F493151

General Info

Members Datasets Scaffolds Average Seq Length
1340 372 2680 196

Family's Representative Sequence

Representative Sequence 3300003203|JGI25406J46586_10000210|JGI25406J46586_1000021017
Length 219
Sequence MTRTRSGRPPAPRRGRTSAASNAPARGAEFDRRTTETQISGRLVVDGHGRYDVRTGIRFFDHMLELFTRHGGFDLTLHAAGDLDVDQHHTVEDVGIVLGESLLEALGDRRGINRAGYFVMPMDETLAVVAIDLSGRPHAVVDLKVRVRMVGDLQSELVHDFFDGFAMGARANVHAKVLYGRSNHHHIEAVFKAFARALRVACARDPRLAAMLPSTKGLL

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
125 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
126 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
127 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
128 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
129 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
192 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
196 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
197 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
199 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
200 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
201 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
202 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
203 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
204 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
205 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
206 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
207 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
208 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
209 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
210 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
211 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
212 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
213 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
214 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
215 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
216 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
217 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
218 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
219 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
220 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
221 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
222 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
223 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
224 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
225 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
226 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
227 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
228 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
229 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
230 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
231 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
232 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
233 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
234 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
235 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
236 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
237 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
238 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
239 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
240 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
241 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
242 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
243 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
244 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
245 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
246 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
247 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
248 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
249 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
250 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
251 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
252 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
253 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
254 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
255 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
256 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
257 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
258 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
259 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
260 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
261 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
262 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
263 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
264 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
265 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
266 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
267 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
268 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
269 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
270 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
271 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
272 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
273 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
274 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
275 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
276 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
277 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
278 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
279 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
280 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
281 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
282 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
283 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
284 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
285 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
286 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
287 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
288 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
289 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
290 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
291 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
292 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
293 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
294 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
295 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
296 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
297 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
298 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
299 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
300 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
301 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
302 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
303 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
304 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
305 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
306 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
307 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
308 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
309 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
310 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
311 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
312 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
313 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
314 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
330 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
331 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
332 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
333 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
334 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
335 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
336 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
337 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
338 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
339 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
340 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
341 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
342 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
343 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
344 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
345 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
346 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
347 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
348 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
349 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
350 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
353 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
354 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
355 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
356 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
357 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
358 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
359 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
360 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
361 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
362 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
363 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
364 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
365 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
366 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
367 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
368 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
369 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
370 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
371 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
372 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.85
Metatranscriptomes 0.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 0.9
Rhizosphere 95.9
Stem 0
Stem Tuber 0
Unclassified 5.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000210 3300003203 Bacteria 25956
2 SwRhRL2b_contig_3236978 2162886007 Bacteria 1527
3 SwRhRL2b_contig_3825395 2162886007 Bacteria 1468
4 JGI25406J46586_10001441 3300003203 Bacteria 11218
5 Ga0065714_10125624 3300005288 Bacteria 1299
6 Ga0065704_10075134 3300005289 Bacteria 5772
7 Ga0065712_10018271 3300005290 Bacteria 5026
8 Ga0065712_10321009 3300005290 Bacteria 828
9 Ga0065715_10172499 3300005293 Bacteria 1536
10 Ga0065715_10262856 3300005293 Bacteria 1133
11 Ga0065715_10443124 3300005293 Bacteria 834
12 Ga0065715_10505586 3300005293 Bacteria 768
13 Ga0065707_10001927 3300005295 Bacteria 6902
14 Ga0065707_10084472 3300005295 Bacteria 7165
15 Ga0065707_10157109 3300005295 Bacteria 1598
16 Ga0065707_10381309 3300005295 Bacteria 877
17 Ga0070658_10009861 3300005327 Bacteria 7674
18 Ga0070658_10522636 3300005327 Bacteria 1026
19 Ga0070676_10006282 3300005328 Bacteria 6346
20 Ga0070683_100005237 3300005329 Bacteria 10794
21 Ga0070683_100020370 3300005329 Bacteria 5903
22 Ga0070683_100084842 3300005329 Bacteria 2968
23 Ga0070683_100143466 3300005329 Bacteria 2262
24 Ga0070683_100221656 3300005329 Bacteria 1798
25 Ga0070683_100660156 3300005329 Bacteria 1001
26 Ga0070683_100904347 3300005329 Bacteria 847
27 Ga0070690_100249108 3300005330 Bacteria 1256
28 Ga0070670_100004900 3300005331 Bacteria 11261
29 Ga0070670_100030192 3300005331 Bacteria 4668
30 Ga0070670_100030977 3300005331 Bacteria 4607
31 Ga0070670_100087327 3300005331 Bacteria 2680
32 Ga0070670_100157927 3300005331 Bacteria 1965
33 Ga0070670_100418815 3300005331 Bacteria 1184
34 Ga0070670_100593520 3300005331 Bacteria 991
35 Ga0070670_100924952 3300005331 Bacteria 791
36 Ga0070677_10001462 3300005333 Bacteria 7469
37 Ga0070677_10039601 3300005333 Bacteria 1850
38 Ga0070677_10076161 3300005333 Bacteria 1424
39 Ga0070677_10078642 3300005333 Bacteria 1405
40 Ga0070677_10164098 3300005333 Bacteria 1045
41 Ga0068869_100042368 3300005334 Bacteria 3263
42 Ga0068869_100066274 3300005334 Bacteria 2660
43 Ga0068869_100082871 3300005334 Bacteria 2398
44 Ga0068869_100153391 3300005334 Bacteria 1788
45 Ga0070666_10016581 3300005335 Bacteria 4714
46 Ga0070666_10024914 3300005335 Bacteria 3899
47 Ga0070666_10055207 3300005335 Bacteria 2681
48 Ga0070680_100058199 3300005336 Bacteria 3161
49 Ga0070680_100376931 3300005336 Bacteria 1208
50 Ga0070680_100433345 3300005336 Bacteria 1122
51 Ga0070680_101083871 3300005336 Bacteria 692
52 Ga0068868_100011009 3300005338 Bacteria 6572
53 Ga0068868_100062155 3300005338 Bacteria 2959
54 Ga0068868_100169117 3300005338 Bacteria 1809
55 Ga0068868_100488350 3300005338 Archaea 1077
56 Ga0070660_100007244 3300005339 Bacteria 7720
57 Ga0070660_100203357 3300005339 Unclassified 1607
58 Ga0070660_100363369 3300005339 Unclassified 1193
59 Ga0070689_100005732 3300005340 Bacteria 8517
60 Ga0070689_100065829 3300005340 Bacteria 2823
61 Ga0070689_100103680 3300005340 Bacteria 2254
62 Ga0070689_100373115 3300005340 Bacteria 1201
63 Ga0070689_100683925 3300005340 Bacteria 895
64 Ga0070691_10022558 3300005341 Bacteria 2921
65 Ga0070687_100236648 3300005343 Bacteria 1127
66 Ga0070668_100026632 3300005347 Bacteria 4388
67 Ga0070669_100008311 3300005353 Bacteria 7412
68 Ga0070669_100116793 3300005353 Bacteria 2031
69 Ga0070669_100118006 3300005353 Bacteria 2020
70 Ga0070669_100156307 3300005353 Bacteria 1769
71 Ga0070669_100175803 3300005353 Bacteria 1672
72 Ga0070669_100209938 3300005353 Bacteria 1535
