F493139

General Info

Members Datasets Scaffolds Average Seq Length
1338 390 2672 322

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0044629|Ga0501033_0044629_10_1161
Length 383
Sequence MRAMTGASTGSAAWGGAGVAASVVIAAANAIGSDRSVRAAIGRDHSSRLRRVRSATSTMIERMQTRRFGRLGWPVSEVGYGLWGMGGWSGSDDAESIAALERAIERGCTFFDTALAYGDGKSEQLLGQVLARRRGEPLVVATKIPPKNRKWPAFPEYKLEDVFPADYVREATETSLKNLGVPQIDLQQFHVWTDAWATDERWQRAVDDLKREKLVRAVGISVNRWEPANVLKALRTGLIDSVQVVYNLFDQNPEDELFPLCRELGVAVIARVPFDEGSLTGTLTKDSHWPEGDWRNLYFTPEYLAETLEHVEAVKQDVPSGMSLPELALRFILACPDVTTVIPGMRKTRHVDANLGVSDGRPLDPKLLERLRRHRWVRTHVIV

Samples

Sample ID Description Type Environment
1 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
80 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
81 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
82 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
83 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
87 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
88 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
95 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
96 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
102 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
103 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
104 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
105 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
113 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
114 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
118 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
119 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
120 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
121 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
122 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
123 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
124 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
125 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
126 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
127 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
128 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
129 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
130 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
131 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
132 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
133 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
134 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
135 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
136 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
137 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
199 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
200 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
204 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
205 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
206 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
208 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
209 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
210 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
211 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
212 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
213 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
214 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
215 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
216 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
217 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
218 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
219 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
220 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
221 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
222 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
223 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
224 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
225 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
226 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
227 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
228 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
229 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
230 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
231 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
232 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
233 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
234 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
235 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
236 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
237 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
238 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
239 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
240 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
241 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
242 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
243 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
244 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
245 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
246 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
247 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
248 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
249 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
250 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
251 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
252 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
253 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
254 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
255 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
256 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
257 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
258 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
259 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
260 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
261 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
262 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
263 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
264 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
265 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
266 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
267 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
268 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
269 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
270 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
271 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
272 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
273 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
274 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
275 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
276 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
277 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
278 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
279 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
280 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
281 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
282 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
283 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
284 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
285 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
286 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
287 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
288 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
289 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
290 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
291 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
292 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
293 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
294 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
295 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
296 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
297 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
298 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
299 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
300 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
301 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
302 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
303 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
304 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
305 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
306 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
307 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
308 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
309 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
310 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
311 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
312 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
313 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
314 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
315 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
316 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
317 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
318 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
319 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
320 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
321 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
322 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
323 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
324 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
338 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
339 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
340 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
341 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
342 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
343 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
344 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
345 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
346 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
347 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
348 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
349 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
350 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
351 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
352 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
353 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
354 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
355 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
356 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
357 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
358 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
359 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
360 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
361 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
364 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
365 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
366 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
367 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
368 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
369 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
370 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
371 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
372 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
373 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
374 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
375 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
376 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
377 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
378 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
379 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
380 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
381 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
382 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
383 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
384 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
385 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
386 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
387 2506783011 Frankia datiscae Dg1 Isolate Nodule
388 2904424332 Duganella sp. 1411 Isolate Rhizosphere
389 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
390 8054727385 Micromonospora alfalfae MED01 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.63
Metatranscriptomes 0.07
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.32
Nodule 0.15
Rhizoplane 2.47
Rhizosphere 94.39
Stem 0
Stem Tuber 0
Unclassified 6.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501033_0044629 3300049570 Bacteria 3299
2 SwRhRL3b_contig_1548823 2162886006 Bacteria 1854
3 Ga0065704_10002648 3300005289 Bacteria 5933
4 Ga0065712_10000664 3300005290 Bacteria 9875
5 Ga0065712_10003431 3300005290 Bacteria 4463
6 Ga0065712_10111389 3300005290 Bacteria 1818
7 Ga0065712_10140763 3300005290 Bacteria 1452
8 Ga0065715_10011952 3300005293 Bacteria 2312
9 Ga0065715_10111119 3300005293 Unclassified 2588
10 Ga0065715_10194549 3300005293 Bacteria 1395
11 Ga0065715_10211680 3300005293 Bacteria 1311
12 Ga0065707_10000716 3300005295 Bacteria 22427
13 Ga0065707_10006714 3300005295 Bacteria 3033
14 Ga0065707_10009088 3300005295 Bacteria 2074
15 Ga0065707_10017633 3300005295 Bacteria 2775
16 Ga0065707_10082607 3300005295 Bacteria 13356
17 Ga0065707_10087349 3300005295 Bacteria 5064
18 Ga0065707_10090877 3300005295 Bacteria 4048
19 Ga0065707_10092034 3300005295 Bacteria 3839
20 Ga0065707_10097195 3300005295 Bacteria 3196
21 Ga0065707_10138419 3300005295 Bacteria 1806
22 Ga0070658_10003765 3300005327 Bacteria 12415
23 Ga0070676_10001313 3300005328 Bacteria 12490
