F493081

General Info

Members Datasets Scaffolds Average Seq Length
1331 686 1100 327

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0004071|Ga0496121_0004071_313_1293
Length 326
Sequence MSDQVHILSIGQMMPAVDAALEQQFVLHQADIHNIKSVLAQAGDQIRGIATRGRQKTDAALIAALPRLEIVSNFGVGYDSIDIAAAVKRGIVITNTPDVLNAEVADFTVGLLLATIRELPQADRYLRDGKWPTSPFHLTQTLRDRTIGLIGMGRIGQAIAKRIAAFDVPVVYHSRKSQPNVSYRYYPDLKAMASEVDTLIAIVPGGAATKHMINAEILRALGSRGILINVARGSVVDQGALIDALRDGTIHGAGLDVFADEPNVPPELMAMQNTVRVPHVGSGTHHTRAVMGELVVDNLRSWFAGKGPVTPVPETPWPKSQTSSHL

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
10 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
11 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
12 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
13 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
14 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
15 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
16 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
17 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
18 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
19 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
20 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
21 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
22 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
23 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
24 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
25 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
26 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
27 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
28 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
29 2643221651 Afipia sp. Root123D2 Isolate Unclassified
30 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
31 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
32 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
33 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
34 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
35 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
36 2791355199
37 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
38 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
39 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
40 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
41 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
42 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
43 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
44 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
45 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
46 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
47 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
48 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
49 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
50 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
51 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
52 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
53 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
54 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
55 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
56 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
57 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
58 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
59 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
60 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
61 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
62 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
63 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
64 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
65 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
66 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
67 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
68 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
69 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
70 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
71 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
72 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
73 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
74 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
75 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
76 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
77 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
78 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
79 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
80 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
81 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
82 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
83 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
84 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
85 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
86 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
87 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
88 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
89 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
90 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
91 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
92 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
93 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
94 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
95 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
96 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
97 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
98 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
99 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
100 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
101 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
102 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
103 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
104 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
105 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
106 2904699407
107 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
108 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
109 2906610324
110 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
111 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
112 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
113 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
114 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
115 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
116 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
117 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
118 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
119 2922368715
120 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
121 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
122 2922425934
123 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
124 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
125 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
126 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
127 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
128 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
129 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
130 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
131 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
132 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
133 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
134 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
135 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
136 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
137 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
138 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
139 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
140 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
141 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
142 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
143 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
144 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
145 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
146 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
147 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
148 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
149 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
150 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
151 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
152 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
153 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
154 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
155 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
156 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
157 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
158 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
159 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
160 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
161 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
162 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
163 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
164 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
165 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
166 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
167 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
168 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
169 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
170 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
171 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
172 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
173 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
174 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
175 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
176 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
177 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
178 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
179 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
180 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
181 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
182 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
183 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
184 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
185 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
186 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
187 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
188 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
189 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
190 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
191 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
192 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
193 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
194 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
195 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
196 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
197 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
198 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
199 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
200 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
201 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
202 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