73 Ga0070669_100842915 3300005353 Bacteria 781
74 Ga0070675_100000116 3300005354 Bacteria 46828
75 Ga0070675_100001421 3300005354 Bacteria 17587
76 Ga0070675_100004051 3300005354 Bacteria 11124
77 Ga0070675_100010384 3300005354 Bacteria 7273
78 Ga0070675_100030804 3300005354 Bacteria 4332
79 Ga0070675_100031527 3300005354 Bacteria 4285
80 Ga0070675_100610400 3300005354 Archaea 990
81 Ga0070671_100036440 3300005355 Bacteria 4080
82 Ga0070671_100081927 3300005355 Bacteria 2698
83 Ga0070671_100117122 3300005355 Bacteria 2240
84 Ga0070674_100000382 3300005356 Bacteria 22209
85 Ga0070674_100008990 3300005356 Bacteria 5970
86 Ga0070674_100013039 3300005356 Bacteria 5125
87 Ga0070674_100461468 3300005356 Bacteria 1050
88 Ga0070674_100639929 3300005356 Bacteria 903
89 Ga0070674_100651728 3300005356 Bacteria 895
90 Ga0070673_100008003 3300005364 Bacteria 7002
91 Ga0070673_100046554 3300005364 Bacteria 3370
92 Ga0070673_100060396 3300005364 Bacteria 3004
93 Ga0070673_100097279 3300005364 Bacteria 2417
94 Ga0070673_100118062 3300005364 Bacteria 2208
95 Ga0070673_100128742 3300005364 Bacteria 2121
96 Ga0070673_100273180 3300005364 Bacteria 1480
97 Ga0070673_100782076 3300005364 Bacteria 880
98 Ga0070688_100006025 3300005365 Bacteria 6433
99 Ga0070688_100161187 3300005365 Bacteria 1541
100 Ga0070688_100187499 3300005365 Bacteria 1439
101 Ga0070659_100126655 3300005366 Bacteria 2072
102 Ga0070659_100723373 3300005366 Bacteria 862
103 Ga0070659_101276334 3300005366 Bacteria 651
104 Ga0070667_100013784 3300005367 Bacteria 6683
105 Ga0070667_100150934 3300005367 Bacteria 2041
106 Ga0070703_10041178 3300005406 Bacteria 1439
107 Ga0070709_10013766 3300005434 Bacteria 4557
108 Ga0070709_10801774 3300005434 Bacteria 739
109 Ga0070714_100035658 3300005435 Bacteria 4169
110 Ga0070714_100154566 3300005435 Bacteria 2070
111 Ga0070714_100342232 3300005435 Bacteria 1403
112 Ga0070713_100002523 3300005436 Bacteria 11963
113 Ga0070713_100011179 3300005436 Bacteria 6527
114 Ga0070713_100015164 3300005436 Bacteria 5747
115 Ga0070713_100294210 3300005436 Bacteria 1493
116 Ga0070701_10070914 3300005438 Bacteria 1863
117 Ga0070711_100343129 3300005439 Bacteria 1199
118 Ga0070705_100000746 3300005440 Bacteria 18450
119 Ga0070705_100281217 3300005440 Bacteria 1183
120 Ga0070700_100016825 3300005441 Bacteria 4170
121 Ga0070700_100016870 3300005441 Bacteria 4165
122 Ga0070694_100000370 3300005444 Bacteria 24146
123 Ga0070694_100071340 3300005444 Bacteria 2394
124 Ga0070694_100138356 3300005444 Bacteria 1766
125 Ga0070694_100427146 3300005444 Bacteria 1042
126 Ga0070708_100702172 3300005445 Bacteria 952
127 Ga0070663_100028751 3300005455 Bacteria 3789
128 Ga0070663_100312321 3300005455 Bacteria 1262
129 Ga0070678_100007020 3300005456 Bacteria 6656
130 Ga0070678_100048413 3300005456 Bacteria 3061
131 Ga0070678_100064945 3300005456 Bacteria 2707
132 Ga0070678_100102194 3300005456 Bacteria 2224
133 Ga0070678_100139745 3300005456 Bacteria 1936
134 Ga0070678_100717131 3300005456 Unclassified 902
135 Ga0070678_101243119 3300005456 Bacteria 692
136 Ga0070662_100012691 3300005457 Bacteria 5592
137 Ga0070662_100055147 3300005457 Bacteria 2883
138 Ga0070662_100252293 3300005457 Bacteria 1419
139 Ga0070681_10022213 3300005458 Bacteria 6368
140 Ga0070681_10109201 3300005458 Bacteria 2706
141 Ga0070681_10134031 3300005458 Bacteria 2408
142 Ga0070681_10166064 3300005458 Bacteria 2130
143 Ga0070681_10262776 3300005458 Bacteria 1638
144 Ga0070681_10304575 3300005458 Bacteria 1503
145 Ga0068867_100008687 3300005459 Bacteria 7170
146 Ga0068867_100009631 3300005459 Bacteria 6813
147 Ga0068867_100026117 3300005459 Bacteria 4192
148 Ga0068867_100132380 3300005459 Bacteria 1940
149 Ga0068867_100450981 3300005459 Bacteria 1096
150 Ga0068867_100565344 3300005459 Bacteria 987
151 Ga0070685_10014872 3300005466 Bacteria 4128
152 Ga0070685_10112749 3300005466 Bacteria 1678
153 Ga0070685_10543851 3300005466 Bacteria 828
154 Ga0070707_100149785 3300005468 Bacteria 2272
155 Ga0070707_101010398 3300005468 Unclassified 797
156 Ga0070698_100170431 3300005471 Bacteria 2118
157 Ga0070698_100804955 3300005471 Bacteria 884
158 Ga0070699_100006431 3300005518 Bacteria 10232
159 Ga0070699_100012616 3300005518 Bacteria 7288
160 Ga0070699_100018067 3300005518 Bacteria 6058
161 Ga0070699_100018848 3300005518 Bacteria 5930
162 Ga0070699_100069549 3300005518 Bacteria 3059
163 Ga0070679_100000635 3300005530 Bacteria 29869
164 Ga0070679_100029497 3300005530 Bacteria 5413
165 Ga0070679_100109888 3300005530 Bacteria 2743
166 Ga0070679_100129230 3300005530 Bacteria 2508
167 Ga0070684_100000654 3300005535 Bacteria 23885
168 Ga0070684_100072416 3300005535 Bacteria 3034
169 Ga0070684_100150442 3300005535 Bacteria 2108
170 Ga0070684_100152941 3300005535 Unclassified 2091
171 Ga0070684_100250259 3300005535 Unclassified 1620
172 Ga0070684_100279931 3300005535 Bacteria 1528
173 Ga0070684_100313461 3300005535 Bacteria 1441
174 Ga0070697_100014204 3300005536 Bacteria 6256
175 Ga0070697_100156129 3300005536 Bacteria 1926
176 Ga0068853_100018364 3300005539 Bacteria 5788
177 Ga0068853_100088667 3300005539 Bacteria 2716
178 Ga0068853_100180149 3300005539 Bacteria 1916
179 Ga0068853_100295941 3300005539 Bacteria 1495
180 Ga0068853_100460320 3300005539 Bacteria 1197
181 Ga0068853_100623125 3300005539 Bacteria 1025
182 Ga0070672_100008378 3300005543 Bacteria 7067
183 Ga0070672_100134809 3300005543 Bacteria 2033
184 Ga0070672_100145010 3300005543 Bacteria 1961
185 Ga0070672_100154689 3300005543 Bacteria 1899
186 Ga0070672_100279497 3300005543 Bacteria 1411
187 Ga0070672_100371158 3300005543 Bacteria 1222
188 Ga0070672_101107578 3300005543 Bacteria 704
189 Ga0070686_100204013 3300005544 Bacteria 1419
190 Ga0070686_100209399 3300005544 Bacteria 1402
191 Ga0070686_100238683 3300005544 Bacteria 1322
192 Ga0070695_100000707 3300005545 Bacteria 17815
193 Ga0070696_100000965 3300005546 Bacteria 18625
194 Ga0070696_100001772 3300005546 Bacteria 14152
195 Ga0070693_100052188 3300005547 Bacteria 2344
196 Ga0070693_100225284 3300005547 Unclassified 1231
197 Ga0070665_100024814 3300005548 Bacteria 6040
198 Ga0070665_100078224 3300005548 Bacteria 3314
199 Ga0070665_100084437 3300005548 Bacteria 3181
200 Ga0070665_100098208 3300005548 Bacteria 2933
201 Ga0070665_100102784 3300005548 Bacteria 2861
202 Ga0070665_100170827 3300005548 Bacteria 2175
203 Ga0070665_101061086 3300005548 Bacteria 822
204 Ga0070704_100041318 3300005549 Bacteria 3182
205 Ga0070704_100085381 3300005549 Bacteria 2336
206 Ga0070704_100171290 3300005549 Bacteria 1727
207 Ga0068855_100003676 3300005563 Bacteria 18764
208 Ga0068855_100005921 3300005563 Bacteria 14906
209 Ga0068855_100017587 3300005563 Bacteria 8598
210 Ga0068855_100039960 3300005563 Bacteria 5568
211 Ga0068855_100041567 3300005563 Bacteria 5448
212 Ga0068855_100042276 3300005563 Bacteria 5399
213 Ga0068855_100080897 3300005563 Bacteria 3767
214 Ga0068855_100159886 3300005563 Bacteria 2557
215 Ga0068855_100234432 3300005563 Bacteria 2053
216 Ga0068855_100237672 3300005563 Bacteria 2037
217 Ga0070664_100007187 3300005564 Bacteria 8978
218 Ga0070664_100017828 3300005564 Bacteria 5830
219 Ga0070664_100117700 3300005564 Bacteria 2324
220 Ga0070664_100119171 3300005564 Bacteria 2309
221 Ga0070664_100707240 3300005564 Bacteria 939
222 Ga0070664_101048227 3300005564 Bacteria 767
223 Ga0068857_100000367 3300005577 Bacteria 31519
224 Ga0068857_100009431 3300005577 Bacteria 8471
225 Ga0068857_100027469 3300005577 Bacteria 5021
226 Ga0068857_100033257 3300005577 Bacteria 4561
227 Ga0068857_100120196 3300005577 Bacteria 2365
228 Ga0068857_100175980 3300005577 Bacteria 1946
229 Ga0068857_100314205 3300005577 Bacteria 1446
230 Ga0068857_100388523 3300005577 Unclassified 1297
231 Ga0068857_100486453 3300005577 Bacteria 1157
232 Ga0068854_100135573 3300005578 Bacteria 1884
233 Ga0068854_100168051 3300005578 Bacteria 1704
234 Ga0068854_100863546 3300005578 Bacteria 793
235 Ga0068856_100011813 3300005614 Bacteria 8464
236 Ga0068856_100044788 3300005614 Bacteria 4355
237 Ga0068856_100097316 3300005614 Bacteria 2932
238 Ga0068856_100146605 3300005614 Bacteria 2368
239 Ga0068856_100969365 3300005614 Bacteria 869
240 Ga0068856_100988726 3300005614 Bacteria 860
241 Ga0070702_100010489 3300005615 Bacteria 4564
242 Ga0070702_100461343 3300005615 Bacteria 924
243 Ga0068852_100044205 3300005616 Bacteria 3781
244 Ga0068852_100097280 3300005616 Bacteria 2648
245 Ga0068852_100145279 3300005616 Bacteria 2199
246 Ga0068852_101022385 3300005616 Unclassified 845
247 Ga0068859_100017287 3300005617 Bacteria 7243
248 Ga0068859_100038291 3300005617 Bacteria 4811
249 Ga0068859_100057516 3300005617 Bacteria 3917
250 Ga0068859_100419971 3300005617 Bacteria 1434
251 Ga0068859_100476169 3300005617 Bacteria 1344
252 Ga0068859_100863079 3300005617 Bacteria 991
253 Ga0068864_100045866 3300005618 Bacteria 3750
254 Ga0068864_100054532 3300005618 Bacteria 3450
255 Ga0068864_100172999 3300005618 Bacteria 1970
256 Ga0068864_100197203 3300005618 Bacteria 1848
257 Ga0068864_100216991 3300005618 Bacteria 1763
258 Ga0068864_100232359 3300005618 Bacteria 1706
259 Ga0068864_100299541 3300005618 Bacteria 1505
260 Ga0068864_100517583 3300005618 Bacteria 1150
261 Ga0068866_10418329 3300005718 Bacteria 869
262 Ga0068861_100024564 3300005719 Bacteria 4359
263 Ga0068861_100116117 3300005719 Bacteria 2151
264 Ga0068861_100168397 3300005719 Bacteria 1814
265 Ga0068861_100319788 3300005719 Bacteria 1351
266 Ga0068861_100446064 3300005719 Bacteria 1158
267 Ga0068851_10020670 3300005834 Bacteria 3190
268 Ga0068851_10142813 3300005834 Bacteria 1303
269 Ga0068851_10151590 3300005834 Bacteria 1268
270 Ga0068851_10189334 3300005834 Bacteria 1143
271 Ga0068870_10001437 3300005840 Bacteria 9631
272 Ga0068870_10007144 3300005840 Bacteria 4968
273 Ga0068863_100309952 3300005841 Bacteria 1532
274 Ga0068863_100643844 3300005841 Bacteria 1051
275 Ga0068863_101512294 3300005841 Bacteria 680
276 Ga0068858_100054923 3300005842 Bacteria 3683
277 Ga0068858_100057133 3300005842 Bacteria 3606
278 Ga0068858_100060055 3300005842 Bacteria 3514
279 Ga0068858_100073787 3300005842 Bacteria 3167
280 Ga0068858_100130329 3300005842 Bacteria 2358
281 Ga0068858_100194195 3300005842 Bacteria 1918
282 Ga0068858_100220378 3300005842 Bacteria 1796
283 Ga0068858_101369465 3300005842 Bacteria 697
284 Ga0068860_100008416 3300005843 Bacteria 10275
285 Ga0068860_100030930 3300005843 Bacteria 5147
286 Ga0068860_100064152 3300005843 Bacteria 3490
287 Ga0068862_100001194 3300005844 Bacteria 24496
288 Ga0068862_100092822 3300005844 Bacteria 2631
289 Ga0068862_100195317 3300005844 Bacteria 1823
290 Ga0068862_100301161 3300005844 Bacteria 1475
291 Ga0068862_101082649 3300005844 Bacteria 796
292 Ga0081455_10025992 3300005937 Bacteria 5394
293 Ga0081538_10112503 3300005981 Bacteria 1332
294 Ga0081539_10000093 3300005985 Bacteria 207314
295 Ga0081539_10000535 3300005985 Bacteria 78890
296 Ga0081539_10004525 3300005985 Bacteria 15269
297 Ga0081539_10032394 3300005985 Bacteria 3201
298 Ga0070717_10002297 3300006028 Bacteria 13414
299 Ga0070717_10059120 3300006028 Bacteria 3171
300 Ga0070717_10379742 3300006028 Unclassified 1267
301 Ga0070717_10652868 3300006028 Bacteria 955
302 Ga0075364_10396187 3300006051 Bacteria 942
303 Ga0097621_100008977 3300006237 Bacteria 7231
304 Ga0097621_100057379 3300006237 Bacteria 3184
305 Ga0097621_100087349 3300006237 Bacteria 2603
306 Ga0097621_100090626 3300006237 Bacteria 2559
307 Ga0097621_100198007 3300006237 Bacteria 1743
308 Ga0097621_100222910 3300006237 Bacteria 1644
309 Ga0097621_100587832 3300006237 Unclassified 1016
310 Ga0097621_100714379 3300006237 Bacteria 923
311 Ga0068871_100013047 3300006358 Bacteria 6159
312 Ga0068871_100032955 3300006358 Bacteria 4097
313 Ga0068871_100086558 3300006358 Bacteria 2604
314 Ga0068871_100096532 3300006358 Bacteria 2470
315 Ga0068871_100096698 3300006358 Bacteria 2468
316 Ga0068871_100099782 3300006358 Bacteria 2431
317 Ga0068871_100252561 3300006358 Bacteria 1536
318 Ga0068871_100318934 3300006358 Unclassified 1368
319 Ga0068871_100518294 3300006358 Bacteria 1076
320 Ga0075428_100001298 3300006844 Bacteria 26510
321 Ga0075428_100018128 3300006844 Bacteria 7778
322 Ga0075428_100039791 3300006844 Bacteria 5175
323 Ga0075428_100066193 3300006844 Bacteria 3956
324 Ga0075428_101038833 3300006844 Bacteria 867
325 Ga0075430_100079986 3300006846 Bacteria 2738
326 Ga0075430_100099521 3300006846 Bacteria 2428
327 Ga0075430_100131196 3300006846 Unclassified 2088
328 Ga0075430_100245136 3300006846 Bacteria 1485
329 Ga0075430_100268739 3300006846 Bacteria 1412
330 Ga0075431_100016348 3300006847 Bacteria 7528
331 Ga0075431_100017673 3300006847 Bacteria 7250
332 Ga0075431_100026579 3300006847 Bacteria 5938
333 Ga0075431_100077735 3300006847 Bacteria 3425
334 Ga0075431_100081081 3300006847 Bacteria 3350
335 Ga0075431_100152881 3300006847 Bacteria 2376
336 Ga0075433_10001626 3300006852 Bacteria 16666
337 Ga0075433_10003294 3300006852 Bacteria 12470
338 Ga0075433_10004362 3300006852 Bacteria 10995
339 Ga0075433_10062970 3300006852 Bacteria 3249
340 Ga0075433_10195765 3300006852 Bacteria 1798
341 Ga0075433_10613162 3300006852 Bacteria 955
342 Ga0075433_10686973 3300006852 Bacteria 897
343 Ga0075434_100007857 3300006871 Bacteria 9880
344 Ga0075434_100009480 3300006871 Bacteria 9079
345 Ga0075434_100037878 3300006871 Bacteria 4775
346 Ga0075434_100074269 3300006871 Bacteria 3394
347 Ga0075434_100335194 3300006871 Bacteria 1533
348 Ga0075429_100058130 3300006880 Bacteria 3368
349 Ga0075429_100077576 3300006880 Bacteria 2895
350 Ga0075429_100140751 3300006880 Bacteria 2112
351 Ga0075429_100195061 3300006880 Bacteria 1774
352 Ga0075429_100313515 3300006880 Bacteria 1373
