127037 Ga0068868_1001270371 152
514 3300005338 Ga0068868_100222982 Ga0068868_1002229822 152
515 3300005338 Ga0068868_100366233 Ga0068868_1003662332 152
516 3300005338 Ga0068868_100402680 Ga0068868_1004026802 152
517 3300005338 Ga0068868_100441393 Ga0068868_1004413931 152
518 3300005338 Ga0068868_100883558 Ga0068868_1008835582 152
519 3300005338 Ga0068868_101684467 Ga0068868_1016844671 152
520 3300005339 Ga0070660_100005268 Ga0070660_1000052685 152
521 3300005339 Ga0070660_100012662 Ga0070660_1000126625 152
522 3300005339 Ga0070660_100070608 Ga0070660_1000706082 152
523 3300005339 Ga0070660_100174859 Ga0070660_1001748593 152
524 3300005340 Ga0070689_100022550 Ga0070689_1000225504 152
525 3300005340 Ga0070689_100405142 Ga0070689_1004051422 152
526 3300005341 Ga0070691_10054963 Ga0070691_100549631 152
527 3300005341 Ga0070691_10571208 Ga0070691_105712081 152
528 3300005344 Ga0070661_100003941 Ga0070661_1000039417 152
529 3300005344 Ga0070661_100010590 Ga0070661_1000105902 152
530 3300005344 Ga0070661_100169746 Ga0070661_1001697462 152
531 3300005344 Ga0070661_100694681 Ga0070661_1006946811 152
532 3300005347 Ga0070668_100025535 Ga0070668_1000255351 152
533 3300005353 Ga0070669_100000934 Ga0070669_10000093413 152
534 3300005353 Ga0070669_100188508 Ga0070669_1001885082 152
535 3300005354 Ga0070675_100002986 Ga0070675_1000029868 152
536 3300005354 Ga0070675_100033560 Ga0070675_1000335604 152
537 3300005354 Ga0070675_100343158 Ga0070675_1003431582 152
538 3300005354 Ga0070675_100533980 Ga0070675_1005339802 152
539 3300005354 Ga0070675_100829707 Ga0070675_1008297071 152
540 3300005354 Ga0070675_101027474 Ga0070675_1010274741 152
541 3300005354 Ga0070675_101120086 Ga0070675_1011200861 152
542 3300005354 Ga0070675_101217059 Ga0070675_1012170592 152
543 3300005354 Ga0070675_101307486 Ga0070675_1013074862 152
544 3300005355 Ga0070671_100004074 Ga0070671_1000040745 152
545 3300005355 Ga0070671_100034534 Ga0070671_1000345344 152
546 3300005355 Ga0070671_100051414 Ga0070671_1000514142 152
547 3300005355 Ga0070671_100302633 Ga0070671_1003026332 152
548 3300005355 Ga0070671_100850219 Ga0070671_1008502191 152
549 3300005364 Ga0070673_100013205 Ga0070673_1000132051 152
550 3300005364 Ga0070673_100022831 Ga0070673_1000228314 152
551 3300005364 Ga0070673_100059120 Ga0070673_1000591202 152
552 3300005364 Ga0070673_100088685 Ga0070673_1000886854 152
553 3300005364 Ga0070673_100157373 Ga0070673_1001573732 152
554 3300005364 Ga0070673_100567751 Ga0070673_1005677511 152
555 3300005364 Ga0070673_102080714 Ga0070673_1020807141 152
556 3300005365 Ga0070688_100000510 Ga0070688_10000051010 152
557 3300005365 Ga0070688_100103360 Ga0070688_1001033603 152
558 3300005366 Ga0070659_100013202 Ga0070659_1000132024 152
559 3300005366 Ga0070659_100049494 Ga0070659_1000494942 152
560 3300005366 Ga0070659_100060026 Ga0070659_1000600265 152
561 3300005366 Ga0070659_100198645 Ga0070659_1001986453 152
562 3300005366 Ga0070659_100497160 Ga0070659_1004971602 152
563 3300005367 Ga0070667_100029437 Ga0070667_1000294375 152
564 3300005367 Ga0070667_100057572 Ga0070667_1000575721 152
565 3300005367 Ga0070667_100091710 Ga0070667_1000917102 152
566 3300005367 Ga0070667_100394970 Ga0070667_1003949702 152
567 3300005367 Ga0070667_100668986 Ga0070667_1006689862 152
568 3300005367 Ga0070667_101601534 Ga0070667_1016015341 152
569 3300005455 Ga0070663_101205580 Ga0070663_1012055801 152
570 3300005455 Ga0070663_101459575 Ga0070663_1014595751 152
571 3300005456 Ga0070678_100050986 Ga0070678_1000509865 152
572 3300005456 Ga0070678_100100405 Ga0070678_1001004052 152
573 3300005456 Ga0070678_100180089 Ga0070678_1001800892 152
574 3300005456 Ga0070678_100296641 Ga0070678_1002966411 152
575 3300005457 Ga0070662_100004097 Ga0070662_1000040974 152
576 3300005457 Ga0070662_100151914 Ga0070662_1001519141 152
577 3300005457 Ga0070662_100214937 Ga0070662_1002149372 152
578 3300005458 Ga0070681_10006547 Ga0070681_100065472 152
579 3300005458 Ga0070681_10026168 Ga0070681_100261682 152
580 3300005458 Ga0070681_10031707 Ga0070681_100317074 152
581 3300005458 Ga0070681_10152747 Ga0070681_101527471 152
582 3300005458 Ga0070681_10969092 Ga0070681_109690921 152
583 3300005459 Ga0068867_100007419 Ga0068867_1000074196 152
584 3300005459 Ga0068867_100071452 Ga0068867_1000714523 152
585 3300005459 Ga0068867_100240385 Ga0068867_1002403851 152
586 3300005459 Ga0068867_100390076 Ga0068867_1003900762 152
587 3300005459 Ga0068867_100483893 Ga0068867_1004838932 152
588 3300005459 Ga0068867_100720947 Ga0068867_1007209472 152
589 3300005459 Ga0068867_101084100 Ga0068867_1010841002 152
590 3300005459 Ga0068867_101164400 Ga0068867_1011644001 152
591 3300005530 Ga0070679_100011551 Ga0070679_1000115517 152
592 3300005530 Ga0070679_100034369 Ga0070679_1000343692 152
593 3300005530 Ga0070679_100076993 Ga0070679_1000769932 152
594 3300005530 Ga0070679_100092666 Ga0070679_1000926662 152
595 3300005530 Ga0070679_100486223 Ga0070679_1004862231 152
596 3300005535 Ga0070684_100019987 Ga0070684_1000199875 152
597 3300005535 Ga0070684_100031330 Ga0070684_1000313304 152
598 3300005535 Ga0070684_100270243 Ga0070684_1002702432 152
599 3300005535 Ga0070684_100331356 Ga0070684_1003313562 152
600 3300005535 Ga0070684_100344529 Ga0070684_1003445291 152
601 3300005535 Ga0070684_100663216 Ga0070684_1006632162 152
602 3300005539 Ga0068853_100000422 Ga0068853_1000004222 152
603 3300005539 Ga0068853_100004153 Ga0068853_1000041538 152
604 3300005539 Ga0068853_100010199 Ga0068853_1000101994 152
605 3300005539 Ga0068853_100014450 Ga0068853_1000144502 152
606 3300005539 Ga0068853_100020518 Ga0068853_1000205184 152
607 3300005539 Ga0068853_100030972 Ga0068853_1000309721 152
608 3300005539 Ga0068853_100046971 Ga0068853_1000469712 152
609 3300005539 Ga0068853_100341781 Ga0068853_1003417813 152
610 3300005539 Ga0068853_100589734 Ga0068853_1005897341 152
611 3300005539 Ga0068853_100899317 Ga0068853_1008993171 152
612 3300005539 Ga0068853_101607231 Ga0068853_1016072311 152
613 3300005539 Ga0068853_101730659 Ga0068853_1017306591 152
614 3300005543 Ga0070672_100007724 Ga0070672_1000077242 152
615 3300005543 Ga0070672_100234979 Ga0070672_1002349792 152
616 3300005543 Ga0070672_101674274 Ga0070672_1016742741 152
617 3300005544 Ga0070686_100106223 Ga0070686_1001062232 152
618 3300005544 Ga0070686_100208702 Ga0070686_1002087023 152
619 3300005547 Ga0070693_100105797 Ga0070693_1001057974 152
620 3300005547 Ga0070693_100497797 Ga0070693_1004977971 152