203 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
204 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
205 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
206 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
207 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
208 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
209 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
210 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
211 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
212 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
213 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
214 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
215 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
216 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
217 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
218 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
219 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
220 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
221 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
222 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
223 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
224 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
225 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
226 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
227 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
228 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
229 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
230 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
231 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
232 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
233 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
234 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
235 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
236 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
237 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
238 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
239 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
240 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
241 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
242 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
243 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
244 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
245 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
246 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
247 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
248 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
249 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
250 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
251 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
252 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
253 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
254 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
255 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
256 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
257 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
258 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
259 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
260 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
261 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
262 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
263 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
264 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
265 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
266 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
267 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
268 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
269 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
270 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
271 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
272 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
273 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
274 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
275 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
276 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
277 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
278 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
279 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
280 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
281 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
282 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
283 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
284 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
285 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
286 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
287 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
288 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
289 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
290 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
291 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
292 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
293 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
294 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
295 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
296 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
297 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
298 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
299 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
300 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
301 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
302 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
303 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
304 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
305 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
306 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
307 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
308 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
309 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
310 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
311 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
312 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
313 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
314 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
315 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
316 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
317 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
318 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
319 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
320 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
321 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
322 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
323 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
324 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
325 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
326 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
327 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
369 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
370 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
371 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
374 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
375 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
376 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
377 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
378 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
379 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
381 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
382 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
383 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
384 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
385 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
386 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
387 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
389 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
390 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
391 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
392 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
393 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
394 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
395 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
396 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
397 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
398 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
399 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
400 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
401 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
402 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
403 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
404 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
405 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
406 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
407 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
408 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
409 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
410 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
411 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
412 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
413 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
414 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
415 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
416 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
417 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
418 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
419 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
420 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
421 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
422 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
423 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
424 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
425 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
426 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
427 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
428 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
429 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
430 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
431 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
432 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
433 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
434 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
435 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
436 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
437 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
438 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
439 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
440 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
441 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
442 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
443 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
444 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
445 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