353 Ga0075429_100361761 3300006880 Unclassified 1270
354 Ga0068865_100036885 3300006881 Bacteria 3298
355 Ga0068865_100044873 3300006881 Bacteria 3028
356 Ga0075436_100004678 3300006914 Bacteria 9385
357 Ga0097620_100017287 3300006931 Bacteria 7243
358 Ga0097620_100038292 3300006931 Bacteria 4811
359 Ga0097620_100057515 3300006931 Bacteria 3917
360 Ga0097620_100419969 3300006931 Bacteria 1434
361 Ga0097620_100476190 3300006931 Bacteria 1344
362 Ga0097620_100863073 3300006931 Bacteria 991
363 Ga0075435_100005103 3300007076 Bacteria 9123
364 Ga0075435_100033031 3300007076 Bacteria 4089
365 Ga0075435_100057482 3300007076 Bacteria 3147
366 Ga0075435_100396863 3300007076 Bacteria 1186
367 Ga0075435_100421943 3300007076 Bacteria 1149
368 Ga0105240_10000137 3300009093 Bacteria 149925
369 Ga0105240_10000725 3300009093 Bacteria 60249
370 Ga0105240_10006267 3300009093 Bacteria 17501
371 Ga0105240_10008603 3300009093 Bacteria 14585
372 Ga0105240_10014192 3300009093 Bacteria 10881
373 Ga0105240_10049742 3300009093 Bacteria 5288
374 Ga0105240_10561268 3300009093 Unclassified 1262
375 Ga0105240_10575124 3300009093 Unclassified 1243
376 Ga0105240_10821146 3300009093 Bacteria 1006
377 Ga0105240_10973917 3300009093 Bacteria 909
378 Ga0105240_11515547 3300009093 Unclassified 703
379 Ga0105240_11596924 3300009093 Bacteria 682
380 Ga0105240_11686691 3300009093 Bacteria 662
381 Ga0111539_10000937 3300009094 Bacteria 38215
382 Ga0111539_10012890 3300009094 Bacteria 10461
383 Ga0111539_10018172 3300009094 Bacteria 8709
384 Ga0111539_10025633 3300009094 Bacteria 7226
385 Ga0111539_10057520 3300009094 Bacteria 4618
386 Ga0111539_10165833 3300009094 Bacteria 2583
387 Ga0111539_10184728 3300009094 Bacteria 2435
388 Ga0111539_11505010 3300009094 Bacteria 780
389 Ga0105245_10002584 3300009098 Bacteria 16303
390 Ga0105245_10031219 3300009098 Bacteria 4713
391 Ga0105245_10092800 3300009098 Bacteria 2781
392 Ga0105245_10122005 3300009098 Bacteria 2436
393 Ga0105245_10143630 3300009098 Bacteria 2250
394 Ga0105245_10192564 3300009098 Bacteria 1954
395 Ga0105245_10441173 3300009098 Bacteria 1308
396 Ga0105245_10481719 3300009098 Bacteria 1254
397 Ga0105245_10723661 3300009098 Bacteria 1030
398 Ga0105247_10036932 3300009101 Bacteria 2979
399 Ga0105247_10081730 3300009101 Bacteria 2038
400 Ga0105247_10381386 3300009101 Bacteria 1000
401 Ga0114129_10000428 3300009147 Bacteria 49983
402 Ga0114129_10012760 3300009147 Bacteria 11960
403 Ga0114129_10013768 3300009147 Bacteria 11526
404 Ga0114129_10016831 3300009147 Bacteria 10409
405 Ga0114129_10017625 3300009147 Bacteria 10167
406 Ga0114129_10060488 3300009147 Bacteria 5296
407 Ga0114129_10082295 3300009147 Bacteria 4473
408 Ga0114129_10178069 3300009147 Bacteria 2895
409 Ga0114129_10207936 3300009147 Bacteria 2647
410 Ga0114129_10426391 3300009147 Bacteria 1744
411 Ga0114129_10483657 3300009147 Unclassified 1619
412 Ga0114129_10489668 3300009147 Bacteria 1608
413 Ga0114129_10625396 3300009147 Bacteria 1392
414 Ga0114129_11680760 3300009147 Bacteria 775
415 Ga0105243_10094326 3300009148 Bacteria 2471
416 Ga0105243_10094586 3300009148 Bacteria 2468
417 Ga0105241_10011127 3300009174 Bacteria 6598
418 Ga0105241_10052017 3300009174 Unclassified 3126
419 Ga0105241_10081489 3300009174 Bacteria 2535
420 Ga0105241_10098267 3300009174 Bacteria 2322
421 Ga0105241_10142579 3300009174 Bacteria 1952
422 Ga0105241_10326669 3300009174 Bacteria 1324
423 Ga0105241_10347029 3300009174 Unclassified 1288
424 Ga0105241_10398817 3300009174 Bacteria 1206
425 Ga0105242_10008301 3300009176 Bacteria 7977
426 Ga0105242_10037404 3300009176 Bacteria 3898
427 Ga0105242_10055620 3300009176 Bacteria 3237
428 Ga0105242_10057510 3300009176 Bacteria 3185
429 Ga0105242_10074164 3300009176 Bacteria 2831
430 Ga0105242_10351275 3300009176 Bacteria 1362
431 Ga0105242_10388503 3300009176 Unclassified 1299
432 Ga0105242_10669786 3300009176 Bacteria 1011
433 Ga0105242_10709865 3300009176 Bacteria 985
434 Ga0105242_11368909 3300009176 Bacteria 734
435 Ga0105242_11515327 3300009176 Bacteria 702
436 Ga0105248_10015334 3300009177 Bacteria 8451
437 Ga0105248_10021914 3300009177 Bacteria 7080
438 Ga0105248_10038535 3300009177 Bacteria 5349
439 Ga0105248_10051528 3300009177 Bacteria 4619
440 Ga0105248_10058795 3300009177 Bacteria 4317
441 Ga0105248_10135318 3300009177 Bacteria 2780
442 Ga0105248_10169783 3300009177 Bacteria 2458
443 Ga0105248_10247604 3300009177 Bacteria 2006
444 Ga0105248_11615924 3300009177 Bacteria 734
445 Ga0105248_12121924 3300009177 Bacteria 639
446 Ga0105237_10011284 3300009545 Bacteria 9454
447 Ga0105237_10015643 3300009545 Bacteria 7886
448 Ga0105237_10022807 3300009545 Bacteria 6423
449 Ga0105237_10047639 3300009545 Bacteria 4308
450 Ga0105237_10076113 3300009545 Bacteria 3347
451 Ga0105237_10135652 3300009545 Bacteria 2455
452 Ga0105237_10163191 3300009545 Bacteria 2227
453 Ga0105237_10296008 3300009545 Bacteria 1621
454 Ga0105237_10485865 3300009545 Bacteria 1241
455 Ga0105237_10895175 3300009545 Bacteria 894
456 Ga0105237_11266348 3300009545 Bacteria 744
457 Ga0105238_10003531 3300009551 Bacteria 15586
458 Ga0105238_10027090 3300009551 Bacteria 5842
459 Ga0105238_10038115 3300009551 Bacteria 4883
460 Ga0105238_10039789 3300009551 Bacteria 4767
461 Ga0105238_10047108 3300009551 Bacteria 4348
462 Ga0105238_10087883 3300009551 Bacteria 3095
463 Ga0105238_10091744 3300009551 Bacteria 3025
464 Ga0105238_10094723 3300009551 Bacteria 2974
465 Ga0105238_10115494 3300009551 Bacteria 2664
466 Ga0105238_10194410 3300009551 Bacteria 2004
467 Ga0105238_10243629 3300009551 Bacteria 1775
468 Ga0105238_10348781 3300009551 Bacteria 1469
469 Ga0105238_10364361 3300009551 Bacteria 1435
470 Ga0105238_10475469 3300009551 Bacteria 1248
471 Ga0105238_10501488 3300009551 Bacteria 1215
472 Ga0105238_11070304 3300009551 Bacteria 828
473 Ga0105249_10001435 3300009553 Bacteria 20875
474 Ga0105249_10025302 3300009553 Bacteria 5342
475 Ga0105249_10166133 3300009553 Bacteria 2136
476 Ga0105249_10264232 3300009553 Bacteria 1711
477 Ga0105239_10005509 3300010375 Bacteria 14830
478 Ga0105239_10009505 3300010375 Bacteria 10949
479 Ga0105239_10019116 3300010375 Bacteria 7571
480 Ga0105239_10020840 3300010375 Bacteria 7232
481 Ga0105239_10061846 3300010375 Bacteria 4110
482 Ga0105239_10101145 3300010375 Bacteria 3188
483 Ga0105239_12377717 3300010375 Bacteria 617
484 Ga0105246_10053857 3300011119 Bacteria 2770
485 Ga0105246_10148180 3300011119 Bacteria 1773
486 Ga0105246_10942538 3300011119 Bacteria 777
487 Ga0105246_10956565 3300011119 Unclassified 772
488 Ga0157373_10091811 3300013100 Archaea 2138
489 Ga0157373_10354183 3300013100 Unclassified 1047
490 Ga0157373_10519418 3300013100 Bacteria 861
491 Ga0157371_10361351 3300013102 Unclassified 1058
492 Ga0157370_10004065 3300013104 Bacteria 16962
493 Ga0157370_10023653 3300013104 Bacteria 6097
494 Ga0157370_10056344 3300013104 Bacteria 3741
495 Ga0157370_10086143 3300013104 Bacteria 2952
496 Ga0157370_10167543 3300013104 Bacteria 2042
497 Ga0157370_10244403 3300013104 Bacteria 1660
498 Ga0157370_10428937 3300013104 Bacteria 1216
499 Ga0157370_10462589 3300013104 Bacteria 1166
500 Ga0157369_10001658 3300013105 Bacteria 27137
501 Ga0157369_10026955 3300013105 Bacteria 6373
502 Ga0157369_10070995 3300013105 Bacteria 3740
503 Ga0157369_10133353 3300013105 Bacteria 2631
504 Ga0157369_10267773 3300013105 Bacteria 1781
505 Ga0157374_10019090 3300013296 Bacteria 6066
506 Ga0157374_10215332 3300013296 Bacteria 1884
507 Ga0157374_10300801 3300013296 Bacteria 1587
508 Ga0157374_10469155 3300013296 Bacteria 1261
509 Ga0157374_10536445 3300013296 Bacteria 1177
510 Ga0157374_10536464 3300013296 Bacteria 1177
511 Ga0157378_10006769 3300013297 Bacteria 10014
512 Ga0157378_10119552 3300013297 Bacteria 2426
513 Ga0157378_10234682 3300013297 Bacteria 1750
514 Ga0157378_10294620 3300013297 Bacteria 1568
515 Ga0157378_11660936 3300013297 Bacteria 685
516 Ga0163162_10009244 3300013306 Bacteria 9589
517 Ga0163162_10056855 3300013306 Bacteria 3940
518 Ga0163162_10113990 3300013306 Bacteria 2802
519 Ga0163162_10412334 3300013306 Bacteria 1483
520 Ga0163162_10653733 3300013306 Unclassified 1175
521 Ga0163162_10792842 3300013306 Bacteria 1065
522 Ga0163162_11003167 3300013306 Bacteria 944
523 Ga0163162_11553556 3300013306 Bacteria 754
524 Ga0163162_11956867 3300013306 Unclassified 671
525 Ga0157372_10019405 3300013307 Bacteria 7328
526 Ga0157372_10023620 3300013307 Bacteria 6670
527 Ga0157372_10045493 3300013307 Bacteria 4870
528 Ga0157372_10050147 3300013307 Bacteria 4644
529 Ga0157372_10356181 3300013307 Bacteria 1705
530 Ga0157372_10926295 3300013307 Unclassified 1010
531 Ga0157372_10962289 3300013307 Bacteria 989
532 Ga0157372_11719590 3300013307 Bacteria 722
533 Ga0157375_10027796 3300013308 Bacteria 5292
534 Ga0157375_10057570 3300013308 Bacteria 3843
535 Ga0157375_10117140 3300013308 Bacteria 2769
536 Ga0157375_10222753 3300013308 Bacteria 2045
537 Ga0157375_10530500 3300013308 Unclassified 1340
538 Ga0157375_11333136 3300013308 Bacteria 844
539 Ga0157375_11958864 3300013308 Bacteria 696
540 Ga0163163_10033602 3300014325 Bacteria 4963
541 Ga0163163_10037531 3300014325 Bacteria 4714
542 Ga0163163_10039812 3300014325 Bacteria 4588
543 Ga0163163_10057030 3300014325 Bacteria 3862
544 Ga0163163_10112756 3300014325 Bacteria 2749
545 Ga0163163_10130349 3300014325 Bacteria 2555
546 Ga0163163_10147461 3300014325 Bacteria 2397
547 Ga0163163_10149270 3300014325 Bacteria 2382
548 Ga0163163_10169333 3300014325 Bacteria 2231
549 Ga0163163_10244900 3300014325 Bacteria 1843
550 Ga0163163_10914752 3300014325 Bacteria 941
551 Ga0157380_10007797 3300014326 Bacteria 7618
552 Ga0157380_10009711 3300014326 Bacteria 6905
553 Ga0157380_10010846 3300014326 Bacteria 6570
554 Ga0157380_10027142 3300014326 Bacteria 4352
555 Ga0157380_10028962 3300014326 Bacteria 4229
556 Ga0157380_10044968 3300014326 Bacteria 3463
557 Ga0157380_10148475 3300014326 Bacteria 2023
558 Ga0157380_10258555 3300014326 Bacteria 1580
559 Ga0157380_10400869 3300014326 Bacteria 1301
560 Ga0157380_11634156 3300014326 Unclassified 700
561 Ga0157377_10017096 3300014745 Bacteria 3746
562 Ga0157377_10089282 3300014745 Bacteria 1817
563 Ga0157377_10157863 3300014745 Bacteria 1408
564 Ga0157377_10564782 3300014745 Bacteria 806
565 Ga0157377_10626905 3300014745 Bacteria 771
566 Ga0157379_10053964 3300014968 Bacteria 3591
567 Ga0157379_10789500 3300014968 Unclassified 896
568 Ga0157379_11285073 3300014968 Bacteria 706
569 Ga0157376_10010690 3300014969 Bacteria 6729
570 Ga0157376_10059844 3300014969 Bacteria 3195
571 Ga0157376_10254235 3300014969 Bacteria 1643
572 Ga0157376_10329167 3300014969 Bacteria 1455
573 Ga0157376_11400287 3300014969 Bacteria 731
574 Ga0163161_10066300 3300017792 Bacteria 2636
575 Ga0163161_10158763 3300017792 Bacteria 1723
576 Ga0213873_10031808 3300021358 Bacteria 1315
577 Ga0213874_10008846 3300021377 Bacteria 2469
578 Ga0213876_10001214 3300021384 Bacteria 16256
579 Ga0213876_10083920 3300021384 Bacteria 1685
580 Ga0213875_10002769 3300021388 Bacteria 10348
581 Ga0213875_10006476 3300021388 Bacteria 6139
582 Ga0213875_10010188 3300021388 Bacteria 4721
583 Ga0213875_10071064 3300021388 Bacteria 1625
584 Ga0213875_10088214 3300021388 Bacteria 1447
585 Ga0213875_10089555 3300021388 Bacteria 1435
586 Ga0213875_10152047 3300021388 Bacteria 1084
587 Ga0213871_10099049 3300021441 Unclassified 851
588 Ga0224712_10225900 3300022467 Bacteria 858
589 Ga0207697_10001282 3300025315 Bacteria 13790
590 Ga0207656_10009659 3300025321 Bacteria 3585
591 Ga0207656_10116763 3300025321 Bacteria 1238
592 Ga0207656_10231557 3300025321 Bacteria 901
593 Ga0207682_10000378 3300025893 Bacteria 20628
594 Ga0207682_10018854 3300025893 Bacteria 2699
595 Ga0207682_10020419 3300025893 Bacteria 2602
596 Ga0207682_10025631 3300025893 Bacteria 2339
597 Ga0207688_10000628 3300025901 Bacteria 17382
598 Ga0207688_10010226 3300025901 Bacteria 5107
599 Ga0207688_10064495 3300025901 Bacteria 2069
600 Ga0207680_10151867 3300025903 Bacteria 1545
601 Ga0207680_10155269 3300025903 Bacteria 1529
602 Ga0207699_10025855 3300025906 Bacteria 3229
603 Ga0207699_10141254 3300025906 Bacteria 1583
604 Ga0207699_10203931 3300025906 Bacteria 1341
605 Ga0207699_10357970 3300025906 Bacteria 1031
606 Ga0207645_10001911 3300025907 Bacteria 16819
607 Ga0207645_10161032 3300025907 Bacteria 1468
608 Ga0207645_10324054 3300025907 Bacteria 1028
609 Ga0207643_10000925 3300025908 Bacteria 17575
610 Ga0207643_10059446 3300025908 Bacteria 2180
611 Ga0207643_10079229 3300025908 Bacteria 1901
612 Ga0207643_10130402 3300025908 Bacteria 1496
613 Ga0207643_10542749 3300025908 Bacteria 746
614 Ga0207705_10009074 3300025909 Bacteria 7247
615 Ga0207705_10056458 3300025909 Bacteria 2831
616 Ga0207684_10127932 3300025910 Bacteria 2180
617 Ga0207654_10007778 3300025911 Bacteria 5409
618 Ga0207654_10040135 3300025911 Bacteria 2636
619 Ga0207654_10045861 3300025911 Unclassified 2490
620 Ga0207654_10864630 3300025911 Bacteria 655
621 Ga0207707_10007135 3300025912 Bacteria 9730
622 Ga0207707_10023281 3300025912 Bacteria 5420
623 Ga0207707_10122403 3300025912 Bacteria 2275
624 Ga0207707_10128104 3300025912 Unclassified 2220
625 Ga0207707_10129369 3300025912 Bacteria 2208
626 Ga0207707_10329341 3300025912 Bacteria 1318
627 Ga0207707_10482139 3300025912 Bacteria 1059
628 Ga0207707_10955132 3300025912 Bacteria 706
629 Ga0207695_10000770 3300025913 Bacteria 60994
630 Ga0207695_10002883 3300025913 Bacteria 24934
631 Ga0207695_10005525 3300025913 Bacteria 16734
632 Ga0207695_10009314 3300025913 Bacteria 12156
633 Ga0207695_10012024 3300025913 Bacteria 10411
634 Ga0207695_10022417 3300025913 Bacteria 7168
635 Ga0207695_10032450 3300025913 Bacteria 5714