621 3300005548 Ga0070665_100000014 Ga0070665_100000014371 152
622 3300005563 Ga0068855_100006360 Ga0068855_1000063604 152
623 3300005563 Ga0068855_100008021 Ga0068855_1000080214 152
624 3300005563 Ga0068855_100008926 Ga0068855_1000089264 152
625 3300005563 Ga0068855_100017900 Ga0068855_1000179005 152
626 3300005563 Ga0068855_100025205 Ga0068855_1000252057 152
627 3300005563 Ga0068855_100043979 Ga0068855_1000439796 152
628 3300005563 Ga0068855_100062983 Ga0068855_1000629832 152
629 3300005563 Ga0068855_100066465 Ga0068855_1000664655 152
630 3300005563 Ga0068855_100517272 Ga0068855_1005172722 152
631 3300005564 Ga0070664_100006443 Ga0070664_1000064432 152
632 3300005564 Ga0070664_100024727 Ga0070664_1000247272 152
633 3300005564 Ga0070664_100102283 Ga0070664_1001022832 152
634 3300005577 Ga0068857_100000536 Ga0068857_10000053620 152
635 3300005577 Ga0068857_100002416 Ga0068857_10000241614 152
636 3300005577 Ga0068857_100042072 Ga0068857_1000420723 152
637 3300005577 Ga0068857_100065486 Ga0068857_1000654862 152
638 3300005577 Ga0068857_100137001 Ga0068857_1001370012 152
639 3300005577 Ga0068857_100291855 Ga0068857_1002918552 152
640 3300005577 Ga0068857_100434273 Ga0068857_1004342732 152
641 3300005577 Ga0068857_101066635 Ga0068857_1010666352 152
642 3300005577 Ga0068857_101713960 Ga0068857_1017139602 152
643 3300005578 Ga0068854_100094261 Ga0068854_1000942612 152
644 3300005578 Ga0068854_100113247 Ga0068854_1001132472 152
645 3300005578 Ga0068854_100220674 Ga0068854_1002206743 152
646 3300005578 Ga0068854_100236417 Ga0068854_1002364172 152
647 3300005578 Ga0068854_100274156 Ga0068854_1002741562 152
648 3300005578 Ga0068854_100306711 Ga0068854_1003067112 152
649 3300005578 Ga0068854_100641866 Ga0068854_1006418662 152
650 3300005578 Ga0068854_100870157 Ga0068854_1008701572 152
651 3300005614 Ga0068856_100014081 Ga0068856_1000140817 152
652 3300005614 Ga0068856_100162962 Ga0068856_1001629621 152
653 3300005615 Ga0070702_100546531 Ga0070702_1005465311 152
654 3300005616 Ga0068852_100011198 Ga0068852_1000111984 152
655 3300005616 Ga0068852_100038402 Ga0068852_1000384023 152
656 3300005616 Ga0068852_100045041 Ga0068852_1000450413 152
657 3300005616 Ga0068852_100149566 Ga0068852_1001495662 152
658 3300005616 Ga0068852_100153579 Ga0068852_1001535792 152
659 3300005616 Ga0068852_100484989 Ga0068852_1004849892 152
660 3300005616 Ga0068852_100518328 Ga0068852_1005183282 152
661 3300005616 Ga0068852_100532620 Ga0068852_1005326202 152
662 3300005616 Ga0068852_100621766 Ga0068852_1006217662 152
663 3300005616 Ga0068852_101363885 Ga0068852_1013638851 152
664 3300005616 Ga0068852_102291355 Ga0068852_1022913551 152
665 3300005617 Ga0068859_100000006 Ga0068859_100000006113 152
666 3300005617 Ga0068859_100000735 Ga0068859_10000073516 152
667 3300005617 Ga0068859_100019133 Ga0068859_1000191333 152
668 3300005617 Ga0068859_100036492 Ga0068859_1000364926 152
669 3300005617 Ga0068859_100129414 Ga0068859_1001294145 152
670 3300005617 Ga0068859_100160171 Ga0068859_1001601712 152
671 3300005617 Ga0068859_100649685 Ga0068859_1006496852 152
672 3300005617 Ga0068859_102774942 Ga0068859_1027749421 152
673 3300005618 Ga0068864_100095928 Ga0068864_1000959285 152
674 3300005618 Ga0068864_100158528 Ga0068864_1001585283 152
675 3300005618 Ga0068864_100185819 Ga0068864_1001858192 152
676 3300005618 Ga0068864_100337144 Ga0068864_1003371442 152
677 3300005618 Ga0068864_100563055 Ga0068864_1005630551 152
678 3300005618 Ga0068864_100725783 Ga0068864_1007257832 152
679 3300005618 Ga0068864_100757795 Ga0068864_1007577952 152
680 3300005618 Ga0068864_101270336 Ga0068864_1012703361 152
681 3300005618 Ga0068864_101291842 Ga0068864_1012918421 152
682 3300005718 Ga0068866_10045706 Ga0068866_100457064 152
683 3300005718 Ga0068866_10434408 Ga0068866_104344082 152
684 3300005718 Ga0068866_10487145 Ga0068866_104871452 152
685 3300005719 Ga0068861_100014736 Ga0068861_1000147364 152
686 3300005719 Ga0068861_100078004 Ga0068861_1000780042 152
687 3300005719 Ga0068861_100203610 Ga0068861_1002036101 152
688 3300005719 Ga0068861_100231191 Ga0068861_1002311912 152
689 3300005719 Ga0068861_100447271 Ga0068861_1004472712 152
690 3300005719 Ga0068861_100501420 Ga0068861_1005014202 152
691 3300005719 Ga0068861_100854387 Ga0068861_1008543872 152
692 3300005834 Ga0068851_10110485 Ga0068851_101104852 152
693 3300005834 Ga0068851_10614862 Ga0068851_106148622 152
694 3300005834 Ga0068851_10756525 Ga0068851_107565251 152
695 3300005840 Ga0068870_10060235 Ga0068870_100602352 152
696 3300005840 Ga0068870_10348688 Ga0068870_103486882 152
697 3300005840 Ga0068870_10428263 Ga0068870_104282632 152
698 3300005841 Ga0068863_100001252 Ga0068863_1000012529 152
699 3300005841 Ga0068863_100032647 Ga0068863_1000326474 152
700 3300005841 Ga0068863_100086136 Ga0068863_1000861362 152
701 3300005841 Ga0068863_100147721 Ga0068863_1001477214 152
702 3300005841 Ga0068863_100564301 Ga0068863_1005643012 152
703 3300005842 Ga0068858_100007555 Ga0068858_1000075554 152
704 3300005842 Ga0068858_100043357 Ga0068858_1000433572 152
705 3300005842 Ga0068858_100646809 Ga0068858_1006468091 152
706 3300005842 Ga0068858_100983942 Ga0068858_1009839422 152
707 3300005842 Ga0068858_101215008 Ga0068858_1012150082 152
708 3300005842 Ga0068858_101278145 Ga0068858_1012781451 152
709 3300005843 Ga0068860_100000061 Ga0068860_100000061165 152
710 3300005843 Ga0068860_100003402 Ga0068860_1000034029 152
711 3300005843 Ga0068860_100030317 Ga0068860_1000303174 152
712 3300005843 Ga0068860_100109399 Ga0068860_1001093992 152
713 3300005843 Ga0068860_100154146 Ga0068860_1001541462 152
714 3300005843 Ga0068860_100333541 Ga0068860_1003335412 152
715 3300005843 Ga0068860_100572169 Ga0068860_1005721691 152
716 3300005843 Ga0068860_100982235 Ga0068860_1009822352 152
717 3300005844 Ga0068862_100002841 Ga0068862_1000028414 152
718 3300005844 Ga0068862_100542417 Ga0068862_1005424172 152
719 3300005844 Ga0068862_101138861 Ga0068862_1011388612 152
720 3300005844 Ga0068862_101696117 Ga0068862_1016961172 152
721 3300005983 Ga0081540_1039023 Ga0081540_10390233 152
722 3300005985 Ga0081539_10000377 Ga0081539_1000037774 152
723 3300006028 Ga0070717_10716314 Ga0070717_107163143 152
724 3300006195 Ga0075366_10093664 Ga0075366_100936641 152
725 3300006195 Ga0075366_10877359 Ga0075366_108773591 152
726 3300006237 Ga0097621_100008333 Ga0097621_1000083339 152
727 3300006237 Ga0097621_100233447 Ga0097621_1002334472 152
728 3300006237 Ga0097621_100909370 Ga0097621_1009093702 152