446 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
447 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
448 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
449 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
450 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
451 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
452 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
453 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
454 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
455 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
456 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
457 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
458 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
459 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
460 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
461 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
462 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
463 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
464 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
465 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
466 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
467 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
468 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
469 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
470 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
471 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
472 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
473 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
474 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
475 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
476 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
477 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
478 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
479 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
480 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
481 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
482 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
483 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
484 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
485 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
486 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
487 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
488 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
489 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
490 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
491 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
492 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
493 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
494 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
495 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
496 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
497 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
498 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
499 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
500 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
501 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
502 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
503 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
504 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
505 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
506 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
507 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
508 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
509 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
510 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
511 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
512 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
513 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
514 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
515 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
516 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
517 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
518 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
519 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
520 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
521 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
522 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
523 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
524 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
525 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
526 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
527 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
528 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
529 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
530 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
531 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
532 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
533 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
534 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
535 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
536 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
537 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
538 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
539 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
540 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
541 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
542 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
543 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
544 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
545 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
546 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
547 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
548 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
549 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
550 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
551 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
552 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
553 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
554 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
555 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
556 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
557 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
558 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
559 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
560 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
561 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
562 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
563 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
564 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
565 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
566 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
567 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
568 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
569 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
570 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
571 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
572 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
573 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
574 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
575 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
576 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
577 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
578 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
579 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
580 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
581 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
582 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
583 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
584 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
585 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
586 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
587 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
588 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
589 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
590 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
591 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
592 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
593 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
594 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
595 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
596 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
597 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
598 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
599 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
600 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
601 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
602 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
603 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
604 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
605 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
606 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
607 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
608 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
609 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
610 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
611 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
612 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
613 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
614 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
615 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
616 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
617 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
618 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
619 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
620 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
621 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
622 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
623 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
624 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
625 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
626 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
627 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
628 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
629 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
630 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
631 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
632 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
633 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
634 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
635 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
636 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
637 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
638 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
639 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
640 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
641 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
642 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
643 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