636 Ga0207695_10210757 3300025913 Bacteria 1854
637 Ga0207695_10307166 3300025913 Unclassified 1477
638 Ga0207695_10735222 3300025913 Bacteria 867
639 Ga0207671_10053083 3300025914 Bacteria 3004
640 Ga0207671_10136381 3300025914 Bacteria 1887
641 Ga0207671_10149982 3300025914 Unclassified 1801
642 Ga0207671_10424851 3300025914 Bacteria 1057
643 Ga0207663_10668246 3300025916 Bacteria 821
644 Ga0207660_10083025 3300025917 Bacteria 2358
645 Ga0207660_10187192 3300025917 Bacteria 1610
646 Ga0207660_10628553 3300025917 Bacteria 875
647 Ga0207660_11074692 3300025917 Bacteria 656
648 Ga0207662_10009608 3300025918 Bacteria 5329
649 Ga0207662_10018372 3300025918 Bacteria 3966
650 Ga0207662_10029781 3300025918 Bacteria 3165
651 Ga0207657_10007163 3300025919 Bacteria 11456
652 Ga0207657_10230904 3300025919 Unclassified 1480
653 Ga0207657_10239693 3300025919 Bacteria 1448
654 Ga0207649_10228255 3300025920 Bacteria 1330
655 Ga0207652_10016163 3300025921 Bacteria 6088
656 Ga0207652_10080761 3300025921 Bacteria 2843
657 Ga0207652_10147679 3300025921 Bacteria 2104
658 Ga0207681_10046098 3300025923 Bacteria 2931
659 Ga0207681_10108455 3300025923 Bacteria 2015
660 Ga0207681_10125365 3300025923 Bacteria 1890
661 Ga0207681_10179122 3300025923 Bacteria 1613
662 Ga0207681_10264114 3300025923 Bacteria 1349
663 Ga0207681_10593950 3300025923 Bacteria 914
664 Ga0207694_10002138 3300025924 Bacteria 16241
665 Ga0207694_10011929 3300025924 Bacteria 6553
666 Ga0207694_10044456 3300025924 Bacteria 3429
667 Ga0207694_10061145 3300025924 Bacteria 2931
668 Ga0207694_10079285 3300025924 Bacteria 2575
669 Ga0207694_10137183 3300025924 Bacteria 1965
670 Ga0207694_10292997 3300025924 Unclassified 1339
671 Ga0207694_10316567 3300025924 Bacteria 1287
672 Ga0207694_10324519 3300025924 Bacteria 1271
673 Ga0207650_10001613 3300025925 Bacteria 16089
674 Ga0207650_10018995 3300025925 Bacteria 4831
675 Ga0207650_10024950 3300025925 Bacteria 4256
676 Ga0207650_10066823 3300025925 Bacteria 2697
677 Ga0207650_10111038 3300025925 Bacteria 2122
678 Ga0207650_10490652 3300025925 Bacteria 1026
679 Ga0207659_10000064 3300025926 Bacteria 67058
680 Ga0207659_10000228 3300025926 Bacteria 34204
681 Ga0207659_10004292 3300025926 Bacteria 8618
682 Ga0207659_10005992 3300025926 Bacteria 7418
683 Ga0207659_10012850 3300025926 Bacteria 5346
684 Ga0207659_10034223 3300025926 Bacteria 3501
685 Ga0207659_10036318 3300025926 Bacteria 3412
686 Ga0207659_10065120 3300025926 Bacteria 2640
687 Ga0207659_10079734 3300025926 Bacteria 2416
688 Ga0207659_10230452 3300025926 Bacteria 1494
689 Ga0207659_10235648 3300025926 Bacteria 1478
690 Ga0207659_10460799 3300025926 Bacteria 1072
691 Ga0207659_10515366 3300025926 Archaea 1014
692 Ga0207687_10012877 3300025927 Bacteria 5467
693 Ga0207687_10043361 3300025927 Bacteria 3099
694 Ga0207687_10053985 3300025927 Bacteria 2810
695 Ga0207687_10094021 3300025927 Bacteria 2193
696 Ga0207687_10145721 3300025927 Bacteria 1801
697 Ga0207687_10160729 3300025927 Bacteria 1724
698 Ga0207687_10376574 3300025927 Bacteria 1162
699 Ga0207700_10039457 3300025928 Bacteria 3438
700 Ga0207700_10041486 3300025928 Bacteria 3367
701 Ga0207700_10079503 3300025928 Bacteria 2554
702 Ga0207664_10027284 3300025929 Bacteria 4327
703 Ga0207664_10119110 3300025929 Bacteria 2207
704 Ga0207644_10138078 3300025931 Bacteria 1874
705 Ga0207644_10337395 3300025931 Bacteria 1222
706 Ga0207644_10370971 3300025931 Bacteria 1166
707 Ga0207644_10561460 3300025931 Bacteria 945
708 Ga0207644_10582099 3300025931 Bacteria 928
709 Ga0207690_10273408 3300025932 Bacteria 1313
710 Ga0207690_10621099 3300025932 Bacteria 884
711 Ga0207706_10038266 3300025933 Bacteria 4255
712 Ga0207706_10191644 3300025933 Bacteria 1794
713 Ga0207706_10371621 3300025933 Bacteria 1242
714 Ga0207686_10002152 3300025934 Bacteria 10841
715 Ga0207686_10002620 3300025934 Bacteria 9761
716 Ga0207686_10005323 3300025934 Bacteria 6900
717 Ga0207686_10054128 3300025934 Bacteria 2512
718 Ga0207686_10055571 3300025934 Bacteria 2484
719 Ga0207686_10086326 3300025934 Bacteria 2061
720 Ga0207686_10421072 3300025934 Bacteria 1021
721 Ga0207686_10465737 3300025934 Bacteria 975
722 Ga0207709_10019269 3300025935 Bacteria 3833
723 Ga0207709_10027336 3300025935 Bacteria 3286
724 Ga0207709_10233308 3300025935 Bacteria 1334
725 Ga0207670_10004170 3300025936 Bacteria 7753
726 Ga0207670_10071424 3300025936 Bacteria 2401
727 Ga0207670_10211326 3300025936 Bacteria 1480
728 Ga0207670_10327409 3300025936 Bacteria 1207
729 Ga0207670_10535541 3300025936 Bacteria 955
730 Ga0207669_10000517 3300025937 Bacteria 16886
731 Ga0207669_10004725 3300025937 Bacteria 6031
732 Ga0207669_10098920 3300025937 Bacteria 1922
733 Ga0207669_10424911 3300025937 Bacteria 1047
734 Ga0207669_10478367 3300025937 Bacteria 992
735 Ga0207669_10601611 3300025937 Bacteria 894
736 Ga0207704_10004043 3300025938 Bacteria 6681
737 Ga0207704_10006783 3300025938 Bacteria 5362
738 Ga0207704_10067906 3300025938 Bacteria 2245
739 Ga0207704_10195005 3300025938 Bacteria 1477
740 Ga0207665_10358373 3300025939 Bacteria 1102
741 Ga0207665_10548819 3300025939 Bacteria 898
742 Ga0207691_10005381 3300025940 Bacteria 12358
743 Ga0207691_10023122 3300025940 Bacteria 5853
744 Ga0207691_10025557 3300025940 Bacteria 5542
745 Ga0207691_10043378 3300025940 Bacteria 4146
746 Ga0207691_10167524 3300025940 Bacteria 1925
747 Ga0207691_10250137 3300025940 Bacteria 1530
748 Ga0207691_10263906 3300025940 Bacteria 1484
749 Ga0207691_10326462 3300025940 Bacteria 1315
750 Ga0207711_10057026 3300025941 Bacteria 3358
751 Ga0207711_10058775 3300025941 Bacteria 3310
752 Ga0207711_10062940 3300025941 Bacteria 3202
753 Ga0207711_10177044 3300025941 Bacteria 1938
754 Ga0207711_10330763 3300025941 Bacteria 1409
755 Ga0207711_10488516 3300025941 Bacteria 1147
756 Ga0207689_10005493 3300025942 Bacteria 11339
757 Ga0207689_10014043 3300025942 Bacteria 6816
758 Ga0207689_10066220 3300025942 Bacteria 2971
759 Ga0207689_10073568 3300025942 Bacteria 2807
760 Ga0207689_10182689 3300025942 Bacteria 1729
761 Ga0207689_10201284 3300025942 Bacteria 1644
762 Ga0207689_10212500 3300025942 Bacteria 1598
763 Ga0207689_10441410 3300025942 Bacteria 1087
764 Ga0207661_10008190 3300025944 Bacteria 7461
765 Ga0207661_10020313 3300025944 Bacteria 4963
766 Ga0207661_10034465 3300025944 Bacteria 3937
767 Ga0207661_10116924 3300025944 Bacteria 2264
768 Ga0207661_10171746 3300025944 Bacteria 1887
769 Ga0207661_10234084 3300025944 Bacteria 1628
770 Ga0207661_10273605 3300025944 Unclassified 1507
771 Ga0207661_10992637 3300025944 Bacteria 773
772 Ga0207679_10030495 3300025945 Bacteria 3766
773 Ga0207679_10056076 3300025945 Bacteria 2908
774 Ga0207679_10208072 3300025945 Bacteria 1639
775 Ga0207667_10001168 3300025949 Bacteria 32962
776 Ga0207667_10002566 3300025949 Bacteria 22601
777 Ga0207667_10008741 3300025949 Bacteria 12005
778 Ga0207667_10042580 3300025949 Bacteria 4825
779 Ga0207667_10083019 3300025949 Bacteria 3318
780 Ga0207667_10444800 3300025949 Unclassified 1317
781 Ga0207667_10591880 3300025949 Bacteria 1119
782 Ga0207651_10002909 3300025960 Bacteria 8271
783 Ga0207651_10038468 3300025960 Bacteria 3145
784 Ga0207651_10134430 3300025960 Bacteria 1899
785 Ga0207651_10230893 3300025960 Bacteria 1502
786 Ga0207651_10247509 3300025960 Bacteria 1456
787 Ga0207651_10256499 3300025960 Bacteria 1433
788 Ga0207651_10375388 3300025960 Bacteria 1204
789 Ga0207712_10020945 3300025961 Bacteria 4289
790 Ga0207712_10029296 3300025961 Bacteria 3691
791 Ga0207712_10239193 3300025961 Bacteria 1461
792 Ga0207712_10616317 3300025961 Bacteria 940
793 Ga0207668_10026763 3300025972 Bacteria 3750
794 Ga0207640_10349165 3300025981 Bacteria 1188
795 Ga0207640_10510639 3300025981 Bacteria 1003
796 Ga0207658_10023883 3300025986 Bacteria 4272
797 Ga0207658_10068874 3300025986 Bacteria 2672
798 Ga0207658_10124428 3300025986 Bacteria 2061
799 Ga0207677_10095049 3300026023 Bacteria 2177
800 Ga0207677_10368856 3300026023 Bacteria 1208
801 Ga0207677_10439843 3300026023 Archaea 1115
802 Ga0207703_10009334 3300026035 Bacteria 7710
803 Ga0207703_10009949 3300026035 Bacteria 7463
804 Ga0207703_10049412 3300026035 Bacteria 3400
805 Ga0207703_10162311 3300026035 Bacteria 1958
806 Ga0207703_10184905 3300026035 Bacteria 1841
807 Ga0207703_10689738 3300026035 Bacteria 971
808 Ga0207639_10073035 3300026041 Bacteria 2688
809 Ga0207639_10204673 3300026041 Bacteria 1695
810 Ga0207639_10257951 3300026041 Bacteria 1523
811 Ga0207639_10605982 3300026041 Unclassified 1010
812 Ga0207639_10951875 3300026041 Bacteria 803
813 Ga0207678_10303308 3300026067 Bacteria 1372
814 Ga0207708_10026932 3300026075 Bacteria 4353
815 Ga0207708_10043189 3300026075 Bacteria 3436
816 Ga0207708_10065842 3300026075 Bacteria 2770
817 Ga0207708_10153111 3300026075 Bacteria 1817
818 Ga0207702_10015048 3300026078 Bacteria 6415
819 Ga0207702_10055899 3300026078 Bacteria 3349
820 Ga0207702_10066986 3300026078 Bacteria 3080
821 Ga0207702_10444450 3300026078 Unclassified 1257
822 Ga0207702_10680981 3300026078 Bacteria 1013
823 Ga0207641_10467193 3300026088 Bacteria 1221
824 Ga0207648_10000163 3300026089 Bacteria 68352
825 Ga0207648_10005974 3300026089 Bacteria 12169
826 Ga0207648_10010408 3300026089 Bacteria 8817
827 Ga0207648_10013761 3300026089 Bacteria 7510
828 Ga0207648_10066022 3300026089 Bacteria 3155
829 Ga0207648_10110545 3300026089 Bacteria 2412
830 Ga0207648_10120681 3300026089 Bacteria 2305
831 Ga0207648_10278070 3300026089 Bacteria 1497
832 Ga0207648_10493976 3300026089 Bacteria 1119
833 Ga0207648_10495649 3300026089 Bacteria 1117
834 Ga0207648_10684417 3300026089 Bacteria 949
835 Ga0207648_10772281 3300026089 Bacteria 893
836 Ga0207648_10839716 3300026089 Bacteria 856
837 Ga0207676_10066179 3300026095 Bacteria 2881
838 Ga0207676_10112821 3300026095 Bacteria 2278
839 Ga0207676_10182371 3300026095 Bacteria 1839
840 Ga0207676_10205587 3300026095 Bacteria 1743
841 Ga0207676_10254592 3300026095 Bacteria 1582
842 Ga0207676_10383972 3300026095 Unclassified 1308
843 Ga0207676_10409678 3300026095 Bacteria 1269
844 Ga0207676_10882436 3300026095 Unclassified 876
845 Ga0207674_10000166 3300026116 Bacteria 79149
846 Ga0207674_10030026 3300026116 Bacteria 5719
847 Ga0207674_10035376 3300026116 Bacteria 5212
848 Ga0207674_10065120 3300026116 Bacteria 3674
849 Ga0207674_10158407 3300026116 Bacteria 2219
850 Ga0207674_10346522 3300026116 Bacteria 1436
851 Ga0207674_10521358 3300026116 Unclassified 1148
852 Ga0207674_10618213 3300026116 Bacteria 1046
853 Ga0207674_10709974 3300026116 Bacteria 971
854 Ga0207675_100007871 3300026118 Bacteria 10056
855 Ga0207675_100157346 3300026118 Bacteria 2166
856 Ga0207675_100177235 3300026118 Bacteria 2040
857 Ga0207675_100207046 3300026118 Bacteria 1885
858 Ga0207683_10018406 3300026121 Bacteria 5961
859 Ga0207683_10046567 3300026121 Bacteria 3796
860 Ga0207683_10067010 3300026121 Bacteria 3167
861 Ga0207683_10078532 3300026121 Bacteria 2925
862 Ga0207683_10106347 3300026121 Bacteria 2509
863 Ga0207683_10108233 3300026121 Bacteria 2487
864 Ga0207683_10295213 3300026121 Bacteria 1482
865 Ga0207683_10545968 3300026121 Archaea 1071
866 Ga0207698_10044678 3300026142 Bacteria 3331
867 Ga0207698_10185000 3300026142 Bacteria 1849
868 Ga0207698_10217328 3300026142 Bacteria 1724
869 Ga0207698_11058134 3300026142 Bacteria 823
870 Ga0207698_11107193 3300026142 Bacteria 805
871 Ga0207698_11681131 3300026142 Unclassified 650
872 Ga0209974_10027219 3300027876 Bacteria 1891
873 Ga0209974_10047241 3300027876 Unclassified 1441
874 Ga0207428_10001370 3300027907 Bacteria 25833
875 Ga0207428_10001377 3300027907 Bacteria 25761
876 Ga0207428_10003130 3300027907 Bacteria 16230
877 Ga0207428_10072291 3300027907 Bacteria 2708
878 Ga0207428_10188549 3300027907 Bacteria 1555
879 Ga0268266_10061402 3300028379 Bacteria 3242
880 Ga0268266_10070582 3300028379 Bacteria 3027
881 Ga0268266_10306151 3300028379 Bacteria 1484
882 Ga0268266_10372573 3300028379 Bacteria 1345
883 Ga0268266_11063237 3300028379 Bacteria 783
884 Ga0268265_10023143 3300028380 Bacteria 4376
885 Ga0268265_10089292 3300028380 Bacteria 2458
886 Ga0268265_10231499 3300028380 Bacteria 1624
887 Ga0268265_10295874 3300028380 Bacteria 1455
888 Ga0268265_10557409 3300028380 Bacteria 1089
889 Ga0268265_11113616 3300028380 Bacteria 784
890 Ga0268264_10003737 3300028381 Bacteria 13072
891 Ga0268264_10009037 3300028381 Bacteria 8267
892 Ga0268264_10243591 3300028381 Bacteria 1666
893 Ga0268264_10420460 3300028381 Bacteria 1289
894 Ga0268264_10483648 3300028381 Bacteria 1205
895 Ga0265323_10001994 3300028653 Bacteria 9627
896 Ga0265338_10137740 3300028800 Bacteria 1916
897 Ga0265760_10219868 3300031090 Unclassified 647
898 Ga0265320_10001179 3300031240 Bacteria 19255
899 Ga0265325_10003125 3300031241 Bacteria 10924
900 Ga0265325_10012734 3300031241 Bacteria 4801
901 Ga0265340_10022045 3300031247 Bacteria 3260
902 Ga0265331_10069063 3300031250 Bacteria 1655
903 Ga0265316_10001444 3300031344 Bacteria 25507
904 Ga0265316_10004197 3300031344 Bacteria 14404
905 Ga0265316_10118693 3300031344 Bacteria 1998
906 Ga0265316_10245706 3300031344 Bacteria 1315
907 Ga0265316_10444213 3300031344 Bacteria 931
908 Ga0307408_100007941 3300031548 Bacteria 7016
909 Ga0307408_100016620 3300031548 Bacteria 4915
910 Ga0265313_10027055 3300031595 Bacteria 3008
911 Ga0265314_10000282 3300031711 Bacteria 73865
912 Ga0265314_10000961 3300031711 Bacteria 33842
913 Ga0265314_10025644 3300031711 Bacteria 4442
914 Ga0265314_10089002 3300031711 Bacteria 2015
915 Ga0265342_10049765 3300031712 Bacteria 2506
916 Ga0307405_10013982 3300031731 Bacteria 4301
917 Ga0307405_10336380 3300031731 Bacteria 1159
918 Ga0307413_10366244 3300031824 Bacteria 1118
919 Ga0307410_10141551 3300031852 Bacteria 1780