24 Ga0070676_10002029 3300005328 Bacteria 10285
25 Ga0070676_10083248 3300005328 Bacteria 1945
26 Ga0070676_10143608 3300005328 Bacteria 1522
27 Ga0070683_100000441 3300005329 Bacteria 28823
28 Ga0070683_100058647 3300005329 Bacteria 3576
29 Ga0070690_100004593 3300005330 Bacteria 7677
30 Ga0070690_100053974 3300005330 Bacteria 2572
31 Ga0070690_100062595 3300005330 Bacteria 2399
32 Ga0070670_100000914 3300005331 Bacteria 23199
33 Ga0070670_100070787 3300005331 Bacteria 2994
34 Ga0070670_100073139 3300005331 Bacteria 2944
35 Ga0070670_100083180 3300005331 Bacteria 2750
36 Ga0070670_100143507 3300005331 Bacteria 2065
37 Ga0070670_100330020 3300005331 Bacteria 1338
38 Ga0068869_100076581 3300005334 Bacteria 2487
39 Ga0068869_100077375 3300005334 Bacteria 2475
40 Ga0068869_100199175 3300005334 Unclassified 1578
41 Ga0068869_100273469 3300005334 Bacteria 1356
42 Ga0070666_10115949 3300005335 Bacteria 1855
43 Ga0070666_10141448 3300005335 Bacteria 1676
44 Ga0070666_10275004 3300005335 Unclassified 1196
45 Ga0070680_100005221 3300005336 Bacteria 9827
46 Ga0070680_100155870 3300005336 Bacteria 1918
47 Ga0070680_100199806 3300005336 Bacteria 1686
48 Ga0070680_100204858 3300005336 Bacteria 1664
49 Ga0070680_100217499 3300005336 Bacteria 1612
50 Ga0070680_100316232 3300005336 Bacteria 1325
51 Ga0068868_100003742 3300005338 Bacteria 10622
52 Ga0068868_100044782 3300005338 Bacteria 3460
53 Ga0068868_100046378 3300005338 Unclassified 3401
54 Ga0070660_100027018 3300005339 Bacteria 4280
55 Ga0070660_100353714 3300005339 Bacteria 1210
56 Ga0070689_100012900 3300005340 Bacteria 6033
57 Ga0070689_100060516 3300005340 Bacteria 2945
58 Ga0070689_100092860 3300005340 Unclassified 2381
59 Ga0070689_100107089 3300005340 Bacteria 2219
60 Ga0070689_100176844 3300005340 Bacteria 1731
61 Ga0070691_10007518 3300005341 Bacteria 4994
62 Ga0070691_10103156 3300005341 Bacteria 1419
63 Ga0070687_100013401 3300005343 Bacteria 3653
64 Ga0070687_100021843 3300005343 Unclassified 3017
65 Ga0070687_100040519 3300005343 Bacteria 2347
66 Ga0070661_100000760 3300005344 Bacteria 23236
67 Ga0070661_100003975 3300005344 Bacteria 10171
68 Ga0070661_100005992 3300005344 Bacteria 8365
69 Ga0070661_100194410 3300005344 Unclassified 1548
70 Ga0070661_100249231 3300005344 Bacteria 1370
71 Ga0070661_100315391 3300005344 Unclassified 1220
72 Ga0070692_10014113 3300005345 Bacteria 3741
73 Ga0070692_10021692 3300005345 Bacteria 3126
74 Ga0070668_100000512 3300005347 Bacteria 25674
75 Ga0070668_100065191 3300005347 Bacteria 2825
76 Ga0070668_100327964 3300005347 Unclassified 1290
77 Ga0070668_100370834 3300005347 Bacteria 1216
78 Ga0070669_100009884 3300005353 Bacteria 6795
79 Ga0070669_100011865 3300005353 Bacteria 6181
80 Ga0070669_100017634 3300005353 Bacteria 5093
81 Ga0070669_100025080 3300005353 Bacteria 4281
82 Ga0070669_100045952 3300005353 Bacteria 3183
83 Ga0070669_100259140 3300005353 Bacteria 1387
84 Ga0070675_100005742 3300005354 Bacteria 9491
85 Ga0070675_100008413 3300005354 Bacteria 8007
86 Ga0070675_100172281 3300005354 Bacteria 1867
87 Ga0070675_100361081 3300005354 Bacteria 1290
88 Ga0070671_100028612 3300005355 Bacteria 4590
89 Ga0070671_100106747 3300005355 Bacteria 2351
90 Ga0070671_100264380 3300005355 Unclassified 1462
91 Ga0070671_100328381 3300005355 Bacteria 1304
92 Ga0070671_100427801 3300005355 Bacteria 1134
93 Ga0070674_100142974 3300005356 Bacteria 1798
94 Ga0070673_100010825 3300005364 Bacteria 6196
95 Ga0070673_100091596 3300005364 Bacteria 2485
96 Ga0070673_100100536 3300005364 Bacteria 2381
97 Ga0070673_100179023 3300005364 Bacteria 1814
98 Ga0070673_100210975 3300005364 Bacteria 1677
99 Ga0070673_100231048 3300005364 Bacteria 1604
100 Ga0070688_100000001 3300005365 Bacteria 106331
101 Ga0070688_100043642 3300005365 Bacteria 2763
102 Ga0070688_100076845 3300005365 Bacteria 2150
103 Ga0070688_100128606 3300005365 Bacteria 1706
104 Ga0070688_100181349 3300005365 Bacteria 1461
105 Ga0070659_100074412 3300005366 Bacteria 2706
106 Ga0070659_100089216 3300005366 Bacteria 2470
107 Ga0070659_100132249 3300005366 Bacteria 2027
108 Ga0070659_100142702 3300005366 Bacteria 1950
109 Ga0070667_100016071 3300005367 Bacteria 6190
110 Ga0070667_100026879 3300005367 Unclassified 4789
111 Ga0070667_100108559 3300005367 Bacteria 2404
112 Ga0070703_10000152 3300005406 Bacteria 35286
113 Ga0070709_10090535 3300005434 Bacteria 2017
114 Ga0070709_10157501 3300005434 Bacteria 1576
115 Ga0070709_10165971 3300005434 Bacteria 1539
116 Ga0070714_100040245 3300005435 Bacteria 3939
117 Ga0070713_100008765 3300005436 Bacteria 7197
118 Ga0070713_100034744 3300005436 Bacteria 4054
119 Ga0070701_10040259 3300005438 Bacteria 2375
120 Ga0070701_10165203 3300005438 Bacteria 1285
121 Ga0070701_10227046 3300005438 Bacteria 1116
122 Ga0070711_100010744 3300005439 Bacteria 5676
123 Ga0070711_100037721 3300005439 Bacteria 3244
124 Ga0070711_100085743 3300005439 Bacteria 2256
125 Ga0070711_100175455 3300005439 Bacteria 1637
126 Ga0070705_100008199 3300005440 Bacteria 5169
127 Ga0070705_100015671 3300005440 Unclassified 3923
128 Ga0070705_100031275 3300005440 Bacteria 2946
129 Ga0070705_100034141 3300005440 Bacteria 2842
130 Ga0070700_100011493 3300005441 Bacteria 4906
131 Ga0070700_100012541 3300005441 Bacteria 4735
132 Ga0070700_100013017 3300005441 Bacteria 4666
133 Ga0070700_100114134 3300005441 Bacteria 1801
134 Ga0070700_100134063 3300005441 Bacteria 1675
135 Ga0070700_100139858 3300005441 Bacteria 1644
136 Ga0070700_100303742 3300005441 Bacteria 1166
137 Ga0070694_100000592 3300005444 Bacteria 19999
138 Ga0070694_100006937 3300005444 Bacteria 6883
139 Ga0070694_100098865 3300005444 Bacteria 2061
140 Ga0070694_100149752 3300005444 Bacteria 1703
141 Ga0070694_100219445 3300005444 Bacteria 1425
142 Ga0070694_100330374 3300005444 Bacteria 1176
143 Ga0070708_100006015 3300005445 Bacteria 9642
144 Ga0070708_100020071 3300005445 Bacteria 5629
145 Ga0070708_100032962 3300005445 Bacteria 4498
146 Ga0070708_100049544 3300005445 Bacteria 3716
147 Ga0070708_100079872 3300005445 Bacteria 2960
148 Ga0070708_100097098 3300005445 Bacteria 2693
149 Ga0070708_100193249 3300005445 Bacteria 1904
150 Ga0070708_100391997 3300005445 Bacteria 1309
151 Ga0070678_100034757 3300005456 Bacteria 3512
152 Ga0070678_100204267 3300005456 Bacteria 1633
153 Ga0070678_100324593 3300005456 Bacteria 1315
154 Ga0070662_100004746 3300005457 Bacteria 8613
155 Ga0070662_100165608 3300005457 Bacteria 1732
156 Ga0070681_10000352 3300005458 Bacteria 37162
157 Ga0070681_10048479 3300005458 Unclassified 4244
158 Ga0070681_10166505 3300005458 Bacteria 2127
159 Ga0068867_100008651 3300005459 Bacteria 7188
160 Ga0068867_100028594 3300005459 Bacteria 4015
161 Ga0068867_100060503 3300005459 Bacteria 2809
162 Ga0068867_100077776 3300005459 Bacteria 2494
163 Ga0068867_100138718 3300005459 Bacteria 1898
164 Ga0068867_100247339 3300005459 Bacteria 1449
165 Ga0070685_10026688 3300005466 Unclassified 3185
166 Ga0070685_10077328 3300005466 Bacteria 1987
167 Ga0070685_10188947 3300005466 Bacteria 1331
168 Ga0070706_100009017 3300005467 Bacteria 9288
169 Ga0070706_100119516 3300005467 Bacteria 2456
170 Ga0070706_100152242 3300005467 Bacteria 2159
171 Ga0070706_100172103 3300005467 Bacteria 2022
172 Ga0070706_100199432 3300005467 Unclassified 1869
173 Ga0070707_100000054 3300005468 Bacteria 100665
174 Ga0070707_100003246 3300005468 Bacteria 15409
175 Ga0070707_100010071 3300005468 Bacteria 8799
176 Ga0070707_100010681 3300005468 Bacteria 8553
177 Ga0070707_100138732 3300005468 Bacteria 2366
178 Ga0070707_100173056 3300005468 Bacteria 2104
179 Ga0070698_100000100 3300005471 Bacteria 69977
180 Ga0070698_100000405 3300005471 Bacteria 45717
181 Ga0070698_100012361 3300005471 Bacteria 9039
182 Ga0070698_100012643 3300005471 Bacteria 8937
183 Ga0070698_100032930 3300005471 Bacteria 5368
184 Ga0070698_100037732 3300005471 Bacteria 4981
185 Ga0070698_100057200 3300005471 Bacteria 3947
186 Ga0070698_100087070 3300005471 Bacteria 3110
187 Ga0070698_100093868 3300005471 Bacteria 2980
188 Ga0070698_100153958 3300005471 Bacteria 2245
189 Ga0070698_100207299 3300005471 Bacteria 1895
190 Ga0070699_100006555 3300005518 Bacteria 10132
191 Ga0070699_100006717 3300005518 Bacteria 10005
192 Ga0070699_100022062 3300005518 Bacteria 5484
193 Ga0070699_100050710 3300005518 Bacteria 3593
194 Ga0070699_100118954 3300005518 Bacteria 2322
195 Ga0070699_100168447 3300005518 Bacteria 1941
196 Ga0070699_100172663 3300005518 Bacteria 1916
197 Ga0070699_100334043 3300005518 Bacteria 1363
198 Ga0070679_100000126 3300005530 Bacteria 61205
199 Ga0070679_100004803 3300005530 Bacteria 12464
200 Ga0070679_100049548 3300005530 Bacteria 4183
201 Ga0070679_100087335 3300005530 Bacteria 3105
202 Ga0070684_100000140 3300005535 Bacteria 48458
203 Ga0070684_100000998 3300005535 Bacteria 20154
204 Ga0070684_100005201 3300005535 Bacteria 9949
205 Ga0070684_100018053 3300005535 Bacteria 5802
206 Ga0070684_100024500 3300005535 Bacteria 5063
207 Ga0070684_100254208 3300005535 Bacteria 1606
208 Ga0070697_100010545 3300005536 Bacteria 7215
209 Ga0070697_100016980 3300005536 Bacteria 5722
210 Ga0070697_100019393 3300005536 Bacteria 5372
211 Ga0070697_100065035 3300005536 Bacteria 2979
212 Ga0070697_100086493 3300005536 Bacteria 2587
213 Ga0070697_100283887 3300005536 Bacteria 1421
214 Ga0068853_100023808 3300005539 Bacteria 5131
215 Ga0068853_100037484 3300005539 Bacteria 4125
216 Ga0068853_100141029 3300005539 Bacteria 2163
217 Ga0070672_100008377 3300005543 Bacteria 7067
218 Ga0070672_100031269 3300005543 Bacteria 4006
219 Ga0070672_100049715 3300005543 Bacteria 3263
220 Ga0070672_100055567 3300005543 Unclassified 3102
221 Ga0070672_100067894 3300005543 Bacteria 2826
222 Ga0070672_100296528 3300005543 Bacteria 1370
223 Ga0070686_100002649 3300005544 Bacteria 9860
224 Ga0070686_100013471 3300005544 Unclassified 4684
225 Ga0070686_100020379 3300005544 Bacteria 3923
226 Ga0070686_100037357 3300005544 Bacteria 3012
227 Ga0070686_100256560 3300005544 Bacteria 1280
228 Ga0070695_100000599 3300005545 Bacteria 19075
229 Ga0070695_100000725 3300005545 Bacteria 17599
230 Ga0070695_100020206 3300005545 Bacteria 4065
231 Ga0070695_100028301 3300005545 Bacteria 3477
232 Ga0070695_100056823 3300005545 Bacteria 2526
233 Ga0070695_100094305 3300005545 Bacteria 2004
234 Ga0070695_100102432 3300005545 Bacteria 1931
235 Ga0070695_100148491 3300005545 Bacteria 1633
236 Ga0070696_100000092 3300005546 Bacteria 44449
237 Ga0070696_100023279 3300005546 Bacteria 4209
238 Ga0070696_100027776 3300005546 Unclassified 3858
239 Ga0070696_100173665 3300005546 Bacteria 1594
240 Ga0070696_100329474 3300005546 Bacteria 1177
241 Ga0070696_100361892 3300005546 Bacteria 1126
242 Ga0070693_100000592 3300005547 Bacteria 16048
243 Ga0070693_100005102 3300005547 Bacteria 6277
244 Ga0070693_100005176 3300005547 Bacteria 6237
245 Ga0070693_100068767 3300005547 Bacteria 2079
246 Ga0070665_100007034 3300005548 Bacteria 11432
247 Ga0070665_100022874 3300005548 Bacteria 6292
248 Ga0070665_100033774 3300005548 Bacteria 5146
249 Ga0070665_100158327 3300005548 Bacteria 2267
250 Ga0070665_100181102 3300005548 Bacteria 2108
251 Ga0070704_100000639 3300005549 Bacteria 16924
252 Ga0070704_100010823 3300005549 Bacteria 5563
253 Ga0070704_100012514 3300005549 Bacteria 5240
254 Ga0070704_100016093 3300005549 Bacteria 4717
255 Ga0070704_100029465 3300005549 Bacteria 3665
256 Ga0070704_100062045 3300005549 Bacteria 2678
257 Ga0070704_100078376 3300005549 Bacteria 2424
258 Ga0068855_100022301 3300005563 Bacteria 7588
259 Ga0068855_100092215 3300005563 Bacteria 3493
260 Ga0068855_100245207 3300005563 Bacteria 2000
261 Ga0068855_100514677 3300005563 Bacteria 1299
262 Ga0070664_100007265 3300005564 Bacteria 8927
263 Ga0070664_100052885 3300005564 Bacteria 3441
264 Ga0070664_100089757 3300005564 Bacteria 2659
265 Ga0070664_100183362 3300005564 Bacteria 1861
266 Ga0070664_100375906 3300005564 Bacteria 1296
267 Ga0068857_100011145 3300005577 Bacteria 7818
268 Ga0068854_100078913 3300005578 Bacteria 2426
269 Ga0068854_100243307 3300005578 Bacteria 1434
270 Ga0068854_100346136 3300005578 Bacteria 1215
271 Ga0070702_100011002 3300005615 Bacteria 4486
272 Ga0070702_100074749 3300005615 Bacteria 2011
273 Ga0070702_100204835 3300005615 Bacteria 1309
274 Ga0068852_100002820 3300005616 Bacteria 12043
275 Ga0068859_100016381 3300005617 Bacteria 7445
276 Ga0068859_100043700 3300005617 Bacteria 4504
277 Ga0068859_100144361 3300005617 Unclassified 2454
278 Ga0068859_100162363 3300005617 Bacteria 2313
279 Ga0068859_100210547 3300005617 Bacteria 2030
280 Ga0068859_100337514 3300005617 Bacteria 1601
281 Ga0068859_100397624 3300005617 Bacteria 1474
282 Ga0068864_100004084 3300005618 Bacteria 11986
283 Ga0068864_100026370 3300005618 Bacteria 4902
284 Ga0068864_100087864 3300005618 Bacteria 2737
285 Ga0068864_100154210 3300005618 Bacteria 2083
286 Ga0068864_100189508 3300005618 Bacteria 1885
287 Ga0068864_100274335 3300005618 Unclassified 1572
288 Ga0068864_100311257 3300005618 Bacteria 1476
289 Ga0068866_10043077 3300005718 Bacteria 2250
290 Ga0068866_10070391 3300005718 Bacteria 1846
291 Ga0068861_100000412 3300005719 Bacteria 24724
292 Ga0068861_100022157 3300005719 Bacteria 4573
293 Ga0068861_100031403 3300005719 Bacteria 3902
294 Ga0068861_100057580 3300005719 Unclassified 2969
295 Ga0068861_100170989 3300005719 Bacteria 1801
296 Ga0068851_10033119 3300005834 Bacteria 2574
297 Ga0068851_10057679 3300005834 Bacteria 1983
298 Ga0068863_100014985 3300005841 Bacteria 7446
299 Ga0068863_100145752 3300005841 Bacteria 2264
300 Ga0068863_100171914 3300005841 Bacteria 2078
301 Ga0068863_100172578 3300005841 Unclassified 2074
302 Ga0068863_100174161 3300005841 Bacteria 2065
303 Ga0068863_100543953 3300005841 Bacteria 1146
304 Ga0068858_100008146 3300005842 Bacteria 10074
305 Ga0068858_100018592 3300005842 Bacteria 6507
306 Ga0068858_100025743 3300005842 Bacteria 5473
307 Ga0068858_100049196 3300005842 Bacteria 3904
308 Ga0068858_100211686 3300005842 Bacteria 1834
309 Ga0068858_100245237 3300005842 Bacteria 1700