644 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
645 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
646 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
647 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
648 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
649 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
650 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
651 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
652 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
653 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
654 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
655 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
656 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
657 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
658 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
659 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
660 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
661 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
662 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
663 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
664 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
665 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
666 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
667 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
668 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
669 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
670 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
671 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
672 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
673 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
674 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
675 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
676 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
677 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
678 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
679 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
680 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
681 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
682 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
683 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
684 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
685 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
686 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 82.88
Metatranscriptomes 0.08
Isolates 17.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.99
Nodule 13.6
Rhizoplane 5.79
Rhizosphere 58.98
Stem 0
Stem Tuber 0
Unclassified 11.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000425 3300001979 Bacteria 18047
2 JGI24735J21928_10004541 3300002067 Bacteria 4666
3 JGI25406J46586_10000170 3300003203 Bacteria 29119
4 JGI25406J46586_10020229 3300003203 Bacteria 2696
5 JGI25153J46596_10007605 3300003215 Bacteria 5297
6 JGI25153J46596_10014183 3300003215 Bacteria 3328
7 JGI25404J52841_10002788 3300003659 Bacteria 3363
8 JGI25404J52841_10020255 3300003659 Bacteria 1441
9 JGI25404J52841_10020816 3300003659 Bacteria 1420
10 Ga0055539_1005620 3300003752 Bacteria 1622
11 Ga0055524_1025744 3300003775 Bacteria 1834
12 Ga0055531_10001969 3300003794 Bacteria 14324
13 Ga0055543_1007718 3300004625 Bacteria 2456
14 Ga0065165_1002418 3300005262 Bacteria 15912
15 Ga0065165_1004254 3300005262 Bacteria 9053
16 Ga0070658_10022210 3300005327 Bacteria 5092
17 Ga0070658_10418233 3300005327 Bacteria 1152
18 Ga0070676_10007989 3300005328 Bacteria 5689
19 Ga0070683_100050728 3300005329 Bacteria 3842
20 Ga0070683_100349627 3300005329 Bacteria 1408
21 Ga0070683_100417424 3300005329 Bacteria 1280
22 Ga0070680_100067985 3300005336 Bacteria 2924
23 Ga0070680_100473476 3300005336 Bacteria 1070
24 Ga0070682_100023808 3300005337 Bacteria 3639
25 Ga0070682_100108793 3300005337 Bacteria 1844
26 Ga0070660_100382763 3300005339 Bacteria 1161
27 Ga0070689_100141027 3300005340 Bacteria 1938
28 Ga0070689_100314067 3300005340 Bacteria 1307
29 Ga0070661_100295139 3300005344 Bacteria 1260
30 Ga0070661_100298027 3300005344 Bacteria 1254
31 Ga0070692_10185132 3300005345 Bacteria 1209
32 Ga0070668_100015166 3300005347 Bacteria 5758
33 Ga0070668_100016551 3300005347 Bacteria 5512
34 Ga0070668_100192363 3300005347 Bacteria 1671
35 Ga0070675_100291316 3300005354 Bacteria 1437
36 Ga0070675_100445646 3300005354 Bacteria 1160
37 Ga0070671_100013043 3300005355 Bacteria 6698
38 Ga0070671_100193799 3300005355 Bacteria 1722
39 Ga0070671_100264604 3300005355 Bacteria 1461
40 Ga0070671_100370648 3300005355 Bacteria 1223
41 Ga0070674_100038335 3300005356 Bacteria 3229
42 Ga0070674_100052473 3300005356 Bacteria 2813
43 Ga0070673_100251779 3300005364 Bacteria 1540
44 Ga0070659_100060018 3300005366 Bacteria 3004
45 Ga0070667_100025504 3300005367 Bacteria 4914
46 Ga0070709_10006483 3300005434 Bacteria 6378
47 Ga0070709_10033865 3300005434 Bacteria 3093
48 Ga0070709_10107221 3300005434 Bacteria 1872
49 Ga0070714_100003521 3300005435 Bacteria 11689
50 Ga0070714_100004001 3300005435 Bacteria 11083
51 Ga0070714_100012654 3300005435 Bacteria 6739
52 Ga0070714_100061329 3300005435 Bacteria 3230
53 Ga0070714_100155992 3300005435 Bacteria 2061
54 Ga0070714_100559230 3300005435 Bacteria 1096
55 Ga0070713_100006580 3300005436 Bacteria 8075
56 Ga0070713_100006616 3300005436 Bacteria 8057
57 Ga0070713_100055790 3300005436 Bacteria 3285
58 Ga0070713_100080610 3300005436 Bacteria 2776
59 Ga0070713_100101588 3300005436 Bacteria 2492
60 Ga0070710_10000219 3300005437 Bacteria 26539
61 Ga0070710_10015416 3300005437 Bacteria 3868
62 Ga0070710_10070845 3300005437 Bacteria 2009
63 Ga0070710_10078935 3300005437 Bacteria 1917
64 Ga0070711_100002404 3300005439 Bacteria 10676
65 Ga0070711_100002832 3300005439 Bacteria 9961
66 Ga0070711_100007523 3300005439 Bacteria 6631
67 Ga0070711_100023994 3300005439 Bacteria 3974
68 Ga0070711_100200420 3300005439 Bacteria 1540
69 Ga0070705_100040255 3300005440 Bacteria 2657
70 Ga0070708_100061161 3300005445 Bacteria 3364
71 Ga0070663_100003302 3300005455 Bacteria 9291
72 Ga0070663_100012874 3300005455 Bacteria 5311
73 Ga0070663_100089732 3300005455 Bacteria 2275
74 Ga0070663_100119546 3300005455 Bacteria 1989
75 Ga0070663_100216284 3300005455 Bacteria 1503
76 Ga0070678_100121198 3300005456 Bacteria 2063
77 Ga0070678_100369908 3300005456 Bacteria 1237
78 Ga0070662_100362989 3300005457 Bacteria 1189
79 Ga0070681_10009562 3300005458 Bacteria 9537
80 Ga0070681_10058567 3300005458 Bacteria 3831
81 Ga0070681_10369461 3300005458 Bacteria 1345
82 Ga0070706_100206761 3300005467 Bacteria 1833
83 Ga0070707_100039062 3300005468 Bacteria 4536
84 Ga0070679_100022307 3300005530 Bacteria 6188
85 Ga0070679_100083660 3300005530 Bacteria 3179
86 Ga0070679_100106676 3300005530 Bacteria 2787
87 Ga0070679_100263811 3300005530 Bacteria 1677
88 Ga0070679_100327180 3300005530 Bacteria 1481
89 Ga0070684_100011463 3300005535 Bacteria 7061
90 Ga0070684_100112861 3300005535 Bacteria 2438
91 Ga0070697_100156128 3300005536 Bacteria 1926
92 Ga0068853_100036694 3300005539 Bacteria 4169
93 Ga0068853_100038220 3300005539 Bacteria 4087
94 Ga0068853_100122686 3300005539 Bacteria 2319
95 Ga0068853_100156671 3300005539 Bacteria 2052
96 Ga0068853_100249648 3300005539 Bacteria 1628
97 Ga0068853_100387183 3300005539 Bacteria 1306
98 Ga0070672_100282173 3300005543 Bacteria 1404
99 Ga0070696_100122749 3300005546 Bacteria 1882
100 Ga0070693_100126214 3300005547 Bacteria 1593
101 Ga0070665_100063100 3300005548 Bacteria 3715
102 Ga0070665_100113564 3300005548 Bacteria 2712
103 Ga0070665_100230562 3300005548 Bacteria 1852
104 Ga0070704_100145198 3300005549 Bacteria 1858
105 Ga0068855_100025942 3300005563 Bacteria 7011
106 Ga0068855_100055336 3300005563 Bacteria 4660
107 Ga0068855_100087122 3300005563 Bacteria 3610
108 Ga0068855_100121183 3300005563 Bacteria 2993
109 Ga0068855_100145326 3300005563 Bacteria 2700
110 Ga0070664_100143577 3300005564 Bacteria 2103
111 Ga0070664_100345887 3300005564 Bacteria 1352
112 Ga0068857_100014108 3300005577 Bacteria 6957
113 Ga0068857_100017627 3300005577 Bacteria 6261
114 Ga0068854_100004314 3300005578 Bacteria 8961
115 Ga0068854_100040592 3300005578 Bacteria 3284
116 Ga0068854_100085691 3300005578 Bacteria 2334
117 Ga0068856_100002788 3300005614 Bacteria 17883
118 Ga0068856_100021565 3300005614 Bacteria 6261
119 Ga0068856_100037771 3300005614 Bacteria 4739
120 Ga0068856_100050275 3300005614 Bacteria 4109
121 Ga0068856_100147691 3300005614 Bacteria 2359
122 Ga0068856_100151030 3300005614 Bacteria 2332
123 Ga0068856_100209451 3300005614 Bacteria 1964
124 Ga0068852_100017600 3300005616 Bacteria 5612
125 Ga0068852_100027985 3300005616 Bacteria 4605
126 Ga0068859_100160315 3300005617 Bacteria 2328
127 Ga0068864_100041943 3300005618 Bacteria 3915
128 Ga0068864_100133125 3300005618 Bacteria 2236
129 Ga0068861_100059504 3300005719 Bacteria 2925
130 Ga0068861_100229769 3300005719 Bacteria 1572
131 Ga0068851_10003007 3300005834 Bacteria 7445
132 Ga0068851_10049292 3300005834 Bacteria 2136
133 Ga0068870_10060797 3300005840 Bacteria 2029
134 Ga0068863_100049355 3300005841 Bacteria 3991
135 Ga0068863_100278379 3300005841 Bacteria 1620
136 Ga0068858_100039032 3300005842 Bacteria 4405
137 Ga0068858_100097972 3300005842 Bacteria 2734
138 Ga0068858_100115183 3300005842 Bacteria 2511
139 Ga0068858_100165975 3300005842 Bacteria 2080
140 Ga0068858_100213226 3300005842 Bacteria 1827
141 Ga0068858_100453615 3300005842 Bacteria 1236
142 Ga0068860_100001070 3300005843 Bacteria 30180
143 Ga0068862_100123022 3300005844 Bacteria 2288
144 Ga0068862_100193688 3300005844 Bacteria 1830
145 Ga0081455_10003639 3300005937 Bacteria 17660
146 Ga0081455_10016498 3300005937 Bacteria 7128
147 Ga0081455_10018914 3300005937 Bacteria 6535
148 Ga0081455_10023899 3300005937 Bacteria 5676
149 Ga0081540_1001561 3300005983 Bacteria 19619
150 Ga0081540_1002615 3300005983 Bacteria 14634
151 Ga0081540_1003198 3300005983 Bacteria 13049
152 Ga0081540_1003591 3300005983 Bacteria 12180
153 Ga0081540_1011508 3300005983 Bacteria 5911
154 Ga0081540_1016877 3300005983 Bacteria 4546
155 Ga0081540_1055762 3300005983 Bacteria 1923
156 Ga0081540_1098118 3300005983 Bacteria 1269
157 Ga0081540_1098526 3300005983 Bacteria 1265
158 Ga0081539_10000040 3300005985 Bacteria 292753
159 Ga0081539_10000629 3300005985 Bacteria 71410
160 Ga0081539_10010272 3300005985 Bacteria 7644
161 Ga0081539_10080264 3300005985 Bacteria 1717
162 Ga0070717_10042834 3300006028 Bacteria 3693
163 Ga0070717_10060673 3300006028 Bacteria 3132
164 Ga0070717_10066529 3300006028 Bacteria 2997
165 Ga0075365_10000230 3300006038 Bacteria 19070
166 Ga0075365_10043037 3300006038 Bacteria 2955
167 Ga0075365_10066569 3300006038 Bacteria 2417
168 Ga0075365_10111342 3300006038 Bacteria 1881
169 Ga0075365_10233866 3300006038 Bacteria 1290
170 Ga0075368_10043216 3300006042 Bacteria 1775
171 Ga0075363_100002768 3300006048 Bacteria 7271
172 Ga0075363_100026974 3300006048 Bacteria 2942
173 Ga0075363_100051359 3300006048 Bacteria 2198
174 Ga0075364_10117059 3300006051 Bacteria 1782
175 Ga0070715_10083250 3300006163 Bacteria 1456
176 Ga0070716_100009512 3300006173 Bacteria 4845
177 Ga0070716_100055019 3300006173 Bacteria 2275
178 Ga0070716_100238052 3300006173 Bacteria 1233
179 Ga0070712_100009393 3300006175 Bacteria 6161
180 Ga0070712_100024020 3300006175 Bacteria 4033
181 Ga0070712_100073619 3300006175 Bacteria 2451
182 Ga0075362_10058839 3300006177 Bacteria 1734