920 Ga0307406_10233116 3300031901 Bacteria 1376
921 Ga0307406_10455426 3300031901 Bacteria 1027
922 Ga0307407_10146428 3300031903 Unclassified 1530
923 Ga0307412_10177391 3300031911 Bacteria 1599
924 Ga0307412_10352083 3300031911 Bacteria 1183
925 Ga0307412_10406641 3300031911 Bacteria 1110
926 Ga0307412_10562196 3300031911 Unclassified 960
927 Ga0307409_100024156 3300031995 Bacteria 4233
928 Ga0307409_100033309 3300031995 Bacteria 3748
929 Ga0307409_100387479 3300031995 Bacteria 1331
930 Ga0307409_100412144 3300031995 Bacteria 1294
931 Ga0307409_100965143 3300031995 Bacteria 869
932 Ga0307416_100009691 3300032002 Bacteria 6324
933 Ga0307416_100034952 3300032002 Bacteria 3832
934 Ga0307416_100198348 3300032002 Bacteria 1901
935 Ga0307416_100258351 3300032002 Bacteria 1701
936 Ga0307416_100367049 3300032002 Bacteria 1464
937 Ga0307416_100765140 3300032002 Bacteria 1059
938 Ga0307416_101171400 3300032002 Unclassified 874
939 Ga0307416_101678148 3300032002 Bacteria 740
940 Ga0307414_10367557 3300032004 Bacteria 1240
941 Ga0307414_10669985 3300032004 Bacteria 937
942 Ga0307414_11061783 3300032004 Bacteria 747
943 Ga0307411_10005955 3300032005 Bacteria 6058
944 Ga0307411_10016736 3300032005 Bacteria 4157
945 Ga0307411_10168931 3300032005 Bacteria 1647
946 Ga0307411_10287175 3300032005 Bacteria 1312
947 Ga0307411_10306516 3300032005 Bacteria 1276
948 Ga0307411_10843652 3300032005 Bacteria 810
949 Ga0307415_100511887 3300032126 Bacteria 1052
950 Ga0307415_100801156 3300032126 Unclassified 860
951 Ga0373950_0029730 3300034818 Bacteria 1006
952 Ga0373938_0035448 3300034957 Bacteria 1088
953 Ga0373926_0066528 3300035083 Bacteria 1319
954 Ga0373934_0001945 3300035086 Bacteria 7572
955 Ga0373934_0137732 3300035086 Bacteria 997
956 Ga0373940_0005259 3300035088 Bacteria 2792
957 Ga0373949_0035044 3300035090 Bacteria 1212
958 Ga0373923_0274862 3300035111 Unclassified 793
959 Ga0373923_0360644 3300035111 Bacteria 695
960 Ga0373932_0053834 3300035112 Bacteria 1202
961 Ga0373939_0010404 3300035114 Bacteria 2325
962 Ga0373953_0135848 3300035117 Bacteria 1050
963 Ga0373954_0001726 3300035118 Bacteria 8948
964 Ga0373954_0004906 3300035118 Bacteria 5775
965 Ga0373956_0020307 3300035119 Bacteria 2825
966 Ga0373956_0075491 3300035119 Bacteria 1542
967 Ga0373957_0012652 3300035120 Bacteria 2846
968 Ga0373960_0012930 3300035121 Bacteria 2084
969 Ga0373960_0115612 3300035121 Bacteria 885
970 Ga0373960_0207769 3300035121 Bacteria 695
971 Ga0373943_0316264 3300035170 Bacteria 889
972 Ga0373946_0038006 3300035171 Bacteria 1959
973 Ga0373955_0056036 3300035172 Bacteria 2161
974 Ga0373955_0133431 3300035172 Bacteria 1451
975 Ga0373955_0217186 3300035172 Bacteria 1141
976 Ga0373955_0235734 3300035172 Bacteria 1095
977 Ga0373961_0083350 3300035241 Bacteria 1009
978 Ga0373924_0240676 3300035410 Bacteria 801
979 Ga0373931_0078914 3300035691 Bacteria 1812
980 Ga0373935_0044795 3300035692 Bacteria 2790
981 Ga0373935_0116314 3300035692 Bacteria 1781
982 Ga0373927_0000498 3300035695 Bacteria 29897
983 Ga0373927_0002081 3300035695 Bacteria 14775
984 Ga0373927_0007350 3300035695 Bacteria 7457
985 Ga0373927_0042674 3300035695 Bacteria 2939
986 Ga0373933_0128788 3300035724 Unclassified 1590
987 Ga0373933_0183833 3300035724 Bacteria 1334
988 Ga0373947_0001083 3300035725 Bacteria 16688
989 Ga0373947_0013876 3300035725 Bacteria 4620
990 Ga0373947_0021389 3300035725 Bacteria 3744
991 Ga0373937_0017647 3300036401 Bacteria 6366
992 Ga0373937_0061324 3300036401 Bacteria 3457
993 Ga0373937_0084305 3300036401 Bacteria 2940
994 Ga0373937_0089365 3300036401 Bacteria 2852
995 Ga0373937_0323934 3300036401 Bacteria 1458
996 Ga0373937_0387906 3300036401 Bacteria 1325
997 Ga0373937_0418446 3300036401 Bacteria 1272
998 Ga0373937_0459359 3300036401 Bacteria 1209
999 Ga0373937_0747975 3300036401 Bacteria 925
1000 Ga0373925_0000281 3300037068 Bacteria 53236
1001 Ga0373925_0036609 3300037068 Bacteria 3622
1002 Ga0373925_0119629 3300037068 Bacteria 2043
1003 Ga0373925_0160195 3300037068 Bacteria 1772
1004 Ga0373925_0231751 3300037068 Bacteria 1477
1005 Ga0373925_0248232 3300037068 Bacteria 1427
1006 Ga0373925_0266953 3300037068 Bacteria 1376
1007 Ga0373925_0626934 3300037068 Unclassified 886
1008 Ga0436364_0062454 3300037853 Bacteria 1604
1009 Ga0436364_0298586 3300037853 Bacteria 4338
1010 Ga0436364_0349717 3300037853 Bacteria 2676
1011 Ga0436364_0365940 3300037853 Bacteria 2488
1012 Ga0436364_0509131 3300037853 Bacteria 1939
1013 Ga0436364_0555496 3300037853 Bacteria 1971
1014 Ga0436364_0618208 3300037853 Bacteria 688
1015 Ga0436364_0633516 3300037853 Bacteria 25573
1016 Ga0436364_0674901 3300037853 Bacteria 3046
1017 Ga0436364_0818237 3300037853 Bacteria 6615
1018 Ga0436364_0835808 3300037853 Bacteria 4462
1019 Ga0436364_0991276 3300037853 Bacteria 2683
1020 Ga0436364_1046318 3300037853 Unclassified 2118
1021 Ga0436364_1080095 3300037853 Bacteria 2864
1022 Ga0436364_1193035 3300037853 Bacteria 6898
1023 Ga0436364_1295092 3300037853 Bacteria 1458
1024 Ga0395901_0142089 3300038443 Bacteria 2523
1025 Ga0436365_0082371 3300039437 Bacteria 1967
1026 Ga0436365_0344744 3300039437 Bacteria 9555
1027 Ga0436365_0512169 3300039437 Unclassified 2020
1028 Ga0436365_0650674 3300039437 Bacteria 3958
1029 Ga0436365_1778817 3300039437 Bacteria 29645
1030 Ga0436360_0580543 3300039438 Bacteria 14902
1031 Ga0436360_0677337 3300039438 Bacteria 922
1032 Ga0436360_0882145 3300039438 Bacteria 1311
1033 Ga0436361_0793152 3300039447 Bacteria 90360
1034 Ga0436361_1149713 3300039447 Bacteria 2715
1035 Ga0436363_0651938 3300039450 Bacteria 1132
1036 Ga0436363_0673922 3300039450 Bacteria 841
1037 Ga0436363_0858902 3300039450 Bacteria 2994
1038 Ga0436363_1297791 3300039450 Bacteria 3582
1039 Ga0436363_1382872 3300039450 Bacteria 674
1040 Ga0436363_1694135 3300039450 Bacteria 980
1041 Ga0436362_0155526 3300039453 Bacteria 907
1042 Ga0436362_0701537 3300039453 Unclassified 751
1043 Ga0436362_0890342 3300039453 Bacteria 5717
1044 Ga0451843_0968640 3300041509 Bacteria 1036
1045 Ga0451853_1530684 3300041512 Bacteria 638
1046 Ga0439441_072265 3300042001 Bacteria 741
1047 Ga0439454_012362 3300042011 Bacteria 1157
1048 Ga0450920_027248 3300042122 Bacteria 1118
1049 Ga0439446_0046055 3300042156 Bacteria 1295
1050 Ga0450908_015851 3300042184 Bacteria 1347
1051 Ga0439434_0067418 3300042435 Bacteria 1124
1052 Ga0439435_0015984 3300042436 Bacteria 1875
1053 Ga0439444_0007370 3300042437 Bacteria 1688
1054 Ga0439460_0057087 3300042461 Bacteria 1184
1055 Ga0450916_005898 3300042530 Bacteria 1430
1056 Ga0450916_012289 3300042530 Bacteria 1091
1057 Ga0451577_0469755 3300042876 Bacteria 1142
1058 Ga0439440_0043722 3300042993 Bacteria 1099
1059 Ga0453683_0672215 3300044673 Bacteria 678
1060 Ga0466966_0113650 3300044684 Bacteria 1667
1061 Ga0466963_0178329 3300044694 Bacteria 1483
1062 Ga0466963_0525925 3300044694 Bacteria 835
1063 Ga0451576_0048913 3300045051 Bacteria 4438
1064 Ga0451576_0201094 3300045051 Bacteria 2081
1065 Ga0451576_0229180 3300045051 Bacteria 1940
1066 Ga0495592_0059402 3300046454 Bacteria 2816
1067 Ga0495603_0059674 3300046455 Bacteria 2255
1068 Ga0495603_0101562 3300046455 Bacteria 1679
1069 Ga0495603_0117581 3300046455 Bacteria 1550
1070 Ga0495603_0140246 3300046455 Bacteria 1406
1071 Ga0495651_0002965 3300046462 Bacteria 13114
1072 Ga0495651_0211998 3300046462 Bacteria 1347
1073 Ga0495651_0365259 3300046462 Bacteria 950
1074 Ga0495580_0014096 3300046472 Bacteria 6077
1075 Ga0495580_0073689 3300046472 Bacteria 2384
1076 Ga0495580_0103321 3300046472 Bacteria 1981
1077 Ga0495580_0146563 3300046472 Bacteria 1636
1078 Ga0495580_0205857 3300046472 Bacteria 1355
1079 Ga0495580_0339995 3300046472 Bacteria 1018
1080 Ga0495580_0375568 3300046472 Bacteria 961
1081 Ga0495580_0408976 3300046472 Unclassified 914
1082 Ga0495582_0092109 3300046473 Bacteria 1691
1083 Ga0495582_0201521 3300046473 Bacteria 1136
1084 Ga0495582_0352007 3300046473 Bacteria 848
1085 Ga0495639_0224658 3300046475 Bacteria 924
1086 Ga0495664_0087302 3300046477 Bacteria 1874
1087 Ga0495664_0164764 3300046477 Bacteria 1345
1088 Ga0495664_0208754 3300046477 Bacteria 1183
1089 Ga0495664_0385348 3300046477 Bacteria 843
1090 Ga0495594_0004891 3300046499 Bacteria 6897
1091 Ga0495594_0114077 3300046499 Bacteria 1525
1092 Ga0495608_0423284 3300046511 Bacteria 812
1093 Ga0495643_0003489 3300046522 Bacteria 11463
1094 Ga0495663_0203336 3300046525 Bacteria 692
1095 Ga0495666_0096729 3300046526 Bacteria 1392
1096 Ga0495652_0036329 3300046529 Bacteria 4286
1097 Ga0495652_0116086 3300046529 Bacteria 2144
1098 Ga0495665_0139085 3300046531 Bacteria 1269
1099 Ga0495665_0338815 3300046531 Bacteria 767
1100 Ga0495586_0381494 3300046535 Bacteria 811
1101 Ga0495587_0006862 3300046536 Bacteria 7406
1102 Ga0495587_0423880 3300046536 Bacteria 738
1103 Ga0495621_0020422 3300046539 Bacteria 2174
1104 Ga0495621_0270016 3300046539 Bacteria 699
1105 Ga0495645_0019007 3300046543 Bacteria 4945
1106 Ga0495645_0209763 3300046543 Bacteria 1316
1107 Ga0495645_0281329 3300046543 Bacteria 1094
1108 Ga0495645_0298586 3300046543 Bacteria 1053
1109 Ga0495645_0301265 3300046543 Bacteria 1047
1110 Ga0495645_0349397 3300046543 Bacteria 953
1111 Ga0495633_0271185 3300046558 Bacteria 772
1112 Ga0495667_0081241 3300046559 Bacteria 2107
1113 Ga0495656_0075421 3300046615 Bacteria 1509
1114 Ga0495635_0047094 3300046663 Bacteria 2975
1115 Ga0495635_0160477 3300046663 Bacteria 1530
1116 Ga0495635_0181987 3300046663 Bacteria 1428
1117 Ga0495659_0036011 3300046664 Bacteria 1746
1118 Ga0495588_0030217 3300046674 Bacteria 2722
1119 Ga0495599_0003371 3300046678 Bacteria 9341
1120 Ga0495599_0063543 3300046678 Bacteria 2307
1121 Ga0495599_0081458 3300046678 Bacteria 2022
1122 Ga0495599_0521714 3300046678 Bacteria 698
1123 Ga0495623_0207215 3300046679 Bacteria 1124
1124 Ga0495623_0306250 3300046679 Unclassified 876
1125 Ga0495646_0208377 3300046680 Bacteria 1062
1126 Ga0495647_0146881 3300046681 Bacteria 1009
1127 Ga0495647_0353485 3300046681 Bacteria 669
1128 Ga0495658_0277003 3300046683 Unclassified 1058
1129 Ga0495658_0564125 3300046683 Bacteria 729
1130 Ga0495658_0700151 3300046683 Bacteria 649
1131 Ga0495604_0060748 3300047317 Bacteria 2893
1132 Ga0495604_0186718 3300047317 Bacteria 1447
1133 Ga0495636_0037685 3300047318 Bacteria 1997
1134 Ga0495636_0065943 3300047318 Bacteria 1538
1135 Ga0495674_0077054 3300047319 Bacteria 2867
1136 Ga0495674_0083109 3300047319 Bacteria 2745
1137 Ga0495674_0320258 3300047319 Bacteria 1263
1138 Ga0495675_0288190 3300047444 Bacteria 978
1139 Ga0495684_0005866 3300047471 Bacteria 9545
1140 Ga0495684_0094188 3300047471 Bacteria 2268
1141 Ga0495684_0104527 3300047471 Bacteria 2140
1142 Ga0495684_0112073 3300047471 Bacteria 2058
1143 Ga0495684_0113952 3300047471 Bacteria 2038
1144 Ga0495684_0246229 3300047471 Bacteria 1302
1145 Ga0495684_0278866 3300047471 Bacteria 1207
1146 Ga0495602_0012640 3300048088 Bacteria 8661
1147 Ga0495602_0043456 3300048088 Bacteria 4085
1148 Ga0496104_0085600 3300048907 Bacteria 3009
1149 Ga0496104_0571391 3300048907 Unclassified 1041
1150 Ga0496104_0745116 3300048907 Bacteria 887
1151 Ga0496106_0164867 3300048909 Bacteria 1754
1152 Ga0496109_0048511 3300048912 Bacteria 3864
1153 Ga0496110_0290872 3300048913 Bacteria 1488
1154 Ga0496110_0339636 3300048913 Bacteria 1368
1155 Ga0496112_0169095 3300048915 Bacteria 2152
1156 Ga0496113_0205790 3300048916 Bacteria 1565
1157 Ga0496114_0267889 3300048917 Bacteria 1505
1158 Ga0496115_0144934 3300048918 Bacteria 1960
1159 Ga0496115_0190661 3300048918 Bacteria 1694
1160 Ga0501291_003827 3300049514 Bacteria 1891
1161 Ga0501291_007243 3300049514 Bacteria 1499
1162 Ga0501298_016445 3300049521 Bacteria 1341
1163 Ga0501031_0020202 3300049568 Bacteria 4341
1164 Ga0501032_0001366 3300049569 Bacteria 19354
1165 Ga0501033_0015134 3300049570 Bacteria 5853
1166 Ga0501033_0206514 3300049570 Bacteria 1402
1167 Ga0501034_0026807 3300049571 Bacteria 5862
1168 Ga0501036_0001154 3300049572 Bacteria 20080
1169 Ga0501036_0063750 3300049572 Bacteria 3120
1170 Ga0501036_0081431 3300049572 Bacteria 2736
1171 Ga0501036_0244084 3300049572 Bacteria 1506
1172 Ga0501037_0005354 3300049573 Bacteria 9335
1173 Ga0501038_0000838 3300049574 Bacteria 27356
1174 Ga0501038_0188613 3300049574 Bacteria 1660
1175 Ga0501038_0273276 3300049574 Bacteria 1332
1176 Ga0501039_0005534 3300049575 Bacteria 9561
1177 Ga0501039_0030051 3300049575 Bacteria 4187
1178 Ga0501039_0052695 3300049575 Bacteria 3147
1179 Ga0501039_0118927 3300049575 Bacteria 2070
1180 Ga0501040_0020549 3300049576 Bacteria 4402
1181 Ga0501040_0085853 3300049576 Bacteria 2185
1182 Ga0501040_0467044 3300049576 Bacteria 909
1183 Ga0501040_0623788 3300049576 Unclassified 779
1184 Ga0501040_0682928 3300049576 Bacteria 742
1185 Ga0501041_0019686 3300049577 Bacteria 4032
1186 Ga0501042_0005920 3300049578 Bacteria 7909
1187 Ga0501042_0018389 3300049578 Bacteria 4837
1188 Ga0501042_0027614 3300049578 Bacteria 3992
1189 Ga0501043_0031914 3300049579 Bacteria 4139
1190 Ga0501043_0067928 3300049579 Bacteria 2799
1191 Ga0501043_0513089 3300049579 Bacteria 894
1192 Ga0501046_0024267 3300049580 Bacteria 4977
1193 Ga0501046_0026841 3300049580 Bacteria 4703
1194 Ga0501046_0138773 3300049580 Bacteria 1841
1195 Ga0501046_0351759 3300049580 Bacteria 1070
1196 Ga0501047_0064494 3300049581 Bacteria 3532
1197 Ga0501047_0226882 3300049581 Bacteria 1722
1198 Ga0501048_0026632 3300049582 Bacteria 4209
1199 Ga0501048_0032255 3300049582 Bacteria 3786
1200 Ga0501048_0106806 3300049582 Bacteria 1976
1201 Ga0501067_0033450 3300049583 Bacteria 2852
1202 Ga0501068_0001809 3300049584 Bacteria 11364
1203 Ga0501069_0011896 3300049585 Bacteria 4616
1204 Ga0501070_0018049 3300049586 Bacteria 5921
1205 Ga0501070_0065536 3300049586 Bacteria 3007