729 3300006237 Ga0097621_101601656 Ga0097621_1016016561 152
730 3300006358 Ga0068871_100000319 Ga0068871_10000031913 152
731 3300006358 Ga0068871_100008771 Ga0068871_1000087716 152
732 3300006358 Ga0068871_100055566 Ga0068871_1000555664 152
733 3300006358 Ga0068871_100145169 Ga0068871_1001451691 152
734 3300006358 Ga0068871_100681690 Ga0068871_1006816901 152
735 3300006358 Ga0068871_100734479 Ga0068871_1007344792 152
736 3300006881 Ga0068865_100075542 Ga0068865_1000755422 152
737 3300006881 Ga0068865_100253078 Ga0068865_1002530782 152
738 3300006881 Ga0068865_101404718 Ga0068865_1014047181 152
739 3300006914 Ga0075436_100630211 Ga0075436_1006302112 152
740 3300006931 Ga0097620_100000006 Ga0097620_100000006113 152
741 3300006931 Ga0097620_100000735 Ga0097620_10000073516 152
742 3300006931 Ga0097620_100019133 Ga0097620_1000191334 152
743 3300006931 Ga0097620_100036493 Ga0097620_1000364936 152
744 3300006931 Ga0097620_100129411 Ga0097620_1001294115 152
745 3300006931 Ga0097620_100160177 Ga0097620_1001601772 152
746 3300006931 Ga0097620_100649685 Ga0097620_1006496852 152
747 3300006931 Ga0097620_102774752 Ga0097620_1027747521 152
748 3300007076 Ga0075435_100431440 Ga0075435_1004314403 152
749 3300007076 Ga0075435_100976727 Ga0075435_1009767271 152
750 3300009093 Ga0105240_10000198 Ga0105240_1000019842 152
751 3300009093 Ga0105240_10013967 Ga0105240_100139679 152
752 3300009093 Ga0105240_10015957 Ga0105240_100159574 152
753 3300009093 Ga0105240_10016504 Ga0105240_100165044 152
754 3300009093 Ga0105240_10030173 Ga0105240_100301732 152
755 3300009093 Ga0105240_10031764 Ga0105240_100317644 152
756 3300009093 Ga0105240_10063722 Ga0105240_100637223 152
757 3300009093 Ga0105240_10077023 Ga0105240_100770234 152
758 3300009093 Ga0105240_10329619 Ga0105240_103296192 152
759 3300009093 Ga0105240_11034942 Ga0105240_110349421 152
760 3300009094 Ga0111539_10000962 Ga0111539_1000096212 152
761 3300009098 Ga0105245_10044369 Ga0105245_100443693 152
762 3300009098 Ga0105245_10087307 Ga0105245_100873072 152
763 3300009098 Ga0105245_11226622 Ga0105245_112266222 152
764 3300009101 Ga0105247_10007950 Ga0105247_100079504 152
765 3300009101 Ga0105247_10049748 Ga0105247_100497482 152
766 3300009148 Ga0105243_10464351 Ga0105243_104643512 152
767 3300009174 Ga0105241_10006910 Ga0105241_100069103 152
768 3300009174 Ga0105241_10066448 Ga0105241_100664482 152
769 3300009174 Ga0105241_10077674 Ga0105241_100776745 152
770 3300009174 Ga0105241_10510077 Ga0105241_105100771 152
771 3300009174 Ga0105241_11038252 Ga0105241_110382522 152
772 3300009176 Ga0105242_10014706 Ga0105242_100147063 152
773 3300009176 Ga0105242_10053731 Ga0105242_100537312 152
774 3300009176 Ga0105242_10136150 Ga0105242_101361503 152
775 3300009176 Ga0105242_10428938 Ga0105242_104289382 152
776 3300009176 Ga0105242_10503307 Ga0105242_105033072 152
777 3300009176 Ga0105242_10516631 Ga0105242_105166312 152
778 3300009176 Ga0105242_10534996 Ga0105242_105349962 152
779 3300009176 Ga0105242_12941927 Ga0105242_129419271 152
780 3300009177 Ga0105248_10100373 Ga0105248_101003735 152
781 3300009545 Ga0105237_10001982 Ga0105237_1000198220 152
782 3300009545 Ga0105237_10005617 Ga0105237_100056172 152
783 3300009545 Ga0105237_10009021 Ga0105237_100090218 152
784 3300009545 Ga0105237_10012986 Ga0105237_100129868 152
785 3300009545 Ga0105237_10015967 Ga0105237_100159674 152
786 3300009545 Ga0105237_10023843 Ga0105237_100238434 152
787 3300009545 Ga0105237_10371442 Ga0105237_103714422 152
788 3300009545 Ga0105237_10865989 Ga0105237_108659891 152
789 3300009545 Ga0105237_11337957 Ga0105237_113379572 152
790 3300009551 Ga0105238_10017486 Ga0105238_100174864 152
791 3300009551 Ga0105238_10181149 Ga0105238_101811492 152
792 3300009551 Ga0105238_10186391 Ga0105238_101863912 152
793 3300009551 Ga0105238_10302076 Ga0105238_103020762 152
794 3300009551 Ga0105238_10302706 Ga0105238_103027062 152
795 3300009551 Ga0105238_10962055 Ga0105238_109620552 152
796 3300009553 Ga0105249_10002985 Ga0105249_100029855 152
797 3300009553 Ga0105249_10079783 Ga0105249_100797832 152
798 3300009553 Ga0105249_10123416 Ga0105249_101234162 152
799 3300009553 Ga0105249_10679815 Ga0105249_106798152 152
800 3300009553 Ga0105249_11116968 Ga0105249_111169682 152
801 3300009553 Ga0105249_11129543 Ga0105249_111295432 152
802 3300010375 Ga0105239_10000019 Ga0105239_10000019215 152
803 3300010375 Ga0105239_10011609 Ga0105239_100116094 152
804 3300010375 Ga0105239_10013153 Ga0105239_100131534 152
805 3300010375 Ga0105239_10015448 Ga0105239_100154484 152
806 3300010375 Ga0105239_10041345 Ga0105239_100413454 152
807 3300010375 Ga0105239_10086685 Ga0105239_100866852 152
808 3300010375 Ga0105239_10093938 Ga0105239_100939384 152
809 3300010375 Ga0105239_10105489 Ga0105239_101054892 152
810 3300010375 Ga0105239_10136751 Ga0105239_101367514 152
811 3300010375 Ga0105239_10232044 Ga0105239_102320442 152
812 3300010375 Ga0105239_10481427 Ga0105239_104814272 152
813 3300010375 Ga0105239_10619623 Ga0105239_106196232 152
814 3300010375 Ga0105239_11065702 Ga0105239_110657022 152
815 3300010375 Ga0105239_11232637 Ga0105239_112326372 152
816 3300011119 Ga0105246_10011345 Ga0105246_100113455 152
817 3300011119 Ga0105246_12126441 Ga0105246_121264411 152
818 3300013100 Ga0157373_10002874 Ga0157373_100028743 152
819 3300013100 Ga0157373_10021650 Ga0157373_100216504 152
820 3300013100 Ga0157373_10185966 Ga0157373_101859661 152
821 3300013100 Ga0157373_10283310 Ga0157373_102833102 152
822 3300013100 Ga0157373_10283582 Ga0157373_102835823 152
823 3300013100 Ga0157373_10295618 Ga0157373_102956182 152
824 3300013102 Ga0157371_10000952 Ga0157371_1000095219 152
825 3300013102 Ga0157371_10001122 Ga0157371_1000112224 152
826 3300013102 Ga0157371_10002846 Ga0157371_100028469 152
827 3300013102 Ga0157371_10027570 Ga0157371_100275702 152
828 3300013102 Ga0157371_10066975 Ga0157371_100669753 152
829 3300013102 Ga0157371_10074646 Ga0157371_100746462 152
830 3300013102 Ga0157371_10076831 Ga0157371_100768311 152
831 3300013102 Ga0157371_10079122 Ga0157371_100791224 152
832 3300013102 Ga0157371_10243713 Ga0157371_102437132 152
833 3300013102 Ga0157371_10295276 Ga0157371_102952762 152
834 3300013104 Ga0157370_10002201 Ga0157370_100022014 152
835 3300013104 Ga0157370_10003755 Ga0157370_100037556 152
836 3300013104 Ga0157370_10006791 Ga0157370_1000679111 152
837 3300013104 Ga0157370_10047041 Ga0157370_100470414 152
838 3300013104 Ga0157370_10084917 Ga0157370_100849175 152
839 3300013104 Ga0157370_10292857 Ga0157370_102928573 152