183 Ga0075362_10140496 3300006177 Bacteria 1154
184 Ga0075367_10040880 3300006178 Bacteria 2708
185 Ga0075367_10128164 3300006178 Bacteria 1567
186 Ga0075367_10151234 3300006178 Bacteria 1440
187 Ga0075369_10082099 3300006186 Bacteria 1430
188 Ga0097621_100076401 3300006237 Bacteria 2778
189 Ga0097621_100223747 3300006237 Bacteria 1641
190 Ga0075370_10047914 3300006353 Bacteria 2420
191 Ga0075370_10105722 3300006353 Bacteria 1632
192 Ga0075370_10119165 3300006353 Bacteria 1536
193 Ga0068871_100313797 3300006358 Bacteria 1379
194 Ga0068871_100341879 3300006358 Bacteria 1322
195 Ga0075428_100152807 3300006844 Bacteria 2507
196 Ga0068865_100051894 3300006881 Bacteria 2840
197 Ga0068865_100192205 3300006881 Bacteria 1579
198 Ga0068865_100240795 3300006881 Bacteria 1423
199 Ga0097620_100160321 3300006931 Bacteria 2328
200 Ga0099824_1010813 3300006942 Bacteria 10575
201 Ga0099824_1016377 3300006942 Bacteria 6735
202 Ga0099822_1002332 3300006943 Bacteria 23535
203 Ga0099823_1037534 3300006944 Bacteria 3658
204 Ga0075435_100035211 3300007076 Bacteria 3973
205 Ga0099794_10023536 3300007265 Bacteria 2819
206 Ga0099794_10185797 3300007265 Bacteria 1062
207 Ga0099795_10009237 3300007788 Bacteria 2851
208 Ga0099795_10014635 3300007788 Bacteria 2437
209 Ga0105240_10034054 3300009093 Bacteria 6575
210 Ga0105240_10046615 3300009093 Bacteria 5491
211 Ga0105240_10061416 3300009093 Bacteria 4683
212 Ga0105240_10088594 3300009093 Bacteria 3787
213 Ga0105240_10090182 3300009093 Bacteria 3747
214 Ga0105240_10133219 3300009093 Bacteria 2978
215 Ga0111539_10036660 3300009094 Bacteria 5926
216 Ga0105245_10108732 3300009098 Bacteria 2576
217 Ga0105247_10048921 3300009101 Bacteria 2598
218 Ga0105247_10162695 3300009101 Bacteria 1479
219 Ga0105247_10301216 3300009101 Bacteria 1112
220 Ga0114129_10089335 3300009147 Bacteria 4271
221 Ga0114129_10229803 3300009147 Bacteria 2499
222 Ga0105243_10074455 3300009148 Bacteria 2754
223 Ga0105241_10009598 3300009174 Bacteria 7115
224 Ga0105241_10074950 3300009174 Bacteria 2636
225 Ga0105241_10108202 3300009174 Bacteria 2222
226 Ga0105241_10134760 3300009174 Bacteria 2004
227 Ga0105241_10396602 3300009174 Bacteria 1209
228 Ga0105242_10058731 3300009176 Bacteria 3155
229 Ga0105237_10002092 3300009545 Bacteria 25220
230 Ga0105237_10023476 3300009545 Bacteria 6319
231 Ga0105237_10036215 3300009545 Bacteria 4992
232 Ga0105237_10062720 3300009545 Bacteria 3716
233 Ga0105237_10139508 3300009545 Bacteria 2418
234 Ga0105238_10029551 3300009551 Bacteria 5583
235 Ga0105238_10043421 3300009551 Bacteria 4549
236 Ga0105238_10067329 3300009551 Bacteria 3583
237 Ga0105249_10041299 3300009553 Bacteria 4192
238 Ga0105249_10121599 3300009553 Bacteria 2481
239 Ga0099796_10020991 3300010159 Bacteria 2005
240 Ga0105239_10021610 3300010375 Bacteria 7095
241 Ga0105239_10027243 3300010375 Bacteria 6291
242 Ga0105239_10031504 3300010375 Bacteria 5830
243 Ga0105239_10053186 3300010375 Bacteria 4442
244 Ga0105239_10065469 3300010375 Bacteria 3991
245 Ga0105239_10075985 3300010375 Bacteria 3694
246 Ga0105239_10286135 3300010375 Bacteria 1856
247 Ga0105239_10373033 3300010375 Bacteria 1613
248 Ga0105246_10138697 3300011119 Bacteria 1826
249 Ga0157371_10023801 3300013102 Bacteria 4476
250 Ga0157370_10029759 3300013104 Bacteria 5356
251 Ga0157370_10056752 3300013104 Bacteria 3726
252 Ga0157369_10008687 3300013105 Bacteria 11646
253 Ga0157369_10014863 3300013105 Bacteria 8787
254 Ga0157369_10015000 3300013105 Bacteria 8746
255 Ga0157369_10078819 3300013105 Bacteria 3529
256 Ga0157374_10007266 3300013296 Bacteria 9438
257 Ga0157378_10275946 3300013297 Bacteria 1619
258 Ga0157378_10367787 3300013297 Bacteria 1409
259 Ga0163162_10058930 3300013306 Bacteria 3870
260 Ga0163162_10178735 3300013306 Bacteria 2248
261 Ga0157372_10132015 3300013307 Bacteria 2874
262 Ga0157372_10519055 3300013307 Bacteria 1389
263 Ga0157375_10156807 3300013308 Bacteria 2416
264 Ga0163163_10032478 3300014325 Bacteria 5040
265 Ga0163163_10112864 3300014325 Bacteria 2747
266 Ga0163163_10279135 3300014325 Bacteria 1722
267 Ga0157379_10147786 3300014968 Bacteria 2119
268 Ga0157376_10108045 3300014969 Bacteria 2443
269 Ga0163161_10312521 3300017792 Bacteria 1240
270 Ga0206356_10611048 3300020070 Bacteria 1718
271 Ga0214544_1000007 3300021320 Bacteria 379989
272 Ga0214542_1000216 3300021321 Bacteria 92614
273 Ga0214545_1000118 3300021324 Bacteria 92737
274 Ga0214543_1000009 3300021327 Bacteria 384302
275 Ga0213873_10014582 3300021358 Bacteria 1744
276 Ga0213872_10022262 3300021361 Bacteria 2919
277 Ga0213876_10013493 3300021384 Bacteria 4336
278 Ga0213876_10057406 3300021384 Bacteria 2055
279 Ga0213876_10158781 3300021384 Bacteria 1203
280 Ga0213876_10164378 3300021384 Bacteria 1181
281 Ga0209563_101733 3300025230 Bacteria 5500
282 Ga0209677_100395 3300025253 Bacteria 26466
283 Ga0209677_101305 3300025253 Bacteria 11059
284 Ga0209148_1000388 3300025254 Bacteria 52495
285 Ga0209148_1007027 3300025254 Bacteria 2376
286 Ga0209233_1000949 3300025261 Bacteria 12587
287 Ga0209233_1002242 3300025261 Bacteria 7224
288 Ga0209233_1002405 3300025261 Bacteria 6911
289 Ga0209233_1019667 3300025261 Bacteria 1789
290 Ga0209455_1007359 3300025272 Bacteria 3119
291 Ga0209564_1001154 3300025295 Bacteria 30904
292 Ga0209564_1018635 3300025295 Bacteria 2635
293 Ga0209564_1023468 3300025295 Bacteria 2142
294 Ga0209758_1000030 3300025297 Bacteria 509217
295 Ga0209758_1000429 3300025297 Bacteria 71157
296 Ga0209758_1001015 3300025297 Bacteria 37162
297 Ga0209758_1002652 3300025297 Bacteria 17708
298 Ga0209758_1003562 3300025297 Bacteria 14000
299 Ga0209256_1003190 3300025299 Bacteria 11867
300 Ga0207426_1000347 3300025302 Bacteria 85420
301 Ga0207426_1001408 3300025302 Bacteria 20164
302 Ga0207426_1003607 3300025302 Bacteria 8216
303 Ga0209257_1004526 3300025304 Bacteria 10674
304 Ga0207656_10009178 3300025321 Bacteria 3668
305 Ga0207656_10024823 3300025321 Bacteria 2428
306 Ga0207653_10014357 3300025885 Bacteria 2486
307 Ga0207692_10000213 3300025898 Bacteria 19497
308 Ga0207692_10034398 3300025898 Bacteria 2453
309 Ga0207692_10041308 3300025898 Bacteria 2282
310 Ga0207710_10031263 3300025900 Bacteria 2327
311 Ga0207647_10059968 3300025904 Bacteria 2327
312 Ga0207699_10035638 3300025906 Bacteria 2832
313 Ga0207699_10040885 3300025906 Bacteria 2674
314 Ga0207699_10108963 3300025906 Bacteria 1771
315 Ga0207699_10149410 3300025906 Bacteria 1544
316 Ga0207645_10048434 3300025907 Bacteria 2714
317 Ga0207643_10185510 3300025908 Bacteria 1261
318 Ga0207705_10034575 3300025909 Bacteria 3614
319 Ga0207705_10178962 3300025909 Bacteria 1599
320 Ga0207654_10000073 3300025911 Bacteria 66148
321 Ga0207654_10050613 3300025911 Bacteria 2388
322 Ga0207654_10099770 3300025911 Bacteria 1787
323 Ga0207707_10000398 3300025912 Bacteria 45384
324 Ga0207707_10024840 3300025912 Bacteria 5241
325 Ga0207707_10063900 3300025912 Bacteria 3204
326 Ga0207707_10081956 3300025912 Bacteria 2816
327 Ga0207695_10000006 3300025913 Bacteria 1135309
328 Ga0207695_10000366 3300025913 Bacteria 103345
329 Ga0207695_10032098 3300025913 Bacteria 5751
330 Ga0207695_10141453 3300025913 Bacteria 2354
331 Ga0207695_10433465 3300025913 Bacteria 1198
332 Ga0207671_10013114 3300025914 Bacteria 6620
333 Ga0207671_10018633 3300025914 Bacteria 5320
334 Ga0207671_10146459 3300025914 Bacteria 1822
335 Ga0207671_10160882 3300025914 Bacteria 1739
336 Ga0207671_10214977 3300025914 Bacteria 1505
337 Ga0207693_10007490 3300025915 Bacteria 8973
338 Ga0207693_10015350 3300025915 Bacteria 6146
339 Ga0207693_10120128 3300025915 Bacteria 2064
340 Ga0207663_10000167 3300025916 Bacteria 29694
341 Ga0207663_10009487 3300025916 Bacteria 5142
342 Ga0207663_10014741 3300025916 Bacteria 4292
343 Ga0207663_10018460 3300025916 Bacteria 3909
344 Ga0207663_10250868 3300025916 Bacteria 1302
345 Ga0207660_10003186 3300025917 Bacteria 10733
346 Ga0207660_10071421 3300025917 Bacteria 2526
347 Ga0207660_10095433 3300025917 Bacteria 2213
348 Ga0207657_10020195 3300025919 Bacteria 6302
349 Ga0207657_10076584 3300025919 Bacteria 2821
350 Ga0207657_10169523 3300025919 Bacteria 1769
351 Ga0207649_10158912 3300025920 Bacteria 1564
352 Ga0207649_10166512 3300025920 Bacteria 1532
353 Ga0207652_10014407 3300025921 Bacteria 6405
354 Ga0207652_10038391 3300025921 Bacteria 4059
355 Ga0207652_10041401 3300025921 Bacteria 3916
356 Ga0207652_10074840 3300025921 Bacteria 2949
357 Ga0207652_10108192 3300025921 Bacteria 2463
358 Ga0207646_10038053 3300025922 Bacteria 4335
359 Ga0207681_10127401 3300025923 Bacteria 1877
360 Ga0207694_10000139 3300025924 Bacteria 74561
361 Ga0207694_10000268 3300025924 Bacteria 49480
362 Ga0207694_10012864 3300025924 Bacteria 6302
363 Ga0207694_10047790 3300025924 Bacteria 3309
364 Ga0207659_10403621 3300025926 Bacteria 1144
365 Ga0207687_10142316 3300025927 Bacteria 1821
366 Ga0207700_10012800 3300025928 Bacteria 5426
367 Ga0207700_10029515 3300025928 Bacteria 3871
368 Ga0207700_10038034 3300025928 Bacteria 3490
369 Ga0207700_10047186 3300025928 Bacteria 3191
370 Ga0207700_10053226 3300025928 Bacteria 3031
371 Ga0207664_10004015 3300025929 Bacteria 9921
372 Ga0207664_10124051 3300025929 Bacteria 2166
373 Ga0207664_10159517 3300025929 Bacteria 1923
374 Ga0207664_10202228 3300025929 Bacteria 1715
375 Ga0207644_10183029 3300025931 Bacteria 1643
376 Ga0207690_10042002 3300025932 Bacteria 3000
377 Ga0207706_10034285 3300025933 Bacteria 4516
378 Ga0207706_10037506 3300025933 Bacteria 4303
379 Ga0207686_10092473 3300025934 Bacteria 2000
380 Ga0207669_10179405 3300025937 Bacteria 1516
381 Ga0207704_10014864 3300025938 Bacteria 3946
382 Ga0207704_10205136 3300025938 Bacteria 1446
383 Ga0207665_10001098 3300025939 Bacteria 18235
384 Ga0207665_10020658 3300025939 Bacteria 4328
385 Ga0207665_10095577 3300025939 Bacteria 2065
386 Ga0207665_10125637 3300025939 Bacteria 1816
387 Ga0207665_10149912 3300025939 Bacteria 1670
388 Ga0207691_10281564 3300025940 Bacteria 1430
389 Ga0207691_10285813 3300025940 Bacteria 1419
390 Ga0207711_10281964 3300025941 Bacteria 1530
391 Ga0207689_10046448 3300025942 Bacteria 3589
392 Ga0207689_10057354 3300025942 Bacteria 3204
393 Ga0207689_10059449 3300025942 Bacteria 3144
394 Ga0207661_10010897 3300025944 Bacteria 6562
395 Ga0207661_10025129 3300025944 Bacteria 4525
396 Ga0207661_10191275 3300025944 Bacteria 1794
397 Ga0207661_10201049 3300025944 Bacteria 1752
398 Ga0207679_10231633 3300025945 Bacteria 1560
399 Ga0207667_10015832 3300025949 Bacteria 8547
400 Ga0207667_10020820 3300025949 Bacteria 7283
401 Ga0207667_10027659 3300025949 Bacteria 6169
402 Ga0207667_10161752 3300025949 Bacteria 2303
403 Ga0207667_10317256 3300025949 Bacteria 1592
404 Ga0207651_10205511 3300025960 Bacteria 1582
405 Ga0207668_10141199 3300025972 Bacteria 1853
406 Ga0207668_10161880 3300025972 Bacteria 1744
407 Ga0207668_10251917 3300025972 Bacteria 1434
408 Ga0207640_10006813 3300025981 Bacteria 6283
409 Ga0207640_10009040 3300025981 Bacteria 5559
410 Ga0207640_10029111 3300025981 Bacteria 3385
411 Ga0207640_10100200 3300025981 Bacteria 2029
412 Ga0207640_10195500 3300025981 Bacteria 1528
413 Ga0207640_10379698 3300025981 Bacteria 1144
414 Ga0207703_10094594 3300026035 Bacteria 2520
415 Ga0207703_10213157 3300026035 Bacteria 1723
416 Ga0207703_10227884 3300026035 Bacteria 1669
417 Ga0207703_10354502 3300026035 Bacteria 1352
418 Ga0207639_10007864 3300026041 Bacteria 7282
419 Ga0207639_10031296 3300026041 Bacteria 3909
420 Ga0207639_10038411 3300026041 Bacteria 3560