1206 Ga0501070_0200056 3300049586 Bacteria 1641
1207 Ga0501071_0198807 3300049587 Bacteria 1505
1208 Ga0501072_0003019 3300049588 Bacteria 12694
1209 Ga0501072_0084843 3300049588 Bacteria 2512
1210 Ga0501072_0198084 3300049588 Bacteria 1601
1211 Ga0501073_0001367 3300049589 Bacteria 18010
1212 Ga0501073_0167321 3300049589 Bacteria 1522
1213 Ga0501073_0743464 3300049589 Bacteria 676
1214 Ga0501074_0010960 3300049590 Bacteria 6581
1215 Ga0501075_0116492 3300049591 Bacteria 2031
1216 Ga0501075_0211629 3300049591 Bacteria 1479
1217 Ga0501075_0611791 3300049591 Bacteria 831
1218 Ga0501075_0832920 3300049591 Unclassified 702
1219 Ga0501076_0035470 3300049592 Bacteria 3902
1220 Ga0501076_0044751 3300049592 Bacteria 3492
1221 Ga0501076_0120849 3300049592 Bacteria 2121
1222 Ga0501076_0853483 3300049592 Bacteria 751
1223 Ga0501077_0018748 3300049593 Bacteria 4377
1224 Ga0501077_0087085 3300049593 Bacteria 1980
1225 Ga0501202_032463 3300049652 Bacteria 1096
1226 Ga0501217_150745 3300049661 Bacteria 695
1227 Ga0501233_075282 3300049668 Bacteria 861
1228 Ga0501243_059450 3300049675 Bacteria 706
1229 Ga0501249_014980 3300049679 Bacteria 1656
1230 Ga0501249_034932 3300049679 Bacteria 1129
1231 Ga0501249_063792 3300049679 Bacteria 855
1232 Ga0501079_0009365 3300049741 Bacteria 7421
1233 Ga0501079_0047546 3300049741 Bacteria 3310
1234 Ga0501079_0049621 3300049741 Bacteria 3239
1235 Ga0501080_0000243 3300049742 Bacteria 40903
1236 Ga0501080_0141503 3300049742 Bacteria 2224
1237 Ga0501080_0210814 3300049742 Bacteria 1780
1238 Ga0501081_0053824 3300049743 Bacteria 2779
1239 Ga0501081_0060120 3300049743 Bacteria 2632
1240 Ga0501081_0185443 3300049743 Bacteria 1506
1241 Ga0501081_0224102 3300049743 Bacteria 1368
1242 Ga0501081_0283204 3300049743 Bacteria 1214
1243 Ga0501081_0416991 3300049743 Bacteria 995
1244 Ga0501083_0004506 3300049744 Bacteria 9839
1245 Ga0501083_0217186 3300049744 Bacteria 1246
1246 Ga0501283_022383 3300049779 Bacteria 1019
1247 Ga0501035_0081046 3300049822 Bacteria 2864
1248 Ga0501035_0242560 3300049822 Unclassified 1532
1249 Ga0501035_0658421 3300049822 Bacteria 848
1250 Ga0501044_0001257 3300049823 Bacteria 29993
1251 Ga0501044_0014994 3300049823 Bacteria 8355
1252 Ga0501044_0033042 3300049823 Bacteria 5436
1253 Ga0501044_0085577 3300049823 Bacteria 3185
1254 Ga0501045_0039403 3300049824 Bacteria 3438
1255 Ga0501045_0053881 3300049824 Bacteria 2940
1256 Ga0501045_0706923 3300049824 Bacteria 743
1257 Ga0501045_0781592 3300049824 Unclassified 703
1258 nmdc:mga00v17_675120_c1 3300050491 Unclassified 663
1259 nmdc:mga06z11_262520_c1 3300050494 Bacteria 1019
1260 nmdc:mga05p37_1080949_c1 3300050507 Bacteria 842
1261 nmdc:mga05p37_171260_c1 3300050507 Bacteria 2647
1262 nmdc:mga05p37_177921_c1 3300050507 Bacteria 2590
1263 nmdc:mga05p37_2419_c1 3300050507 Bacteria 21703
1264 nmdc:mga05p37_437550_c1 3300050507 Unclassified 1518
1265 nmdc:mga05p37_437754_c1 3300050507 Bacteria 1517
1266 nmdc:mga05p37_44782_c1 3300050507 Bacteria 5443
1267 nmdc:mga05p37_483596_c1 3300050507 Bacteria 1425
1268 nmdc:mga05p37_84148_c1 3300050507 Bacteria 3919
1269 nmdc:mga09592_177681_c1 3300050508 Bacteria 1841
1270 nmdc:mga09592_19125_c1 3300050508 Bacteria 5621
1271 nmdc:mga09592_27132_c1 3300050508 Bacteria 4751
1272 nmdc:mga09592_35835_c1 3300050508 Bacteria 4155
1273 nmdc:mga09592_50982_c1 3300050508 Bacteria 3491
1274 nmdc:mga09592_74264_c1 3300050508 Bacteria 2890
1275 nmdc:mga0qj67_102877_c1 3300050509 Bacteria 2303
1276 nmdc:mga0qj67_134553_c1 3300050509 Bacteria 2003
1277 nmdc:mga0qj67_17604_c1 3300050509 Bacteria 5435
1278 nmdc:mga0qj67_216745_c1 3300050509 Bacteria 1554
1279 nmdc:mga0qj67_444188_c1 3300050509 Bacteria 1045
1280 nmdc:mga0qj67_59487_c1 3300050509 Bacteria 3030
1281 nmdc:mga0qj67_60595_c1 3300050509 Bacteria 3004
1282 nmdc:mga06r32_263078_c1 3300050510 Unclassified 1713
1283 nmdc:mga06r32_336659_c1 3300050510 Bacteria 1494
1284 nmdc:mga06r32_55695_c1 3300050510 Bacteria 3794
1285 nmdc:mga06r32_7152_c1 3300050510 Bacteria 10057
1286 nmdc:mga06r32_752330_c1 3300050510 Bacteria 938
1287 nmdc:mga06r32_77979_c1 3300050510 Bacteria 3219
1288 nmdc:mga06r32_7934_c1 3300050510 Bacteria 9542
1289 nmdc:mga08y16_142240_c1 3300050511 Bacteria 2494
1290 nmdc:mga08y16_156827_c1 3300050511 Bacteria 2365
1291 nmdc:mga08y16_16007_c1 3300050511 Bacteria 7883
1292 nmdc:mga08y16_227274_c1 3300050511 Bacteria 1931
1293 nmdc:mga08y16_23988_c1 3300050511 Bacteria 6443
1294 nmdc:mga08y16_28438_c1 3300050511 Bacteria 5894
1295 nmdc:mga08y16_444180_c1 3300050511 Bacteria 1323
1296 nmdc:mga08y16_52853_c1 3300050511 Bacteria 4249
1297 nmdc:mga08y16_667382_c1 3300050511 Bacteria 1042
1298 nmdc:mga08y16_743_c1 3300050511 Bacteria 31040
1299 nmdc:mga0n895_12115_c1 3300050512 Bacteria 7717
1300 nmdc:mga0n895_18663_c1 3300050512 Bacteria 6424
1301 nmdc:mga0n895_19455_c1 3300050512 Bacteria 6312
1302 nmdc:mga0n895_239890_c1 3300050512 Bacteria 1839
1303 nmdc:mga0n895_31629_c1 3300050512 Bacteria 5069
1304 nmdc:mga0n895_4506_c2 3300050512 Bacteria 10814
1305 nmdc:mga0n895_90797_c1 3300050512 Bacteria 3057
1306 nmdc:mga0rr50_148320_c1 3300050513 Bacteria 1893
1307 nmdc:mga0rr50_155539_c1 3300050513 Bacteria 1852
1308 nmdc:mga0rr50_6700_c1 3300050513 Bacteria 7047
1309 nmdc:mga0rr50_7227_c1 3300050513 Bacteria 6829
1310 nmdc:mga08x19_128473_c1 3300050514 Bacteria 1703
1311 nmdc:mga08x19_394968_c1 3300050514 Bacteria 969
1312 nmdc:mga0a205_17414_c1 3300050515 Bacteria 6736
1313 nmdc:mga0a205_2187_c1 3300050515 Bacteria 17201
1314 nmdc:mga0a205_224344_c1 3300050515 Bacteria 1764
1315 nmdc:mga0a205_29117_c1 3300050515 Bacteria 5285
1316 nmdc:mga0a205_2928_c1 3300050515 Bacteria 15120
1317 nmdc:mga0a205_49577_c1 3300050515 Bacteria 4054
1318 nmdc:mga0a205_5356_c1 3300050515 Bacteria 11561
1319 nmdc:mga0a205_79452_c1 3300050515 Bacteria 3170
1320 Ga0495619_0191817 3300053085 Bacteria 1414
1321 Ga0500645_000386 3300053730 Bacteria 30983
1322 Ga0501084_0000227 3300054114 Bacteria 42697
1323 Ga0501084_0081371 3300054114 Bacteria 2716
1324 Ga0501084_0098210 3300054114 Bacteria 2459
1325 Ga0501084_0114826 3300054114 Bacteria 2264
1326 Ga0501084_0155670 3300054114 Bacteria 1927
1327 Ga0501084_0174185 3300054114 Bacteria 1816
1328 Ga0590071_000168 3300059421 Bacteria 18744
1329 Ga0590071_029512 3300059421 Bacteria 1304
1330 Ga0590074_001533 3300059423 Bacteria 3743
1331 Ga0590075_000104 3300059424 Bacteria 21627
1332 Ga0590075_005298 3300059424 Bacteria 3047
1333 Ga0590077_000085 3300059426 Bacteria 23923
1334 Ga0590077_028077 3300059426 Bacteria 1221
1335 Ga0501082_0000199 3300060353 Bacteria 52195
1336 Ga0501082_0004396 3300060353 Bacteria 12305
1337 Ga0501082_0131626 3300060353 Bacteria 2170
1338 Ga0501082_0457589 3300060353 Unclassified 1115
1339 Ga0530510_0009133 3300061734 Bacteria 6947
1340 Ga0530510_0285840 3300061734 Archaea 1233
1341 JGI25406J46586_10000210
1342 SwRhRL2b_contig_3236978
1343 SwRhRL2b_contig_3825395
1344 JGI25406J46586_10001441
1345 Ga0065714_10125624
1346 Ga0065704_10075134
1347 Ga0065712_10018271
1348 Ga0065712_10321009
1349 Ga0065715_10172499
1350 Ga0065715_10262856
1351 Ga0065715_10443124
1352 Ga0065715_10505586
1353 Ga0065707_10001927
1354 Ga0065707_10084472
1355 Ga0065707_10157109
1356 Ga0065707_10381309
1357 Ga0070658_10009861
1358 Ga0070658_10522636
1359 Ga0070676_10006282
1360 Ga0070683_100005237
1361 Ga0070683_100020370
1362 Ga0070683_100084842
1363 Ga0070683_100143466
1364 Ga0070683_100221656
1365 Ga0070683_100660156
1366 Ga0070683_100904347
1367 Ga0070690_100249108
1368 Ga0070670_100004900
1369 Ga0070670_100030192
1370 Ga0070670_100030977
1371 Ga0070670_100087327
1372 Ga0070670_100157927
1373 Ga0070670_100418815
1374 Ga0070670_100593520
1375 Ga0070670_100924952
1376 Ga0070677_10001462
1377 Ga0070677_10039601
1378 Ga0070677_10076161
1379 Ga0070677_10078642
1380 Ga0070677_10164098
1381 Ga0068869_100042368
1382 Ga0068869_100066274
1383 Ga0068869_100082871
1384 Ga0068869_100153391
1385 Ga0070666_10016581
1386 Ga0070666_10024914
1387 Ga0070666_10055207
1388 Ga0070680_100058199
1389 Ga0070680_100376931
1390 Ga0070680_100433345
1391 Ga0070680_101083871
1392 Ga0068868_100011009
1393 Ga0068868_100062155
1394 Ga0068868_100169117
1395 Ga0068868_100488350
1396 Ga0070660_100007244
1397 Ga0070660_100203357
1398 Ga0070660_100363369
1399 Ga0070689_100005732
1400 Ga0070689_100065829
1401 Ga0070689_100103680
1402 Ga0070689_100373115
1403 Ga0070689_100683925
1404 Ga0070691_10022558
1405 Ga0070687_100236648
1406 Ga0070668_100026632
1407 Ga0070669_100008311
1408 Ga0070669_100116793
1409 Ga0070669_100118006
1410 Ga0070669_100156307
1411 Ga0070669_100175803
1412 Ga0070669_100209938
1413 Ga0070669_100842915
1414 Ga0070675_100000116
1415 Ga0070675_100001421
1416 Ga0070675_100004051
1417 Ga0070675_100010384
1418 Ga0070675_100030804
1419 Ga0070675_100031527
1420 Ga0070675_100610400
1421 Ga0070671_100036440
1422 Ga0070671_100081927
1423 Ga0070671_100117122
1424 Ga0070674_100000382
1425 Ga0070674_100008990
1426 Ga0070674_100013039
1427 Ga0070674_100461468
1428 Ga0070674_100639929
1429 Ga0070674_100651728
1430 Ga0070673_100008003
1431 Ga0070673_100046554
1432 Ga0070673_100060396
1433 Ga0070673_100097279
1434 Ga0070673_100118062
1435 Ga0070673_100128742
1436 Ga0070673_100273180
1437 Ga0070673_100782076
1438 Ga0070688_100006025
1439 Ga0070688_100161187
1440 Ga0070688_100187499
1441 Ga0070659_100126655
1442 Ga0070659_100723373
1443 Ga0070659_101276334
1444 Ga0070667_100013784
1445 Ga0070667_100150934
1446 Ga0070703_10041178
1447 Ga0070709_10013766
1448 Ga0070709_10801774
1449 Ga0070714_100035658
1450 Ga0070714_100154566
1451 Ga0070714_100342232
1452 Ga0070713_100002523
1453 Ga0070713_100011179
1454 Ga0070713_100015164
1455 Ga0070713_100294210
1456 Ga0070701_10070914
1457 Ga0070711_100343129
1458 Ga0070705_100000746
1459 Ga0070705_100281217
1460 Ga0070700_100016825
1461 Ga0070700_100016870
1462 Ga0070694_100000370
1463 Ga0070694_100071340
1464 Ga0070694_100138356
1465 Ga0070694_100427146
1466 Ga0070708_100702172
1467 Ga0070663_100028751
1468 Ga0070663_100312321
1469 Ga0070678_100007020
1470 Ga0070678_100048413
1471 Ga0070678_100064945
1472 Ga0070678_100102194
1473 Ga0070678_100139745
1474 Ga0070678_100717131
1475 Ga0070678_101243119
1476 Ga0070662_100012691
1477 Ga0070662_100055147
1478 Ga0070662_100252293
1479 Ga0070681_10022213
1480 Ga0070681_10109201
1481 Ga0070681_10134031
1482 Ga0070681_10166064
1483 Ga0070681_10262776
1484 Ga0070681_10304575
1485 Ga0068867_100008687
1486 Ga0068867_100009631
1487 Ga0068867_100026117
1488 Ga0068867_100132380
1489 Ga0068867_100450981
1490 Ga0068867_100565344
1491 Ga0070685_10014872
1492 Ga0070685_10112749
1493 Ga0070685_10543851
1494 Ga0070707_100149785
1495 Ga0070707_101010398
1496 Ga0070698_100170431
1497 Ga0070698_100804955
1498 Ga0070699_100006431
1499 Ga0070699_100012616
1500 Ga0070699_100018067
1501 Ga0070699_100018848
1502 Ga0070699_100069549
1503 Ga0070679_100000635
1504 Ga0070679_100029497
1505 Ga0070679_100109888
1506 Ga0070679_100129230
1507 Ga0070684_100000654
1508 Ga0070684_100072416
1509 Ga0070684_100150442
1510 Ga0070684_100152941
1511 Ga0070684_100250259
1512 Ga0070684_100279931
1513 Ga0070684_100313461
1514 Ga0070697_100014204
1515 Ga0070697_100156129
1516 Ga0068853_100018364
1517 Ga0068853_100088667
1518 Ga0068853_100180149
1519 Ga0068853_100295941
1520 Ga0068853_100460320
1521 Ga0068853_100623125
1522 Ga0070672_100008378
1523 Ga0070672_100134809
1524 Ga0070672_100145010
1525 Ga0070672_100154689
1526 Ga0070672_100279497
1527 Ga0070672_100371158
1528 Ga0070672_101107578
1529 Ga0070686_100204013
1530 Ga0070686_100209399
1531 Ga0070686_100238683
1532 Ga0070695_100000707
1533 Ga0070696_100000965
1534 Ga0070696_100001772
1535 Ga0070693_100052188
1536 Ga0070693_100225284
1537 Ga0070665_100024814
1538 Ga0070665_100078224
1539 Ga0070665_100084437
1540 Ga0070665_100098208
1541 Ga0070665_100102784
1542 Ga0070665_100170827
1543 Ga0070665_101061086
1544 Ga0070704_100041318
1545 Ga0070704_100085381
1546 Ga0070704_100171290
1547 Ga0068855_100003676
1548 Ga0068855_100005921
1549 Ga0068855_100017587
1550 Ga0068855_100039960
1551 Ga0068855_100041567
1552 Ga0068855_100042276
1553 Ga0068855_100080897
1554 Ga0068855_100159886
1555 Ga0068855_100234432
1556 Ga0068855_100237672
1557 Ga0070664_100007187
1558 Ga0070664_100017828
1559 Ga0070664_100117700
1560 Ga0070664_100119171
1561 Ga0070664_100707240
1562 Ga0070664_101048227
1563 Ga0068857_100000367
1564 Ga0068857_100009431
1565 Ga0068857_100027469
1566 Ga0068857_100033257
1567 Ga0068857_100120196
1568 Ga0068857_100175980
1569 Ga0068857_100314205
1570 Ga0068857_100388523
1571 Ga0068857_100486453
1572 Ga0068854_100135573
1573 Ga0068854_100168051
1574 Ga0068854_100863546
1575 Ga0068856_100011813
1576 Ga0068856_100044788
1577 Ga0068856_100097316
1578 Ga0068856_100146605
1579 Ga0068856_100969365
1580 Ga0068856_100988726
1581 Ga0070702_100010489
1582 Ga0070702_100461343
1583 Ga0068852_100044205
1584 Ga0068852_100097280
1585 Ga0068852_100145279
1586 Ga0068852_101022385
1587 Ga0068859_100017287
1588 Ga0068859_100038291
1589 Ga0068859_100057516
1590 Ga0068859_100419971
1591 Ga0068859_100476169
1592 Ga0068859_100863079
1593 Ga0068864_100045866
1594 Ga0068864_100054532
1595 Ga0068864_100172999
1596 Ga0068864_100197203
1597 Ga0068864_100216991
1598 Ga0068864_100232359
1599 Ga0068864_100299541
1600 Ga0068864_100517583
1601 Ga0068866_10418329
1602 Ga0068861_100024564
1603 Ga0068861_100116117
1604 Ga0068861_100168397
1605 Ga0068861_100319788
1606 Ga0068861_100446064
1607 Ga0068851_10020670
1608 Ga0068851_10142813
1609 Ga0068851_10151590
1610 Ga0068851_10189334
1611 Ga0068870_10001437
1612 Ga0068870_10007144
1613 Ga0068863_100309952
1614 Ga0068863_100643844
1615 Ga0068863_101512294