840 3300013104 Ga0157370_10498687 Ga0157370_104986872 152
841 3300013104 Ga0157370_10519839 Ga0157370_105198392 152
842 3300013104 Ga0157370_11143492 Ga0157370_111434921 152
843 3300013105 Ga0157369_10067384 Ga0157369_100673843 152
844 3300013105 Ga0157369_10159214 Ga0157369_101592142 152
845 3300013105 Ga0157369_10226437 Ga0157369_102264371 152
846 3300013105 Ga0157369_11710858 Ga0157369_117108581 152
847 3300013296 Ga0157374_10000011 Ga0157374_10000011161 152
848 3300013296 Ga0157374_10008439 Ga0157374_100084395 152
849 3300013296 Ga0157374_10013524 Ga0157374_100135247 152
850 3300013296 Ga0157374_10040149 Ga0157374_100401492 152
851 3300013296 Ga0157374_10283094 Ga0157374_102830943 152
852 3300013296 Ga0157374_10307497 Ga0157374_103074972 152
853 3300013296 Ga0157374_10812862 Ga0157374_108128621 152
854 3300013296 Ga0157374_11122917 Ga0157374_111229172 152
855 3300013297 Ga0157378_10003243 Ga0157378_1000324310 152
856 3300013297 Ga0157378_10041196 Ga0157378_100411965 152
857 3300013297 Ga0157378_10233520 Ga0157378_102335202 152
858 3300013297 Ga0157378_10821083 Ga0157378_108210832 152
859 3300013297 Ga0157378_11405307 Ga0157378_114053071 152
860 3300013297 Ga0157378_11906018 Ga0157378_119060181 152
861 3300013306 Ga0163162_10000112 Ga0163162_100001123 152
862 3300013306 Ga0163162_10000614 Ga0163162_1000061424 152
863 3300013306 Ga0163162_10000913 Ga0163162_1000091321 152
864 3300013306 Ga0163162_10001319 Ga0163162_100013199 152
865 3300013306 Ga0163162_10015374 Ga0163162_100153744 152
866 3300013306 Ga0163162_10023043 Ga0163162_100230433 152
867 3300013306 Ga0163162_10035099 Ga0163162_100350993 152
868 3300013306 Ga0163162_10053588 Ga0163162_100535885 152
869 3300013306 Ga0163162_10144246 Ga0163162_101442461 152
870 3300013306 Ga0163162_10157063 Ga0163162_101570632 152
871 3300013306 Ga0163162_10177223 Ga0163162_101772232 152
872 3300013306 Ga0163162_10224020 Ga0163162_102240202 152
873 3300013306 Ga0163162_10357940 Ga0163162_103579402 152
874 3300013306 Ga0163162_10420505 Ga0163162_104205052 152
875 3300013306 Ga0163162_10819656 Ga0163162_108196562 152
876 3300013306 Ga0163162_11111615 Ga0163162_111116151 152
877 3300013307 Ga0157372_10001903 Ga0157372_1000190319 152
878 3300013307 Ga0157372_10003342 Ga0157372_1000334215 152
879 3300013307 Ga0157372_10006578 Ga0157372_100065787 152
880 3300013307 Ga0157372_10049589 Ga0157372_100495898 152
881 3300013307 Ga0157372_10065202 Ga0157372_100652022 152
882 3300013307 Ga0157372_10069651 Ga0157372_100696515 152
883 3300013307 Ga0157372_10083334 Ga0157372_100833342 152
884 3300013307 Ga0157372_10264813 Ga0157372_102648133 152
885 3300013307 Ga0157372_10488483 Ga0157372_104884832 152
886 3300013307 Ga0157372_10931406 Ga0157372_109314062 152
887 3300013308 Ga0157375_10000601 Ga0157375_1000060116 152
888 3300013308 Ga0157375_10012310 Ga0157375_100123104 152
889 3300013308 Ga0157375_10022970 Ga0157375_100229704 152
890 3300013308 Ga0157375_10028715 Ga0157375_100287155 152
891 3300013308 Ga0157375_10674013 Ga0157375_106740132 152
892 3300013308 Ga0157375_12777891 Ga0157375_127778911 152
893 3300014325 Ga0163163_10000690 Ga0163163_1000069028 152
894 3300014325 Ga0163163_10113399 Ga0163163_101133992 152
895 3300014325 Ga0163163_10116364 Ga0163163_101163642 152
896 3300014325 Ga0163163_10181011 Ga0163163_101810112 152
897 3300014326 Ga0157380_10014204 Ga0157380_100142044 152
898 3300014326 Ga0157380_10085888 Ga0157380_100858882 152
899 3300014326 Ga0157380_10247952 Ga0157380_102479522 152
900 3300014326 Ga0157380_10580194 Ga0157380_105801942 152
901 3300014326 Ga0157380_11533395 Ga0157380_115333952 152
902 3300014745 Ga0157377_10004274 Ga0157377_100042744 152
903 3300014745 Ga0157377_10123596 Ga0157377_101235962 152
904 3300014745 Ga0157377_10776138 Ga0157377_107761381 152
905 3300014968 Ga0157379_10041837 Ga0157379_100418372 152
906 3300014968 Ga0157379_10086985 Ga0157379_100869852 152
907 3300014968 Ga0157379_10155677 Ga0157379_101556772 152
908 3300014968 Ga0157379_10394826 Ga0157379_103948262 152
909 3300014968 Ga0157379_10412309 Ga0157379_104123091 152
910 3300014968 Ga0157379_10671618 Ga0157379_106716181 152
911 3300014968 Ga0157379_10923899 Ga0157379_109238992 152
912 3300014968 Ga0157379_11923917 Ga0157379_119239171 152
913 3300014969 Ga0157376_10000444 Ga0157376_100004449 152
914 3300014969 Ga0157376_10002197 Ga0157376_100021972 152
915 3300014969 Ga0157376_10003806 Ga0157376_100038062 152
916 3300014969 Ga0157376_10079302 Ga0157376_100793023 152
917 3300014969 Ga0157376_10082599 Ga0157376_100825994 152
918 3300014969 Ga0157376_10249085 Ga0157376_102490852 152
919 3300014969 Ga0157376_10333775 Ga0157376_103337751 152
920 3300014969 Ga0157376_10761157 Ga0157376_107611571 152
921 3300014969 Ga0157376_12141406 Ga0157376_121414061 152
922 3300015265 Ga0182005_1207556 Ga0182005_12075561 152
923 3300017792 Ga0163161_10014070 Ga0163161_100140705 152
924 3300017792 Ga0163161_10017711 Ga0163161_100177114 152
925 3300017792 Ga0163161_10017989 Ga0163161_100179896 152
926 3300017792 Ga0163161_10029789 Ga0163161_100297892 152
927 3300017792 Ga0163161_10091444 Ga0163161_100914442 152
928 3300017792 Ga0163161_10119903 Ga0163161_101199032 152
929 3300017792 Ga0163161_10430865 Ga0163161_104308653 152
930 3300017792 Ga0163161_10518465 Ga0163161_105184651 152
931 3300017792 Ga0163161_10662237 Ga0163161_106622372 152
932 3300021384 Ga0213876_10011635 Ga0213876_100116357 152
933 3300025302 Ga0207426_1000026 Ga0207426_1000026105 152
934 3300025315 Ga0207697_10340488 Ga0207697_103404881 152
935 3300025321 Ga0207656_10266838 Ga0207656_102668381 152
936 3300025321 Ga0207656_10506713 Ga0207656_105067131 152
937 3300025893 Ga0207682_10304172 Ga0207682_103041722 152
938 3300025900 Ga0207710_10018757 Ga0207710_100187574 152
939 3300025901 Ga0207688_10376825 Ga0207688_103768252 152
940 3300025903 Ga0207680_10000037 Ga0207680_1000003745 152
941 3300025903 Ga0207680_10008931 Ga0207680_100089313 152
942 3300025903 Ga0207680_10662740 Ga0207680_106627401 152
943 3300025904 Ga0207647_10012136 Ga0207647_100121364 152
944 3300025904 Ga0207647_10079256 Ga0207647_100792562 152
945 3300025904 Ga0207647_10094433 Ga0207647_100944333 152
946 3300025904 Ga0207647_10352870 Ga0207647_103528702 152
947 3300025904 Ga0207647_10401203 Ga0207647_104012032 152
948 3300025905 Ga0207685_10152165 Ga0207685_101521652 152
949 3300025907 Ga0207645_10013030 Ga0207645_100130304 152
950 3300025907 Ga0207645_10132267 Ga0207645_101322672 152