421 Ga0207639_10075127 3300026041 Bacteria 2656
422 Ga0207639_10171307 3300026041 Bacteria 1839
423 Ga0207639_10194085 3300026041 Bacteria 1736
424 Ga0207639_10209354 3300026041 Bacteria 1677
425 Ga0207639_10242035 3300026041 Bacteria 1569
426 Ga0207678_10008196 3300026067 Bacteria 9212
427 Ga0207678_10022440 3300026067 Bacteria 5527
428 Ga0207678_10065204 3300026067 Bacteria 3128
429 Ga0207678_10107187 3300026067 Bacteria 2383
430 Ga0207678_10235605 3300026067 Bacteria 1567
431 Ga0207678_10438878 3300026067 Bacteria 1134
432 Ga0207708_10088023 3300026075 Bacteria 2392
433 Ga0207702_10000491 3300026078 Bacteria 44501
434 Ga0207702_10000623 3300026078 Bacteria 38970
435 Ga0207702_10012083 3300026078 Bacteria 7181
436 Ga0207702_10023961 3300026078 Bacteria 5064
437 Ga0207702_10205087 3300026078 Bacteria 1830
438 Ga0207641_10038292 3300026088 Bacteria 4009
439 Ga0207641_10358752 3300026088 Bacteria 1391
440 Ga0207648_10415314 3300026089 Bacteria 1221
441 Ga0207676_10229465 3300026095 Bacteria 1659
442 Ga0207674_10008730 3300026116 Bacteria 11666
443 Ga0207674_10008835 3300026116 Bacteria 11595
444 Ga0207674_10085543 3300026116 Bacteria 3148
445 Ga0207674_10143540 3300026116 Bacteria 2346
446 Ga0207675_100025313 3300026118 Bacteria 5522
447 Ga0207675_100049103 3300026118 Bacteria 3939
448 Ga0207675_100263583 3300026118 Bacteria 1671
449 Ga0207683_10017559 3300026121 Bacteria 6100
450 Ga0207683_10057950 3300026121 Bacteria 3400
451 Ga0207683_10178146 3300026121 Bacteria 1927
452 Ga0207683_10381196 3300026121 Bacteria 1296
453 Ga0207698_10027962 3300026142 Bacteria 4013
454 Ga0207698_10170342 3300026142 Bacteria 1916
455 Ga0209389_1000015 3300027296 Bacteria 188311
456 Ga0209389_1000035 3300027296 Bacteria 127089
457 Ga0209589_1000015 3300027357 Bacteria 225913
458 Ga0209589_1000039 3300027357 Bacteria 127084
459 Ga0209489_100015 3300027361 Bacteria 225913
460 Ga0209489_100072 3300027361 Bacteria 138111
461 Ga0209489_100084 3300027361 Bacteria 127094
462 Ga0209700_100025 3300027363 Bacteria 225913
463 Ga0209700_100034 3300027363 Bacteria 197276
464 Ga0209179_1014575 3300027512 Bacteria 1446
465 Ga0209179_1017579 3300027512 Bacteria 1357
466 Ga0209813_10016710 3300027866 Bacteria 2006
467 Ga0268266_10007778 3300028379 Bacteria 9611
468 Ga0268266_10008893 3300028379 Bacteria 8891
469 Ga0268266_10172700 3300028379 Bacteria 1962
470 Ga0268264_10000107 3300028381 Bacteria 209105
471 Ga0265337_1025017 3300028556 Bacteria 1820
472 Ga0265319_1019294 3300028563 Bacteria 2548
473 Ga0265334_10001242 3300028573 Bacteria 12451
474 Ga0265318_10009393 3300028577 Bacteria 4302
475 Ga0265323_10001035 3300028653 Bacteria 14454
476 Ga0265336_10000363 3300028666 Bacteria 29266
477 Ga0307517_10001780 3300028786 Bacteria 35475
478 Ga0307515_10054512 3300028794 Bacteria 5868
479 Ga0265338_10000155 3300028800 Bacteria 125121
480 Ga0265324_10021334 3300029957 Bacteria 2323
481 Ga0265330_10021950 3300031235 Bacteria 2909
482 Ga0265332_10006675 3300031238 Bacteria 5226
483 Ga0265325_10058919 3300031241 Bacteria 1954
484 Ga0265340_10054987 3300031247 Bacteria 1918
485 Ga0265339_10000326 3300031249 Bacteria 38178
486 Ga0265339_10006252 3300031249 Bacteria 7840
487 Ga0265339_10119973 3300031249 Bacteria 1353
488 Ga0265331_10017323 3300031250 Bacteria 3762
489 Ga0265316_10036469 3300031344 Bacteria 3976
490 Ga0307513_10066655 3300031456 Bacteria 3781
491 Ga0307408_100403235 3300031548 Bacteria 1175
492 Ga0307508_10000088 3300031616 Bacteria 107883
493 Ga0307508_10033626 3300031616 Bacteria 4628
494 Ga0307508_10089914 3300031616 Bacteria 2656
495 Ga0307508_10187216 3300031616 Bacteria 1672
496 Ga0265314_10001992 3300031711 Bacteria 21668
497 Ga0265314_10013803 3300031711 Bacteria 6506
498 Ga0265342_10007871 3300031712 Bacteria 7736
499 Ga0307516_10008774 3300031730 Bacteria 11362
500 Ga0307516_10042852 3300031730 Bacteria 4487
501 Ga0307405_10191561 3300031731 Bacteria 1477
502 Ga0307412_10018506 3300031911 Bacteria 4194
503 Ga0307416_100160220 3300032002 Bacteria 2079
504 Ga0307416_100232550 3300032002 Bacteria 1778
505 Ga0307411_10141884 3300032005 Bacteria 1772
506 Ga0307415_100069402 3300032126 Bacteria 2471
507 Ga0307415_100091856 3300032126 Bacteria 2200
508 Ga0307507_10068020 3300033179 Bacteria 3253
509 Ga0307510_10017889 3300033180 Bacteria 8351
510 Ga0307510_10076564 3300033180 Bacteria 3290
511 Ga0307510_10090387 3300033180 Bacteria 2909
512 Ga0307510_10103456 3300033180 Bacteria 2625
513 Ga0307510_10112752 3300033180 Bacteria 2455
514 Ga0315911_1000021 3300033442 Bacteria 124874
515 Ga0316215_1004766 3300033544 Bacteria 1302
516 Ga0373929_0025195 3300035085 Bacteria 1234
517 Ga0373934_0010050 3300035086 Bacteria 3552
518 Ga0373944_0109761 3300035089 Bacteria 941
519 Ga0373923_0000546 3300035111 Bacteria 9199
520 Ga0373923_0041206 3300035111 Bacteria 1903
521 Ga0373936_0020991 3300035113 Bacteria 2539
522 Ga0373936_0059115 3300035113 Bacteria 1562
523 Ga0373945_0014927 3300035116 Bacteria 2608
524 Ga0373953_0027393 3300035117 Bacteria 2190
525 Ga0373954_0000782 3300035118 Bacteria 12269
526 Ga0373954_0011586 3300035118 Bacteria 3910
527 Ga0373954_0043866 3300035118 Bacteria 2086
528 Ga0373956_0033694 3300035119 Bacteria 2253
529 Ga0373956_0065721 3300035119 Bacteria 1648
530 Ga0373957_0009651 3300035120 Bacteria 3163
531 Ga0373943_0001276 3300035170 Bacteria 11264
532 Ga0373943_0030259 3300035170 Bacteria 2561
533 Ga0373943_0034911 3300035170 Bacteria 2401
534 Ga0373946_0026191 3300035171 Bacteria 2298
535 Ga0373946_0144167 3300035171 Bacteria 1106
536 Ga0373955_0002870 3300035172 Bacteria 7557
537 Ga0373955_0034153 3300035172 Bacteria 2683
538 Ga0373955_0242146 3300035172 Bacteria 1080
539 Ga0373924_0001544 3300035410 Bacteria 7518
540 Ga0373924_0055987 3300035410 Bacteria 1642
541 Ga0373931_0009956 3300035691 Bacteria 4556
542 Ga0373931_0040942 3300035691 Bacteria 2433
543 Ga0373935_0002629 3300035692 Bacteria 10329
544 Ga0373935_0032233 3300035692 Bacteria 3255
545 Ga0373935_0117670 3300035692 Bacteria 1771
546 Ga0373935_0130896 3300035692 Bacteria 1686
547 Ga0373927_0000136 3300035695 Bacteria 56656
548 Ga0373927_0017818 3300035695 Bacteria 4671
549 Ga0373927_0047249 3300035695 Bacteria 2784
550 Ga0373927_0102789 3300035695 Bacteria 1859
551 Ga0373933_0000160 3300035724 Bacteria 43896
552 Ga0373933_0001268 3300035724 Bacteria 14904
553 Ga0373933_0026697 3300035724 Bacteria 3318
554 Ga0373933_0140529 3300035724 Bacteria 1524
555 Ga0373947_0008188 3300035725 Bacteria 6028
556 Ga0373947_0008868 3300035725 Bacteria 5788
557 Ga0373947_0009170 3300035725 Bacteria 5688
558 Ga0373947_0031678 3300035725 Bacteria 3113
559 Ga0373937_0007853 3300036401 Bacteria 9249
560 Ga0373937_0011985 3300036401 Bacteria 7611
561 Ga0373925_0001167 3300037068 Bacteria 23303
562 Ga0373925_0026045 3300037068 Bacteria 4276
563 Ga0373925_0063889 3300037068 Bacteria 2770
564 Ga0373925_0138170 3300037068 Bacteria 1905
565 Ga0395900_0001546 3300037418 Bacteria 27342
566 Ga0395900_0021796 3300037418 Bacteria 6550
567 Ga0395898_0002015 3300037466 Bacteria 25472
568 Ga0395898_0003151 3300037466 Bacteria 18627
569 Ga0395898_0078628 3300037466 Bacteria 3182
570 Ga0395898_0109793 3300037466 Bacteria 2644
571 Ga0395898_0132975 3300037466 Bacteria 2382
572 Ga0395905_0003722 3300037471 Bacteria 16157
573 Ga0395905_0051982 3300037471 Bacteria 3837
574 Ga0395901_0083638 3300038443 Bacteria 3336
575 Ga0436365_0877008 3300039437 Bacteria 23245
576 Ga0436365_1301685 3300039437 Bacteria 1634
577 Ga0436365_1606403 3300039437 Bacteria 2062
578 Ga0436365_1727551 3300039437 Bacteria 1751
579 Ga0436361_0935166 3300039447 Bacteria 5677
580 Ga0436363_0101344 3300039450 Bacteria 4293
581 Ga0436363_0321331 3300039450 Bacteria 1021
582 Ga0436363_0583495 3300039450 Bacteria 1927
583 Ga0436363_1407757 3300039450 Bacteria 15958
584 Ga0436362_1015371 3300039453 Bacteria 9547
585 Ga0466972_0000048 3300044658 Bacteria 119165
586 Ga0466972_0005127 3300044658 Bacteria 6561
587 Ga0466966_0000542 3300044684 Bacteria 24049
588 Ga0466966_0088054 3300044684 Bacteria 1930
589 Ga0466961_0000018 3300044693 Bacteria 109837
590 Ga0466961_0077546 3300044693 Bacteria 2105
591 Ga0466963_0007846 3300044694 Bacteria 6389
592 Ga0466963_0141252 3300044694 Bacteria 1668
593 Ga0466964_0076792 3300044706 Bacteria 1425
594 Ga0466971_0025243 3300044719 Bacteria 2654
595 Ga0466971_0041232 3300044719 Bacteria 2073
596 Ga0466957_0023546 3300044842 Bacteria 3641
597 Ga0466960_0008711 3300044901 Bacteria 4162
598 Ga0466960_0058540 3300044901 Bacteria 1882
599 Ga0466959_0017920 3300045049 Bacteria 5195
600 Ga0466959_0117802 3300045049 Bacteria 1890
601 Ga0466967_0022021 3300045976 Bacteria 5190
602 Ga0466967_0059151 3300045976 Bacteria 3391
603 Ga0466967_0238754 3300045976 Bacteria 1733
604 Ga0466967_0372054 3300045976 Bacteria 1386
605 Ga0495592_0001707 3300046454 Bacteria 15427
606 Ga0495592_0012511 3300046454 Bacteria 6448
607 Ga0495592_0030832 3300046454 Bacteria 4056
608 Ga0495603_0000019 3300046455 Bacteria 65316
609 Ga0495603_0019786 3300046455 Bacteria 4075
610 Ga0495603_0123234 3300046455 Bacteria 1510
611 Ga0495629_0000151 3300046459 Bacteria 60632
612 Ga0495629_0002944 3300046459 Bacteria 12975
613 Ga0495629_0004909 3300046459 Bacteria 10038
614 Ga0495629_0034018 3300046459 Bacteria 3604
615 Ga0495638_0037800 3300046460 Bacteria 3070
616 Ga0495638_0037825 3300046460 Bacteria 3069
617 Ga0495638_0137263 3300046460 Bacteria 1430
618 Ga0495641_0004241 3300046461 Bacteria 10254
619 Ga0495641_0038764 3300046461 Bacteria 2225
620 Ga0495651_0001421 3300046462 Bacteria 18588
621 Ga0495651_0010977 3300046462 Bacteria 6968
622 Ga0495651_0011269 3300046462 Bacteria 6872
623 Ga0495651_0043692 3300046462 Bacteria 3476
624 Ga0495651_0187577 3300046462 Bacteria 1458
625 Ga0495651_0266405 3300046462 Bacteria 1164
626 Ga0495653_0004360 3300046463 Bacteria 11448
627 Ga0495653_0054417 3300046463 Bacteria 3058
628 Ga0495650_0066871 3300046471 Bacteria 1421
629 Ga0495580_0001229 3300046472 Bacteria 22603
630 Ga0495580_0007090 3300046472 Bacteria 9031
631 Ga0495582_0000019 3300046473 Bacteria 91143
632 Ga0495582_0004005 3300046473 Bacteria 8272
633 Ga0495605_0085233 3300046474 Bacteria 1472
634 Ga0495605_0094464 3300046474 Bacteria 1381
635 Ga0495605_0110747 3300046474 Bacteria 1253
636 Ga0495639_0000159 3300046475 Bacteria 34872
637 Ga0495639_0062908 3300046475 Bacteria 1703
638 Ga0495662_0000798 3300046476 Bacteria 15288
639 Ga0495664_0004893 3300046477 Bacteria 7329
640 Ga0495664_0009417 3300046477 Bacteria 5465
641 Ga0495664_0040201 3300046477 Bacteria 2764
642 Ga0495664_0059446 3300046477 Bacteria 2275
643 Ga0495664_0076735 3300046477 Bacteria 2000
644 Ga0495584_0085432 3300046491 Bacteria 1590
645 Ga0495585_0079005 3300046492 Bacteria 1784
646 Ga0495594_0000235 3300046499 Bacteria 26790
647 Ga0495594_0015471 3300046499 Bacteria 4008
648 Ga0495606_0000234 3300046507 Bacteria 98166
649 Ga0495606_0018376 3300046507 Bacteria 5244
650 Ga0495608_0010956 3300046511 Bacteria 6320
651 Ga0495608_0020201 3300046511 Bacteria 4578
652 Ga0495608_0085652 3300046511 Bacteria 2042
653 Ga0495608_0344313 3300046511 Bacteria 918
654 Ga0495610_0061594 3300046512 Bacteria 1782
655 Ga0495616_0020323 3300046513 Bacteria 3615
656 Ga0495618_0033917 3300046514 Bacteria 3200
657 Ga0495620_0063225 3300046515 Bacteria 1535
658 Ga0495628_0016475 3300046516 Bacteria 6165
659 Ga0495628_0034223 3300046516 Bacteria 4088
660 Ga0495628_0232120 3300046516 Bacteria 1383
661 Ga0495630_0008130 3300046517 Bacteria 7538