1616 Ga0068858_100054923
1617 Ga0068858_100057133
1618 Ga0068858_100060055
1619 Ga0068858_100073787
1620 Ga0068858_100130329
1621 Ga0068858_100194195
1622 Ga0068858_100220378
1623 Ga0068858_101369465
1624 Ga0068860_100008416
1625 Ga0068860_100030930
1626 Ga0068860_100064152
1627 Ga0068862_100001194
1628 Ga0068862_100092822
1629 Ga0068862_100195317
1630 Ga0068862_100301161
1631 Ga0068862_101082649
1632 Ga0081455_10025992
1633 Ga0081538_10112503
1634 Ga0081539_10000093
1635 Ga0081539_10000535
1636 Ga0081539_10004525
1637 Ga0081539_10032394
1638 Ga0070717_10002297
1639 Ga0070717_10059120
1640 Ga0070717_10379742
1641 Ga0070717_10652868
1642 Ga0075364_10396187
1643 Ga0097621_100008977
1644 Ga0097621_100057379
1645 Ga0097621_100087349
1646 Ga0097621_100090626
1647 Ga0097621_100198007
1648 Ga0097621_100222910
1649 Ga0097621_100587832
1650 Ga0097621_100714379
1651 Ga0068871_100013047
1652 Ga0068871_100032955
1653 Ga0068871_100086558
1654 Ga0068871_100096532
1655 Ga0068871_100096698
1656 Ga0068871_100099782
1657 Ga0068871_100252561
1658 Ga0068871_100318934
1659 Ga0068871_100518294
1660 Ga0075428_100001298
1661 Ga0075428_100018128
1662 Ga0075428_100039791
1663 Ga0075428_100066193
1664 Ga0075428_101038833
1665 Ga0075430_100079986
1666 Ga0075430_100099521
1667 Ga0075430_100131196
1668 Ga0075430_100245136
1669 Ga0075430_100268739
1670 Ga0075431_100016348
1671 Ga0075431_100017673
1672 Ga0075431_100026579
1673 Ga0075431_100077735
1674 Ga0075431_100081081
1675 Ga0075431_100152881
1676 Ga0075433_10001626
1677 Ga0075433_10003294
1678 Ga0075433_10004362
1679 Ga0075433_10062970
1680 Ga0075433_10195765
1681 Ga0075433_10613162
1682 Ga0075433_10686973
1683 Ga0075434_100007857
1684 Ga0075434_100009480
1685 Ga0075434_100037878
1686 Ga0075434_100074269
1687 Ga0075434_100335194
1688 Ga0075429_100058130
1689 Ga0075429_100077576
1690 Ga0075429_100140751
1691 Ga0075429_100195061
1692 Ga0075429_100313515
1693 Ga0075429_100361761
1694 Ga0068865_100036885
1695 Ga0068865_100044873
1696 Ga0075436_100004678
1697 Ga0097620_100017287
1698 Ga0097620_100038292
1699 Ga0097620_100057515
1700 Ga0097620_100419969
1701 Ga0097620_100476190
1702 Ga0097620_100863073
1703 Ga0075435_100005103
1704 Ga0075435_100033031
1705 Ga0075435_100057482
1706 Ga0075435_100396863
1707 Ga0075435_100421943
1708 Ga0105240_10000137
1709 Ga0105240_10000725
1710 Ga0105240_10006267
1711 Ga0105240_10008603
1712 Ga0105240_10014192
1713 Ga0105240_10049742
1714 Ga0105240_10561268
1715 Ga0105240_10575124
1716 Ga0105240_10821146
1717 Ga0105240_10973917
1718 Ga0105240_11515547
1719 Ga0105240_11596924
1720 Ga0105240_11686691
1721 Ga0111539_10000937
1722 Ga0111539_10012890
1723 Ga0111539_10018172
1724 Ga0111539_10025633
1725 Ga0111539_10057520
1726 Ga0111539_10165833
1727 Ga0111539_10184728
1728 Ga0111539_11505010
1729 Ga0105245_10002584
1730 Ga0105245_10031219
1731 Ga0105245_10092800
1732 Ga0105245_10122005
1733 Ga0105245_10143630
1734 Ga0105245_10192564
1735 Ga0105245_10441173
1736 Ga0105245_10481719
1737 Ga0105245_10723661
1738 Ga0105247_10036932
1739 Ga0105247_10081730
1740 Ga0105247_10381386
1741 Ga0114129_10000428
1742 Ga0114129_10012760
1743 Ga0114129_10013768
1744 Ga0114129_10016831
1745 Ga0114129_10017625
1746 Ga0114129_10060488
1747 Ga0114129_10082295
1748 Ga0114129_10178069
1749 Ga0114129_10207936
1750 Ga0114129_10426391
1751 Ga0114129_10483657
1752 Ga0114129_10489668
1753 Ga0114129_10625396
1754 Ga0114129_11680760
1755 Ga0105243_10094326
1756 Ga0105243_10094586
1757 Ga0105241_10011127
1758 Ga0105241_10052017
1759 Ga0105241_10081489
1760 Ga0105241_10098267
1761 Ga0105241_10142579
1762 Ga0105241_10326669
1763 Ga0105241_10347029
1764 Ga0105241_10398817
1765 Ga0105242_10008301
1766 Ga0105242_10037404
1767 Ga0105242_10055620
1768 Ga0105242_10057510
1769 Ga0105242_10074164
1770 Ga0105242_10351275
1771 Ga0105242_10388503
1772 Ga0105242_10669786
1773 Ga0105242_10709865
1774 Ga0105242_11368909
1775 Ga0105242_11515327
1776 Ga0105248_10015334
1777 Ga0105248_10021914
1778 Ga0105248_10038535
1779 Ga0105248_10051528
1780 Ga0105248_10058795
1781 Ga0105248_10135318
1782 Ga0105248_10169783
1783 Ga0105248_10247604
1784 Ga0105248_11615924
1785 Ga0105248_12121924
1786 Ga0105237_10011284
1787 Ga0105237_10015643
1788 Ga0105237_10022807
1789 Ga0105237_10047639
1790 Ga0105237_10076113
1791 Ga0105237_10135652
1792 Ga0105237_10163191
1793 Ga0105237_10296008
1794 Ga0105237_10485865
1795 Ga0105237_10895175
1796 Ga0105237_11266348
1797 Ga0105238_10003531
1798 Ga0105238_10027090
1799 Ga0105238_10038115
1800 Ga0105238_10039789
1801 Ga0105238_10047108
1802 Ga0105238_10087883
1803 Ga0105238_10091744
1804 Ga0105238_10094723
1805 Ga0105238_10115494
1806 Ga0105238_10194410
1807 Ga0105238_10243629
1808 Ga0105238_10348781
1809 Ga0105238_10364361
1810 Ga0105238_10475469
1811 Ga0105238_10501488
1812 Ga0105238_11070304
1813 Ga0105249_10001435
1814 Ga0105249_10025302
1815 Ga0105249_10166133
1816 Ga0105249_10264232
1817 Ga0105239_10005509
1818 Ga0105239_10009505
1819 Ga0105239_10019116
1820 Ga0105239_10020840
1821 Ga0105239_10061846
1822 Ga0105239_10101145
1823 Ga0105239_12377717
1824 Ga0105246_10053857
1825 Ga0105246_10148180
1826 Ga0105246_10942538
1827 Ga0105246_10956565
1828 Ga0157373_10091811
1829 Ga0157373_10354183
1830 Ga0157373_10519418
1831 Ga0157371_10361351
1832 Ga0157370_10004065
1833 Ga0157370_10023653
1834 Ga0157370_10056344
1835 Ga0157370_10086143
1836 Ga0157370_10167543
1837 Ga0157370_10244403
1838 Ga0157370_10428937
1839 Ga0157370_10462589
1840 Ga0157369_10001658
1841 Ga0157369_10026955
1842 Ga0157369_10070995
1843 Ga0157369_10133353
1844 Ga0157369_10267773
1845 Ga0157374_10019090
1846 Ga0157374_10215332
1847 Ga0157374_10300801
1848 Ga0157374_10469155
1849 Ga0157374_10536445
1850 Ga0157374_10536464
1851 Ga0157378_10006769
1852 Ga0157378_10119552
1853 Ga0157378_10234682
1854 Ga0157378_10294620
1855 Ga0157378_11660936
1856 Ga0163162_10009244
1857 Ga0163162_10056855
1858 Ga0163162_10113990
1859 Ga0163162_10412334
1860 Ga0163162_10653733
1861 Ga0163162_10792842
1862 Ga0163162_11003167
1863 Ga0163162_11553556
1864 Ga0163162_11956867
1865 Ga0157372_10019405
1866 Ga0157372_10023620
1867 Ga0157372_10045493
1868 Ga0157372_10050147
1869 Ga0157372_10356181
1870 Ga0157372_10926295
1871 Ga0157372_10962289
1872 Ga0157372_11719590
1873 Ga0157375_10027796
1874 Ga0157375_10057570
1875 Ga0157375_10117140
1876 Ga0157375_10222753
1877 Ga0157375_10530500
1878 Ga0157375_11333136
1879 Ga0157375_11958864
1880 Ga0163163_10033602
1881 Ga0163163_10037531
1882 Ga0163163_10039812
1883 Ga0163163_10057030
1884 Ga0163163_10112756
1885 Ga0163163_10130349
1886 Ga0163163_10147461
1887 Ga0163163_10149270
1888 Ga0163163_10169333
1889 Ga0163163_10244900
1890 Ga0163163_10914752
1891 Ga0157380_10007797
1892 Ga0157380_10009711
1893 Ga0157380_10010846
1894 Ga0157380_10027142
1895 Ga0157380_10028962
1896 Ga0157380_10044968
1897 Ga0157380_10148475
1898 Ga0157380_10258555
1899 Ga0157380_10400869
1900 Ga0157380_11634156
1901 Ga0157377_10017096
1902 Ga0157377_10089282
1903 Ga0157377_10157863
1904 Ga0157377_10564782
1905 Ga0157377_10626905
1906 Ga0157379_10053964
1907 Ga0157379_10789500
1908 Ga0157379_11285073
1909 Ga0157376_10010690
1910 Ga0157376_10059844
1911 Ga0157376_10254235
1912 Ga0157376_10329167
1913 Ga0157376_11400287
1914 Ga0163161_10066300
1915 Ga0163161_10158763
1916 Ga0213873_10031808
1917 Ga0213874_10008846
1918 Ga0213876_10001214
1919 Ga0213876_10083920
1920 Ga0213875_10002769
1921 Ga0213875_10006476
1922 Ga0213875_10010188
1923 Ga0213875_10071064
1924 Ga0213875_10088214
1925 Ga0213875_10089555
1926 Ga0213875_10152047
1927 Ga0213871_10099049
1928 Ga0224712_10225900
1929 Ga0207697_10001282
1930 Ga0207656_10009659
1931 Ga0207656_10116763
1932 Ga0207656_10231557
1933 Ga0207682_10000378
1934 Ga0207682_10018854
1935 Ga0207682_10020419
1936 Ga0207682_10025631
1937 Ga0207688_10000628
1938 Ga0207688_10010226
1939 Ga0207688_10064495
1940 Ga0207680_10151867
1941 Ga0207680_10155269
1942 Ga0207699_10025855
1943 Ga0207699_10141254
1944 Ga0207699_10203931
1945 Ga0207699_10357970
1946 Ga0207645_10001911
1947 Ga0207645_10161032
1948 Ga0207645_10324054
1949 Ga0207643_10000925
1950 Ga0207643_10059446
1951 Ga0207643_10079229
1952 Ga0207643_10130402
1953 Ga0207643_10542749
1954 Ga0207705_10009074
1955 Ga0207705_10056458
1956 Ga0207684_10127932
1957 Ga0207654_10007778
1958 Ga0207654_10040135
1959 Ga0207654_10045861
1960 Ga0207654_10864630
1961 Ga0207707_10007135
1962 Ga0207707_10023281
1963 Ga0207707_10122403
1964 Ga0207707_10128104
1965 Ga0207707_10129369
1966 Ga0207707_10329341
1967 Ga0207707_10482139
1968 Ga0207707_10955132
1969 Ga0207695_10000770
1970 Ga0207695_10002883
1971 Ga0207695_10005525
1972 Ga0207695_10009314
1973 Ga0207695_10012024
1974 Ga0207695_10022417
1975 Ga0207695_10032450
1976 Ga0207695_10210757
1977 Ga0207695_10307166
1978 Ga0207695_10735222
1979 Ga0207671_10053083
1980 Ga0207671_10136381
1981 Ga0207671_10149982
1982 Ga0207671_10424851
1983 Ga0207663_10668246
1984 Ga0207660_10083025
1985 Ga0207660_10187192
1986 Ga0207660_10628553
1987 Ga0207660_11074692
1988 Ga0207662_10009608
1989 Ga0207662_10018372
1990 Ga0207662_10029781
1991 Ga0207657_10007163
1992 Ga0207657_10230904
1993 Ga0207657_10239693
1994 Ga0207649_10228255
1995 Ga0207652_10016163
1996 Ga0207652_10080761
1997 Ga0207652_10147679
1998 Ga0207681_10046098
1999 Ga0207681_10108455
2000 Ga0207681_10125365
2001 Ga0207681_10179122
2002 Ga0207681_10264114
2003 Ga0207681_10593950
2004 Ga0207694_10002138
2005 Ga0207694_10011929
2006 Ga0207694_10044456
2007 Ga0207694_10061145
2008 Ga0207694_10079285
2009 Ga0207694_10137183
2010 Ga0207694_10292997
2011 Ga0207694_10316567
2012 Ga0207694_10324519
2013 Ga0207650_10001613
2014 Ga0207650_10018995
2015 Ga0207650_10024950
2016 Ga0207650_10066823
2017 Ga0207650_10111038
2018 Ga0207650_10490652
2019 Ga0207659_10000064
2020 Ga0207659_10000228
2021 Ga0207659_10004292
2022 Ga0207659_10005992
2023 Ga0207659_10012850
2024 Ga0207659_10034223
2025 Ga0207659_10036318
2026 Ga0207659_10065120
2027 Ga0207659_10079734
2028 Ga0207659_10230452
2029 Ga0207659_10235648
2030 Ga0207659_10460799
2031 Ga0207659_10515366
2032 Ga0207687_10012877
2033 Ga0207687_10043361
2034 Ga0207687_10053985
2035 Ga0207687_10094021
2036 Ga0207687_10145721
2037 Ga0207687_10160729
2038 Ga0207687_10376574
2039 Ga0207700_10039457
2040 Ga0207700_10041486
2041 Ga0207700_10079503
2042 Ga0207664_10027284
2043 Ga0207664_10119110
2044 Ga0207644_10138078
2045 Ga0207644_10337395
2046 Ga0207644_10370971
2047 Ga0207644_10561460
2048 Ga0207644_10582099
2049 Ga0207690_10273408
2050 Ga0207690_10621099
2051 Ga0207706_10038266
2052 Ga0207706_10191644
2053 Ga0207706_10371621
2054 Ga0207686_10002152
2055 Ga0207686_10002620
2056 Ga0207686_10005323
2057 Ga0207686_10054128
2058 Ga0207686_10055571
2059 Ga0207686_10086326
2060 Ga0207686_10421072
2061 Ga0207686_10465737
2062 Ga0207709_10019269
2063 Ga0207709_10027336
2064 Ga0207709_10233308
2065 Ga0207670_10004170
2066 Ga0207670_10071424
2067 Ga0207670_10211326
2068 Ga0207670_10327409
2069 Ga0207670_10535541
2070 Ga0207669_10000517
2071 Ga0207669_10004725
2072 Ga0207669_10098920
2073 Ga0207669_10424911
2074 Ga0207669_10478367
2075 Ga0207669_10601611
2076 Ga0207704_10004043
2077 Ga0207704_10006783
2078 Ga0207704_10067906
2079 Ga0207704_10195005
2080 Ga0207665_10358373
2081 Ga0207665_10548819
2082 Ga0207691_10005381
2083 Ga0207691_10023122
2084 Ga0207691_10025557
2085 Ga0207691_10043378
2086 Ga0207691_10167524
2087 Ga0207691_10250137
2088 Ga0207691_10263906
2089 Ga0207691_10326462
2090 Ga0207711_10057026
2091 Ga0207711_10058775
2092 Ga0207711_10062940
2093 Ga0207711_10177044
2094 Ga0207711_10330763
2095 Ga0207711_10488516
2096 Ga0207689_10005493
2097 Ga0207689_10014043
2098 Ga0207689_10066220
2099 Ga0207689_10073568
2100 Ga0207689_10182689
2101 Ga0207689_10201284
2102 Ga0207689_10212500
2103 Ga0207689_10441410
2104 Ga0207661_10008190
2105 Ga0207661_10020313
2106 Ga0207661_10034465
2107 Ga0207661_10116924
2108 Ga0207661_10171746
2109 Ga0207661_10234084
2110 Ga0207661_10273605
2111 Ga0207661_10992637
2112 Ga0207679_10030495
2113 Ga0207679_10056076
2114 Ga0207679_10208072
2115 Ga0207667_10001168
2116 Ga0207667_10002566
2117 Ga0207667_10008741
2118 Ga0207667_10042580
2119 Ga0207667_10083019
2120 Ga0207667_10444800
2121 Ga0207667_10591880
2122 Ga0207651_10002909
2123 Ga0207651_10038468
2124 Ga0207651_10134430
2125 Ga0207651_10230893
2126 Ga0207651_10247509
2127 Ga0207651_10256499
2128 Ga0207651_10375388
2129 Ga0207712_10020945
2130 Ga0207712_10029296
2131 Ga0207712_10239193
2132 Ga0207712_10616317
2133 Ga0207668_10026763
2134 Ga0207640_10349165
2135 Ga0207640_10510639
2136 Ga0207658_10023883
2137 Ga0207658_10068874
2138 Ga0207658_10124428
2139 Ga0207677_10095049
2140 Ga0207677_10368856
2141 Ga0207677_10439843
2142 Ga0207703_10009334
2143 Ga0207703_10009949
2144 Ga0207703_10049412
2145 Ga0207703_10162311
2146 Ga0207703_10184905
2147 Ga0207703_10689738
2148 Ga0207639_10073035
2149 Ga0207639_10204673
2150 Ga0207639_10257951
2151 Ga0207639_10605982
2152 Ga0207639_10951875
2153 Ga0207678_10303308
2154 Ga0207708_10026932
2155 Ga0207708_10043189
2156 Ga0207708_10065842
2157 Ga0207708_10153111
2158 Ga0207702_10015048
2159 Ga0207702_10055899
2160 Ga0207702_10066986
2161 Ga0207702_10444450
2162 Ga0207702_10680981
2163 Ga0207641_10467193
2164 Ga0207648_10000163
2165 Ga0207648_10005974
2166 Ga0207648_10010408
2167 Ga0207648_10013761
2168 Ga0207648_10066022
2169 Ga0207648_10110545
2170 Ga0207648_10120681
2171 Ga0207648_10278070
2172 Ga0207648_10493976
2173 Ga0207648_10495649
2174 Ga0207648_10684417
2175 Ga0207648_10772281
2176 Ga0207648_10839716
2177 Ga0207676_10066179
2178 Ga0207676_10112821
2179 Ga0207676_10182371
2180 Ga0207676_10205587
2181 Ga0207676_10254592
2182 Ga0207676_10383972
2183 Ga0207676_10409678