310 Ga0068858_100314576 3300005842 Bacteria 1495
311 Ga0068860_100007125 3300005843 Bacteria 11188
312 Ga0068860_100045046 3300005843 Bacteria 4205
313 Ga0068860_100045466 3300005843 Bacteria 4187
314 Ga0068860_100079001 3300005843 Bacteria 3128
315 Ga0068860_100175841 3300005843 Bacteria 2069
316 Ga0068860_100197205 3300005843 Bacteria 1950
317 Ga0068860_100361378 3300005843 Bacteria 1430
318 Ga0068862_100005934 3300005844 Bacteria 10173
319 Ga0068862_100008404 3300005844 Bacteria 8540
320 Ga0068862_100015650 3300005844 Bacteria 6301
321 Ga0068862_100040049 3300005844 Bacteria 3982
322 Ga0068862_100061564 3300005844 Unclassified 3226
323 Ga0068862_100065137 3300005844 Bacteria 3138
324 Ga0068862_100072056 3300005844 Bacteria 2984
325 Ga0068862_100081569 3300005844 Bacteria 2806
326 Ga0068862_100103390 3300005844 Bacteria 2495
327 Ga0068862_100131154 3300005844 Unclassified 2217
328 Ga0068862_100203210 3300005844 Bacteria 1787
329 Ga0081538_10092415 3300005981 Bacteria 1558
330 Ga0081539_10045686 3300005985 Bacteria 2516
331 Ga0081539_10151227 3300005985 Bacteria 1116
332 Ga0070717_10013839 3300006028 Bacteria 6195
333 Ga0075365_10004369 3300006038 Bacteria 7473
334 Ga0075365_10055661 3300006038 Bacteria 2626
335 Ga0075368_10024155 3300006042 Bacteria 2326
336 Ga0075363_100076048 3300006048 Bacteria 1830
337 Ga0075363_100120813 3300006048 Bacteria 1463
338 Ga0075364_10002494 3300006051 Bacteria 10306
339 Ga0075364_10021750 3300006051 Bacteria 4043
340 Ga0075364_10101416 3300006051 Bacteria 1916
341 Ga0070715_10036501 3300006163 Bacteria 2028
342 Ga0070715_10110447 3300006163 Bacteria 1296
343 Ga0070716_100002059 3300006173 Bacteria 9207
344 Ga0070716_100071479 3300006173 Bacteria 2040
345 Ga0070716_100286203 3300006173 Bacteria 1140
346 Ga0070712_100008528 3300006175 Bacteria 6449
347 Ga0070712_100073560 3300006175 Bacteria 2452
348 Ga0070712_100147570 3300006175 Bacteria 1802
349 Ga0075362_10076186 3300006177 Bacteria 1539
350 Ga0075367_10004489 3300006178 Bacteria 6821
351 Ga0075367_10019528 3300006178 Bacteria 3759
352 Ga0075367_10079739 3300006178 Bacteria 1979
353 Ga0075367_10141587 3300006178 Bacteria 1490
354 Ga0075366_10003085 3300006195 Bacteria 8698
355 Ga0075366_10016716 3300006195 Bacteria 4218
356 Ga0075366_10037624 3300006195 Bacteria 2858
357 Ga0075366_10159080 3300006195 Bacteria 1369
358 Ga0097621_100036317 3300006237 Bacteria 3942
359 Ga0097621_100080568 3300006237 Bacteria 2709
360 Ga0097621_100342686 3300006237 Unclassified 1327
361 Ga0097621_100381534 3300006237 Bacteria 1259
362 Ga0075370_10001242 3300006353 Bacteria 10836
363 Ga0068871_100001050 3300006358 Bacteria 18513
364 Ga0068871_100025690 3300006358 Bacteria 4586
365 Ga0068871_100052159 3300006358 Bacteria 3312
366 Ga0068871_100108035 3300006358 Bacteria 2338
367 Ga0068871_100120919 3300006358 Bacteria 2211
368 Ga0068871_100185895 3300006358 Bacteria 1788
369 Ga0068871_100265835 3300006358 Unclassified 1497
370 Ga0068871_100344334 3300006358 Bacteria 1317
371 Ga0075428_100000030 3300006844 Bacteria 119551
372 Ga0075428_100020724 3300006844 Bacteria 7277
373 Ga0075428_100077153 3300006844 Bacteria 3637
374 Ga0075428_100082115 3300006844 Bacteria 3517
375 Ga0075428_100146391 3300006844 Bacteria 2567
376 Ga0075428_100347819 3300006844 Bacteria 1591
377 Ga0075428_100409629 3300006844 Bacteria 1453
378 Ga0075430_100004540 3300006846 Bacteria 11688
379 Ga0075430_100019833 3300006846 Bacteria 5719
380 Ga0075430_100028439 3300006846 Bacteria 4749
381 Ga0075430_100030187 3300006846 Bacteria 4603
382 Ga0075430_100060505 3300006846 Bacteria 3183
383 Ga0075430_100200292 3300006846 Bacteria 1658
384 Ga0075431_100004879 3300006847 Bacteria 13208
385 Ga0075431_100018981 3300006847 Bacteria 7005
386 Ga0075431_100021366 3300006847 Bacteria 6618
387 Ga0075431_100027041 3300006847 Bacteria 5884
388 Ga0075431_100028854 3300006847 Bacteria 5706
389 Ga0075431_100045410 3300006847 Bacteria 4529
390 Ga0075431_100056677 3300006847 Bacteria 4041
391 Ga0075431_100131109 3300006847 Unclassified 2585
392 Ga0075431_100155508 3300006847 Bacteria 2353
393 Ga0075431_100367597 3300006847 Bacteria 1444
394 Ga0075433_10002238 3300006852 Bacteria 14686
395 Ga0075433_10003916 3300006852 Bacteria 11528
396 Ga0075433_10056002 3300006852 Bacteria 3444
397 Ga0075433_10068998 3300006852 Bacteria 3104
398 Ga0075433_10111829 3300006852 Bacteria 2423
399 Ga0075433_10301102 3300006852 Bacteria 1420
400 Ga0075433_10476992 3300006852 Bacteria 1099
401 Ga0075434_100007838 3300006871 Bacteria 9893
402 Ga0075434_100015409 3300006871 Bacteria 7328
403 Ga0075434_100038248 3300006871 Bacteria 4752
404 Ga0075434_100058732 3300006871 Bacteria 3823
405 Ga0075434_100073809 3300006871 Bacteria 3404
406 Ga0075434_100080183 3300006871 Bacteria 3260
407 Ga0075434_100087615 3300006871 Bacteria 3114
408 Ga0075434_100136407 3300006871 Bacteria 2473
409 Ga0075434_100279513 3300006871 Bacteria 1689
410 Ga0075434_100322789 3300006871 Bacteria 1564
411 Ga0075429_100004096 3300006880 Bacteria 12485
412 Ga0075429_100012646 3300006880 Bacteria 7319
413 Ga0075429_100025523 3300006880 Bacteria 5128
414 Ga0075429_100058817 3300006880 Bacteria 3348
415 Ga0075429_100074289 3300006880 Bacteria 2961
416 Ga0075429_100081245 3300006880 Unclassified 2826
417 Ga0075429_100159760 3300006880 Unclassified 1974
418 Ga0075429_100411268 3300006880 Bacteria 1185
419 Ga0068865_100017931 3300006881 Bacteria 4561
420 Ga0068865_100041175 3300006881 Bacteria 3142
421 Ga0068865_100056669 3300006881 Bacteria 2731
422 Ga0068865_100080061 3300006881 Bacteria 2342
423 Ga0068865_100138330 3300006881 Bacteria 1833
424 Ga0068865_100191045 3300006881 Bacteria 1583
425 Ga0075436_100003654 3300006914 Bacteria 10533
426 Ga0075436_100010018 3300006914 Bacteria 6483
427 Ga0075436_100023895 3300006914 Bacteria 4201
428 Ga0075436_100100226 3300006914 Bacteria 2017
429 Ga0097620_100016381 3300006931 Bacteria 7445
430 Ga0097620_100043700 3300006931 Bacteria 4504
431 Ga0097620_100099416 3300006931 Bacteria 2964
432 Ga0097620_100144358 3300006931 Unclassified 2454
433 Ga0097620_100162358 3300006931 Bacteria 2313
434 Ga0097620_100210538 3300006931 Bacteria 2030
435 Ga0097620_100337500 3300006931 Bacteria 1601
436 Ga0097620_100397664 3300006931 Bacteria 1474
437 Ga0075435_100000034 3300007076 Bacteria 70048
438 Ga0075435_100002807 3300007076 Bacteria 11644
439 Ga0075435_100015945 3300007076 Bacteria 5658
440 Ga0075435_100056677 3300007076 Bacteria 3169
441 Ga0075435_100060029 3300007076 Bacteria 3083
442 Ga0075435_100088004 3300007076 Bacteria 2560
443 Ga0075435_100152283 3300007076 Bacteria 1945
444 Ga0075435_100327405 3300007076 Bacteria 1312
445 Ga0075435_100362315 3300007076 Bacteria 1244
446 Ga0099794_10004198 3300007265 Bacteria 5619
447 Ga0099794_10012800 3300007265 Bacteria 3634
448 Ga0099794_10018983 3300007265 Bacteria 3091
449 Ga0099794_10024512 3300007265 Bacteria 2770
450 Ga0099794_10029125 3300007265 Unclassified 2572
451 Ga0099794_10035011 3300007265 Bacteria 2368
452 Ga0099794_10054783 3300007265 Unclassified 1926
453 Ga0099794_10152017 3300007265 Bacteria 1175
454 Ga0099795_10024344 3300007788 Bacteria 2018
455 Ga0105251_10045268 3300009011 Bacteria 2122
456 Ga0105251_10074008 3300009011 Unclassified 1582
457 Ga0105244_10008811 3300009036 Bacteria 6266
458 Ga0105240_10000644 3300009093 Bacteria 64391
459 Ga0105240_10018646 3300009093 Bacteria 9301
460 Ga0105240_10121668 3300009093 Bacteria 3142
461 Ga0105240_10407921 3300009093 Bacteria 1529
462 Ga0111539_10000015 3300009094 Bacteria 296576
463 Ga0111539_10000076 3300009094 Bacteria 98052
464 Ga0111539_10000876 3300009094 Bacteria 39324
465 Ga0111539_10012436 3300009094 Bacteria 10670
466 Ga0111539_10015016 3300009094 Bacteria 9651
467 Ga0111539_10025350 3300009094 Bacteria 7269
468 Ga0111539_10071487 3300009094 Bacteria 4094
469 Ga0111539_10153434 3300009094 Bacteria 2695
470 Ga0111539_10197043 3300009094 Bacteria 2349
471 Ga0111539_10263913 3300009094 Unclassified 2004
472 Ga0111539_10424306 3300009094 Bacteria 1549
473 Ga0105245_10062195 3300009098 Bacteria 3368
474 Ga0105245_10096498 3300009098 Bacteria 2728
475 Ga0105245_10200590 3300009098 Bacteria 1916
476 Ga0105245_10298133 3300009098 Bacteria 1581
477 Ga0105245_10646841 3300009098 Bacteria 1087
478 Ga0105247_10012285 3300009101 Bacteria 5144
479 Ga0105247_10022203 3300009101 Bacteria 3821
480 Ga0105247_10032618 3300009101 Bacteria 3164
481 Ga0105247_10088295 3300009101 Unclassified 1964
482 Ga0114129_10003934 3300009147 Bacteria 20979
483 Ga0114129_10005715 3300009147 Bacteria 17621
484 Ga0114129_10009259 3300009147 Bacteria 14044
485 Ga0114129_10009787 3300009147 Bacteria 13672
486 Ga0114129_10010235 3300009147 Bacteria 13378
487 Ga0114129_10010506 3300009147 Bacteria 13207
488 Ga0114129_10018867 3300009147 Bacteria 9825
489 Ga0114129_10020396 3300009147 Bacteria 9427
490 Ga0114129_10021207 3300009147 Bacteria 9227
491 Ga0114129_10040874 3300009147 Bacteria 6536
492 Ga0114129_10085473 3300009147 Bacteria 4377
493 Ga0114129_10112364 3300009147 Bacteria 3757
494 Ga0114129_10116899 3300009147 Bacteria 3675
495 Ga0114129_10121005 3300009147 Bacteria 3603
496 Ga0114129_10179111 3300009147 Bacteria 2886
497 Ga0114129_10205510 3300009147 Bacteria 2665
498 Ga0114129_10264670 3300009147 Bacteria 2303
499 Ga0114129_10344416 3300009147 Bacteria 1976
500 Ga0105243_10000119 3300009148 Bacteria 91258
501 Ga0105243_10018099 3300009148 Bacteria 5331
502 Ga0105243_10021318 3300009148 Bacteria 4918
503 Ga0105243_10026725 3300009148 Bacteria 4419
504 Ga0105243_10192570 3300009148 Bacteria 1782
505 Ga0105243_10366024 3300009148 Bacteria 1329
506 Ga0105243_10417920 3300009148 Bacteria 1250
507 Ga0105241_10047993 3300009174 Bacteria 3248
508 Ga0105241_10299217 3300009174 Bacteria 1380
509 Ga0105241_10424411 3300009174 Bacteria 1171
510 Ga0105242_10000514 3300009176 Bacteria 30424
511 Ga0105242_10042132 3300009176 Bacteria 3685
512 Ga0105242_10059398 3300009176 Bacteria 3137
513 Ga0105242_10217046 3300009176 Bacteria 1707
514 Ga0105242_10359524 3300009176 Bacteria 1347
515 Ga0105242_10445634 3300009176 Bacteria 1219
516 Ga0105242_10499974 3300009176 Bacteria 1156
517 Ga0105248_10002795 3300009177 Bacteria 19403
518 Ga0105248_10005698 3300009177 Bacteria 13685
519 Ga0105248_10030427 3300009177 Bacteria 6027
520 Ga0105248_10063542 3300009177 Bacteria 4144
521 Ga0105248_10081028 3300009177 Bacteria 3649
522 Ga0105248_10151575 3300009177 Bacteria 2616
523 Ga0105248_10152214 3300009177 Bacteria 2610
524 Ga0105248_10174409 3300009177 Bacteria 2424
525 Ga0105248_10191929 3300009177 Bacteria 2302
526 Ga0105248_10212333 3300009177 Unclassified 2180
527 Ga0105248_10277245 3300009177 Bacteria 1888
528 Ga0105248_10352512 3300009177 Bacteria 1657
529 Ga0105248_10440356 3300009177 Bacteria 1468
530 Ga0105248_10456926 3300009177 Bacteria 1439
531 Ga0105237_10011697 3300009545 Bacteria 9281
532 Ga0105237_10278310 3300009545 Unclassified 1676
533 Ga0105238_10084260 3300009551 Bacteria 3168
534 Ga0105238_10199581 3300009551 Bacteria 1976
535 Ga0105249_10002058 3300009553 Bacteria 17439
536 Ga0105249_10026478 3300009553 Bacteria 5226
537 Ga0105249_10046721 3300009553 Bacteria 3941
538 Ga0105249_10062099 3300009553 Bacteria 3430
539 Ga0105249_10179953 3300009553 Bacteria 2056
540 Ga0105249_10319794 3300009553 Unclassified 1563
541 Ga0105249_10581300 3300009553 Bacteria 1173
542 Ga0099796_10030456 3300010159 Bacteria 1751
543 Ga0099796_10053014 3300010159 Unclassified 1414
544 Ga0105239_10029880 3300010375 Bacteria 5993
545 Ga0105239_10066314 3300010375 Bacteria 3965
546 Ga0105239_10130083 3300010375 Bacteria 2799
547 Ga0105239_10395222 3300010375 Bacteria 1564
548 Ga0105239_10395866 3300010375 Bacteria 1563
549 Ga0105246_10046138 3300011119 Unclassified 2971
550 Ga0105246_10091045 3300011119 Bacteria 2197
551 Ga0157371_10045466 3300013102 Bacteria 3124
552 Ga0157370_10005959 3300013104 Bacteria 13564
553 Ga0157370_10111246 3300013104 Bacteria 2560
554 Ga0157370_10431475 3300013104 Bacteria 1212
555 Ga0157369_10008685 3300013105 Bacteria 11647
556 Ga0157369_10172269 3300013105 Bacteria 2280
557 Ga0157369_10470477 3300013105 Bacteria 1301
558 Ga0157374_10029053 3300013296 Bacteria 5001
559 Ga0157374_10052558 3300013296 Bacteria 3795
560 Ga0157374_10082749 3300013296 Bacteria 3048
561 Ga0157374_10183418 3300013296 Bacteria 2045
562 Ga0157374_10408765 3300013296 Bacteria 1355
563 Ga0157378_10000197 3300013297 Bacteria 58779
564 Ga0157378_10004551 3300013297 Bacteria 12162
565 Ga0157378_10010252 3300013297 Bacteria 8180
566 Ga0157378_10068961 3300013297 Bacteria 3172
567 Ga0157378_10083371 3300013297 Bacteria 2893
568 Ga0157378_10105266 3300013297 Bacteria 2580
569 Ga0157378_10198041 3300013297 Bacteria 1898
570 Ga0157378_10234818 3300013297 Bacteria 1749
571 Ga0157378_10272629 3300013297 Bacteria 1628
572 Ga0163162_10027530 3300013306 Bacteria 5621
573 Ga0163162_10031078 3300013306 Bacteria 5295
574 Ga0163162_10103178 3300013306 Bacteria 2945
575 Ga0163162_10137169 3300013306 Bacteria 2558
576 Ga0163162_10212397 3300013306 Bacteria 2065
577 Ga0163162_10261769 3300013306 Bacteria 1861
578 Ga0163162_10435369 3300013306 Bacteria 1443
579 Ga0163162_10721344 3300013306 Bacteria 1118
580 Ga0157372_10149453 3300013307 Bacteria 2695
581 Ga0157372_10174616 3300013307 Bacteria 2487
582 Ga0157375_10056638 3300013308 Bacteria 3872
583 Ga0157375_10163230 3300013308 Bacteria 2371
584 Ga0157375_10696538 3300013308 Bacteria 1170
585 Ga0157375_10697319 3300013308 Bacteria 1169
586 Ga0163163_10000005 3300014325 Bacteria 369548
587 Ga0163163_10011616 3300014325 Bacteria 7999
588 Ga0163163_10035216 3300014325 Bacteria 4855
589 Ga0163163_10165243 3300014325 Bacteria 2259
590 Ga0157380_10003719 3300014326 Bacteria 10488
591 Ga0157380_10008511 3300014326 Bacteria 7331
592 Ga0157380_10030530 3300014326 Unclassified 4128
593 Ga0157380_10069583 3300014326 Bacteria 2841
594 Ga0157380_10084073 3300014326 Bacteria 2609
595 Ga0157380_10122187 3300014326 Bacteria 2207
596 Ga0157380_10155803 3300014326 Bacteria 1980
597 Ga0157380_10277393 3300014326 Bacteria 1532