662 Ga0495630_0036438 3300046517 Bacteria 3677
663 Ga0495630_0090128 3300046517 Bacteria 2317
664 Ga0495648_0001116 3300046524 Bacteria 27214
665 Ga0495648_0008002 3300046524 Bacteria 8382
666 Ga0495648_0028040 3300046524 Bacteria 3757
667 Ga0495648_0032290 3300046524 Bacteria 3437
668 Ga0495666_0015247 3300046526 Bacteria 3828
669 Ga0495652_0013238 3300046529 Bacteria 7425
670 Ga0495652_0031261 3300046529 Bacteria 4663
671 Ga0495652_0032740 3300046529 Bacteria 4543
672 Ga0495652_0052170 3300046529 Bacteria 3489
673 Ga0495665_0000093 3300046531 Bacteria 40936
674 Ga0495665_0063631 3300046531 Bacteria 1947
675 Ga0495640_0005573 3300046533 Bacteria 10012
676 Ga0495640_0030012 3300046533 Bacteria 3897
677 Ga0495640_0053002 3300046533 Bacteria 2783
678 Ga0495640_0244693 3300046533 Bacteria 1125
679 Ga0495586_0029710 3300046535 Bacteria 2926
680 Ga0495587_0002440 3300046536 Bacteria 12404
681 Ga0495598_0004856 3300046537 Bacteria 2940
682 Ga0495609_0068648 3300046538 Bacteria 1559
683 Ga0495621_0142561 3300046539 Bacteria 938
684 Ga0495597_0044137 3300046542 Bacteria 1983
685 Ga0495645_0007006 3300046543 Bacteria 7838
686 Ga0495645_0044063 3300046543 Bacteria 3254
687 Ga0495645_0114078 3300046543 Bacteria 1910
688 Ga0495645_0146194 3300046543 Bacteria 1646
689 Ga0495622_0000571 3300046557 Bacteria 22078
690 Ga0495622_0023862 3300046557 Bacteria 2853
691 Ga0495622_0033105 3300046557 Bacteria 2413
692 Ga0495622_0076309 3300046557 Bacteria 1544
693 Ga0495633_0159353 3300046558 Bacteria 1041
694 Ga0495667_0029704 3300046559 Bacteria 3678
695 Ga0495667_0059712 3300046559 Bacteria 2502
696 Ga0495656_0091876 3300046615 Bacteria 1389
697 Ga0495668_0047773 3300046616 Bacteria 2376
698 Ga0495668_0102905 3300046616 Bacteria 1562
699 Ga0495668_0106360 3300046616 Bacteria 1535
700 Ga0495634_0003979 3300046642 Bacteria 11723
701 Ga0495634_0004199 3300046642 Bacteria 11374
702 Ga0495634_0034102 3300046642 Bacteria 3494
703 Ga0495625_0094667 3300046660 Bacteria 2060
704 Ga0495625_0135023 3300046660 Bacteria 1668
705 Ga0495625_0157229 3300046660 Bacteria 1525
706 Ga0495635_0000322 3300046663 Bacteria 30913
707 Ga0495635_0001817 3300046663 Bacteria 14418
708 Ga0495635_0002995 3300046663 Bacteria 11592
709 Ga0495635_0046009 3300046663 Bacteria 3010
710 Ga0495661_0037219 3300046665 Bacteria 3039
711 Ga0495588_0010061 3300046674 Bacteria 4385
712 Ga0495588_0107436 3300046674 Bacteria 1469
713 Ga0495657_0005003 3300046675 Bacteria 10533
714 Ga0495657_0008039 3300046675 Bacteria 8087
715 Ga0495657_0041298 3300046675 Bacteria 3157
716 Ga0495657_0184582 3300046675 Bacteria 1278
717 Ga0495599_0010948 3300046678 Bacteria 5562
718 Ga0495599_0014770 3300046678 Bacteria 4834
719 Ga0495599_0068418 3300046678 Bacteria 2217
720 Ga0495599_0081125 3300046678 Bacteria 2026
721 Ga0495623_0003342 3300046679 Bacteria 10604
722 Ga0495623_0003554 3300046679 Bacteria 10313
723 Ga0495623_0072456 3300046679 Bacteria 2142
724 Ga0495623_0075559 3300046679 Bacteria 2092
725 Ga0495646_0008241 3300046680 Bacteria 6626
726 Ga0495646_0070591 3300046680 Bacteria 2057
727 Ga0495647_0000250 3300046681 Bacteria 14710
728 Ga0495658_0000054 3300046683 Bacteria 57414
729 Ga0495658_0023308 3300046683 Bacteria 3285
730 Ga0495658_0110449 3300046683 Bacteria 1653
731 Ga0495669_0014235 3300046684 Bacteria 3401
732 Ga0495669_0082900 3300046684 Bacteria 1473
733 Ga0495613_0002331 3300046689 Bacteria 14372
734 Ga0495613_0085459 3300046689 Bacteria 2289
735 Ga0495624_0007986 3300046690 Bacteria 7417
736 Ga0495624_0035811 3300046690 Bacteria 3203
737 Ga0495671_0057594 3300046692 Bacteria 1923
738 Ga0495589_0118225 3300046794 Bacteria 1277
739 Ga0495600_0001578 3300046809 Bacteria 12679
740 Ga0495600_0003823 3300046809 Bacteria 8919
741 Ga0495600_0006664 3300046809 Bacteria 7038
742 Ga0495581_0000247 3300047315 Bacteria 25790
743 Ga0495581_0044765 3300047315 Bacteria 2559
744 Ga0495581_0070132 3300047315 Bacteria 2027
745 Ga0495581_0136570 3300047315 Bacteria 1429
746 Ga0495604_0001719 3300047317 Bacteria 17960
747 Ga0495604_0004125 3300047317 Bacteria 11539
748 Ga0495604_0063355 3300047317 Bacteria 2820
749 Ga0495604_0148477 3300047317 Bacteria 1668
750 Ga0495636_0103829 3300047318 Bacteria 1245
751 Ga0495674_0000871 3300047319 Bacteria 28857
752 Ga0495674_0107558 3300047319 Bacteria 2367
753 Ga0495674_0186365 3300047319 Bacteria 1726
754 Ga0495672_0018857 3300047320 Bacteria 4570
755 Ga0495672_0095558 3300047320 Bacteria 1622
756 Ga0495676_0041253 3300047321 Bacteria 3801
757 Ga0495676_0131114 3300047321 Bacteria 1809
758 Ga0495680_0006451 3300047322 Bacteria 10899
759 Ga0495680_0007673 3300047322 Bacteria 9850
760 Ga0495680_0164774 3300047322 Bacteria 1608
761 Ga0495683_0073925 3300047323 Bacteria 1671
762 Ga0495687_012431 3300047443 Bacteria 4502
763 Ga0495675_0005025 3300047444 Bacteria 8045
764 Ga0495675_0005708 3300047444 Bacteria 7610
765 Ga0495675_0178501 3300047444 Bacteria 1301
766 Ga0495685_038131 3300047447 Bacteria 1647
767 Ga0495681_0053640 3300047470 Bacteria 1887
768 Ga0495681_0114680 3300047470 Bacteria 1163
769 Ga0495684_0001840 3300047471 Bacteria 17040
770 Ga0495684_0024950 3300047471 Bacteria 4598
771 Ga0495684_0041304 3300047471 Bacteria 3534
772 Ga0495684_0211558 3300047471 Bacteria 1426
773 Ga0495686_0053491 3300047472 Bacteria 2530
774 Ga0495686_0069667 3300047472 Bacteria 2168
775 Ga0495686_0071333 3300047472 Bacteria 2138
776 Ga0495686_0093652 3300047472 Bacteria 1821
777 Ga0495686_0093920 3300047472 Bacteria 1818
778 Ga0495593_0000063 3300047673 Bacteria 45066
779 Ga0495593_0002843 3300047673 Bacteria 10428
780 Ga0495593_0090543 3300047673 Bacteria 1576
781 Ga0495602_0009382 3300048088 Bacteria 10180
782 Ga0495602_0016924 3300048088 Bacteria 7316
783 Ga0495602_0051263 3300048088 Bacteria 3677
784 Ga0495626_0037089 3300048091 Bacteria 2318
785 Ga0496100_0040777 3300048903 Bacteria 2956
786 Ga0496100_0048959 3300048903 Bacteria 2730
787 Ga0496100_0091951 3300048903 Bacteria 2072
788 Ga0496101_0007477 3300048904 Bacteria 7082
789 Ga0496101_0033278 3300048904 Bacteria 3634
790 Ga0496101_0042350 3300048904 Bacteria 3250
791 Ga0496101_0160283 3300048904 Bacteria 1725
792 Ga0496102_0001177 3300048905 Bacteria 23840
793 Ga0496102_0015035 3300048905 Bacteria 6736
794 Ga0496102_0035246 3300048905 Bacteria 4503
795 Ga0496102_0182525 3300048905 Bacteria 1977
796 Ga0496102_0298131 3300048905 Bacteria 1519
797 Ga0496103_0214465 3300048906 Bacteria 1238
798 Ga0496103_0233707 3300048906 Bacteria 1183
799 Ga0496104_0008588 3300048907 Bacteria 9085
800 Ga0496104_0009097 3300048907 Bacteria 8834
801 Ga0496104_0021540 3300048907 Bacteria 5919
802 Ga0496104_0024076 3300048907 Bacteria 5602
803 Ga0496104_0103423 3300048907 Bacteria 2728
804 Ga0496104_0104398 3300048907 Bacteria 2715
805 Ga0496104_0120288 3300048907 Bacteria 2521
806 Ga0496105_0021408 3300048908 Bacteria 5232
807 Ga0496105_0022649 3300048908 Bacteria 5089
808 Ga0496105_0048912 3300048908 Bacteria 3490
809 Ga0496105_0070475 3300048908 Bacteria 2890
810 Ga0496106_0001271 3300048909 Bacteria 18905
811 Ga0496106_0030896 3300048909 Bacteria 3993
812 Ga0496106_0037087 3300048909 Bacteria 3646
813 Ga0496106_0348566 3300048909 Bacteria 1189
814 Ga0496107_0025796 3300048910 Bacteria 4164
815 Ga0496107_0026598 3300048910 Bacteria 4102
816 Ga0496107_0035617 3300048910 Bacteria 3568
817 Ga0496108_0000507 3300048911 Bacteria 30629
818 Ga0496108_0017223 3300048911 Bacteria 5911
819 Ga0496108_0030002 3300048911 Bacteria 4507
820 Ga0496108_0041867 3300048911 Bacteria 3824
821 Ga0496108_0042694 3300048911 Bacteria 3786
822 Ga0496108_0170617 3300048911 Bacteria 1882
823 Ga0496108_0181261 3300048911 Bacteria 1824
824 Ga0496109_0008835 3300048912 Bacteria 8579
825 Ga0496109_0015980 3300048912 Bacteria 6558
826 Ga0496109_0024123 3300048912 Bacteria 5404
827 Ga0496109_0077384 3300048912 Bacteria 3061
828 Ga0496109_0361566 3300048912 Bacteria 1371
829 Ga0496110_0002891 3300048913 Bacteria 12991
830 Ga0496110_0014981 3300048913 Bacteria 6446
831 Ga0496110_0120504 3300048913 Bacteria 2363
832 Ga0496110_0131722 3300048913 Bacteria 2258
833 Ga0496110_0199167 3300048913 Bacteria 1819
834 Ga0496110_0408864 3300048913 Bacteria 1237
835 Ga0496111_0013376 3300048914 Bacteria 5582
836 Ga0496111_0035880 3300048914 Bacteria 3545
837 Ga0496111_0047402 3300048914 Bacteria 3095
838 Ga0496111_0053924 3300048914 Bacteria 2905
839 Ga0496111_0372141 3300048914 Bacteria 1057
840 Ga0496112_0000051 3300048915 Bacteria 82351
841 Ga0496112_0007653 3300048915 Bacteria 9607
842 Ga0496112_0018304 3300048915 Bacteria 6594
843 Ga0496112_0027083 3300048915 Bacteria 5525
844 Ga0496112_0046746 3300048915 Bacteria 4246
845 Ga0496112_0069445 3300048915 Bacteria 3480
846 Ga0496112_0145021 3300048915 Bacteria 2342
847 Ga0496112_0410985 3300048915 Bacteria 1292
848 Ga0496113_0019566 3300048916 Bacteria 4739
849 Ga0496113_0063378 3300048916 Bacteria 2793
850 Ga0496113_0081284 3300048916 Bacteria 2483
851 Ga0496113_0316421 3300048916 Bacteria 1251
852 Ga0496114_0036732 3300048917 Bacteria 4050
853 Ga0496114_0081821 3300048917 Bacteria 2728
854 Ga0496115_0003395 3300048918 Bacteria 11436
855 Ga0496115_0017793 3300048918 Bacteria 5442
856 Ga0496115_0070407 3300048918 Bacteria 2835
857 Ga0496115_0114485 3300048918 Bacteria 2217
858 Ga0496115_0154044 3300048918 Bacteria 1898
859 Ga0496115_0344973 3300048918 Bacteria 1215
860 Ga0496116_0020888 3300048919 Bacteria 4955
861 Ga0496116_0080857 3300048919 Bacteria 2017
862 Ga0496117_0022107 3300048920 Bacteria 5110
863 Ga0496117_0076968 3300048920 Bacteria 2209
864 Ga0496117_0079592 3300048920 Bacteria 2158
865 Ga0496118_0028837 3300048921 Bacteria 4666
866 Ga0496118_0032916 3300048921 Bacteria 4261
867 Ga0496118_0045268 3300048921 Bacteria 3437
868 Ga0496118_0292353 3300048921 Bacteria 900
869 Ga0496119_0020199 3300048922 Bacteria 4866
870 Ga0496119_0033954 3300048922 Bacteria 3370
871 Ga0496120_0016606 3300048923 Bacteria 4807
872 Ga0496120_0030057 3300048923 Bacteria 3308
873 Ga0496120_0105296 3300048923 Bacteria 1483
874 Ga0496120_0116144 3300048923 Bacteria 1390
875 Ga0496121_0000091 3300048924 Bacteria 216685
876 Ga0496121_0000451 3300048924 Bacteria 80840
877 Ga0496121_0004071 3300048924 Bacteria 20076
878 Ga0496121_0004123 3300048924 Bacteria 19914
879 Ga0496121_0007759 3300048924 Bacteria 12856
880 Ga0496121_0064130 3300048924 Bacteria 2997
881 Ga0496121_0072706 3300048924 Bacteria 2760
882 Ga0496121_0079491 3300048924 Bacteria 2603
883 Ga0496121_0115304 3300048924 Bacteria 2040
884 Ga0496121_0119263 3300048924 Bacteria 1995
885 Ga0496121_0133285 3300048924 Bacteria 1855
886 Ga0496121_0137565 3300048924 Bacteria 1817
887 Ga0496121_0191703 3300048924 Bacteria 1465
888 Ga0496121_0321646 3300048924 Bacteria 1041
889 Ga0496122_0014770 3300048925 Bacteria 7527
890 Ga0496122_0073007 3300048925 Bacteria 2436
891 Ga0496122_0125829 3300048925 Bacteria 1641
892 Ga0496123_0056676 3300048926 Bacteria 2558
893 Ga0496124_0002796 3300048927 Bacteria 22105
894 Ga0496124_0048273 3300048927 Bacteria 3639
895 Ga0496124_0056207 3300048927 Bacteria 3320
896 Ga0496124_0075008 3300048927 Bacteria 2795
897 Ga0496124_0100870 3300048927 Bacteria 2339
898 Ga0496124_0188417 3300048927 Bacteria 1581
899 Ga0496125_0000099 3300048928 Bacteria 203333
900 Ga0496125_0001377 3300048928 Bacteria 35705
901 Ga0496125_0004112 3300048928 Bacteria 16995
902 Ga0496125_0015326 3300048928 Bacteria 7419
903 Ga0496125_0040920 3300048928 Bacteria 3968
904 Ga0496125_0068010 3300048928 Bacteria 2804
905 Ga0496125_0162615 3300048928 Bacteria 1513