2184 Ga0207676_10882436
2185 Ga0207674_10000166
2186 Ga0207674_10030026
2187 Ga0207674_10035376
2188 Ga0207674_10065120
2189 Ga0207674_10158407
2190 Ga0207674_10346522
2191 Ga0207674_10521358
2192 Ga0207674_10618213
2193 Ga0207674_10709974
2194 Ga0207675_100007871
2195 Ga0207675_100157346
2196 Ga0207675_100177235
2197 Ga0207675_100207046
2198 Ga0207683_10018406
2199 Ga0207683_10046567
2200 Ga0207683_10067010
2201 Ga0207683_10078532
2202 Ga0207683_10106347
2203 Ga0207683_10108233
2204 Ga0207683_10295213
2205 Ga0207683_10545968
2206 Ga0207698_10044678
2207 Ga0207698_10185000
2208 Ga0207698_10217328
2209 Ga0207698_11058134
2210 Ga0207698_11107193
2211 Ga0207698_11681131
2212 Ga0209974_10027219
2213 Ga0209974_10047241
2214 Ga0207428_10001370
2215 Ga0207428_10001377
2216 Ga0207428_10003130
2217 Ga0207428_10072291
2218 Ga0207428_10188549
2219 Ga0268266_10061402
2220 Ga0268266_10070582
2221 Ga0268266_10306151
2222 Ga0268266_10372573
2223 Ga0268266_11063237
2224 Ga0268265_10023143
2225 Ga0268265_10089292
2226 Ga0268265_10231499
2227 Ga0268265_10295874
2228 Ga0268265_10557409
2229 Ga0268265_11113616
2230 Ga0268264_10003737
2231 Ga0268264_10009037
2232 Ga0268264_10243591
2233 Ga0268264_10420460
2234 Ga0268264_10483648
2235 Ga0265323_10001994
2236 Ga0265338_10137740
2237 Ga0265760_10219868
2238 Ga0265320_10001179
2239 Ga0265325_10003125
2240 Ga0265325_10012734
2241 Ga0265340_10022045
2242 Ga0265331_10069063
2243 Ga0265316_10001444
2244 Ga0265316_10004197
2245 Ga0265316_10118693
2246 Ga0265316_10245706
2247 Ga0265316_10444213
2248 Ga0307408_100007941
2249 Ga0307408_100016620
2250 Ga0265313_10027055
2251 Ga0265314_10000282
2252 Ga0265314_10000961
2253 Ga0265314_10025644
2254 Ga0265314_10089002
2255 Ga0265342_10049765
2256 Ga0307405_10013982
2257 Ga0307405_10336380
2258 Ga0307413_10366244
2259 Ga0307410_10141551
2260 Ga0307406_10233116
2261 Ga0307406_10455426
2262 Ga0307407_10146428
2263 Ga0307412_10177391
2264 Ga0307412_10352083
2265 Ga0307412_10406641
2266 Ga0307412_10562196
2267 Ga0307409_100024156
2268 Ga0307409_100033309
2269 Ga0307409_100387479
2270 Ga0307409_100412144
2271 Ga0307409_100965143
2272 Ga0307416_100009691
2273 Ga0307416_100034952
2274 Ga0307416_100198348
2275 Ga0307416_100258351
2276 Ga0307416_100367049
2277 Ga0307416_100765140
2278 Ga0307416_101171400
2279 Ga0307416_101678148
2280 Ga0307414_10367557
2281 Ga0307414_10669985
2282 Ga0307414_11061783
2283 Ga0307411_10005955
2284 Ga0307411_10016736
2285 Ga0307411_10168931
2286 Ga0307411_10287175
2287 Ga0307411_10306516
2288 Ga0307411_10843652
2289 Ga0307415_100511887
2290 Ga0307415_100801156
2291 Ga0373950_0029730
2292 Ga0373938_0035448
2293 Ga0373926_0066528
2294 Ga0373934_0001945
2295 Ga0373934_0137732
2296 Ga0373940_0005259
2297 Ga0373949_0035044
2298 Ga0373923_0274862
2299 Ga0373923_0360644
2300 Ga0373932_0053834
2301 Ga0373939_0010404
2302 Ga0373953_0135848
2303 Ga0373954_0001726
2304 Ga0373954_0004906
2305 Ga0373956_0020307
2306 Ga0373956_0075491
2307 Ga0373957_0012652
2308 Ga0373960_0012930
2309 Ga0373960_0115612
2310 Ga0373960_0207769
2311 Ga0373943_0316264
2312 Ga0373946_0038006
2313 Ga0373955_0056036
2314 Ga0373955_0133431
2315 Ga0373955_0217186
2316 Ga0373955_0235734
2317 Ga0373961_0083350
2318 Ga0373924_0240676
2319 Ga0373931_0078914
2320 Ga0373935_0044795
2321 Ga0373935_0116314
2322 Ga0373927_0000498
2323 Ga0373927_0002081
2324 Ga0373927_0007350
2325 Ga0373927_0042674
2326 Ga0373933_0128788
2327 Ga0373933_0183833
2328 Ga0373947_0001083
2329 Ga0373947_0013876
2330 Ga0373947_0021389
2331 Ga0373937_0017647
2332 Ga0373937_0061324
2333 Ga0373937_0084305
2334 Ga0373937_0089365
2335 Ga0373937_0323934
2336 Ga0373937_0387906
2337 Ga0373937_0418446
2338 Ga0373937_0459359
2339 Ga0373937_0747975
2340 Ga0373925_0000281
2341 Ga0373925_0036609
2342 Ga0373925_0119629
2343 Ga0373925_0160195
2344 Ga0373925_0231751
2345 Ga0373925_0248232
2346 Ga0373925_0266953
2347 Ga0373925_0626934
2348 Ga0436364_0062454
2349 Ga0436364_0298586
2350 Ga0436364_0349717
2351 Ga0436364_0365940
2352 Ga0436364_0509131
2353 Ga0436364_0555496
2354 Ga0436364_0618208
2355 Ga0436364_0633516
2356 Ga0436364_0674901
2357 Ga0436364_0818237
2358 Ga0436364_0835808
2359 Ga0436364_0991276
2360 Ga0436364_1046318
2361 Ga0436364_1080095
2362 Ga0436364_1193035
2363 Ga0436364_1295092
2364 Ga0395901_0142089
2365 Ga0436365_0082371
2366 Ga0436365_0344744
2367 Ga0436365_0512169
2368 Ga0436365_0650674
2369 Ga0436365_1778817
2370 Ga0436360_0580543
2371 Ga0436360_0677337
2372 Ga0436360_0882145
2373 Ga0436361_0793152
2374 Ga0436361_1149713
2375 Ga0436363_0651938
2376 Ga0436363_0673922
2377 Ga0436363_0858902
2378 Ga0436363_1297791
2379 Ga0436363_1382872
2380 Ga0436363_1694135
2381 Ga0436362_0155526
2382 Ga0436362_0701537
2383 Ga0436362_0890342
2384 Ga0451843_0968640
2385 Ga0451853_1530684
2386 Ga0439441_072265
2387 Ga0439454_012362
2388 Ga0450920_027248
2389 Ga0439446_0046055
2390 Ga0450908_015851
2391 Ga0439434_0067418
2392 Ga0439435_0015984
2393 Ga0439444_0007370
2394 Ga0439460_0057087
2395 Ga0450916_005898
2396 Ga0450916_012289
2397 Ga0451577_0469755
2398 Ga0439440_0043722
2399 Ga0453683_0672215
2400 Ga0466966_0113650
2401 Ga0466963_0178329
2402 Ga0466963_0525925
2403 Ga0451576_0048913
2404 Ga0451576_0201094
2405 Ga0451576_0229180
2406 Ga0495592_0059402
2407 Ga0495603_0059674
2408 Ga0495603_0101562
2409 Ga0495603_0117581
2410 Ga0495603_0140246
2411 Ga0495651_0002965
2412 Ga0495651_0211998
2413 Ga0495651_0365259
2414 Ga0495580_0014096
2415 Ga0495580_0073689
2416 Ga0495580_0103321
2417 Ga0495580_0146563
2418 Ga0495580_0205857
2419 Ga0495580_0339995
2420 Ga0495580_0375568
2421 Ga0495580_0408976
2422 Ga0495582_0092109
2423 Ga0495582_0201521
2424 Ga0495582_0352007
2425 Ga0495639_0224658
2426 Ga0495664_0087302
2427 Ga0495664_0164764
2428 Ga0495664_0208754
2429 Ga0495664_0385348
2430 Ga0495594_0004891
2431 Ga0495594_0114077
2432 Ga0495608_0423284
2433 Ga0495643_0003489
2434 Ga0495663_0203336
2435 Ga0495666_0096729
2436 Ga0495652_0036329
2437 Ga0495652_0116086
2438 Ga0495665_0139085
2439 Ga0495665_0338815
2440 Ga0495586_0381494
2441 Ga0495587_0006862
2442 Ga0495587_0423880
2443 Ga0495621_0020422
2444 Ga0495621_0270016
2445 Ga0495645_0019007
2446 Ga0495645_0209763
2447 Ga0495645_0281329
2448 Ga0495645_0298586
2449 Ga0495645_0301265
2450 Ga0495645_0349397
2451 Ga0495633_0271185
2452 Ga0495667_0081241
2453 Ga0495656_0075421
2454 Ga0495635_0047094
2455 Ga0495635_0160477
2456 Ga0495635_0181987
2457 Ga0495659_0036011
2458 Ga0495588_0030217
2459 Ga0495599_0003371
2460 Ga0495599_0063543
2461 Ga0495599_0081458
2462 Ga0495599_0521714
2463 Ga0495623_0207215
2464 Ga0495623_0306250
2465 Ga0495646_0208377
2466 Ga0495647_0146881
2467 Ga0495647_0353485
2468 Ga0495658_0277003
2469 Ga0495658_0564125
2470 Ga0495658_0700151
2471 Ga0495604_0060748
2472 Ga0495604_0186718
2473 Ga0495636_0037685
2474 Ga0495636_0065943
2475 Ga0495674_0077054
2476 Ga0495674_0083109
2477 Ga0495674_0320258
2478 Ga0495675_0288190
2479 Ga0495684_0005866
2480 Ga0495684_0094188
2481 Ga0495684_0104527
2482 Ga0495684_0112073
2483 Ga0495684_0113952
2484 Ga0495684_0246229
2485 Ga0495684_0278866
2486 Ga0495602_0012640
2487 Ga0495602_0043456
2488 Ga0496104_0085600
2489 Ga0496104_0571391
2490 Ga0496104_0745116
2491 Ga0496106_0164867
2492 Ga0496109_0048511
2493 Ga0496110_0290872
2494 Ga0496110_0339636
2495 Ga0496112_0169095
2496 Ga0496113_0205790
2497 Ga0496114_0267889
2498 Ga0496115_0144934
2499 Ga0496115_0190661
2500 Ga0501291_003827
2501 Ga0501291_007243
2502 Ga0501298_016445
2503 Ga0501031_0020202
2504 Ga0501032_0001366
2505 Ga0501033_0015134
2506 Ga0501033_0206514
2507 Ga0501034_0026807
2508 Ga0501036_0001154
2509 Ga0501036_0063750
2510 Ga0501036_0081431
2511 Ga0501036_0244084
2512 Ga0501037_0005354
2513 Ga0501038_0000838
2514 Ga0501038_0188613
2515 Ga0501038_0273276
2516 Ga0501039_0005534
2517 Ga0501039_0030051
2518 Ga0501039_0052695
2519 Ga0501039_0118927
2520 Ga0501040_0020549
2521 Ga0501040_0085853
2522 Ga0501040_0467044
2523 Ga0501040_0623788
2524 Ga0501040_0682928
2525 Ga0501041_0019686
2526 Ga0501042_0005920
2527 Ga0501042_0018389
2528 Ga0501042_0027614
2529 Ga0501043_0031914
2530 Ga0501043_0067928
2531 Ga0501043_0513089
2532 Ga0501046_0024267
2533 Ga0501046_0026841
2534 Ga0501046_0138773
2535 Ga0501046_0351759
2536 Ga0501047_0064494
2537 Ga0501047_0226882
2538 Ga0501048_0026632
2539 Ga0501048_0032255
2540 Ga0501048_0106806
2541 Ga0501067_0033450
2542 Ga0501068_0001809
2543 Ga0501069_0011896
2544 Ga0501070_0018049
2545 Ga0501070_0065536
2546 Ga0501070_0200056
2547 Ga0501071_0198807
2548 Ga0501072_0003019
2549 Ga0501072_0084843
2550 Ga0501072_0198084
2551 Ga0501073_0001367
2552 Ga0501073_0167321
2553 Ga0501073_0743464
2554 Ga0501074_0010960
2555 Ga0501075_0116492
2556 Ga0501075_0211629
2557 Ga0501075_0611791
2558 Ga0501075_0832920
2559 Ga0501076_0035470
2560 Ga0501076_0044751
2561 Ga0501076_0120849
2562 Ga0501076_0853483
2563 Ga0501077_0018748
2564 Ga0501077_0087085
2565 Ga0501202_032463
2566 Ga0501217_150745
2567 Ga0501233_075282
2568 Ga0501243_059450
2569 Ga0501249_014980
2570 Ga0501249_034932
2571 Ga0501249_063792
2572 Ga0501079_0009365
2573 Ga0501079_0047546
2574 Ga0501079_0049621
2575 Ga0501080_0000243
2576 Ga0501080_0141503
2577 Ga0501080_0210814
2578 Ga0501081_0053824
2579 Ga0501081_0060120
2580 Ga0501081_0185443
2581 Ga0501081_0224102
2582 Ga0501081_0283204
2583 Ga0501081_0416991
2584 Ga0501083_0004506
2585 Ga0501083_0217186
2586 Ga0501283_022383
2587 Ga0501035_0081046
2588 Ga0501035_0242560
2589 Ga0501035_0658421
2590 Ga0501044_0001257
2591 Ga0501044_0014994
2592 Ga0501044_0033042
2593 Ga0501044_0085577
2594 Ga0501045_0039403
2595 Ga0501045_0053881
2596 Ga0501045_0706923
2597 Ga0501045_0781592
2598 nmdc:mga00v17_675120_c1
2599 nmdc:mga06z11_262520_c1
2600 nmdc:mga05p37_1080949_c1
2601 nmdc:mga05p37_171260_c1
2602 nmdc:mga05p37_177921_c1
2603 nmdc:mga05p37_2419_c1
2604 nmdc:mga05p37_437550_c1
2605 nmdc:mga05p37_437754_c1
2606 nmdc:mga05p37_44782_c1
2607 nmdc:mga05p37_483596_c1
2608 nmdc:mga05p37_84148_c1
2609 nmdc:mga09592_177681_c1
2610 nmdc:mga09592_19125_c1
2611 nmdc:mga09592_27132_c1
2612 nmdc:mga09592_35835_c1
2613 nmdc:mga09592_50982_c1
2614 nmdc:mga09592_74264_c1
2615 nmdc:mga0qj67_102877_c1
2616 nmdc:mga0qj67_134553_c1
2617 nmdc:mga0qj67_17604_c1
2618 nmdc:mga0qj67_216745_c1
2619 nmdc:mga0qj67_444188_c1
2620 nmdc:mga0qj67_59487_c1
2621 nmdc:mga0qj67_60595_c1
2622 nmdc:mga06r32_263078_c1
2623 nmdc:mga06r32_336659_c1
2624 nmdc:mga06r32_55695_c1
2625 nmdc:mga06r32_7152_c1
2626 nmdc:mga06r32_752330_c1
2627 nmdc:mga06r32_77979_c1
2628 nmdc:mga06r32_7934_c1
2629 nmdc:mga08y16_142240_c1
2630 nmdc:mga08y16_156827_c1
2631 nmdc:mga08y16_16007_c1
2632 nmdc:mga08y16_227274_c1
2633 nmdc:mga08y16_23988_c1
2634 nmdc:mga08y16_28438_c1
2635 nmdc:mga08y16_444180_c1
2636 nmdc:mga08y16_52853_c1
2637 nmdc:mga08y16_667382_c1
2638 nmdc:mga08y16_743_c1
2639 nmdc:mga0n895_12115_c1
2640 nmdc:mga0n895_18663_c1
2641 nmdc:mga0n895_19455_c1
2642 nmdc:mga0n895_239890_c1
2643 nmdc:mga0n895_31629_c1
2644 nmdc:mga0n895_4506_c2
2645 nmdc:mga0n895_90797_c1
2646 nmdc:mga0rr50_148320_c1
2647 nmdc:mga0rr50_155539_c1
2648 nmdc:mga0rr50_6700_c1
2649 nmdc:mga0rr50_7227_c1
2650 nmdc:mga08x19_128473_c1
2651 nmdc:mga08x19_394968_c1
2652 nmdc:mga0a205_17414_c1
2653 nmdc:mga0a205_2187_c1
2654 nmdc:mga0a205_224344_c1
2655 nmdc:mga0a205_29117_c1
2656 nmdc:mga0a205_2928_c1
2657 nmdc:mga0a205_49577_c1
2658 nmdc:mga0a205_5356_c1
2659 nmdc:mga0a205_79452_c1
2660 Ga0495619_0191817
2661 Ga0500645_000386
2662 Ga0501084_0000227
2663 Ga0501084_0081371
2664 Ga0501084_0098210
2665 Ga0501084_0114826
2666 Ga0501084_0155670
2667 Ga0501084_0174185
2668 Ga0590071_000168
2669 Ga0590071_029512
2670 Ga0590074_001533
2671 Ga0590075_000104
2672 Ga0590075_005298
2673 Ga0590077_000085
2674 Ga0590077_028077
2675 Ga0501082_0000199
2676 Ga0501082_0004396
2677 Ga0501082_0131626
2678 Ga0501082_0457589
2679 Ga0530510_0009133
2680 Ga0530510_0285840

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00475

IGPD

Imidazoleglycerol-phosphate dehydratase

55

198

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fwh-assembly1.cif.gz_A acanthamoeba igpd in complex with r-c348 to 1.7a resolution 0.9816 1 182
2f1d-assembly1.cif.gz_D x-ray structure of imidazoleglycerol-phosphate dehydratase 0.9798 4 182
4mu0-assembly1.cif.gz_A the structure of wt a. thaliana igpd2 in complex with mn2+ and 1,2,4-triazole at 1.3 a resolution 0.9783 1 184
4mu3-assembly1.cif.gz_A the form a structure of an e21q catalytic mutant of a. thaliana igpd2 in complex with mn2+ and a mixture of its substrate, 2r3s-igp, and an inhibitor, 2s3s-igp, to 1.12 a resolution 0.9768 1 184
7oj5-assembly1.cif.gz_A cryo-em structure of medicago truncatula hisn5 protein 0.9685 3 184
ID Description Score Start End Superfamily
af_C6T988_68_169_3.30.230.40 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9746 2 89 3.30.230.40
4qnkD01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9728 1 89 3.30.230.40
1rhyA02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9702 91 181 3.30.230.40
2f1dA02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9674 91 182 3.30.230.40
1rhyA02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9599 91 181 3.30.230.40
ID Description Score Start End GO Terms
AF-A0A7C3DXF6-F1-model_v4 Imidazoleglycerol-phosphate dehydratase HisB 0.9953 1 175 GO:0000105
GO:0004424
AF-A0A3B9I1R9-F1-model_v4 Imidazoleglycerol-phosphate dehydratase (EC 4.2.1.19) 0.9882 3 168 GO:0000105
GO:0004424
GO:0005737
AF-A0A355VD00-F1-model_v4 deleted 0.9874 4 70
AF-A0A7C4ZAG7-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 0.9869 3 83 GO:0000105
GO:0004424
AF-A0A1Z9GWE8-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 0.9867 3 84 GO:0000105
GO:0004424

Map