598 Ga0157380_10416244 3300014326 Bacteria 1280
599 Ga0157380_10663405 3300014326 Bacteria 1042
600 Ga0157377_10010241 3300014745 Unclassified 4631
601 Ga0157379_10030044 3300014968 Unclassified 4833
602 Ga0157379_10144164 3300014968 Bacteria 2148
603 Ga0157379_10191386 3300014968 Bacteria 1849
604 Ga0157379_10328263 3300014968 Bacteria 1398
605 Ga0157376_10000716 3300014969 Bacteria 21448
606 Ga0157376_10027855 3300014969 Bacteria 4484
607 Ga0157376_10101804 3300014969 Bacteria 2511
608 Ga0157376_10113124 3300014969 Bacteria 2393
609 Ga0163161_10029054 3300017792 Unclassified 3930
610 Ga0163161_10030219 3300017792 Bacteria 3854
611 Ga0163161_10077216 3300017792 Bacteria 2446
612 Ga0213876_10000111 3300021384 Bacteria 89727
613 Ga0213876_10000955 3300021384 Bacteria 19002
614 Ga0224572_1029591 3300024225 Bacteria 1047
615 Ga0207653_10000492 3300025885 Bacteria 15400
616 Ga0207653_10033847 3300025885 Bacteria 1658
617 Ga0207642_10060792 3300025899 Bacteria 1754
618 Ga0207642_10190736 3300025899 Bacteria 1124
619 Ga0207710_10018952 3300025900 Bacteria 2933
620 Ga0207710_10037341 3300025900 Bacteria 2145
621 Ga0207688_10121065 3300025901 Bacteria 1527
622 Ga0207688_10154707 3300025901 Bacteria 1356
623 Ga0207680_10031050 3300025903 Bacteria 3023
624 Ga0207680_10139134 3300025903 Bacteria 1608
625 Ga0207647_10065786 3300025904 Bacteria 2199
626 Ga0207699_10078957 3300025906 Bacteria 2034
627 Ga0207699_10279574 3300025906 Bacteria 1159
628 Ga0207645_10000393 3300025907 Bacteria 35992
629 Ga0207645_10009155 3300025907 Bacteria 6866
630 Ga0207645_10029509 3300025907 Bacteria 3535
631 Ga0207705_10004408 3300025909 Bacteria 10637
632 Ga0207705_10171430 3300025909 Bacteria 1634
633 Ga0207684_10022673 3300025910 Bacteria 5360
634 Ga0207684_10025239 3300025910 Bacteria 5066
635 Ga0207684_10068227 3300025910 Unclassified 3022
636 Ga0207684_10196915 3300025910 Bacteria 1738
637 Ga0207684_10304319 3300025910 Bacteria 1374
638 Ga0207707_10001356 3300025912 Bacteria 22773
639 Ga0207707_10040016 3300025912 Unclassified 4096
640 Ga0207707_10070758 3300025912 Bacteria 3040
641 Ga0207695_10006561 3300025913 Bacteria 15063
642 Ga0207695_10071994 3300025913 Bacteria 3529
643 Ga0207695_10161394 3300025913 Bacteria 2173
644 Ga0207671_10009461 3300025914 Bacteria 8145
645 Ga0207693_10009180 3300025915 Bacteria 8076
646 Ga0207693_10067965 3300025915 Bacteria 2790
647 Ga0207693_10152923 3300025915 Bacteria 1815
648 Ga0207663_10020406 3300025916 Bacteria 3752
649 Ga0207663_10046020 3300025916 Bacteria 2686
650 Ga0207663_10048434 3300025916 Bacteria 2631
651 Ga0207660_10040352 3300025917 Bacteria 3268
652 Ga0207660_10199256 3300025917 Bacteria 1563
653 Ga0207662_10021437 3300025918 Bacteria 3693
654 Ga0207662_10025733 3300025918 Bacteria 3390
655 Ga0207662_10071888 3300025918 Bacteria 2095
656 Ga0207657_10005772 3300025919 Bacteria 12907
657 Ga0207657_10154733 3300025919 Bacteria 1865
658 Ga0207649_10002571 3300025920 Bacteria 10094
659 Ga0207649_10082891 3300025920 Bacteria 2080
660 Ga0207649_10111454 3300025920 Bacteria 1829
661 Ga0207649_10235610 3300025920 Bacteria 1311
662 Ga0207652_10005907 3300025921 Bacteria 9901
663 Ga0207652_10010698 3300025921 Bacteria 7385
664 Ga0207652_10026796 3300025921 Bacteria 4804
665 Ga0207652_10110187 3300025921 Unclassified 2441
666 Ga0207652_10186187 3300025921 Bacteria 1867
667 Ga0207646_10000900 3300025922 Bacteria 38311
668 Ga0207646_10003971 3300025922 Bacteria 16403
669 Ga0207646_10013324 3300025922 Bacteria 7867
670 Ga0207646_10121652 3300025922 Bacteria 2345
671 Ga0207646_10173246 3300025922 Bacteria 1949
672 Ga0207646_10284227 3300025922 Bacteria 1495
673 Ga0207646_10332609 3300025922 Bacteria 1372
674 Ga0207681_10024806 3300025923 Bacteria 3850
675 Ga0207681_10032533 3300025923 Bacteria 3415
676 Ga0207681_10039215 3300025923 Bacteria 3143
677 Ga0207681_10054960 3300025923 Bacteria 2709
678 Ga0207681_10114556 3300025923 Bacteria 1967
679 Ga0207681_10173387 3300025923 Bacteria 1637
680 Ga0207681_10291132 3300025923 Bacteria 1289
681 Ga0207694_10138683 3300025924 Bacteria 1955
682 Ga0207650_10000872 3300025925 Bacteria 22890
683 Ga0207650_10067366 3300025925 Bacteria 2686
684 Ga0207650_10103749 3300025925 Bacteria 2193
685 Ga0207650_10335342 3300025925 Bacteria 1241
686 Ga0207659_10025660 3300025926 Bacteria 3964
687 Ga0207659_10044776 3300025926 Bacteria 3115
688 Ga0207659_10078936 3300025926 Bacteria 2427
689 Ga0207659_10082846 3300025926 Unclassified 2376
690 Ga0207659_10120972 3300025926 Bacteria 2006
691 Ga0207659_10178647 3300025926 Bacteria 1680
692 Ga0207687_10014770 3300025927 Bacteria 5114
693 Ga0207700_10020150 3300025928 Bacteria 4521
694 Ga0207700_10036070 3300025928 Bacteria 3567
695 Ga0207700_10121534 3300025928 Bacteria 2118
696 Ga0207664_10070026 3300025929 Bacteria 2822
697 Ga0207664_10151358 3300025929 Bacteria 1971
698 Ga0207644_10090025 3300025931 Bacteria 2285
699 Ga0207644_10124536 3300025931 Bacteria 1966
700 Ga0207644_10154372 3300025931 Bacteria 1779
701 Ga0207644_10205350 3300025931 Bacteria 1556
702 Ga0207690_10047149 3300025932 Bacteria 2858
703 Ga0207690_10048040 3300025932 Bacteria 2835
704 Ga0207706_10000841 3300025933 Bacteria 31722
705 Ga0207706_10058701 3300025933 Bacteria 3389
706 Ga0207706_10070861 3300025933 Bacteria 3066
707 Ga0207686_10000114 3300025934 Bacteria 64832
708 Ga0207686_10020401 3300025934 Bacteria 3786
709 Ga0207686_10048912 3300025934 Unclassified 2622
710 Ga0207686_10249808 3300025934 Bacteria 1295
711 Ga0207709_10000162 3300025935 Bacteria 91279
712 Ga0207709_10025907 3300025935 Bacteria 3362
713 Ga0207709_10091451 3300025935 Bacteria 1990
714 Ga0207670_10000012 3300025936 Bacteria 246808
715 Ga0207670_10064214 3300025936 Bacteria 2516
716 Ga0207670_10086975 3300025936 Bacteria 2201
717 Ga0207670_10112668 3300025936 Bacteria 1963
718 Ga0207670_10328734 3300025936 Unclassified 1205
719 Ga0207669_10198136 3300025937 Bacteria 1455
720 Ga0207704_10025787 3300025938 Bacteria 3213
721 Ga0207704_10144497 3300025938 Bacteria 1669
722 Ga0207704_10261452 3300025938 Bacteria 1305
723 Ga0207665_10000053 3300025939 Bacteria 73573
724 Ga0207665_10006891 3300025939 Bacteria 7522
725 Ga0207665_10116632 3300025939 Bacteria 1882
726 Ga0207665_10166861 3300025939 Bacteria 1588
727 Ga0207665_10315551 3300025939 Bacteria 1172
728 Ga0207691_10000103 3300025940 Bacteria 75136
729 Ga0207691_10003569 3300025940 Bacteria 15136
730 Ga0207691_10039748 3300025940 Bacteria 4351
731 Ga0207691_10145722 3300025940 Unclassified 2084
732 Ga0207691_10321471 3300025940 Bacteria 1327
733 Ga0207711_10129295 3300025941 Bacteria 2263
734 Ga0207711_10154374 3300025941 Bacteria 2074
735 Ga0207711_10225992 3300025941 Bacteria 1713
736 Ga0207711_10296350 3300025941 Bacteria 1491
737 Ga0207711_10510323 3300025941 Bacteria 1121
738 Ga0207689_10004944 3300025942 Bacteria 12008
739 Ga0207689_10016952 3300025942 Bacteria 6163
740 Ga0207689_10026220 3300025942 Bacteria 4881
741 Ga0207689_10156306 3300025942 Bacteria 1880
742 Ga0207689_10237494 3300025942 Bacteria 1506
743 Ga0207689_10267192 3300025942 Bacteria 1416
744 Ga0207661_10001023 3300025944 Bacteria 18535
745 Ga0207661_10007769 3300025944 Bacteria 7637
746 Ga0207661_10030403 3300025944 Bacteria 4160
747 Ga0207661_10053408 3300025944 Bacteria 3233
748 Ga0207661_10062110 3300025944 Bacteria 3021
749 Ga0207679_10006276 3300025945 Bacteria 7501
750 Ga0207667_10109983 3300025949 Bacteria 2843
751 Ga0207667_10234813 3300025949 Bacteria 1877
752 Ga0207667_10520735 3300025949 Bacteria 1205
753 Ga0207651_10124237 3300025960 Bacteria 1963
754 Ga0207651_10171895 3300025960 Unclassified 1710
755 Ga0207651_10335937 3300025960 Bacteria 1268
756 Ga0207712_10008254 3300025961 Bacteria 6582
757 Ga0207712_10012061 3300025961 Bacteria 5518
758 Ga0207712_10024482 3300025961 Bacteria 3999
759 Ga0207712_10070992 3300025961 Bacteria 2503
760 Ga0207712_10072536 3300025961 Bacteria 2480
761 Ga0207712_10157006 3300025961 Bacteria 1763
762 Ga0207712_10173972 3300025961 Bacteria 1685
763 Ga0207712_10206087 3300025961 Unclassified 1563
764 Ga0207668_10058087 3300025972 Bacteria 2702
765 Ga0207668_10060838 3300025972 Bacteria 2652
766 Ga0207668_10245305 3300025972 Bacteria 1452
767 Ga0207668_10398018 3300025972 Bacteria 1164
768 Ga0207640_10045028 3300025981 Bacteria 2831
769 Ga0207640_10070836 3300025981 Bacteria 2346
770 Ga0207640_10164145 3300025981 Bacteria 1647
771 Ga0207640_10262482 3300025981 Bacteria 1347
772 Ga0207658_10187709 3300025986 Bacteria 1716
773 Ga0207658_10326168 3300025986 Unclassified 1330
774 Ga0207677_10105165 3300026023 Bacteria 2088
775 Ga0207677_10120069 3300026023 Bacteria 1975
776 Ga0207677_10180330 3300026023 Bacteria 1661
777 Ga0207703_10012842 3300026035 Bacteria 6532
778 Ga0207703_10057424 3300026035 Bacteria 3173
779 Ga0207703_10170912 3300026035 Bacteria 1912
780 Ga0207703_10327545 3300026035 Bacteria 1404
781 Ga0207703_10521356 3300026035 Bacteria 1118
782 Ga0207639_10339303 3300026041 Bacteria 1339
783 Ga0207678_10020951 3300026067 Bacteria 5730
784 Ga0207708_10011853 3300026075 Bacteria 6491
785 Ga0207708_10023635 3300026075 Bacteria 4647
786 Ga0207708_10049578 3300026075 Bacteria 3198
787 Ga0207708_10070450 3300026075 Bacteria 2677
788 Ga0207708_10092692 3300026075 Bacteria 2331
789 Ga0207708_10155575 3300026075 Bacteria 1803
790 Ga0207708_10182231 3300026075 Bacteria 1668
791 Ga0207708_10280988 3300026075 Bacteria 1349
792 Ga0207702_10441769 3300026078 Bacteria 1261
793 Ga0207641_10022383 3300026088 Bacteria 5203
794 Ga0207641_10095253 3300026088 Unclassified 2612
795 Ga0207641_10107100 3300026088 Bacteria 2472
796 Ga0207641_10252039 3300026088 Bacteria 1649
797 Ga0207641_10281061 3300026088 Bacteria 1565
798 Ga0207641_10312427 3300026088 Bacteria 1488
799 Ga0207641_10384981 3300026088 Bacteria 1344
800 Ga0207641_10439405 3300026088 Bacteria 1259
801 Ga0207641_10626045 3300026088 Bacteria 1055
802 Ga0207648_10023129 3300026089 Bacteria 5573
803 Ga0207648_10051011 3300026089 Bacteria 3617
804 Ga0207648_10061227 3300026089 Bacteria 3282
805 Ga0207648_10094013 3300026089 Bacteria 2621
806 Ga0207648_10099689 3300026089 Bacteria 2544
807 Ga0207648_10109377 3300026089 Bacteria 2426
808 Ga0207648_10138645 3300026089 Bacteria 2143
809 Ga0207648_10146892 3300026089 Bacteria 2080
810 Ga0207648_10318447 3300026089 Bacteria 1397
811 Ga0207648_10345496 3300026089 Bacteria 1340
812 Ga0207648_10417555 3300026089 Bacteria 1218
813 Ga0207676_10007518 3300026095 Bacteria 7733
814 Ga0207676_10209575 3300026095 Unclassified 1728
815 Ga0207676_10299050 3300026095 Bacteria 1469
816 Ga0207676_10471762 3300026095 Bacteria 1187
817 Ga0207674_10007101 3300026116 Bacteria 13087
818 Ga0207674_10237741 3300026116 Unclassified 1769
819 Ga0207675_100001905 3300026118 Bacteria 20811
820 Ga0207675_100032759 3300026118 Bacteria 4842
821 Ga0207675_100037035 3300026118 Bacteria 4551
822 Ga0207675_100053235 3300026118 Bacteria 3776
823 Ga0207675_100065524 3300026118 Bacteria 3395
824 Ga0207675_100079303 3300026118 Bacteria 3077
825 Ga0207675_100096683 3300026118 Bacteria 2780
826 Ga0207675_100143416 3300026118 Bacteria 2270
827 Ga0207675_100178203 3300026118 Bacteria 2034
828 Ga0207675_100200135 3300026118 Bacteria 1918
829 Ga0207675_100213097 3300026118 Unclassified 1859
830 Ga0207675_100281596 3300026118 Bacteria 1616
831 Ga0207675_100340199 3300026118 Bacteria 1469
832 Ga0207683_10051249 3300026121 Unclassified 3616
833 Ga0207683_10199400 3300026121 Bacteria 1819
834 Ga0209588_1019560 3300027671 Unclassified 2114
835 Ga0209588_1020005 3300027671 Bacteria 2094
836 Ga0209588_1021467 3300027671 Bacteria 2029
837 Ga0209588_1022317 3300027671 Unclassified 1991
838 Ga0207428_10000048 3300027907 Bacteria 180760
839 Ga0207428_10000660 3300027907 Bacteria 40431
840 Ga0207428_10011057 3300027907 Bacteria 8020
841 Ga0207428_10023351 3300027907 Bacteria 5201
842 Ga0207428_10047442 3300027907 Bacteria 3449
843 Ga0207428_10079044 3300027907 Bacteria 2572
844 Ga0207428_10173492 3300027907 Bacteria 1632
845 Ga0265354_1000187 3300028016 Bacteria 11337
846 Ga0268266_10000299 3300028379 Bacteria 79882
847 Ga0268266_10222557 3300028379 Bacteria 1735
848 Ga0268265_10005348 3300028380 Bacteria 8797
849 Ga0268265_10043713 3300028380 Bacteria 3332
850 Ga0268265_10054617 3300028380 Bacteria 3032
851 Ga0268265_10060378 3300028380 Bacteria 2905
852 Ga0268265_10065098 3300028380 Bacteria 2811
853 Ga0268265_10180542 3300028380 Bacteria 1813
854 Ga0268265_10200194 3300028380 Bacteria 1732
855 Ga0268265_10496196 3300028380 Bacteria 1149
856 Ga0268264_10003107 3300028381 Bacteria 14381
857 Ga0268264_10017073 3300028381 Bacteria 5944
858 Ga0268264_10027874 3300028381 Bacteria 4618
859 Ga0268264_10050782 3300028381 Bacteria 3454
860 Ga0268264_10077113 3300028381 Bacteria 2838
861 Ga0268264_10192040 3300028381 Bacteria 1862
862 Ga0268264_10261396 3300028381 Bacteria 1613
863 Ga0268264_10353698 3300028381 Bacteria 1399
864 Ga0265318_10000010 3300028577 Bacteria 240629
865 Ga0265318_10031646 3300028577 Unclassified 2051
866 Ga0265338_10058790 3300028800 Unclassified 3391
867 Ga0265338_10154903 3300028800 Bacteria 1776
868 Ga0316182_1038488 3300030745 Bacteria 1342
869 Ga0265765_1006298 3300030879 Bacteria 1260
870 Ga0265330_10000206 3300031235 Bacteria 45608
871 Ga0265332_10000108 3300031238 Bacteria 70555
872 Ga0265328_10001280 3300031239 Bacteria 11598
873 Ga0265320_10000013 3300031240 Bacteria 240784
874 Ga0265329_10003991 3300031242 Bacteria 6290
875 Ga0265331_10000056 3300031250 Bacteria 177651
876 Ga0265331_10106451 3300031250 Bacteria 1288
877 Ga0265316_10071623 3300031344 Bacteria 2671
878 Ga0307408_100003272 3300031548 Bacteria 11143
879 Ga0307408_100066312 3300031548 Bacteria 2651
880 Ga0307408_100142795 3300031548 Bacteria 1881
881 Ga0307408_100229690 3300031548 Bacteria 1519
882 Ga0265313_10000464 3300031595 Bacteria 42754
883 Ga0316579_10028430 3300031691 Bacteria 2545
884 Ga0265314_10000237 3300031711 Bacteria 81300
885 Ga0316576_10013295 3300031727 Bacteria 5464
886 Ga0316578_10227544 3300031728 Unclassified 1121