951 3300025908 Ga0207643_10013487 Ga0207643_100134874 152
952 3300025908 Ga0207643_10391408 Ga0207643_103914082 152
953 3300025908 Ga0207643_10504190 Ga0207643_105041902 152
954 3300025909 Ga0207705_10208432 Ga0207705_102084322 152
955 3300025909 Ga0207705_10489519 Ga0207705_104895191 152
956 3300025909 Ga0207705_11007036 Ga0207705_110070361 152
957 3300025909 Ga0207705_11166358 Ga0207705_111663581 152
958 3300025911 Ga0207654_10000603 Ga0207654_100006034 152
959 3300025911 Ga0207654_10001578 Ga0207654_100015786 152
960 3300025911 Ga0207654_10048701 Ga0207654_100487011 152
961 3300025911 Ga0207654_10171803 Ga0207654_101718032 152
962 3300025911 Ga0207654_10344936 Ga0207654_103449362 152
963 3300025912 Ga0207707_10001095 Ga0207707_1000109518 152
964 3300025912 Ga0207707_10039720 Ga0207707_100397203 152
965 3300025912 Ga0207707_10469739 Ga0207707_104697392 152
966 3300025912 Ga0207707_10573862 Ga0207707_105738622 152
967 3300025912 Ga0207707_10793583 Ga0207707_107935832 152
968 3300025913 Ga0207695_10000346 Ga0207695_1000034640 152
969 3300025913 Ga0207695_10012325 Ga0207695_100123253 152
970 3300025913 Ga0207695_10012913 Ga0207695_100129134 152
971 3300025913 Ga0207695_10023689 Ga0207695_100236892 152
972 3300025913 Ga0207695_10024645 Ga0207695_100246455 152
973 3300025913 Ga0207695_10143899 Ga0207695_101438992 152
974 3300025913 Ga0207695_10152134 Ga0207695_101521344 152
975 3300025914 Ga0207671_10003841 Ga0207671_100038415 152
976 3300025914 Ga0207671_10004209 Ga0207671_1000420910 152
977 3300025914 Ga0207671_10004941 Ga0207671_1000494114 152
978 3300025914 Ga0207671_10007992 Ga0207671_100079928 152
979 3300025914 Ga0207671_10010299 Ga0207671_100102994 152
980 3300025914 Ga0207671_10154787 Ga0207671_101547873 152
981 3300025914 Ga0207671_10173267 Ga0207671_101732672 152
982 3300025914 Ga0207671_10417167 Ga0207671_104171672 152
983 3300025914 Ga0207671_10808666 Ga0207671_108086662 152
984 3300025917 Ga0207660_10010737 Ga0207660_100107373 152
985 3300025917 Ga0207660_10021974 Ga0207660_100219742 152
986 3300025919 Ga0207657_10012542 Ga0207657_100125421 152
987 3300025919 Ga0207657_10040703 Ga0207657_100407033 152
988 3300025919 Ga0207657_10165810 Ga0207657_101658102 152
989 3300025919 Ga0207657_10366888 Ga0207657_103668882 152
990 3300025920 Ga0207649_10003473 Ga0207649_100034734 152
991 3300025920 Ga0207649_10088573 Ga0207649_100885732 152
992 3300025921 Ga0207652_10004110 Ga0207652_100041102 152
993 3300025921 Ga0207652_10016975 Ga0207652_100169753 152
994 3300025921 Ga0207652_10017593 Ga0207652_100175932 152
995 3300025921 Ga0207652_10956727 Ga0207652_109567272 152
996 3300025923 Ga0207681_10003766 Ga0207681_100037667 152
997 3300025924 Ga0207694_10144872 Ga0207694_101448722 152
998 3300025924 Ga0207694_10736733 Ga0207694_107367332 152
999 3300025924 Ga0207694_11199448 Ga0207694_111994481 152
1000 3300025925 Ga0207650_10102447 Ga0207650_101024473 152
1001 3300025925 Ga0207650_10113180 Ga0207650_101131802 152
1002 3300025925 Ga0207650_10172888 Ga0207650_101728883 152
1003 3300025925 Ga0207650_10218448 Ga0207650_102184482 152
1004 3300025925 Ga0207650_10352943 Ga0207650_103529432 152
1005 3300025925 Ga0207650_10388211 Ga0207650_103882111 152
1006 3300025925 Ga0207650_11337743 Ga0207650_113377431 152
1007 3300025926 Ga0207659_10069228 Ga0207659_100692282 152
1008 3300025926 Ga0207659_10530070 Ga0207659_105300702 152
1009 3300025926 Ga0207659_10627556 Ga0207659_106275562 152
1010 3300025927 Ga0207687_10238255 Ga0207687_102382552 152
1011 3300025927 Ga0207687_11309720 Ga0207687_113097201 152
1012 3300025931 Ga0207644_10092597 Ga0207644_100925972 152
1013 3300025931 Ga0207644_10194911 Ga0207644_101949112 152
1014 3300025931 Ga0207644_10412530 Ga0207644_104125302 152
1015 3300025931 Ga0207644_10444848 Ga0207644_104448482 152
1016 3300025931 Ga0207644_10733144 Ga0207644_107331442 152
1017 3300025932 Ga0207690_10009616 Ga0207690_100096162 152
1018 3300025932 Ga0207690_10025651 Ga0207690_100256514 152
1019 3300025932 Ga0207690_10214256 Ga0207690_102142563 152
1020 3300025932 Ga0207690_10323946 Ga0207690_103239462 152
1021 3300025932 Ga0207690_10446319 Ga0207690_104463191 152
1022 3300025933 Ga0207706_10002794 Ga0207706_1000279413 152
1023 3300025933 Ga0207706_10004604 Ga0207706_100046047 152
1024 3300025933 Ga0207706_10050692 Ga0207706_100506924 152
1025 3300025933 Ga0207706_10395973 Ga0207706_103959732 152
1026 3300025934 Ga0207686_10080916 Ga0207686_100809163 152
1027 3300025934 Ga0207686_10441310 Ga0207686_104413101 152
1028 3300025934 Ga0207686_10837110 Ga0207686_108371101 152
1029 3300025936 Ga0207670_10026553 Ga0207670_100265534 152
1030 3300025937 Ga0207669_11095037 Ga0207669_110950371 152
1031 3300025937 Ga0207669_11106951 Ga0207669_111069511 152
1032 3300025938 Ga0207704_10064176 Ga0207704_100641763 152
1033 3300025938 Ga0207704_10698521 Ga0207704_106985212 152
1034 3300025940 Ga0207691_10044889 Ga0207691_100448892 152
1035 3300025940 Ga0207691_10231473 Ga0207691_102314731 152
1036 3300025940 Ga0207691_10369391 Ga0207691_103693911 152
1037 3300025942 Ga0207689_10008996 Ga0207689_100089964 152
1038 3300025942 Ga0207689_10010524 Ga0207689_100105247 152
1039 3300025942 Ga0207689_10019882 Ga0207689_100198823 152
1040 3300025942 Ga0207689_10038034 Ga0207689_100380342 152
1041 3300025942 Ga0207689_10083353 Ga0207689_100833532 152
1042 3300025942 Ga0207689_10116850 Ga0207689_101168503 152
1043 3300025942 Ga0207689_10131150 Ga0207689_101311502 152
1044 3300025942 Ga0207689_10309882 Ga0207689_103098822 152
1045 3300025942 Ga0207689_10384479 Ga0207689_103844792 152
1046 3300025944 Ga0207661_10020210 Ga0207661_100202104 152
1047 3300025944 Ga0207661_10166174 Ga0207661_101661742 152
1048 3300025944 Ga0207661_10329120 Ga0207661_103291201 152
1049 3300025944 Ga0207661_11180483 Ga0207661_111804831 152
1050 3300025944 Ga0207661_11459269 Ga0207661_114592691 152
1051 3300025945 Ga0207679_10028024 Ga0207679_100280244 152
1052 3300025945 Ga0207679_10044269 Ga0207679_100442692 152
1053 3300025945 Ga0207679_10199883 Ga0207679_101998832 152
1054 3300025945 Ga0207679_10289072 Ga0207679_102890722 152
1055 3300025949 Ga0207667_10002151 Ga0207667_1000215122 152
1056 3300025949 Ga0207667_10010172 Ga0207667_100101729 152
1057 3300025949 Ga0207667_10017202 Ga0207667_100172024 152
1058 3300025949 Ga0207667_10018745 Ga0207667_100187458 152
1059 3300025949 Ga0207667_10065806 Ga0207667_100658066 152
1060 3300025949 Ga0207667_10112170 Ga0207667_101121703 152