887 Ga0307405_10034484 3300031731 Bacteria 3012
888 Ga0307405_10037068 3300031731 Unclassified 2928
889 Ga0307405_10210889 3300031731 Bacteria 1418
890 Ga0316577_10016355 3300031733 Bacteria 4087
891 Ga0307410_10002437 3300031852 Bacteria 8988
892 Ga0307410_10182626 3300031852 Unclassified 1589
893 Ga0307406_10043534 3300031901 Bacteria 2808
894 Ga0307406_10044408 3300031901 Bacteria 2785
895 Ga0307406_10106886 3300031901 Bacteria 1918
896 Ga0307406_10318171 3300031901 Bacteria 1202
897 Ga0307407_10015107 3300031903 Bacteria 3803
898 Ga0307407_10144335 3300031903 Unclassified 1539
899 Ga0307412_10010599 3300031911 Bacteria 5312
900 Ga0307412_10014803 3300031911 Bacteria 4610
901 Ga0307412_10253326 3300031911 Bacteria 1368
902 Ga0307409_100001071 3300031995 Bacteria 12885
903 Ga0307409_100054524 3300031995 Bacteria 3079
904 Ga0307409_100057918 3300031995 Bacteria 3006
905 Ga0307416_100060060 3300032002 Bacteria 3094
906 Ga0307416_100087499 3300032002 Unclassified 2660
907 Ga0307416_100100391 3300032002 Bacteria 2517
908 Ga0307414_10053894 3300032004 Bacteria 2807
909 Ga0307411_10034462 3300032005 Bacteria 3151
910 Ga0307411_10091974 3300032005 Bacteria 2120
911 Ga0307411_10193810 3300032005 Bacteria 1554
912 Ga0307411_10239667 3300032005 Bacteria 1419
913 Ga0307415_100002245 3300032126 Bacteria 9562
914 Ga0307415_100006144 3300032126 Bacteria 6445
915 Ga0307415_100227942 3300032126 Bacteria 1498
916 Ga0316212_1004218 3300033547 Bacteria 2083
917 Ga0316212_1009975 3300033547 Bacteria 1361
918 Ga0373930_0000600 3300034816 Bacteria 4982
919 Ga0373959_0001295 3300034820 Bacteria 4013
920 Ga0373934_0001513 3300035086 Bacteria 8529
921 Ga0373934_0005497 3300035086 Bacteria 4689
922 Ga0373949_0002690 3300035090 Bacteria 4460
923 Ga0373951_0002465 3300035091 Bacteria 4665
924 Ga0373951_0033450 3300035091 Bacteria 1219
925 Ga0373952_0002482 3300035092 Bacteria 3327
926 Ga0373945_0041812 3300035116 Unclassified 1659
927 Ga0373954_0000270 3300035118 Bacteria 18818
928 Ga0373954_0009594 3300035118 Bacteria 4259
929 Ga0373956_0001047 3300035119 Bacteria 11382
930 Ga0373956_0010879 3300035119 Bacteria 3740
931 Ga0373957_0000961 3300035120 Bacteria 7550
932 Ga0373957_0003322 3300035120 Bacteria 4742
933 Ga0373957_0016285 3300035120 Bacteria 2572
934 Ga0373960_0010597 3300035121 Bacteria 2255
935 Ga0373946_0101784 3300035171 Bacteria 1289
936 Ga0373955_0000322 3300035172 Bacteria 19872
937 Ga0373955_0003499 3300035172 Bacteria 6905
938 Ga0373955_0018011 3300035172 Bacteria 3504
939 Ga0373955_0108691 3300035172 Bacteria 1601
940 Ga0373942_0000525 3300035207 Bacteria 10727
941 Ga0373942_0037990 3300035207 Bacteria 1304
942 Ga0373961_0003420 3300035241 Bacteria 3931
943 Ga0373962_0002386 3300035242 Bacteria 4478
944 Ga0316574_0001110 3300035398 Bacteria 12323
945 Ga0316574_0001115 3300035398 Bacteria 12299
946 Ga0316574_0005535 3300035398 Bacteria 6743
947 Ga0373931_0008035 3300035691 Bacteria 4992
948 Ga0373931_0135613 3300035691 Bacteria 1421
949 Ga0373927_0158874 3300035695 Bacteria 1481
950 Ga0373933_0000856 3300035724 Bacteria 18651
951 Ga0373933_0012838 3300035724 Bacteria 4632
952 Ga0373933_0106560 3300035724 Bacteria 1744
953 Ga0373933_0117586 3300035724 Bacteria 1663
954 Ga0373947_0209452 3300035725 Bacteria 1278
955 Ga0373937_0000185 3300036401 Bacteria 61109
956 Ga0373937_0000453 3300036401 Bacteria 37842
957 Ga0373937_0001854 3300036401 Bacteria 17756
958 Ga0373937_0006882 3300036401 Bacteria 9813
959 Ga0373937_0164290 3300036401 Bacteria 2082
960 Ga0373937_0208769 3300036401 Bacteria 1837
961 Ga0316582_0001440 3300036647 Bacteria 10433
962 Ga0316582_0050221 3300036647 Bacteria 2641
963 Ga0316582_0187664 3300036647 Bacteria 1408
964 Ga0316582_0271906 3300036647 Unclassified 1162
965 Ga0316584_0002867 3300036712 Bacteria 11053
966 Ga0316584_0044221 3300036712 Bacteria 3321
967 Ga0373925_0089244 3300037068 Bacteria 2355
968 Ga0373925_0106562 3300037068 Bacteria 2161
969 Ga0373925_0109858 3300037068 Bacteria 2128
970 Ga0395900_0019937 3300037418 Bacteria 6836
971 Ga0395898_0389084 3300037466 Bacteria 1330
972 Ga0395898_0462411 3300037466 Bacteria 1208
973 Ga0395905_0317599 3300037471 Bacteria 1447
974 Ga0395905_0341424 3300037471 Bacteria 1389
975 Ga0316581_0007018 3300037588 Bacteria 3004
976 Ga0395901_0302964 3300038443 Bacteria 1657
977 Ga0395901_0546703 3300038443 Bacteria 1174
978 Ga0436365_0407503 3300039437 Bacteria 219857
979 Ga0436365_0785613 3300039437 Bacteria 45802
980 Ga0436365_0956146 3300039437 Bacteria 10735
981 Ga0436365_1322014 3300039437 Bacteria 2907
982 Ga0439438_000475 3300041405 Bacteria 18109
983 Ga0451853_0258695 3300041512 Bacteria 1886
984 Ga0450923_025608 3300042125 Bacteria 1177
985 Ga0439446_0006600 3300042156 Bacteria 3034
986 Ga0451577_0018237 3300042876 Bacteria 6468
987 Ga0451577_0081581 3300042876 Bacteria 2885
988 Ga0451577_0629219 3300042876 Bacteria 973
989 Ga0453683_0004295 3300044673 Bacteria 10161
990 Ga0453683_0005872 3300044673 Bacteria 8491
991 Ga0453683_0041611 3300044673 Unclassified 2886
992 Ga0453683_0330022 3300044673 Bacteria 978
993 Ga0453684_0043719 3300044712 Bacteria 6014
994 Ga0453684_0066760 3300044712 Bacteria 4579
995 Ga0453684_0092549 3300044712 Bacteria 3727
996 Ga0453684_0092682 3300044712 Unclassified 3723
997 Ga0453684_0157103 3300044712 Bacteria 2695
998 Ga0453684_0218311 3300044712 Bacteria 2210
999 Ga0453684_0360436 3300044712 Bacteria 1637
1000 Ga0451576_0005853 3300045051 Bacteria 15267
1001 Ga0451576_0027453 3300045051 Bacteria 6113
1002 Ga0451576_0039150 3300045051 Bacteria 5018
1003 Ga0451576_0077410 3300045051 Bacteria 3461
1004 Ga0451576_0348937 3300045051 Bacteria 1549
1005 Ga0451576_0418419 3300045051 Bacteria 1406
1006 Ga0495592_0108928 3300046454 Bacteria 1963
1007 Ga0495603_0018948 3300046455 Bacteria 4166
1008 Ga0495603_0061696 3300046455 Bacteria 2214
1009 Ga0495629_0056118 3300046459 Bacteria 2754
1010 Ga0495651_0003288 3300046462 Bacteria 12408
1011 Ga0495651_0100225 3300046462 Bacteria 2158
1012 Ga0495653_0055947 3300046463 Bacteria 3009
1013 Ga0495580_0001866 3300046472 Bacteria 18532
1014 Ga0495580_0011032 3300046472 Bacteria 7004
1015 Ga0495580_0014378 3300046472 Bacteria 6003
1016 Ga0495582_0001408 3300046473 Bacteria 13557
1017 Ga0495582_0045593 3300046473 Bacteria 2414
1018 Ga0495582_0132531 3300046473 Bacteria 1409
1019 Ga0495639_0062123 3300046475 Bacteria 1713
1020 Ga0495662_0133108 3300046476 Bacteria 1223
1021 Ga0495594_0011693 3300046499 Bacteria 4563
1022 Ga0495594_0030427 3300046499 Bacteria 2921
1023 Ga0495608_0000990 3300046511 Bacteria 20056
1024 Ga0495610_0044529 3300046512 Bacteria 2202
1025 Ga0495610_0057554 3300046512 Bacteria 1863
1026 Ga0495652_0041109 3300046529 Bacteria 3993
1027 Ga0495640_0015177 3300046533 Bacteria 5802
1028 Ga0495640_0137661 3300046533 Bacteria 1576
1029 Ga0495586_0049520 3300046535 Bacteria 2272
1030 Ga0495587_0008193 3300046536 Bacteria 6734
1031 Ga0495587_0009801 3300046536 Bacteria 6121
1032 Ga0495598_0000652 3300046537 Bacteria 6550
1033 Ga0495598_0069456 3300046537 Bacteria 1106
1034 Ga0495621_0000485 3300046539 Bacteria 9789
1035 Ga0495645_0000133 3300046543 Bacteria 50579
1036 Ga0495667_0008898 3300046559 Bacteria 6826
1037 Ga0495667_0025361 3300046559 Bacteria 3996
1038 Ga0495625_0015326 3300046660 Bacteria 6074
1039 Ga0495635_0034497 3300046663 Bacteria 3509
1040 Ga0495659_0034152 3300046664 Bacteria 1788
1041 Ga0495657_0037458 3300046675 Bacteria 3343
1042 Ga0495599_0048959 3300046678 Bacteria 2649
1043 Ga0495599_0162693 3300046678 Bacteria 1379
1044 Ga0495623_0194499 3300046679 Bacteria 1170
1045 Ga0495647_0015492 3300046681 Bacteria 2673
1046 Ga0495647_0036442 3300046681 Bacteria 1852
1047 Ga0495658_0046261 3300046683 Bacteria 2446
1048 Ga0495658_0063480 3300046683 Unclassified 2125
1049 Ga0495658_0135364 3300046683 Bacteria 1503
1050 Ga0495613_0149424 3300046689 Bacteria 1667
1051 Ga0495613_0185817 3300046689 Unclassified 1470
1052 Ga0495600_0034676 3300046809 Bacteria 3277
1053 Ga0495600_0090361 3300046809 Bacteria 1997
1054 Ga0495581_0041506 3300047315 Bacteria 2662
1055 Ga0495581_0088481 3300047315 Bacteria 1796
1056 Ga0495604_0000234 3300047317 Bacteria 49895
1057 Ga0495674_0055100 3300047319 Bacteria 3488
1058 Ga0495676_0130217 3300047321 Unclassified 1817
1059 Ga0495680_0054918 3300047322 Unclassified 3090
1060 Ga0495675_0004566 3300047444 Bacteria 8398
1061 Ga0495681_0070518 3300047470 Bacteria 1584
1062 Ga0495684_0005214 3300047471 Bacteria 10130
1063 Ga0495684_0057965 3300047471 Bacteria 2951
1064 Ga0495602_0099331 3300048088 Bacteria 2393
1065 Ga0496100_0108064 3300048903 Bacteria 1928
1066 Ga0496100_0235824 3300048903 Bacteria 1348
1067 Ga0496101_0042595 3300048904 Bacteria 3241
1068 Ga0496101_0056099 3300048904 Bacteria 2848
1069 Ga0496102_0001041 3300048905 Bacteria 25747
1070 Ga0496103_0003737 3300048906 Bacteria 9256
1071 Ga0496103_0021767 3300048906 Bacteria 3859
1072 Ga0496104_0018942 3300048907 Bacteria 6288
1073 Ga0496104_0054213 3300048907 Bacteria 3790
1074 Ga0496104_0084299 3300048907 Bacteria 3032
1075 Ga0496104_0135824 3300048907 Bacteria 2363
1076 Ga0496104_0258525 3300048907 Bacteria 1654
1077 Ga0496107_0183054 3300048910 Bacteria 1556
1078 Ga0496107_0285288 3300048910 Bacteria 1229
1079 Ga0496107_0288644 3300048910 Bacteria 1221
1080 Ga0496108_0000134 3300048911 Bacteria 71998
1081 Ga0496108_0001329 3300048911 Bacteria 19429
1082 Ga0496108_0046389 3300048911 Bacteria 3630
1083 Ga0496108_0164895 3300048911 Bacteria 1916
1084 Ga0496109_0014292 3300048912 Bacteria 6908
1085 Ga0496109_0044916 3300048912 Bacteria 4009
1086 Ga0496109_0078316 3300048912 Unclassified 3043
1087 Ga0496110_0005097 3300048913 Bacteria 10264
1088 Ga0496111_0240603 3300048914 Bacteria 1344
1089 Ga0496112_0034333 3300048915 Bacteria 4936
1090 Ga0496112_0047903 3300048915 Bacteria 4192
1091 Ga0496112_0065653 3300048915 Bacteria 3581
1092 Ga0496113_0000718 3300048916 Bacteria 16960
1093 Ga0496114_0007389 3300048917 Bacteria 8681
1094 Ga0496114_0079317 3300048917 Bacteria 2771
1095 Ga0496114_0134717 3300048917 Bacteria 2135
1096 Ga0496115_0050582 3300048918 Bacteria 3330
1097 Ga0496115_0335860 3300048918 Bacteria 1234
1098 Ga0501031_0097552 3300049568 Bacteria 1918
1099 Ga0501031_0141513 3300049568 Unclassified 1572
1100 Ga0501032_0005535 3300049569 Bacteria 9374
1101 Ga0501033_0003247 3300049570 Bacteria 13457
1102 Ga0501033_0003860 3300049570 Bacteria 12181
1103 Ga0501034_0003606 3300049571 Bacteria 17561
1104 Ga0501034_0008048 3300049571 Bacteria 11188
1105 Ga0501034_0010040 3300049571 Bacteria 9886
1106 Ga0501034_0087660 3300049571 Bacteria 3111
1107 Ga0501034_0094314 3300049571 Bacteria 2989
1108 Ga0501034_0105654 3300049571 Bacteria 2808
1109 Ga0501034_0130556 3300049571 Bacteria 2496
1110 Ga0501034_0134441 3300049571 Bacteria 2454
1111 Ga0501034_0137880 3300049571 Bacteria 2420
1112 Ga0501036_0002149 3300049572 Bacteria 15398
1113 Ga0501036_0009795 3300049572 Bacteria 7891
1114 Ga0501036_0013511 3300049572 Bacteria 6787
1115 Ga0501036_0031013 3300049572 Bacteria 4517
1116 Ga0501036_0065687 3300049572 Bacteria 3069
1117 Ga0501036_0236144 3300049572 Bacteria 1533
1118 Ga0501037_0014764 3300049573 Bacteria 5745
1119 Ga0501037_0044823 3300049573 Bacteria 3247
1120 Ga0501037_0071177 3300049573 Unclassified 2530
1121 Ga0501038_0013312 3300049574 Bacteria 7501
1122 Ga0501038_0015788 3300049574 Bacteria 6862
1123 Ga0501038_0046053 3300049574 Bacteria 3783
1124 Ga0501038_0127636 3300049574 Bacteria 2092
1125 Ga0501038_0348267 3300049574 Bacteria 1154
1126 Ga0501039_0004307 3300049575 Bacteria 10730
1127 Ga0501039_0018612 3300049575 Bacteria 5331
1128 Ga0501039_0058449 3300049575 Bacteria 2987
1129 Ga0501039_0221810 3300049575 Bacteria 1486
1130 Ga0501041_0137951 3300049577 Bacteria 1520
1131 Ga0501041_0157309 3300049577 Bacteria 1420
1132 Ga0501042_0005425 3300049578 Bacteria 8215
1133 Ga0501042_0038751 3300049578 Bacteria 3384
1134 Ga0501042_0096606 3300049578 Bacteria 2123
1135 Ga0501042_0175467 3300049578 Bacteria 1546
1136 Ga0501042_0216084 3300049578 Bacteria 1383
1137 Ga0501043_0002399 3300049579 Bacteria 15867
1138 Ga0501043_0006965 3300049579 Bacteria 9003
1139 Ga0501043_0101961 3300049579 Bacteria 2256
1140 Ga0501043_0278628 3300049579 Bacteria 1282
1141 Ga0501046_0075330 3300049580 Bacteria 2616
1142 Ga0501046_0157180 3300049580 Bacteria 1712
1143 Ga0501047_0002033 3300049581 Bacteria 19344
1144 Ga0501047_0007398 3300049581 Bacteria 10329
1145 Ga0501047_0016062 3300049581 Bacteria 7139
1146 Ga0501047_0053243 3300049581 Bacteria 3912
1147 Ga0501047_0086943 3300049581 Bacteria 3004
1148 Ga0501047_0164895 3300049581 Bacteria 2086
1149 Ga0501047_0301384 3300049581 Bacteria 1445
1150 Ga0501048_0000987 3300049582 Bacteria 21132
1151 Ga0501048_0017349 3300049582 Bacteria 5305
1152 Ga0501048_0021630 3300049582 Bacteria 4707
1153 Ga0501048_0080420 3300049582 Bacteria 2299
1154 Ga0501067_0001874 3300049583 Bacteria 11555
1155 Ga0501067_0045453 3300049583 Bacteria 2438
1156 Ga0501067_0131234 3300049583 Unclassified 1394
1157 Ga0501068_0010906 3300049584 Bacteria 5115
1158 Ga0501068_0027406 3300049584 Bacteria 3364
1159 Ga0501068_0121248 3300049584 Bacteria 1630
1160 Ga0501069_0010453 3300049585 Bacteria 4912
1161 Ga0501069_0026109 3300049585 Bacteria 3197
1162 Ga0501070_0006182 3300049586 Bacteria 10203
1163 Ga0501070_0045422 3300049586 Bacteria 3653
1164 Ga0501070_0059736 3300049586 Bacteria 3160
1165 Ga0501071_0032017 3300049587 Bacteria 3731
1166 Ga0501071_0038942 3300049587 Bacteria 3399
1167 Ga0501071_0191189 3300049587 Bacteria 1535
1168 Ga0501072_0209743 3300049588 Bacteria 1552
1169 Ga0501072_0216258 3300049588 Bacteria 1527
1170 Ga0501072_0218416 3300049588 Bacteria 1519
1171 Ga0501073_0004696 3300049589 Bacteria 10257
1172 Ga0501073_0011025 3300049589 Bacteria 6612
1173 Ga0501073_0030832 3300049589 Bacteria 3828
1174 Ga0501073_0032660 3300049589 Bacteria 3710
1175 Ga0501073_0034403 3300049589 Bacteria 3606
1176 Ga0501073_0215319 3300049589 Bacteria 1327
1177 Ga0501074_0023477 3300049590 Bacteria 4482
1178 Ga0501074_0092637 3300049590 Bacteria 2164
1179 Ga0501075_0015806 3300049591 Bacteria 5426
1180 Ga0501075_0033069 3300049591 Bacteria 3846
1181 Ga0501076_0010590 3300049592 Bacteria 6847
1182 Ga0501076_0105168 3300049592 Bacteria 2278
1183 Ga0501076_0344697 3300049592 Bacteria 1223
1184 Ga0501077_0272770 3300049593 Bacteria 1076
1185 Ga0501217_003067 3300049661 Bacteria 3346
1186 Ga0501239_002420 3300049672 Bacteria 1692
1187 Ga0501242_001249 3300049674 Bacteria 2507
1188 Ga0501247_000223 3300049677 Bacteria 3858
1189 Ga0501249_013755 3300049679 Bacteria 1721
1190 Ga0501225_0002663 3300049705 Bacteria 5482
1191 Ga0501079_0371972 3300049741 Bacteria 1120
1192 Ga0501080_0017002 3300049742 Bacteria 6717
1193 Ga0501080_0053695 3300049742 Bacteria 3752
1194 Ga0501080_0133734 3300049742 Unclassified 2295
1195 Ga0501081_0127718 3300049743 Unclassified 1815
1196 Ga0501081_0150044 3300049743 Bacteria 1674
1197 Ga0501083_0002394 3300049744 Bacteria 12846
1198 Ga0501083_0015302 3300049744 Bacteria 5372
1199 Ga0501083_0047126 3300049744 Bacteria 2913
1200 Ga0501083_0088259 3300049744 Bacteria 2050
1201 Ga0501263_002316 3300049760 Bacteria 1930
1202 Ga0501268_001794 3300049765 Bacteria 2735
1203 Ga0501270_000288 3300049767 Bacteria 4310
1204 Ga0501035_0002476 3300049822 Bacteria 18046
1205 Ga0501035_0010613 3300049822 Bacteria 8529
1206 Ga0501035_0019365 3300049822 Bacteria 6261
1207 Ga0501035_0019538 3300049822 Bacteria 6226
1208 Ga0501035_0153678 3300049822 Bacteria 1995
1209 Ga0501044_0009140 3300049823 Bacteria 10824
1210 Ga0501044_0038537 3300049823 Bacteria 4990
1211 Ga0501044_0071099 3300049823 Bacteria 3538
1212 Ga0501045_0019789 3300049824 Bacteria 4804
1213 Ga0501045_0033068 3300049824 Bacteria 3750
1214 Ga0501045_0371418 3300049824 Bacteria 1064
1215 nmdc:mga03683_16492_c1 3300050489 Bacteria 2776
1216 nmdc:mga03683_17938_c1 3300050489 Bacteria 2684
1217 nmdc:mga03683_20103_c1 3300050489 Bacteria 2558
1218 nmdc:mga03n38_22908_c1 3300050490 Bacteria 2534
1219 nmdc:mga00v17_4543_c1 3300050491 Bacteria 7229
1220 nmdc:mga00v17_62248_c1 3300050491 Bacteria 2295
1221 nmdc:mga0yw44_23083_c1 3300050492 Bacteria 3500
1222 nmdc:mga0k408_1635_c1 3300050493 Bacteria 12117
1223 nmdc:mga06z11_49098_c1 3300050494 Bacteria 2151
1224 nmdc:mga07m45_3548_c1 3300050496 Bacteria 7537
1225 nmdc:mga05p37_12702_c1 3300050507 Bacteria 10065
1226 nmdc:mga05p37_131149_c1 3300050507 Bacteria 3075
1227 nmdc:mga05p37_1395_c2 3300050507 Bacteria 20246
1228 nmdc:mga05p37_17242_c1 3300050507 Bacteria 8711
1229 nmdc:mga05p37_20429_c1 3300050507 Bacteria 8010
1230 nmdc:mga05p37_265866_c1 3300050507 Unclassified 2051
1231 nmdc:mga05p37_3102_c1 3300050507 Bacteria 19306
1232 nmdc:mga05p37_31579_c1 3300050507 Bacteria 6470
1233 nmdc:mga05p37_31_c2 3300050507 Bacteria 35180
1234 nmdc:mga05p37_38451_c1 3300050507 Bacteria 5869
1235 nmdc:mga05p37_42717_c1 3300050507 Bacteria 5572
1236 nmdc:mga05p37_4975_c1 3300050507 Bacteria 15577
1237 nmdc:mga05p37_66473_c1 3300050507 Bacteria 2168
1238 nmdc:mga05p37_83167_c1 3300050507 Bacteria 3943
1239 nmdc:mga05p37_85_c1 3300050507 Bacteria 83588
1240 nmdc:mga09592_2037_c2 3300050508 Bacteria 10182
1241 nmdc:mga09592_224613_c1 3300050508 Bacteria 1627
1242 nmdc:mga09592_261282_c1 3300050508 Bacteria 1501
1243 nmdc:mga09592_487094_c1 3300050508 Bacteria 1062
1244 nmdc:mga09592_51012_c1 3300050508 Bacteria 3490
1245 nmdc:mga09592_54458_c1 3300050508 Bacteria 3380
1246 nmdc:mga09592_8625_c1 3300050508 Bacteria 8295
1247 nmdc:mga09592_90106_c1 3300050508 Bacteria 2620
1248 nmdc:mga0qj67_11689_c1 3300050509 Bacteria 6586
1249 nmdc:mga0qj67_14957_c1 3300050509 Bacteria 5871
1250 nmdc:mga0qj67_18432_c1 3300050509 Bacteria 5320
1251 nmdc:mga0qj67_97770_c1 3300050509 Bacteria 2364
1252 nmdc:mga06r32_29459_c1 3300050510 Bacteria 4056
1253 nmdc:mga06r32_48200_c1 3300050510 Bacteria 4072
1254 nmdc:mga06r32_61333_c1 3300050510 Bacteria 3619
1255 nmdc:mga06r32_9156_c1 3300050510 Bacteria 8923
1256 nmdc:mga06r32_9243_c1 3300050510 Bacteria 8884
1257 nmdc:mga08y16_101921_c1 3300050511 Bacteria 2988
1258 nmdc:mga08y16_132128_c1 3300050511 Bacteria 2595
1259 nmdc:mga08y16_1349_c1 3300050511 Bacteria 24501
1260 nmdc:mga08y16_158947_c1 3300050511 Bacteria 2348
1261 nmdc:mga08y16_195020_c1 3300050511 Bacteria 2100
1262 nmdc:mga08y16_27219_c1 3300050511 Bacteria 6024
1263 nmdc:mga08y16_275158_c1 3300050511 Bacteria 1738
1264 nmdc:mga08y16_348550_c1 3300050511 Bacteria 1521
1265 nmdc:mga08y16_37273_c1 3300050511 Bacteria 5108
1266 nmdc:mga08y16_46538_c1 3300050511 Bacteria 4542
1267 nmdc:mga08y16_5440_c1 3300050511 Bacteria 13315
1268 nmdc:mga08y16_549595_c1 3300050511 Bacteria 1169
1269 nmdc:mga08y16_7712_c1 3300050511 Bacteria 11270
1270 nmdc:mga08y16_79440_c1 3300050511 Bacteria 3419
1271 nmdc:mga08y16_8_c1 3300050511 Bacteria 571177
1272 nmdc:mga0n895_12071_c1 3300050512 Bacteria 7731
1273 nmdc:mga0n895_151506_c1 3300050512 Bacteria 2349
1274 nmdc:mga0n895_15518_c1 3300050512 Bacteria 6949
1275 nmdc:mga0n895_208572_c1 3300050512 Bacteria 1985
1276 nmdc:mga0n895_21471_c1 3300050512 Bacteria 6038
1277 nmdc:mga0n895_2531_c1 3300050512 Bacteria 14315
1278 nmdc:mga0n895_32834_c1 3300050512 Bacteria 4984
1279 nmdc:mga0n895_344559_c1 3300050512 Bacteria 1509
1280 nmdc:mga0n895_35465_c1 3300050512 Bacteria 4809
1281 nmdc:mga0n895_39264_c1 3300050512 Bacteria 4592
1282 nmdc:mga0n895_56295_c1 3300050512 Bacteria 3873
1283 nmdc:mga0n895_66150_c1 3300050512 Bacteria 3579
1284 nmdc:mga0n895_91759_c1 3300050512 Bacteria 3040
1285 nmdc:mga0n895_949_c1 3300050512 Bacteria 17319
1286 nmdc:mga0rr50_13245_c1 3300050513 Bacteria 5362
1287 nmdc:mga0rr50_147035_c1 3300050513 Bacteria 1901
1288 nmdc:mga0rr50_154735_c1 3300050513 Bacteria 1856
1289 nmdc:mga0rr50_19_c1 3300050513 Bacteria 158236
1290 nmdc:mga0rr50_323_c1 3300050513 Bacteria 25968
1291 nmdc:mga0rr50_368556_c1 3300050513 Bacteria 1210
1292 nmdc:mga0rr50_37508_c1 3300050513 Bacteria 3499
1293 nmdc:mga0rr50_5441_c1 3300050513 Bacteria 7596
1294 nmdc:mga08x19_139721_c1 3300050514 Bacteria 1635
1295 nmdc:mga08x19_1689_c1 3300050514 Bacteria 13576
1296 nmdc:mga08x19_181248_c1 3300050514 Bacteria 1438
1297 nmdc:mga08x19_20174_c1 3300050514 Bacteria 4103
1298 nmdc:mga08x19_25973_c1 3300050514 Bacteria 3652
1299 nmdc:mga08x19_4588_c1 3300050514 Bacteria 8202
1300 nmdc:mga08x19_64134_c1 3300050514 Bacteria 2385
1301 nmdc:mga08x19_89388_c1 3300050514 Bacteria 2031
1302 nmdc:mga0a205_119277_c1 3300050515 Bacteria 2537
1303 nmdc:mga0a205_127743_c1 3300050515 Bacteria 2442
1304 nmdc:mga0a205_133941_c1 3300050515 Bacteria 2378
1305 nmdc:mga0a205_135289_c1 3300050515 Unclassified 2365
1306 nmdc:mga0a205_139421_c1 3300050515 Bacteria 2325
1307 nmdc:mga0a205_24073_c1 3300050515 Bacteria 5782
1308 nmdc:mga0a205_24948_c1 3300050515 Bacteria 5691
1309 nmdc:mga0a205_256991_c1 3300050515 Bacteria 1625
1310 nmdc:mga0a205_307_c1 3300050515 Bacteria 26469
1311 nmdc:mga0a205_5027_c1 3300050515 Bacteria 11911
1312 Ga0495601_0003752 3300053077 Bacteria 8747
1313 Ga0495601_0014619 3300053077 Bacteria 4732
1314 Ga0495619_0004888 3300053085 Bacteria 8510
1315 Ga0495619_0007328 3300053085 Bacteria 6990
1316 Ga0495619_0027696 3300053085 Bacteria 3653
1317 Ga0495619_0321416 3300053085 Bacteria 1071
1318 Ga0500641_0000444 3300053096 Bacteria 14993
1319 Ga0500645_000406 3300053730 Bacteria 30171
1320 Ga0500645_005991 3300053730 Bacteria 4393
1321 Ga0501084_0001353 3300054114 Bacteria 19369
1322 Ga0501084_0021174 3300054114 Bacteria 5422
1323 Ga0501084_0045402 3300054114 Bacteria 3678
1324 Ga0501084_0137834 3300054114 Bacteria 2054
1325 Ga0501084_0145155 3300054114 Bacteria 1998
1326 Ga0501084_0194547 3300054114 Bacteria 1711
1327 Ga0501084_0309233 3300054114 Bacteria 1335
1328 Ga0501082_0002687 3300060353 Bacteria 15542
1329 Ga0501082_0045429 3300060353 Bacteria 3788
1330 Ga0501082_0289505 3300060353 Bacteria 1426
1331 Ga0501082_0341782 3300060353 Bacteria 1304
1332 Ga0530510_0257957 3300061734 Bacteria 1300
1333 2506866407 2506783011 Bacteria 5323186
1334 2904426889 2904424332 Bacteria 7633521
1335 8003873728 8003870546 Bacteria 7396674
1336 8054729183 8054727385 Bacteria 7558670
1337 Ga0501033_0044629
1338 SwRhRL3b_contig_1548823
1339 Ga0065704_10002648
1340 Ga0065712_10000664
1341 Ga0065712_10003431
1342 Ga0065712_10111389
1343 Ga0065712_10140763
1344 Ga0065715_10011952
1345 Ga0065715_10111119
1346 Ga0065715_10194549
1347 Ga0065715_10211680
1348 Ga0065707_10000716
1349 Ga0065707_10006714
1350 Ga0065707_10009088
1351 Ga0065707_10017633
1352 Ga0065707_10082607
1353 Ga0065707_10087349
1354 Ga0065707_10090877
1355 Ga0065707_10092034
1356 Ga0065707_10097195
1357 Ga0065707_10138419
1358 Ga0070658_10003765
1359 Ga0070676_10001313
1360 Ga0070676_10002029
1361 Ga0070676_10083248
1362 Ga0070676_10143608
1363 Ga0070683_100000441
1364 Ga0070683_100058647
1365 Ga0070690_100004593
1366 Ga0070690_100053974
1367 Ga0070690_100062595
1368 Ga0070670_100000914
1369 Ga0070670_100070787
1370 Ga0070670_100073139
1371 Ga0070670_100083180
1372 Ga0070670_100143507
1373 Ga0070670_100330020
1374 Ga0068869_100076581
1375 Ga0068869_100077375
1376 Ga0068869_100199175
1377 Ga0068869_100273469
1378 Ga0070666_10115949
1379 Ga0070666_10141448
1380 Ga0070666_10275004
1381 Ga0070680_100005221
1382 Ga0070680_100155870
1383 Ga0070680_100199806
1384 Ga0070680_100204858
1385 Ga0070680_100217499
1386 Ga0070680_100316232
1387 Ga0068868_100003742
1388 Ga0068868_100044782
1389 Ga0068868_100046378
1390 Ga0070660_100027018
1391 Ga0070660_100353714
1392 Ga0070689_100012900
1393 Ga0070689_100060516
1394 Ga0070689_100092860
1395 Ga0070689_100107089
1396 Ga0070689_100176844
1397 Ga0070691_10007518
1398 Ga0070691_10103156
1399 Ga0070687_100013401
1400 Ga0070687_100021843
1401 Ga0070687_100040519
1402 Ga0070661_100000760
1403 Ga0070661_100003975
1404 Ga0070661_100005992
1405 Ga0070661_100194410
1406 Ga0070661_100249231
1407 Ga0070661_100315391
1408 Ga0070692_10014113
1409 Ga0070692_10021692
1410 Ga0070668_100000512
1411 Ga0070668_100065191
1412 Ga0070668_100327964
1413 Ga0070668_100370834
1414 Ga0070669_100009884
1415 Ga0070669_100011865
1416 Ga0070669_100017634
1417 Ga0070669_100025080
1418 Ga0070669_100045952
1419 Ga0070669_100259140
1420 Ga0070675_100005742
1421 Ga0070675_100008413
1422 Ga0070675_100172281
1423 Ga0070675_100361081
1424 Ga0070671_100028612
1425 Ga0070671_100106747
1426 Ga0070671_100264380
1427 Ga0070671_100328381
1428 Ga0070671_100427801
1429 Ga0070674_100142974
1430 Ga0070673_100010825
1431 Ga0070673_100091596
1432 Ga0070673_100100536
1433 Ga0070673_100179023
1434 Ga0070673_100210975
1435 Ga0070673_100231048
1436 Ga0070688_100000001
1437 Ga0070688_100043642
1438 Ga0070688_100076845
1439 Ga0070688_100128606
1440 Ga0070688_100181349
1441 Ga0070659_100074412
1442 Ga0070659_100089216
1443 Ga0070659_100132249
1444 Ga0070659_100142702
1445 Ga0070667_100016071
1446 Ga0070667_100026879
1447 Ga0070667_100108559
1448 Ga0070703_10000152
1449 Ga0070709_10090535
1450 Ga0070709_10157501
1451 Ga0070709_10165971
1452 Ga0070714_100040245
1453 Ga0070713_100008765
1454 Ga0070713_100034744
1455 Ga0070701_10040259
1456 Ga0070701_10165203
1457 Ga0070701_10227046
1458 Ga0070711_100010744
1459 Ga0070711_100037721
1460 Ga0070711_100085743
1461 Ga0070711_100175455
1462 Ga0070705_100008199
1463 Ga0070705_100015671
1464 Ga0070705_100031275
1465 Ga0070705_100034141
1466 Ga0070700_100011493
1467 Ga0070700_100012541
1468 Ga0070700_100013017
1469 Ga0070700_100114134
1470 Ga0070700_100134063
1471 Ga0070700_100139858
1472 Ga0070700_100303742
1473 Ga0070694_100000592
1474 Ga0070694_100006937
1475 Ga0070694_100098865
1476 Ga0070694_100149752
1477 Ga0070694_100219445
1478 Ga0070694_100330374
1479 Ga0070708_100006015
1480 Ga0070708_100020071
1481 Ga0070708_100032962
1482 Ga0070708_100049544
1483 Ga0070708_100079872
1484 Ga0070708_100097098
1485 Ga0070708_100193249
1486 Ga0070708_100391997
1487 Ga0070678_100034757
1488 Ga0070678_100204267
1489 Ga0070678_100324593
1490 Ga0070662_100004746
1491 Ga0070662_100165608
1492 Ga0070681_10000352
1493 Ga0070681_10048479
1494 Ga0070681_10166505
1495 Ga0068867_100008651
1496 Ga0068867_100028594
1497 Ga0068867_100060503
1498 Ga0068867_100077776
1499 Ga0068867_100138718
1500 Ga0068867_100247339
1501 Ga0070685_10026688
1502 Ga0070685_10077328
1503 Ga0070685_10188947
1504 Ga0070706_100009017
1505 Ga0070706_100119516
1506 Ga0070706_100152242
1507 Ga0070706_100172103
1508 Ga0070706_100199432
1509 Ga0070707_100000054
1510 Ga0070707_100003246
1511 Ga0070707_100010071
1512 Ga0070707_100010681
1513 Ga0070707_100138732
1514 Ga0070707_100173056
1515 Ga0070698_100000100
1516 Ga0070698_100000405
1517 Ga0070698_100012361
1518 Ga0070698_100012643
1519 Ga0070698_100032930
1520 Ga0070698_100037732
1521 Ga0070698_100057200
1522 Ga0070698_100087070
1523 Ga0070698_100093868
1524 Ga0070698_100153958
1525 Ga0070698_100207299
1526 Ga0070699_100006555
1527 Ga0070699_100006717
1528 Ga0070699_100022062
1529 Ga0070699_100050710
1530 Ga0070699_100118954
1531 Ga0070699_100168447
1532 Ga0070699_100172663
1533 Ga0070699_100334043
1534 Ga0070679_100000126
1535 Ga0070679_100004803
1536 Ga0070679_100049548
1537 Ga0070679_100087335
1538 Ga0070684_100000140
1539 Ga0070684_100000998
1540 Ga0070684_100005201
1541 Ga0070684_100018053
1542 Ga0070684_100024500
1543 Ga0070684_100254208
1544 Ga0070697_100010545
1545 Ga0070697_100016980
1546 Ga0070697_100019393
1547 Ga0070697_100065035
1548 Ga0070697_100086493
1549 Ga0070697_100283887
1550 Ga0068853_100023808
1551 Ga0068853_100037484
1552 Ga0068853_100141029
1553 Ga0070672_100008377
1554 Ga0070672_100031269
1555 Ga0070672_100049715
1556 Ga0070672_100055567
1557 Ga0070672_100067894
1558 Ga0070672_100296528
1559 Ga0070686_100002649
1560 Ga0070686_100013471
1561 Ga0070686_100020379
1562 Ga0070686_100037357
1563 Ga0070686_100256560
1564 Ga0070695_100000599
1565 Ga0070695_100000725
1566 Ga0070695_100020206
1567 Ga0070695_100028301
1568 Ga0070695_100056823
1569 Ga0070695_100094305
1570 Ga0070695_100102432
1571 Ga0070695_100148491
1572 Ga0070696_100000092
1573 Ga0070696_100023279
1574 Ga0070696_100027776