1061 3300025949 Ga0207667_10245114 Ga0207667_102451142 152
1062 3300025949 Ga0207667_10445162 Ga0207667_104451622 152
1063 3300025960 Ga0207651_10054734 Ga0207651_100547342 152
1064 3300025960 Ga0207651_10234627 Ga0207651_102346271 152
1065 3300025960 Ga0207651_10352401 Ga0207651_103524012 152
1066 3300025960 Ga0207651_10521355 Ga0207651_105213552 152
1067 3300025961 Ga0207712_10003486 Ga0207712_100034868 152
1068 3300025961 Ga0207712_10139903 Ga0207712_101399032 152
1069 3300025961 Ga0207712_10289941 Ga0207712_102899411 152
1070 3300025961 Ga0207712_10376531 Ga0207712_103765312 152
1071 3300025961 Ga0207712_11286511 Ga0207712_112865111 152
1072 3300025972 Ga0207668_10022839 Ga0207668_100228394 152
1073 3300025972 Ga0207668_10513460 Ga0207668_105134602 152
1074 3300025981 Ga0207640_10041625 Ga0207640_100416252 152
1075 3300025981 Ga0207640_10201658 Ga0207640_102016582 152
1076 3300025981 Ga0207640_10218684 Ga0207640_102186842 152
1077 3300025981 Ga0207640_10359763 Ga0207640_103597632 152
1078 3300025981 Ga0207640_10821985 Ga0207640_108219852 152
1079 3300025981 Ga0207640_10882634 Ga0207640_108826342 152
1080 3300025981 Ga0207640_11331286 Ga0207640_113312862 152
1081 3300025986 Ga0207658_10025608 Ga0207658_100256082 152
1082 3300025986 Ga0207658_10078943 Ga0207658_100789433 152
1083 3300025986 Ga0207658_10334220 Ga0207658_103342202 152
1084 3300025986 Ga0207658_10480479 Ga0207658_104804791 152
1085 3300025986 Ga0207658_11334051 Ga0207658_113340511 152
1086 3300026023 Ga0207677_10011773 Ga0207677_100117733 152
1087 3300026023 Ga0207677_10016256 Ga0207677_100162565 152
1088 3300026023 Ga0207677_10061897 Ga0207677_100618971 152
1089 3300026023 Ga0207677_10095818 Ga0207677_100958182 152
1090 3300026023 Ga0207677_10190694 Ga0207677_101906942 152
1091 3300026023 Ga0207677_10205422 Ga0207677_102054222 152
1092 3300026023 Ga0207677_10370480 Ga0207677_103704802 152
1093 3300026023 Ga0207677_10589524 Ga0207677_105895241 152
1094 3300026023 Ga0207677_10604982 Ga0207677_106049821 152
1095 3300026023 Ga0207677_10948131 Ga0207677_109481312 152
1096 3300026023 Ga0207677_11257820 Ga0207677_112578201 152
1097 3300026035 Ga0207703_10081669 Ga0207703_100816694 152
1098 3300026035 Ga0207703_10541075 Ga0207703_105410752 152
1099 3300026035 Ga0207703_11189035 Ga0207703_111890351 152
1100 3300026041 Ga0207639_10023610 Ga0207639_100236102 152
1101 3300026041 Ga0207639_10048758 Ga0207639_100487583 152
1102 3300026041 Ga0207639_10057966 Ga0207639_100579662 152
1103 3300026041 Ga0207639_10077014 Ga0207639_100770141 152
1104 3300026041 Ga0207639_10203954 Ga0207639_102039541 152
1105 3300026041 Ga0207639_10289053 Ga0207639_102890532 152
1106 3300026041 Ga0207639_10475086 Ga0207639_104750862 152
1107 3300026041 Ga0207639_10661030 Ga0207639_106610302 152
1108 3300026041 Ga0207639_10842927 Ga0207639_108429272 152
1109 3300026041 Ga0207639_11198379 Ga0207639_111983791 152
1110 3300026041 Ga0207639_11490069 Ga0207639_114900691 152
1111 3300026075 Ga0207708_10684310 Ga0207708_106843101 152
1112 3300026075 Ga0207708_10948449 Ga0207708_109484491 152
1113 3300026078 Ga0207702_10025459 Ga0207702_100254594 152
1114 3300026078 Ga0207702_10044287 Ga0207702_100442872 152
1115 3300026078 Ga0207702_10111012 Ga0207702_101110122 152
1116 3300026088 Ga0207641_10000186 Ga0207641_1000018631 152
1117 3300026088 Ga0207641_10049636 Ga0207641_100496362 152
1118 3300026088 Ga0207641_10053280 Ga0207641_100532804 152
1119 3300026088 Ga0207641_10342402 Ga0207641_103424022 152
1120 3300026089 Ga0207648_10005206 Ga0207648_100052064 152
1121 3300026089 Ga0207648_10005571 Ga0207648_100055711 152
1122 3300026089 Ga0207648_10008521 Ga0207648_100085212 152
1123 3300026089 Ga0207648_10049595 Ga0207648_100495952 152
1124 3300026089 Ga0207648_10213606 Ga0207648_102136063 152
1125 3300026089 Ga0207648_10243008 Ga0207648_102430082 152
1126 3300026089 Ga0207648_10269701 Ga0207648_102697012 152
1127 3300026089 Ga0207648_10420558 Ga0207648_104205582 152
1128 3300026089 Ga0207648_10483197 Ga0207648_104831972 152
1129 3300026095 Ga0207676_10009191 Ga0207676_100091914 152
1130 3300026095 Ga0207676_10151138 Ga0207676_101511382 152
1131 3300026095 Ga0207676_10390576 Ga0207676_103905761 152
1132 3300026095 Ga0207676_11119210 Ga0207676_111192102 152
1133 3300026095 Ga0207676_11257785 Ga0207676_112577852 152
1134 3300026095 Ga0207676_11344209 Ga0207676_113442092 152
1135 3300026116 Ga0207674_10001615 Ga0207674_100016158 152
1136 3300026116 Ga0207674_10003228 Ga0207674_1000322813 152
1137 3300026116 Ga0207674_10009705 Ga0207674_100097053 152
1138 3300026116 Ga0207674_10017319 Ga0207674_100173196 152
1139 3300026116 Ga0207674_10115643 Ga0207674_101156433 152
1140 3300026116 Ga0207674_10161757 Ga0207674_101617572 152
1141 3300026116 Ga0207674_10250621 Ga0207674_102506212 152
1142 3300026116 Ga0207674_10547226 Ga0207674_105472262 152
1143 3300026116 Ga0207674_11910000 Ga0207674_119100001 152
1144 3300026118 Ga0207675_100000260 Ga0207675_10000026022 152
1145 3300026118 Ga0207675_100100049 Ga0207675_1001000492 152
1146 3300026118 Ga0207675_100422306 Ga0207675_1004223062 152
1147 3300026118 Ga0207675_100432829 Ga0207675_1004328292 152
1148 3300026118 Ga0207675_100487356 Ga0207675_1004873562 152
1149 3300026118 Ga0207675_100566034 Ga0207675_1005660342 152
1150 3300026118 Ga0207675_101084216 Ga0207675_1010842162 152
1151 3300026118 Ga0207675_101408724 Ga0207675_1014087242 152
1152 3300026121 Ga0207683_10076815 Ga0207683_100768152 152
1153 3300026121 Ga0207683_11572356 Ga0207683_115723561 152
1154 3300026121 Ga0207683_11581786 Ga0207683_115817861 152
1155 3300026142 Ga0207698_10036780 Ga0207698_100367804 152
1156 3300026142 Ga0207698_10041425 Ga0207698_100414252 152
1157 3300026142 Ga0207698_10128171 Ga0207698_101281712 152
1158 3300026142 Ga0207698_10207660 Ga0207698_102076603 152
1159 3300026142 Ga0207698_10212367 Ga0207698_102123672 152
1160 3300026142 Ga0207698_10804868 Ga0207698_108048682 152
1161 3300026142 Ga0207698_11031882 Ga0207698_110318822 152
1162 3300026142 Ga0207698_11243762 Ga0207698_112437621 152
1163 3300026142 Ga0207698_11269255 Ga0207698_112692552 152
1164 3300026142 Ga0207698_11394471 Ga0207698_113944711 152
1165 3300028379 Ga0268266_10000068 Ga0268266_1000006864 152
1166 3300028379 Ga0268266_11533441 Ga0268266_115334412 152
1167 3300028380 Ga0268265_10034607 Ga0268265_100346072 152
1168 3300028380 Ga0268265_10335057 Ga0268265_103350572 152
1169 3300028380 Ga0268265_10497705 Ga0268265_104977052 152
1170 3300028380 Ga0268265_10833615 Ga0268265_108336151 152