1575 Ga0070696_100173665
1576 Ga0070696_100329474
1577 Ga0070696_100361892
1578 Ga0070693_100000592
1579 Ga0070693_100005102
1580 Ga0070693_100005176
1581 Ga0070693_100068767
1582 Ga0070665_100007034
1583 Ga0070665_100022874
1584 Ga0070665_100033774
1585 Ga0070665_100158327
1586 Ga0070665_100181102
1587 Ga0070704_100000639
1588 Ga0070704_100010823
1589 Ga0070704_100012514
1590 Ga0070704_100016093
1591 Ga0070704_100029465
1592 Ga0070704_100062045
1593 Ga0070704_100078376
1594 Ga0068855_100022301
1595 Ga0068855_100092215
1596 Ga0068855_100245207
1597 Ga0068855_100514677
1598 Ga0070664_100007265
1599 Ga0070664_100052885
1600 Ga0070664_100089757
1601 Ga0070664_100183362
1602 Ga0070664_100375906
1603 Ga0068857_100011145
1604 Ga0068854_100078913
1605 Ga0068854_100243307
1606 Ga0068854_100346136
1607 Ga0070702_100011002
1608 Ga0070702_100074749
1609 Ga0070702_100204835
1610 Ga0068852_100002820
1611 Ga0068859_100016381
1612 Ga0068859_100043700
1613 Ga0068859_100144361
1614 Ga0068859_100162363
1615 Ga0068859_100210547
1616 Ga0068859_100337514
1617 Ga0068859_100397624
1618 Ga0068864_100004084
1619 Ga0068864_100026370
1620 Ga0068864_100087864
1621 Ga0068864_100154210
1622 Ga0068864_100189508
1623 Ga0068864_100274335
1624 Ga0068864_100311257
1625 Ga0068866_10043077
1626 Ga0068866_10070391
1627 Ga0068861_100000412
1628 Ga0068861_100022157
1629 Ga0068861_100031403
1630 Ga0068861_100057580
1631 Ga0068861_100170989
1632 Ga0068851_10033119
1633 Ga0068851_10057679
1634 Ga0068863_100014985
1635 Ga0068863_100145752
1636 Ga0068863_100171914
1637 Ga0068863_100172578
1638 Ga0068863_100174161
1639 Ga0068863_100543953
1640 Ga0068858_100008146
1641 Ga0068858_100018592
1642 Ga0068858_100025743
1643 Ga0068858_100049196
1644 Ga0068858_100211686
1645 Ga0068858_100245237
1646 Ga0068858_100314576
1647 Ga0068860_100007125
1648 Ga0068860_100045046
1649 Ga0068860_100045466
1650 Ga0068860_100079001
1651 Ga0068860_100175841
1652 Ga0068860_100197205
1653 Ga0068860_100361378
1654 Ga0068862_100005934
1655 Ga0068862_100008404
1656 Ga0068862_100015650
1657 Ga0068862_100040049
1658 Ga0068862_100061564
1659 Ga0068862_100065137
1660 Ga0068862_100072056
1661 Ga0068862_100081569
1662 Ga0068862_100103390
1663 Ga0068862_100131154
1664 Ga0068862_100203210
1665 Ga0081538_10092415
1666 Ga0081539_10045686
1667 Ga0081539_10151227
1668 Ga0070717_10013839
1669 Ga0075365_10004369
1670 Ga0075365_10055661
1671 Ga0075368_10024155
1672 Ga0075363_100076048
1673 Ga0075363_100120813
1674 Ga0075364_10002494
1675 Ga0075364_10021750
1676 Ga0075364_10101416
1677 Ga0070715_10036501
1678 Ga0070715_10110447
1679 Ga0070716_100002059
1680 Ga0070716_100071479
1681 Ga0070716_100286203
1682 Ga0070712_100008528
1683 Ga0070712_100073560
1684 Ga0070712_100147570
1685 Ga0075362_10076186
1686 Ga0075367_10004489
1687 Ga0075367_10019528
1688 Ga0075367_10079739
1689 Ga0075367_10141587
1690 Ga0075366_10003085
1691 Ga0075366_10016716
1692 Ga0075366_10037624
1693 Ga0075366_10159080
1694 Ga0097621_100036317
1695 Ga0097621_100080568
1696 Ga0097621_100342686
1697 Ga0097621_100381534
1698 Ga0075370_10001242
1699 Ga0068871_100001050
1700 Ga0068871_100025690
1701 Ga0068871_100052159
1702 Ga0068871_100108035
1703 Ga0068871_100120919
1704 Ga0068871_100185895
1705 Ga0068871_100265835
1706 Ga0068871_100344334
1707 Ga0075428_100000030
1708 Ga0075428_100020724
1709 Ga0075428_100077153
1710 Ga0075428_100082115
1711 Ga0075428_100146391
1712 Ga0075428_100347819
1713 Ga0075428_100409629
1714 Ga0075430_100004540
1715 Ga0075430_100019833
1716 Ga0075430_100028439
1717 Ga0075430_100030187
1718 Ga0075430_100060505
1719 Ga0075430_100200292
1720 Ga0075431_100004879
1721 Ga0075431_100018981
1722 Ga0075431_100021366
1723 Ga0075431_100027041
1724 Ga0075431_100028854
1725 Ga0075431_100045410
1726 Ga0075431_100056677
1727 Ga0075431_100131109
1728 Ga0075431_100155508
1729 Ga0075431_100367597
1730 Ga0075433_10002238
1731 Ga0075433_10003916
1732 Ga0075433_10056002
1733 Ga0075433_10068998
1734 Ga0075433_10111829
1735 Ga0075433_10301102
1736 Ga0075433_10476992
1737 Ga0075434_100007838
1738 Ga0075434_100015409
1739 Ga0075434_100038248
1740 Ga0075434_100058732
1741 Ga0075434_100073809
1742 Ga0075434_100080183
1743 Ga0075434_100087615
1744 Ga0075434_100136407
1745 Ga0075434_100279513
1746 Ga0075434_100322789
1747 Ga0075429_100004096
1748 Ga0075429_100012646
1749 Ga0075429_100025523
1750 Ga0075429_100058817
1751 Ga0075429_100074289
1752 Ga0075429_100081245
1753 Ga0075429_100159760
1754 Ga0075429_100411268
1755 Ga0068865_100017931
1756 Ga0068865_100041175
1757 Ga0068865_100056669
1758 Ga0068865_100080061
1759 Ga0068865_100138330
1760 Ga0068865_100191045
1761 Ga0075436_100003654
1762 Ga0075436_100010018
1763 Ga0075436_100023895
1764 Ga0075436_100100226
1765 Ga0097620_100016381
1766 Ga0097620_100043700
1767 Ga0097620_100099416
1768 Ga0097620_100144358
1769 Ga0097620_100162358
1770 Ga0097620_100210538
1771 Ga0097620_100337500
1772 Ga0097620_100397664
1773 Ga0075435_100000034
1774 Ga0075435_100002807
1775 Ga0075435_100015945
1776 Ga0075435_100056677
1777 Ga0075435_100060029
1778 Ga0075435_100088004
1779 Ga0075435_100152283
1780 Ga0075435_100327405
1781 Ga0075435_100362315
1782 Ga0099794_10004198
1783 Ga0099794_10012800
1784 Ga0099794_10018983
1785 Ga0099794_10024512
1786 Ga0099794_10029125
1787 Ga0099794_10035011
1788 Ga0099794_10054783
1789 Ga0099794_10152017
1790 Ga0099795_10024344
1791 Ga0105251_10045268
1792 Ga0105251_10074008
1793 Ga0105244_10008811
1794 Ga0105240_10000644
1795 Ga0105240_10018646
1796 Ga0105240_10121668
1797 Ga0105240_10407921
1798 Ga0111539_10000015
1799 Ga0111539_10000076
1800 Ga0111539_10000876
1801 Ga0111539_10012436
1802 Ga0111539_10015016
1803 Ga0111539_10025350
1804 Ga0111539_10071487
1805 Ga0111539_10153434
1806 Ga0111539_10197043
1807 Ga0111539_10263913
1808 Ga0111539_10424306
1809 Ga0105245_10062195
1810 Ga0105245_10096498
1811 Ga0105245_10200590
1812 Ga0105245_10298133
1813 Ga0105245_10646841
1814 Ga0105247_10012285
1815 Ga0105247_10022203
1816 Ga0105247_10032618
1817 Ga0105247_10088295
1818 Ga0114129_10003934
1819 Ga0114129_10005715
1820 Ga0114129_10009259
1821 Ga0114129_10009787
1822 Ga0114129_10010235
1823 Ga0114129_10010506
1824 Ga0114129_10018867
1825 Ga0114129_10020396
1826 Ga0114129_10021207
1827 Ga0114129_10040874
1828 Ga0114129_10085473
1829 Ga0114129_10112364
1830 Ga0114129_10116899
1831 Ga0114129_10121005
1832 Ga0114129_10179111
1833 Ga0114129_10205510
1834 Ga0114129_10264670
1835 Ga0114129_10344416
1836 Ga0105243_10000119
1837 Ga0105243_10018099
1838 Ga0105243_10021318
1839 Ga0105243_10026725
1840 Ga0105243_10192570
1841 Ga0105243_10366024
1842 Ga0105243_10417920
1843 Ga0105241_10047993
1844 Ga0105241_10299217
1845 Ga0105241_10424411
1846 Ga0105242_10000514
1847 Ga0105242_10042132
1848 Ga0105242_10059398
1849 Ga0105242_10217046
1850 Ga0105242_10359524
1851 Ga0105242_10445634
1852 Ga0105242_10499974
1853 Ga0105248_10002795
1854 Ga0105248_10005698
1855 Ga0105248_10030427
1856 Ga0105248_10063542
1857 Ga0105248_10081028
1858 Ga0105248_10151575
1859 Ga0105248_10152214
1860 Ga0105248_10174409
1861 Ga0105248_10191929
1862 Ga0105248_10212333
1863 Ga0105248_10277245
1864 Ga0105248_10352512
1865 Ga0105248_10440356
1866 Ga0105248_10456926
1867 Ga0105237_10011697
1868 Ga0105237_10278310
1869 Ga0105238_10084260
1870 Ga0105238_10199581
1871 Ga0105249_10002058
1872 Ga0105249_10026478
1873 Ga0105249_10046721
1874 Ga0105249_10062099
1875 Ga0105249_10179953
1876 Ga0105249_10319794
1877 Ga0105249_10581300
1878 Ga0099796_10030456
1879 Ga0099796_10053014
1880 Ga0105239_10029880
1881 Ga0105239_10066314
1882 Ga0105239_10130083
1883 Ga0105239_10395222
1884 Ga0105239_10395866
1885 Ga0105246_10046138
1886 Ga0105246_10091045
1887 Ga0157371_10045466
1888 Ga0157370_10005959
1889 Ga0157370_10111246
1890 Ga0157370_10431475
1891 Ga0157369_10008685
1892 Ga0157369_10172269
1893 Ga0157369_10470477
1894 Ga0157374_10029053
1895 Ga0157374_10052558
1896 Ga0157374_10082749
1897 Ga0157374_10183418
1898 Ga0157374_10408765
1899 Ga0157378_10000197
1900 Ga0157378_10004551
1901 Ga0157378_10010252
1902 Ga0157378_10068961
1903 Ga0157378_10083371
1904 Ga0157378_10105266
1905 Ga0157378_10198041
1906 Ga0157378_10234818
1907 Ga0157378_10272629
1908 Ga0163162_10027530
1909 Ga0163162_10031078
1910 Ga0163162_10103178
1911 Ga0163162_10137169
1912 Ga0163162_10212397
1913 Ga0163162_10261769
1914 Ga0163162_10435369
1915 Ga0163162_10721344
1916 Ga0157372_10149453
1917 Ga0157372_10174616
1918 Ga0157375_10056638
1919 Ga0157375_10163230
1920 Ga0157375_10696538
1921 Ga0157375_10697319
1922 Ga0163163_10000005
1923 Ga0163163_10011616
1924 Ga0163163_10035216
1925 Ga0163163_10165243
1926 Ga0157380_10003719
1927 Ga0157380_10008511
1928 Ga0157380_10030530
1929 Ga0157380_10069583
1930 Ga0157380_10084073
1931 Ga0157380_10122187
1932 Ga0157380_10155803
1933 Ga0157380_10277393
1934 Ga0157380_10416244
1935 Ga0157380_10663405
1936 Ga0157377_10010241
1937 Ga0157379_10030044
1938 Ga0157379_10144164
1939 Ga0157379_10191386
1940 Ga0157379_10328263
1941 Ga0157376_10000716
1942 Ga0157376_10027855
1943 Ga0157376_10101804
1944 Ga0157376_10113124
1945 Ga0163161_10029054
1946 Ga0163161_10030219
1947 Ga0163161_10077216
1948 Ga0213876_10000111
1949 Ga0213876_10000955
1950 Ga0224572_1029591
1951 Ga0207653_10000492
1952 Ga0207653_10033847
1953 Ga0207642_10060792
1954 Ga0207642_10190736
1955 Ga0207710_10018952
1956 Ga0207710_10037341
1957 Ga0207688_10121065
1958 Ga0207688_10154707
1959 Ga0207680_10031050
1960 Ga0207680_10139134
1961 Ga0207647_10065786
1962 Ga0207699_10078957
1963 Ga0207699_10279574
1964 Ga0207645_10000393
1965 Ga0207645_10009155
1966 Ga0207645_10029509
1967 Ga0207705_10004408
1968 Ga0207705_10171430
1969 Ga0207684_10022673
1970 Ga0207684_10025239
1971 Ga0207684_10068227
1972 Ga0207684_10196915
1973 Ga0207684_10304319
1974 Ga0207707_10001356
1975 Ga0207707_10040016
1976 Ga0207707_10070758
1977 Ga0207695_10006561
1978 Ga0207695_10071994
1979 Ga0207695_10161394
1980 Ga0207671_10009461
1981 Ga0207693_10009180
1982 Ga0207693_10067965
1983 Ga0207693_10152923
1984 Ga0207663_10020406
1985 Ga0207663_10046020
1986 Ga0207663_10048434
1987 Ga0207660_10040352
1988 Ga0207660_10199256
1989 Ga0207662_10021437
1990 Ga0207662_10025733
1991 Ga0207662_10071888
1992 Ga0207657_10005772
1993 Ga0207657_10154733
1994 Ga0207649_10002571
1995 Ga0207649_10082891
1996 Ga0207649_10111454
1997 Ga0207649_10235610
1998 Ga0207652_10005907
1999 Ga0207652_10010698
2000 Ga0207652_10026796
2001 Ga0207652_10110187
2002 Ga0207652_10186187
2003 Ga0207646_10000900
2004 Ga0207646_10003971
2005 Ga0207646_10013324
2006 Ga0207646_10121652
2007 Ga0207646_10173246
2008 Ga0207646_10284227
2009 Ga0207646_10332609
2010 Ga0207681_10024806
2011 Ga0207681_10032533
2012 Ga0207681_10039215
2013 Ga0207681_10054960
2014 Ga0207681_10114556
2015 Ga0207681_10173387
2016 Ga0207681_10291132
2017 Ga0207694_10138683
2018 Ga0207650_10000872
2019 Ga0207650_10067366
2020 Ga0207650_10103749
2021 Ga0207650_10335342
2022 Ga0207659_10025660
2023 Ga0207659_10044776
2024 Ga0207659_10078936
2025 Ga0207659_10082846
2026 Ga0207659_10120972
2027 Ga0207659_10178647
2028 Ga0207687_10014770
2029 Ga0207700_10020150
2030 Ga0207700_10036070
2031 Ga0207700_10121534
2032 Ga0207664_10070026
2033 Ga0207664_10151358
2034 Ga0207644_10090025
2035 Ga0207644_10124536
2036 Ga0207644_10154372
2037 Ga0207644_10205350
2038 Ga0207690_10047149
2039 Ga0207690_10048040
2040 Ga0207706_10000841
2041 Ga0207706_10058701
2042 Ga0207706_10070861
2043 Ga0207686_10000114
2044 Ga0207686_10020401
2045 Ga0207686_10048912
2046 Ga0207686_10249808
2047 Ga0207709_10000162
2048 Ga0207709_10025907
2049 Ga0207709_10091451
2050 Ga0207670_10000012
2051 Ga0207670_10064214
2052 Ga0207670_10086975
2053 Ga0207670_10112668
2054 Ga0207670_10328734
2055 Ga0207669_10198136
2056 Ga0207704_10025787
2057 Ga0207704_10144497
2058 Ga0207704_10261452
2059 Ga0207665_10000053
2060 Ga0207665_10006891
2061 Ga0207665_10116632
2062 Ga0207665_10166861
2063 Ga0207665_10315551
2064 Ga0207691_10000103
2065 Ga0207691_10003569
2066 Ga0207691_10039748
2067 Ga0207691_10145722
2068 Ga0207691_10321471
2069 Ga0207711_10129295
2070 Ga0207711_10154374
2071 Ga0207711_10225992
2072 Ga0207711_10296350
2073 Ga0207711_10510323
2074 Ga0207689_10004944
2075 Ga0207689_10016952
2076 Ga0207689_10026220
2077 Ga0207689_10156306
2078 Ga0207689_10237494
2079 Ga0207689_10267192
2080 Ga0207661_10001023
2081 Ga0207661_10007769
2082 Ga0207661_10030403
2083 Ga0207661_10053408
2084 Ga0207661_10062110
2085 Ga0207679_10006276
2086 Ga0207667_10109983
2087 Ga0207667_10234813
2088 Ga0207667_10520735
2089 Ga0207651_10124237
2090 Ga0207651_10171895
2091 Ga0207651_10335937
2092 Ga0207712_10008254
2093 Ga0207712_10012061
2094 Ga0207712_10024482
2095 Ga0207712_10070992
2096 Ga0207712_10072536
2097 Ga0207712_10157006
2098 Ga0207712_10173972
2099 Ga0207712_10206087
2100 Ga0207668_10058087
2101 Ga0207668_10060838
2102 Ga0207668_10245305
2103 Ga0207668_10398018
2104 Ga0207640_10045028
2105 Ga0207640_10070836
2106 Ga0207640_10164145
2107 Ga0207640_10262482
2108 Ga0207658_10187709
2109 Ga0207658_10326168
2110 Ga0207677_10105165
2111 Ga0207677_10120069
2112 Ga0207677_10180330
2113 Ga0207703_10012842
2114 Ga0207703_10057424
2115 Ga0207703_10170912
2116 Ga0207703_10327545
2117 Ga0207703_10521356
2118 Ga0207639_10339303
2119 Ga0207678_10020951
2120 Ga0207708_10011853
2121 Ga0207708_10023635
2122 Ga0207708_10049578
2123 Ga0207708_10070450
2124 Ga0207708_10092692
2125 Ga0207708_10155575
2126 Ga0207708_10182231
2127 Ga0207708_10280988
2128 Ga0207702_10441769
2129 Ga0207641_10022383
2130 Ga0207641_10095253
2131 Ga0207641_10107100
2132 Ga0207641_10252039
2133 Ga0207641_10281061
2134 Ga0207641_10312427
2135 Ga0207641_10384981
2136 Ga0207641_10439405
2137 Ga0207641_10626045
2138 Ga0207648_10023129
2139 Ga0207648_10051011
2140 Ga0207648_10061227
2141 Ga0207648_10094013
2142 Ga0207648_10099689
2143 Ga0207648_10109377
2144 Ga0207648_10138645
2145 Ga0207648_10146892
2146 Ga0207648_10318447
2147 Ga0207648_10345496
2148 Ga0207648_10417555
2149 Ga0207676_10007518
2150 Ga0207676_10209575
2151 Ga0207676_10299050