1171 3300028380 Ga0268265_12204435 Ga0268265_122044351 152
1172 3300028381 Ga0268264_10000079 Ga0268264_1000007919 152
1173 3300028381 Ga0268264_10017116 Ga0268264_100171166 152
1174 3300028381 Ga0268264_10023995 Ga0268264_100239953 152
1175 3300028381 Ga0268264_10082379 Ga0268264_100823792 152
1176 3300028381 Ga0268264_10168844 Ga0268264_101688442 152
1177 3300028381 Ga0268264_11047550 Ga0268264_110475502 152
1178 3300028794 Ga0307515_10000001 Ga0307515_100000013319 152
1179 3300031251 Ga0265327_10000207 Ga0265327_1000020720 152
1180 3300031251 Ga0265327_10005701 Ga0265327_100057011 152
1181 3300031456 Ga0307513_10157913 Ga0307513_101579132 152
1182 3300031507 Ga0307509_10187009 Ga0307509_101870091 152
1183 3300031548 Ga0307408_100000226 Ga0307408_1000002269 152
1184 3300031595 Ga0265313_10038820 Ga0265313_100388202 152
1185 3300031616 Ga0307508_10185419 Ga0307508_101854191 152
1186 3300031730 Ga0307516_10003590 Ga0307516_100035908 152
1187 3300031903 Ga0307407_10276756 Ga0307407_102767561 152
1188 3300031911 Ga0307412_10216516 Ga0307412_102165162 152
1189 3300032004 Ga0307414_10179819 Ga0307414_101798192 152
1190 3300033180 Ga0307510_10009449 Ga0307510_100094499 152
1191 3300035089 Ga0373944_0125843 Ga0373944_0125843_226_690 152
1192 3300035111 Ga0373923_0219856 Ga0373923_0219856_55_519 152
1193 3300035113 Ga0373936_0101529 Ga0373936_0101529_626_1093 152
1194 3300035117 Ga0373953_0200254 Ga0373953_0200254_22_486 152
1195 3300035410 Ga0373924_0016301 Ga0373924_0016301_2284_2748 152
1196 3300035692 Ga0373935_0512971 Ga0373935_0512971_288_758 152
1197 3300035725 Ga0373947_0432023 Ga0373947_0432023_134_598 152
1198 3300036401 Ga0373937_0286019 Ga0373937_0286019_428_892 152
1199 3300037312 Ga0395899_0133684 Ga0395899_0133684_292_765 152
1200 3300037312 Ga0395899_0188206 Ga0395899_0188206_157_630 152
1201 3300037312 Ga0395899_0189946 Ga0395899_0189946_637_1110 152
1202 3300037312 Ga0395899_0376373 Ga0395899_0376373_293_766 152
1203 3300037418 Ga0395900_0024582 Ga0395900_0024582_4217_4690 152
1204 3300037418 Ga0395900_0125925 Ga0395900_0125925_1863_2336 152
1205 3300037418 Ga0395900_0951123 Ga0395900_0951123_212_685 152
1206 3300037466 Ga0395898_0009393 Ga0395898_0009393_5877_6350 152
1207 3300037466 Ga0395898_0108657 Ga0395898_0108657_2092_2565 152
1208 3300037466 Ga0395898_0419425 Ga0395898_0419425_95_568 152
1209 3300037471 Ga0395905_0026031 Ga0395905_0026031_3096_3569 152
1210 3300037471 Ga0395905_0625759 Ga0395905_0625759_490_963 152
1211 3300038443 Ga0395901_0012608 Ga0395901_0012608_4050_4523 152
1212 3300038443 Ga0395901_0032794 Ga0395901_0032794_1560_2033 152
1213 3300039437 Ga0436365_1125454 Ga0436365_1125454_197_667 152
1214 3300039437 Ga0436365_1302212 Ga0436365_1302212_543_1025 152
1215 3300039437 Ga0436365_1890468 Ga0436365_1890468_3528_4004 152
1216 3300039450 Ga0436363_0004136 Ga0436363_0004136_70_555 152
1217 3300041406 Ga0439439_0052659 Ga0439439_0052659_119_586 152
1218 3300041413 Ga0439465_0005991 Ga0439465_0005991_3078_3548 152
1219 3300041451 Ga0451791_0515634 Ga0451791_0515634_89_622 152
1220 3300042007 Ga0439449_0031510 Ga0439449_0031510_850_1317 152
1221 3300042014 Ga0439457_005986 Ga0439457_005986_990_1457 152
1222 3300042876 Ga0451577_1072455 Ga0451577_1072455_210_668 152
1223 3300044658 Ga0466972_0000997 Ga0466972_0000997_2371_2844 152
1224 3300044694 Ga0466963_0106044 Ga0466963_0106044_1307_1783 152
1225 3300044706 Ga0466964_0054878 Ga0466964_0054878_398_865 152
1226 3300044712 Ga0453684_0004342 Ga0453684_0004342_9961_10419 152
1227 3300044712 Ga0453684_0120656 Ga0453684_0120656_365_826 152
1228 3300044719 Ga0466971_0028116 Ga0466971_0028116_236_733 152
1229 3300044735 Ga0466968_0511478 Ga0466968_0511478_11_481 152
1230 3300044765 Ga0466970_0133763 Ga0466970_0133763_781_1278 152
1231 3300044765 Ga0466970_0213215 Ga0466970_0213215_69_536 152
1232 3300045049 Ga0466959_0028770 Ga0466959_0028770_1033_1530 152
1233 3300046459 Ga0495629_0596565 Ga0495629_0596565_61_525 152
1234 3300046472 Ga0495580_0097568 Ga0495580_0097568_1025_1501 152
1235 3300046507 Ga0495606_0009699 Ga0495606_0009699_181_654 152
1236 3300046511 Ga0495608_0025157 Ga0495608_0025157_3340_3804 152
1237 3300046517 Ga0495630_0160724 Ga0495630_0160724_321_785 152
1238 3300046517 Ga0495630_1155992 Ga0495630_1155992_44_520 152
1239 3300046522 Ga0495643_0012971 Ga0495643_0012971_1253_1723 152
1240 3300046524 Ga0495648_0003925 Ga0495648_0003925_1034_1501 152
1241 3300046533 Ga0495640_0473224 Ga0495640_0473224_262_726 152
1242 3300046536 Ga0495587_0039031 Ga0495587_0039031_349_813 152
1243 3300046616 Ga0495668_0001067 Ga0495668_0001067_23475_23942 152
1244 3300046648 Ga0495611_0000435 Ga0495611_0000435_23944_24411 152
1245 3300046648 Ga0495611_0019835 Ga0495611_0019835_559_1026 152
1246 3300046660 Ga0495625_0324267 Ga0495625_0324267_358_825 152
1247 3300046663 Ga0495635_0058456 Ga0495635_0058456_219_683 152
1248 3300046694 Ga0495649_0082733 Ga0495649_0082733_161_631 152
1249 3300046694 Ga0495649_0446875 Ga0495649_0446875_29_496 152
1250 3300046809 Ga0495600_0398349 Ga0495600_0398349_189_653 152
1251 3300047320 Ga0495672_0018887 Ga0495672_0018887_1441_1914 152
1252 3300047320 Ga0495672_0057410 Ga0495672_0057410_448_921 152
1253 3300047320 Ga0495672_0117072 Ga0495672_0117072_920_1399 152
1254 3300047321 Ga0495676_0491836 Ga0495676_0491836_197_661 152
1255 3300047322 Ga0495680_0762038 Ga0495680_0762038_142_606 152
1256 3300047443 Ga0495687_000058 Ga0495687_000058_9548_10015 152
1257 3300047444 Ga0495675_0112045 Ga0495675_0112045_53_517 152
1258 3300047472 Ga0495686_0000005 Ga0495686_0000005_362210_362683 152
1259 3300048904 Ga0496101_0052642 Ga0496101_0052642_1326_1790 152
1260 3300048907 Ga0496104_1193583 Ga0496104_1193583_101_571 152
1261 3300048911 Ga0496108_0709884 Ga0496108_0709884_347_817 152
1262 3300048913 Ga0496110_1253146 Ga0496110_1253146_59_529 152
1263 3300048917 Ga0496114_0129742 Ga0496114_0129742_1641_2105 152
1264 3300048918 Ga0496115_0530412 Ga0496115_0530412_72_545 152
1265 3300049568 Ga0501031_0036001 Ga0501031_0036001_43_519 152
1266 3300049570 Ga0501033_0442383 Ga0501033_0442383_358_825 152
1267 3300049571 Ga0501034_0000007 Ga0501034_0000007_166719_167189 152
1268 3300049571 Ga0501034_0024166 Ga0501034_0024166_3878_4345 152
1269 3300049571 Ga0501034_0025167 Ga0501034_0025167_3489_3971 152
1270 3300049571 Ga0501034_0089489 Ga0501034_0089489_1830_2297 152
1271 3300049573 Ga0501037_0065379 Ga0501037_0065379_476_958 152