2152 Ga0207676_10471762
2153 Ga0207674_10007101
2154 Ga0207674_10237741
2155 Ga0207675_100001905
2156 Ga0207675_100032759
2157 Ga0207675_100037035
2158 Ga0207675_100053235
2159 Ga0207675_100065524
2160 Ga0207675_100079303
2161 Ga0207675_100096683
2162 Ga0207675_100143416
2163 Ga0207675_100178203
2164 Ga0207675_100200135
2165 Ga0207675_100213097
2166 Ga0207675_100281596
2167 Ga0207675_100340199
2168 Ga0207683_10051249
2169 Ga0207683_10199400
2170 Ga0209588_1019560
2171 Ga0209588_1020005
2172 Ga0209588_1021467
2173 Ga0209588_1022317
2174 Ga0207428_10000048
2175 Ga0207428_10000660
2176 Ga0207428_10011057
2177 Ga0207428_10023351
2178 Ga0207428_10047442
2179 Ga0207428_10079044
2180 Ga0207428_10173492
2181 Ga0265354_1000187
2182 Ga0268266_10000299
2183 Ga0268266_10222557
2184 Ga0268265_10005348
2185 Ga0268265_10043713
2186 Ga0268265_10054617
2187 Ga0268265_10060378
2188 Ga0268265_10065098
2189 Ga0268265_10180542
2190 Ga0268265_10200194
2191 Ga0268265_10496196
2192 Ga0268264_10003107
2193 Ga0268264_10017073
2194 Ga0268264_10027874
2195 Ga0268264_10050782
2196 Ga0268264_10077113
2197 Ga0268264_10192040
2198 Ga0268264_10261396
2199 Ga0268264_10353698
2200 Ga0265318_10000010
2201 Ga0265318_10031646
2202 Ga0265338_10058790
2203 Ga0265338_10154903
2204 Ga0316182_1038488
2205 Ga0265765_1006298
2206 Ga0265330_10000206
2207 Ga0265332_10000108
2208 Ga0265328_10001280
2209 Ga0265320_10000013
2210 Ga0265329_10003991
2211 Ga0265331_10000056
2212 Ga0265331_10106451
2213 Ga0265316_10071623
2214 Ga0307408_100003272
2215 Ga0307408_100066312
2216 Ga0307408_100142795
2217 Ga0307408_100229690
2218 Ga0265313_10000464
2219 Ga0316579_10028430
2220 Ga0265314_10000237
2221 Ga0316576_10013295
2222 Ga0316578_10227544
2223 Ga0307405_10034484
2224 Ga0307405_10037068
2225 Ga0307405_10210889
2226 Ga0316577_10016355
2227 Ga0307410_10002437
2228 Ga0307410_10182626
2229 Ga0307406_10043534
2230 Ga0307406_10044408
2231 Ga0307406_10106886
2232 Ga0307406_10318171
2233 Ga0307407_10015107
2234 Ga0307407_10144335
2235 Ga0307412_10010599
2236 Ga0307412_10014803
2237 Ga0307412_10253326
2238 Ga0307409_100001071
2239 Ga0307409_100054524
2240 Ga0307409_100057918
2241 Ga0307416_100060060
2242 Ga0307416_100087499
2243 Ga0307416_100100391
2244 Ga0307414_10053894
2245 Ga0307411_10034462
2246 Ga0307411_10091974
2247 Ga0307411_10193810
2248 Ga0307411_10239667
2249 Ga0307415_100002245
2250 Ga0307415_100006144
2251 Ga0307415_100227942
2252 Ga0316212_1004218
2253 Ga0316212_1009975
2254 Ga0373930_0000600
2255 Ga0373959_0001295
2256 Ga0373934_0001513
2257 Ga0373934_0005497
2258 Ga0373949_0002690
2259 Ga0373951_0002465
2260 Ga0373951_0033450
2261 Ga0373952_0002482
2262 Ga0373945_0041812
2263 Ga0373954_0000270
2264 Ga0373954_0009594
2265 Ga0373956_0001047
2266 Ga0373956_0010879
2267 Ga0373957_0000961
2268 Ga0373957_0003322
2269 Ga0373957_0016285
2270 Ga0373960_0010597
2271 Ga0373946_0101784
2272 Ga0373955_0000322
2273 Ga0373955_0003499
2274 Ga0373955_0018011
2275 Ga0373955_0108691
2276 Ga0373942_0000525
2277 Ga0373942_0037990
2278 Ga0373961_0003420
2279 Ga0373962_0002386
2280 Ga0316574_0001110
2281 Ga0316574_0001115
2282 Ga0316574_0005535
2283 Ga0373931_0008035
2284 Ga0373931_0135613
2285 Ga0373927_0158874
2286 Ga0373933_0000856
2287 Ga0373933_0012838
2288 Ga0373933_0106560
2289 Ga0373933_0117586
2290 Ga0373947_0209452
2291 Ga0373937_0000185
2292 Ga0373937_0000453
2293 Ga0373937_0001854
2294 Ga0373937_0006882
2295 Ga0373937_0164290
2296 Ga0373937_0208769
2297 Ga0316582_0001440
2298 Ga0316582_0050221
2299 Ga0316582_0187664
2300 Ga0316582_0271906
2301 Ga0316584_0002867
2302 Ga0316584_0044221
2303 Ga0373925_0089244
2304 Ga0373925_0106562
2305 Ga0373925_0109858
2306 Ga0395900_0019937
2307 Ga0395898_0389084
2308 Ga0395898_0462411
2309 Ga0395905_0317599
2310 Ga0395905_0341424
2311 Ga0316581_0007018
2312 Ga0395901_0302964
2313 Ga0395901_0546703
2314 Ga0436365_0407503
2315 Ga0436365_0785613
2316 Ga0436365_0956146
2317 Ga0436365_1322014
2318 Ga0439438_000475
2319 Ga0451853_0258695
2320 Ga0450923_025608
2321 Ga0439446_0006600
2322 Ga0451577_0018237
2323 Ga0451577_0081581
2324 Ga0451577_0629219
2325 Ga0453683_0004295
2326 Ga0453683_0005872
2327 Ga0453683_0041611
2328 Ga0453683_0330022
2329 Ga0453684_0043719
2330 Ga0453684_0066760
2331 Ga0453684_0092549
2332 Ga0453684_0092682
2333 Ga0453684_0157103
2334 Ga0453684_0218311
2335 Ga0453684_0360436
2336 Ga0451576_0005853
2337 Ga0451576_0027453
2338 Ga0451576_0039150
2339 Ga0451576_0077410
2340 Ga0451576_0348937
2341 Ga0451576_0418419
2342 Ga0495592_0108928
2343 Ga0495603_0018948
2344 Ga0495603_0061696
2345 Ga0495629_0056118
2346 Ga0495651_0003288
2347 Ga0495651_0100225
2348 Ga0495653_0055947
2349 Ga0495580_0001866
2350 Ga0495580_0011032
2351 Ga0495580_0014378
2352 Ga0495582_0001408
2353 Ga0495582_0045593
2354 Ga0495582_0132531
2355 Ga0495639_0062123
2356 Ga0495662_0133108
2357 Ga0495594_0011693
2358 Ga0495594_0030427
2359 Ga0495608_0000990
2360 Ga0495610_0044529
2361 Ga0495610_0057554
2362 Ga0495652_0041109
2363 Ga0495640_0015177
2364 Ga0495640_0137661
2365 Ga0495586_0049520
2366 Ga0495587_0008193
2367 Ga0495587_0009801
2368 Ga0495598_0000652
2369 Ga0495598_0069456
2370 Ga0495621_0000485
2371 Ga0495645_0000133
2372 Ga0495667_0008898
2373 Ga0495667_0025361
2374 Ga0495625_0015326
2375 Ga0495635_0034497
2376 Ga0495659_0034152
2377 Ga0495657_0037458
2378 Ga0495599_0048959
2379 Ga0495599_0162693
2380 Ga0495623_0194499
2381 Ga0495647_0015492
2382 Ga0495647_0036442
2383 Ga0495658_0046261
2384 Ga0495658_0063480
2385 Ga0495658_0135364
2386 Ga0495613_0149424
2387 Ga0495613_0185817
2388 Ga0495600_0034676
2389 Ga0495600_0090361
2390 Ga0495581_0041506
2391 Ga0495581_0088481
2392 Ga0495604_0000234
2393 Ga0495674_0055100
2394 Ga0495676_0130217
2395 Ga0495680_0054918
2396 Ga0495675_0004566
2397 Ga0495681_0070518
2398 Ga0495684_0005214
2399 Ga0495684_0057965
2400 Ga0495602_0099331
2401 Ga0496100_0108064
2402 Ga0496100_0235824
2403 Ga0496101_0042595
2404 Ga0496101_0056099
2405 Ga0496102_0001041
2406 Ga0496103_0003737
2407 Ga0496103_0021767
2408 Ga0496104_0018942
2409 Ga0496104_0054213
2410 Ga0496104_0084299
2411 Ga0496104_0135824
2412 Ga0496104_0258525
2413 Ga0496107_0183054
2414 Ga0496107_0285288
2415 Ga0496107_0288644
2416 Ga0496108_0000134
2417 Ga0496108_0001329
2418 Ga0496108_0046389
2419 Ga0496108_0164895
2420 Ga0496109_0014292
2421 Ga0496109_0044916
2422 Ga0496109_0078316
2423 Ga0496110_0005097
2424 Ga0496111_0240603
2425 Ga0496112_0034333
2426 Ga0496112_0047903
2427 Ga0496112_0065653
2428 Ga0496113_0000718
2429 Ga0496114_0007389
2430 Ga0496114_0079317
2431 Ga0496114_0134717
2432 Ga0496115_0050582
2433 Ga0496115_0335860
2434 Ga0501031_0097552
2435 Ga0501031_0141513
2436 Ga0501032_0005535
2437 Ga0501033_0003247
2438 Ga0501033_0003860
2439 Ga0501034_0003606
2440 Ga0501034_0008048
2441 Ga0501034_0010040
2442 Ga0501034_0087660
2443 Ga0501034_0094314
2444 Ga0501034_0105654
2445 Ga0501034_0130556
2446 Ga0501034_0134441
2447 Ga0501034_0137880
2448 Ga0501036_0002149
2449 Ga0501036_0009795
2450 Ga0501036_0013511
2451 Ga0501036_0031013
2452 Ga0501036_0065687
2453 Ga0501036_0236144
2454 Ga0501037_0014764
2455 Ga0501037_0044823
2456 Ga0501037_0071177
2457 Ga0501038_0013312
2458 Ga0501038_0015788
2459 Ga0501038_0046053
2460 Ga0501038_0127636
2461 Ga0501038_0348267
2462 Ga0501039_0004307
2463 Ga0501039_0018612
2464 Ga0501039_0058449
2465 Ga0501039_0221810
2466 Ga0501041_0137951
2467 Ga0501041_0157309
2468 Ga0501042_0005425
2469 Ga0501042_0038751
2470 Ga0501042_0096606
2471 Ga0501042_0175467
2472 Ga0501042_0216084
2473 Ga0501043_0002399
2474 Ga0501043_0006965
2475 Ga0501043_0101961
2476 Ga0501043_0278628
2477 Ga0501046_0075330
2478 Ga0501046_0157180
2479 Ga0501047_0002033
2480 Ga0501047_0007398
2481 Ga0501047_0016062
2482 Ga0501047_0053243
2483 Ga0501047_0086943
2484 Ga0501047_0164895
2485 Ga0501047_0301384
2486 Ga0501048_0000987
2487 Ga0501048_0017349
2488 Ga0501048_0021630
2489 Ga0501048_0080420
2490 Ga0501067_0001874
2491 Ga0501067_0045453
2492 Ga0501067_0131234
2493 Ga0501068_0010906
2494 Ga0501068_0027406
2495 Ga0501068_0121248
2496 Ga0501069_0010453
2497 Ga0501069_0026109
2498 Ga0501070_0006182
2499 Ga0501070_0045422
2500 Ga0501070_0059736
2501 Ga0501071_0032017
2502 Ga0501071_0038942
2503 Ga0501071_0191189
2504 Ga0501072_0209743
2505 Ga0501072_0216258
2506 Ga0501072_0218416
2507 Ga0501073_0004696
2508 Ga0501073_0011025
2509 Ga0501073_0030832
2510 Ga0501073_0032660
2511 Ga0501073_0034403
2512 Ga0501073_0215319
2513 Ga0501074_0023477
2514 Ga0501074_0092637
2515 Ga0501075_0015806
2516 Ga0501075_0033069
2517 Ga0501076_0010590
2518 Ga0501076_0105168
2519 Ga0501076_0344697
2520 Ga0501077_0272770
2521 Ga0501217_003067
2522 Ga0501239_002420
2523 Ga0501242_001249
2524 Ga0501247_000223
2525 Ga0501249_013755
2526 Ga0501225_0002663
2527 Ga0501079_0371972
2528 Ga0501080_0017002
2529 Ga0501080_0053695
2530 Ga0501080_0133734
2531 Ga0501081_0127718
2532 Ga0501081_0150044
2533 Ga0501083_0002394
2534 Ga0501083_0015302
2535 Ga0501083_0047126
2536 Ga0501083_0088259
2537 Ga0501263_002316
2538 Ga0501268_001794
2539 Ga0501270_000288
2540 Ga0501035_0002476
2541 Ga0501035_0010613
2542 Ga0501035_0019365
2543 Ga0501035_0019538
2544 Ga0501035_0153678
2545 Ga0501044_0009140
2546 Ga0501044_0038537
2547 Ga0501044_0071099
2548 Ga0501045_0019789
2549 Ga0501045_0033068
2550 Ga0501045_0371418
2551 nmdc:mga03683_16492_c1
2552 nmdc:mga03683_17938_c1
2553 nmdc:mga03683_20103_c1
2554 nmdc:mga03n38_22908_c1
2555 nmdc:mga00v17_4543_c1
2556 nmdc:mga00v17_62248_c1
2557 nmdc:mga0yw44_23083_c1
2558 nmdc:mga0k408_1635_c1
2559 nmdc:mga06z11_49098_c1
2560 nmdc:mga07m45_3548_c1
2561 nmdc:mga05p37_12702_c1
2562 nmdc:mga05p37_131149_c1
2563 nmdc:mga05p37_1395_c2
2564 nmdc:mga05p37_17242_c1
2565 nmdc:mga05p37_20429_c1
2566 nmdc:mga05p37_265866_c1
2567 nmdc:mga05p37_3102_c1
2568 nmdc:mga05p37_31579_c1
2569 nmdc:mga05p37_31_c2
2570 nmdc:mga05p37_38451_c1
2571 nmdc:mga05p37_42717_c1
2572 nmdc:mga05p37_4975_c1
2573 nmdc:mga05p37_66473_c1
2574 nmdc:mga05p37_83167_c1
2575 nmdc:mga05p37_85_c1
2576 nmdc:mga09592_2037_c2
2577 nmdc:mga09592_224613_c1
2578 nmdc:mga09592_261282_c1
2579 nmdc:mga09592_487094_c1
2580 nmdc:mga09592_51012_c1
2581 nmdc:mga09592_54458_c1
2582 nmdc:mga09592_8625_c1
2583 nmdc:mga09592_90106_c1
2584 nmdc:mga0qj67_11689_c1
2585 nmdc:mga0qj67_14957_c1
2586 nmdc:mga0qj67_18432_c1
2587 nmdc:mga0qj67_97770_c1
2588 nmdc:mga06r32_29459_c1
2589 nmdc:mga06r32_48200_c1
2590 nmdc:mga06r32_61333_c1
2591 nmdc:mga06r32_9156_c1
2592 nmdc:mga06r32_9243_c1
2593 nmdc:mga08y16_101921_c1
2594 nmdc:mga08y16_132128_c1
2595 nmdc:mga08y16_1349_c1
2596 nmdc:mga08y16_158947_c1
2597 nmdc:mga08y16_195020_c1
2598 nmdc:mga08y16_27219_c1
2599 nmdc:mga08y16_275158_c1
2600 nmdc:mga08y16_348550_c1
2601 nmdc:mga08y16_37273_c1
2602 nmdc:mga08y16_46538_c1
2603 nmdc:mga08y16_5440_c1
2604 nmdc:mga08y16_549595_c1
2605 nmdc:mga08y16_7712_c1
2606 nmdc:mga08y16_79440_c1
2607 nmdc:mga08y16_8_c1
2608 nmdc:mga0n895_12071_c1
2609 nmdc:mga0n895_151506_c1
2610 nmdc:mga0n895_15518_c1
2611 nmdc:mga0n895_208572_c1
2612 nmdc:mga0n895_21471_c1
2613 nmdc:mga0n895_2531_c1
2614 nmdc:mga0n895_32834_c1
2615 nmdc:mga0n895_344559_c1
2616 nmdc:mga0n895_35465_c1
2617 nmdc:mga0n895_39264_c1
2618 nmdc:mga0n895_56295_c1
2619 nmdc:mga0n895_66150_c1
2620 nmdc:mga0n895_91759_c1
2621 nmdc:mga0n895_949_c1
2622 nmdc:mga0rr50_13245_c1
2623 nmdc:mga0rr50_147035_c1
2624 nmdc:mga0rr50_154735_c1
2625 nmdc:mga0rr50_19_c1
2626 nmdc:mga0rr50_323_c1
2627 nmdc:mga0rr50_368556_c1
2628 nmdc:mga0rr50_37508_c1
2629 nmdc:mga0rr50_5441_c1
2630 nmdc:mga08x19_139721_c1
2631 nmdc:mga08x19_1689_c1
2632 nmdc:mga08x19_181248_c1
2633 nmdc:mga08x19_20174_c1
2634 nmdc:mga08x19_25973_c1
2635 nmdc:mga08x19_4588_c1
2636 nmdc:mga08x19_64134_c1
2637 nmdc:mga08x19_89388_c1
2638 nmdc:mga0a205_119277_c1
2639 nmdc:mga0a205_127743_c1
2640 nmdc:mga0a205_133941_c1
2641 nmdc:mga0a205_135289_c1
2642 nmdc:mga0a205_139421_c1
2643 nmdc:mga0a205_24073_c1
2644 nmdc:mga0a205_24948_c1
2645 nmdc:mga0a205_256991_c1
2646 nmdc:mga0a205_307_c1
2647 nmdc:mga0a205_5027_c1
2648 Ga0495601_0003752
2649 Ga0495601_0014619
2650 Ga0495619_0004888
2651 Ga0495619_0007328
2652 Ga0495619_0027696
2653 Ga0495619_0321416
2654 Ga0500641_0000444
2655 Ga0500645_000406
2656 Ga0500645_005991
2657 Ga0501084_0001353
2658 Ga0501084_0021174
2659 Ga0501084_0045402
2660 Ga0501084_0137834
2661 Ga0501084_0145155
2662 Ga0501084_0194547
2663 Ga0501084_0309233
2664 Ga0501082_0002687
2665 Ga0501082_0045429
2666 Ga0501082_0289505
2667 Ga0501082_0341782
2668 Ga0530510_0257957
2669 2506866407
2670 2904426889
2671 8003873728
2672 8054729183

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

77

375

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3v0t-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.8543 1 311
4xap-assembly1.cif.gz_A crystal structure of aldo-keto reductase from sinorhizobium meliloti 1021 0.8539 1 319
4exa-assembly1.cif.gz_A crystal structure of the pa4992, the putative aldo-keto reductase from pseudomona aeruginosa 0.8396 3 296
4exb-assembly1.cif.gz_A putative aldo-keto reductase from pseudomona aeruginosa 0.8389 3 296
4exb-assembly2.cif.gz_F putative aldo-keto reductase from pseudomona aeruginosa 0.8389 3 296
ID Description Score Start End Superfamily
4xapA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8539 1 319 3.20.20.100
1ynpB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8438 1 313 3.20.20.100
af_F4HPY8_8_325_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8405 1 312 3.20.20.100
af_Q2G0G6_3_309_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8403 2 312 3.20.20.100
af_Q2FY71_1_289_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8369 1 310 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A2V8RKK5-F1-model_v4 Aldo/keto reductase 0.9937 45 163
AF-A0A0F9IUQ6-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.993 58 208
AF-A0A1H7IDF7-F1-model_v4 Predicted oxidoreductase 0.9861 1 323 GO:0016491
AF-X1IBD0-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9848 1 210
AF-A0A1H7IDF7-F1-model_v4 Predicted oxidoreductase 0.9831 1 323 GO:0016491

Map