1272 3300049573 Ga0501037_0354932 Ga0501037_0354932_516_983 152
1273 3300049573 Ga0501037_0788292 Ga0501037_0788292_25_492 152
1274 3300049575 Ga0501039_0018150 Ga0501039_0018150_4248_4724 152
1275 3300049579 Ga0501043_0327920 Ga0501043_0327920_10_483 152
1276 3300049580 Ga0501046_0152071 Ga0501046_0152071_729_1196 152
1277 3300049581 Ga0501047_0478113 Ga0501047_0478113_271_744 152
1278 3300049582 Ga0501048_0094005 Ga0501048_0094005_1006_1473 152
1279 3300049583 Ga0501067_0019175 Ga0501067_0019175_290_757 152
1280 3300049585 Ga0501069_0174645 Ga0501069_0174645_124_591 152
1281 3300049586 Ga0501070_0155813 Ga0501070_0155813_1181_1648 152
1282 3300049586 Ga0501070_0166900 Ga0501070_0166900_804_1286 152
1283 3300049586 Ga0501070_0266239 Ga0501070_0266239_377_844 152
1284 3300049586 Ga0501070_0347553 Ga0501070_0347553_515_982 152
1285 3300049589 Ga0501073_0004543 Ga0501073_0004543_8866_9333 152
1286 3300049590 Ga0501074_0046505 Ga0501074_0046505_1342_1809 152
1287 3300049654 Ga0501207_015667 Ga0501207_015667_647_1114 152
1288 3300049672 Ga0501239_003514 Ga0501239_003514_399_866 152
1289 3300049674 Ga0501242_001699 Ga0501242_001699_67_534 152
1290 3300049679 Ga0501249_031659 Ga0501249_031659_675_1142 152
1291 3300049681 Ga0501251_019078 Ga0501251_019078_335_802 152
1292 3300049686 Ga0501257_002258 Ga0501257_002258_1965_2432 152
1293 3300049708 Ga0501245_002542 Ga0501245_002542_1639_2106 152
1294 3300049741 Ga0501079_0042264 Ga0501079_0042264_2078_2545 152
1295 3300049742 Ga0501080_0015789 Ga0501080_0015789_4818_5285 152
1296 3300049742 Ga0501080_0085121 Ga0501080_0085121_632_1096 152
1297 3300049744 Ga0501083_0832508 Ga0501083_0832508_96_563 152
1298 3300049763 Ga0501266_000855 Ga0501266_000855_2754_3221 152
1299 3300049822 Ga0501035_0125078 Ga0501035_0125078_1250_1717 152
1300 3300049822 Ga0501035_0554214 Ga0501035_0554214_46_513 152
1301 3300049823 Ga0501044_0153371 Ga0501044_0153371_1797_2264 152
1302 3300049823 Ga0501044_0465915 Ga0501044_0465915_662_1138 152
1303 3300050493 nmdc:mga0k408_625353_c1 nmdc:mga0k408_625353_c1_77_541 152
1304 3300050511 nmdc:mga08y16_109953_c1 nmdc:mga08y16_109953_c1_336_806 152
1305 3300050515 nmdc:mga0a205_1474798_c1 nmdc:mga0a205_1474798_c1_38_508 152
1306 3300053090 Ga0500646_0089291 Ga0500646_0089291_304_771 152
1307 3300053092 Ga0500583_0001016 Ga0500583_0001016_847_1314 152
1308 3300053092 Ga0500583_0331204 Ga0500583_0331204_46_513 152
1309 3300053096 Ga0500641_0161484 Ga0500641_0161484_230_697 152
1310 3300053101 Ga0500553_184268 Ga0500553_184268_69_539 152
1311 3300053119 Ga0500595_133509 Ga0500595_133509_182_649 152
1312 3300053129 Ga0500628_123697 Ga0500628_123697_10_495 152
1313 3300053133 Ga0500655_040816 Ga0500655_040816_331_801 152
1314 3300053136 Ga0500559_0026090 Ga0500559_0026090_222_698 152
1315 3300053139 Ga0500568_0003967 Ga0500568_0003967_6472_6939 152
1316 3300053139 Ga0500568_0037756 Ga0500568_0037756_1446_1919 152
1317 3300053153 Ga0500616_0009182 Ga0500616_0009182_5080_5544 152
1318 3300053156 Ga0500622_0002303 Ga0500622_0002303_8113_8580 152
1319 3300054114 Ga0501084_0313137 Ga0501084_0313137_560_1027 152
1320 3300060353 Ga0501082_0015936 Ga0501082_0015936_989_1456 152
1321 3300061719 Ga0466962_0004388 Ga0466962_0004388_6217_6714 152
1322 2162886007 SwRhRL2b_contig_1759593 SwRhRL2b_0521.00008580 153
1323 3300005289 Ga0065704_10070133 Ga0065704_1007013373 153
1324 3300005466 Ga0070685_10203752 Ga0070685_102037522 153
1325 3300005563 Ga0068855_100599357 Ga0068855_1005993572 153
1326 3300005834 Ga0068851_10000283 Ga0068851_1000028314 153
1327 3300005834 Ga0068851_10026058 Ga0068851_100260582 153
1328 3300005841 Ga0068863_100086798 Ga0068863_1000867983 153
1329 3300005841 Ga0068863_101929757 Ga0068863_1019297571 153
1330 3300009545 Ga0105237_10054802 Ga0105237_100548023 153
1331 3300013102 Ga0157371_10140954 Ga0157371_101409542 153
1332 3300013306 Ga0163162_10002392 Ga0163162_1000239218 153
1333 3300013307 Ga0157372_10000642 Ga0157372_1000064219 153
1334 3300014325 Ga0163163_10308086 Ga0163163_103080861 153
1335 3300025321 Ga0207656_10000132 Ga0207656_1000013214 153
1336 3300025321 Ga0207656_10074719 Ga0207656_100747192 153
1337 3300025914 Ga0207671_10000248 Ga0207671_1000024849 153
1338 3300025949 Ga0207667_11042637 Ga0207667_110426371 153
1339 3300026088 Ga0207641_10277307 Ga0207641_102773071 153
1340 3300031240 Ga0265320_10111142 Ga0265320_101111422 153
1341 3300031711 Ga0265314_10031558 Ga0265314_100315582 153
1342 3300042876 Ga0451577_0002854 Ga0451577_0002854_13843_14313 153
1343 3300044712 Ga0453684_0955610 Ga0453684_0955610_415_885 153
1344 3300046539 Ga0495621_0053204 Ga0495621_0053204_491_982 153

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

27

156

0.99

PF08534

Redoxin

Redoxin

26

170

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5iph-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - c84s mutant 0.9361 12 152
5io2-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - c48s mutant 0.934 12 152
3gkm-assembly1.cif.gz_A insights into the alkyl peroxide reduction activity of xanthomonas campestris bacterioferritin comigratory protein from the trapped intermediate/ligand complex structures 0.9326 12 152
3drn-assembly2.cif.gz_B the crystal structure of bcp1 from sulfolobus sulfataricus 0.9301 3 152
3ixr-assembly1.cif.gz_A crystal structure of xylella fastidiosa prxq c47s mutant 0.9299 1 152
ID Description Score Start End Superfamily
af_P0AE52_4_156_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9744 3 152 3.40.30.10
af_Q2G280_3_151_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9699 4 150 3.40.30.10
af_P9WIE1_7_157_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9558 3 153 3.40.30.10
af_Q2G280_3_151_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.951 4 150 3.40.30.10
af_P9WIE1_7_157_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9497 3 153 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A6G3HNR1-F1-model_v4 deleted 0.993 1 97
AF-A0A3D6CG26-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9869 1 152 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A3N5YXX7-F1-model_v4 deleted 0.9867 1 103
AF-A0A838F4Z2-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9862 1 152 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A2V2DAP0-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9853 3 149 GO:0005737
GO:0008379
GO:0034599
GO:0045454

Feature Viewer

pLDDT pTM Quality
94.52 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map