906 Ga0496126_0002876 3300048929 Bacteria 22465
907 Ga0496126_0007845 3300048929 Bacteria 11635
908 Ga0496126_0013193 3300048929 Bacteria 8428
909 Ga0496126_0023656 3300048929 Bacteria 5950
910 Ga0496126_0027035 3300048929 Bacteria 5489
911 Ga0496126_0032694 3300048929 Bacteria 4898
912 Ga0496126_0033644 3300048929 Bacteria 4820
913 Ga0496126_0053184 3300048929 Bacteria 3675
914 Ga0496126_0078080 3300048929 Bacteria 2934
915 Ga0496126_0092750 3300048929 Bacteria 2653
916 Ga0496126_0094056 3300048929 Bacteria 2631
917 Ga0496126_0178353 3300048929 Bacteria 1806
918 Ga0496126_0195423 3300048929 Bacteria 1711
919 Ga0496126_0291947 3300048929 Bacteria 1348
920 Ga0496126_0341069 3300048929 Bacteria 1227
921 Ga0496126_0351053 3300048929 Bacteria 1206
922 Ga0495682_0033394 3300049460 Bacteria 1899
923 Ga0501031_0002180 3300049568 Bacteria 12363
924 Ga0501031_0027770 3300049568 Bacteria 3689
925 Ga0501032_0000136 3300049569 Bacteria 59896
926 Ga0501032_0047408 3300049569 Bacteria 2901
927 Ga0501032_0097504 3300049569 Bacteria 1948
928 Ga0501032_0190178 3300049569 Bacteria 1342
929 Ga0501033_0000202 3300049570 Bacteria 57109
930 Ga0501033_0006530 3300049570 Bacteria 9124
931 Ga0501033_0070751 3300049570 Bacteria 2563
932 Ga0501034_0000113 3300049571 Bacteria 149824
933 Ga0501034_0165791 3300049571 Bacteria 2178
934 Ga0501036_0000059 3300049572 Bacteria 72347
935 Ga0501036_0062741 3300049572 Bacteria 3147
936 Ga0501036_0181833 3300049572 Bacteria 1770
937 Ga0501036_0199024 3300049572 Bacteria 1685
938 Ga0501037_0000214 3300049573 Bacteria 51638
939 Ga0501037_0010785 3300049573 Bacteria 6716
940 Ga0501038_0001243 3300049574 Bacteria 23113
941 Ga0501038_0002129 3300049574 Bacteria 18373
942 Ga0501038_0002810 3300049574 Bacteria 16214
943 Ga0501038_0215636 3300049574 Bacteria 1534
944 Ga0501039_0036146 3300049575 Bacteria 3811
945 Ga0501039_0074470 3300049575 Bacteria 2638
946 Ga0501039_0114143 3300049575 Bacteria 2113
947 Ga0501039_0239346 3300049575 Bacteria 1427
948 Ga0501039_0270543 3300049575 Bacteria 1335
949 Ga0501043_0000017 3300049579 Bacteria 166630
950 Ga0501043_0018948 3300049579 Bacteria 5401
951 Ga0501043_0033269 3300049579 Bacteria 4055
952 Ga0501043_0059965 3300049579 Bacteria 2986
953 Ga0501043_0197084 3300049579 Bacteria 1564
954 Ga0501046_0000174 3300049580 Bacteria 65566
955 Ga0501046_0169447 3300049580 Bacteria 1639
956 Ga0501047_0000044 3300049581 Bacteria 174789
957 Ga0501047_0036235 3300049581 Bacteria 4767
958 Ga0501047_0199396 3300049581 Bacteria 1862
959 Ga0501047_0508402 3300049581 Bacteria 1031
960 Ga0501048_0000837 3300049582 Bacteria 22705
961 Ga0501048_0019094 3300049582 Bacteria 5035
962 Ga0501067_0003781 3300049583 Bacteria 8344
963 Ga0501067_0012443 3300049583 Bacteria 4720
964 Ga0501068_0000629 3300049584 Bacteria 17991
965 Ga0501068_0021249 3300049584 Bacteria 3788
966 Ga0501069_0016580 3300049585 Bacteria 3959
967 Ga0501069_0031229 3300049585 Bacteria 2928
968 Ga0501070_0024300 3300049586 Bacteria 5082
969 Ga0501070_0030735 3300049586 Bacteria 4498
970 Ga0501070_0100759 3300049586 Bacteria 2389
971 Ga0501070_0149135 3300049586 Bacteria 1930
972 Ga0501070_0187188 3300049586 Bacteria 1703
973 Ga0501070_0267606 3300049586 Bacteria 1396
974 Ga0501070_0286940 3300049586 Bacteria 1342
975 Ga0501071_0034192 3300049587 Bacteria 3616
976 Ga0501072_0025631 3300049588 Bacteria 4593
977 Ga0501072_0226773 3300049588 Bacteria 1488
978 Ga0501073_0000069 3300049589 Bacteria 63198
979 Ga0501074_0000507 3300049590 Bacteria 23842
980 Ga0501074_0004738 3300049590 Bacteria 9749
981 Ga0501074_0012661 3300049590 Bacteria 6135
982 Ga0501075_0154652 3300049591 Bacteria 1749
983 Ga0501076_0143975 3300049592 Bacteria 1937
984 Ga0501077_0097333 3300049593 Bacteria 1865
985 Ga0501079_0012649 3300049741 Bacteria 6446
986 Ga0501080_0000613 3300049742 Bacteria 28256
987 Ga0501080_0096116 3300049742 Bacteria 2750
988 Ga0501083_0000838 3300049744 Bacteria 20228
989 Ga0501083_0005759 3300049744 Bacteria 8767
990 Ga0501035_0000393 3300049822 Bacteria 49959
991 Ga0501035_0069498 3300049822 Bacteria 3121
992 Ga0501035_0196089 3300049822 Bacteria 1735
993 Ga0501035_0197410 3300049822 Bacteria 1727
994 Ga0501044_0000108 3300049823 Bacteria 100968
995 Ga0501044_0054727 3300049823 Bacteria 4100
996 Ga0501044_0056673 3300049823 Bacteria 4023
997 Ga0501044_0083357 3300049823 Bacteria 3233
998 Ga0501044_0108063 3300049823 Bacteria 2792
999 Ga0501044_0260936 3300049823 Bacteria 1671
1000 Ga0501045_0003166 3300049824 Bacteria 11244
1001 Ga0501045_0210214 3300049824 Bacteria 1449
1002 Ga0501045_0292267 3300049824 Bacteria 1213
1003 nmdc:mga03683_82564_c1 3300050489 Bacteria 1390
1004 nmdc:mga03n38_15385_c1 3300050490 Bacteria 2953
1005 nmdc:mga03n38_25648_c1 3300050490 Bacteria 2424
1006 nmdc:mga00v17_136747_c1 3300050491 Bacteria 1569
1007 nmdc:mga0yw44_187613_c1 3300050492 Bacteria 1363
1008 nmdc:mga0yw44_30927_c1 3300050492 Bacteria 3109
1009 nmdc:mga0yw44_8056_c1 3300050492 Bacteria 5226
1010 nmdc:mga0yw44_87129_c1 3300050492 Bacteria 1968
1011 nmdc:mga0k408_73151_c1 3300050493 Bacteria 2002
1012 nmdc:mga06z11_152157_c1 3300050494 Bacteria 1316
1013 nmdc:mga06z11_19961_c1 3300050494 Bacteria 3090
1014 nmdc:mga04h51_14481_c1 3300050495 Bacteria 2254
1015 nmdc:mga07m45_144408_c1 3300050496 Bacteria 1379
1016 nmdc:mga07m45_31507_c1 3300050496 Bacteria 2939
1017 nmdc:mga07m45_35943_c1 3300050496 Bacteria 2757
1018 nmdc:mga07m45_88026_c1 3300050496 Bacteria 1777
1019 nmdc:mga05p37_197856_c1 3300050507 Bacteria 2436
1020 nmdc:mga08y16_669221_c1 3300050511 Bacteria 1040
1021 nmdc:mga0rr50_65960_c1 3300050513 Bacteria 2744
1022 nmdc:mga0sz30_173256_c1 3300050516 Bacteria 957
1023 nmdc:mga0sz30_18533_c1 3300050516 Bacteria 2787
1024 Ga0495601_0035637 3300053077 Bacteria 3107
1025 Ga0500635_0004703 3300053080 Bacteria 3531
1026 Ga0495655_0009258 3300053083 Bacteria 1903
1027 Ga0495655_0030609 3300053083 Bacteria 1303
1028 Ga0495595_0004533 3300053084 Bacteria 5589
1029 Ga0495595_0013998 3300053084 Bacteria 3396
1030 Ga0495619_0001285 3300053085 Bacteria 16486
1031 Ga0495619_0021537 3300053085 Bacteria 4117
1032 Ga0495619_0027673 3300053085 Bacteria 3654
1033 Ga0495619_0030366 3300053085 Bacteria 3499
1034 Ga0500643_000517 3300053087 Bacteria 27366
1035 Ga0500643_019874 3300053087 Bacteria 2206
1036 Ga0500647_0002370 3300053091 Bacteria 6991
1037 Ga0500647_0011549 3300053091 Bacteria 3949
1038 Ga0500651_0111545 3300053093 Bacteria 1668
1039 Ga0500651_0190199 3300053093 Bacteria 1215
1040 Ga0500566_0000470 3300053094 Bacteria 22447
1041 Ga0500566_0000491 3300053094 Bacteria 22023
1042 Ga0500566_0001030 3300053094 Bacteria 16089
1043 Ga0500566_0006845 3300053094 Bacteria 6749
1044 Ga0500640_073975 3300053095 Bacteria 1457
1045 Ga0500640_082273 3300053095 Bacteria 1363
1046 Ga0500641_0035129 3300053096 Bacteria 1998
1047 Ga0500650_0002265 3300053098 Bacteria 6261
1048 Ga0500555_001517 3300053103 Bacteria 7030
1049 Ga0500556_0000005 3300053104 Bacteria 581135
1050 Ga0500556_0015602 3300053104 Bacteria 2347
1051 Ga0500557_000019 3300053105 Bacteria 93216
1052 Ga0500562_004121 3300053108 Bacteria 3664
1053 Ga0500562_038472 3300053108 Bacteria 1270
1054 Ga0500569_003665 3300053109 Bacteria 3167
1055 Ga0500569_036979 3300053109 Bacteria 1408
1056 Ga0500572_000144 3300053111 Bacteria 24401
1057 Ga0500572_008726 3300053111 Bacteria 2377
1058 Ga0500595_014574 3300053119 Bacteria 2979
1059 Ga0500595_047421 3300053119 Bacteria 1346
1060 Ga0500607_096979 3300053121 Bacteria 1472
1061 Ga0500607_104804 3300053121 Bacteria 1397
1062 Ga0500608_000126 3300053122 Bacteria 31144
1063 Ga0500608_020655 3300053122 Bacteria 3032
1064 Ga0500618_013409 3300053125 Bacteria 2117
1065 Ga0500642_0000009 3300053130 Bacteria 286829
1066 Ga0500642_0000835 3300053130 Bacteria 8983
1067 Ga0500652_000259 3300053131 Bacteria 19823
1068 Ga0500559_0000222 3300053136 Bacteria 45603
1069 Ga0500559_0000386 3300053136 Bacteria 32337
1070 Ga0500568_0003199 3300053139 Bacteria 9308
1071 Ga0500568_0093125 3300053139 Bacteria 1135
1072 Ga0500573_0048305 3300053140 Bacteria 2449
1073 Ga0500586_000081 3300053145 Bacteria 16471
1074 Ga0500590_013765 3300053148 Bacteria 4157
1075 Ga0500590_031683 3300053148 Bacteria 2742
1076 Ga0500590_109997 3300053148 Bacteria 1309
1077 Ga0500603_000143 3300053150 Bacteria 17272
1078 Ga0500603_004087 3300053150 Bacteria 3123
1079 Ga0500604_0005397 3300053151 Bacteria 3375
1080 Ga0500616_0000035 3300053153 Bacteria 394242
1081 Ga0500616_0026411 3300053153 Bacteria 3214
1082 Ga0500622_0000355 3300053156 Bacteria 44648
1083 Ga0500638_000229 3300053162 Bacteria 11997
1084 Ga0500638_056822 3300053162 Bacteria 1885
1085 Ga0500639_005961 3300053163 Bacteria 6271
1086 Ga0500639_013425 3300053163 Bacteria 4308
1087 Ga0500636_0000168 3300053177 Bacteria 34492
1088 Ga0500636_0012018 3300053177 Bacteria 5071
1089 Ga0500636_0029876 3300053177 Bacteria 3221
1090 Ga0500637_0000134 3300053178 Bacteria 27110
1091 Ga0500637_0010521 3300053178 Bacteria 4745
1092 Ga0500649_024644 3300053722 Bacteria 2483
1093 Ga0500625_022425 3300053729 Bacteria 2981
1094 Ga0500645_025680 3300053730 Bacteria 1797
1095 Ga0500596_001188 3300053735 Bacteria 5257
1096 Ga0501084_0012311 3300054114 Bacteria 7084
1097 Ga0501084_0036311 3300054114 Bacteria 4116
1098 Ga0500661_000037 3300055283 Bacteria 19843
1099 Ga0501082_0029005 3300060353 Bacteria 4767
1100 Ga0501082_0070850 3300060353 Bacteria 3001

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049579 Ga0501043_0033269 Ga0501043_0033269_3230_4045 270
2 3300039450 Ga0436363_0321331 Ga0436363_0321331_186_1010 273
3 3300045049 Ga0466959_0117802 Ga0466959_0117802_1050_1874 273
4 3300046462 Ga0495651_0266405 Ga0495651_0266405_315_1139 273
5 3300046511 Ga0495608_0344313 Ga0495608_0344313_16_840 273
6 3300046557 Ga0495622_0076309 Ga0495622_0076309_706_1530 273
7 3300048914 Ga0496111_0372141 Ga0496111_0372141_200_1024 273
8 3300035171 Ga0373946_0144167 Ga0373946_0144167_34_861 274
9 3300025981 Ga0207640_10379698 Ga0207640_103796982 276
10 3300035692 Ga0373935_0130896 Ga0373935_0130896_816_1673 284
11 3300046539 Ga0495621_0142561 Ga0495621_0142561_25_882 284
12 3300046558 Ga0495633_0159353 Ga0495633_0159353_14_871 284
13 3300048921 Ga0496118_0292353 Ga0496118_0292353_31_888 284
14 3300048923 Ga0496120_0116144 Ga0496120_0116144_20_877 284
15 3300035089 Ga0373944_0109761 Ga0373944_0109761_37_924 294
16 3300050516 nmdc:mga0sz30_173256_c1 nmdc:mga0sz30_173256_c1_52_942 295
17 3300050511 nmdc:mga08y16_669221_c1 nmdc:mga08y16_669221_c1_111_1028 302
18 3300048924 Ga0496121_0321646 Ga0496121_0321646_95_1012 304
19 3300048923 Ga0496120_0030057 Ga0496120_0030057_20_955 310
20 3300035172 Ga0373955_0242146 Ga0373955_0242146_50_988 311
21 3300037068 Ga0373925_0138170 Ga0373925_0138170_50_988 311
22 3300005340 Ga0070689_100314067 Ga0070689_1003140672 313
23 3300047322 Ga0495680_0164774 Ga0495680_0164774_86_1030 313
24 3300026089 Ga0207648_10415314 Ga0207648_104153142 315
25 3300026118 Ga0207675_100263583 Ga0207675_1002635831 315
26 3300047317 Ga0495604_0148477 Ga0495604_0148477_155_1171 318
27 3300048910 Ga0496107_0035617 Ga0496107_0035617_116_1096 320
28 3300048924 Ga0496121_0004071 Ga0496121_0004071_313_1293 320
29 3300053087 Ga0500643_019874 Ga0500643_019874_655_1641 320
30 3300005435 Ga0070714_100003521 Ga0070714_1000035213 322
31 3300005437 Ga0070710_10000219 Ga0070710_1000021916 322
32 3300005439 Ga0070711_100002832 Ga0070711_1000028323 322
33 3300025898 Ga0207692_10041308 Ga0207692_100413083 322
34 3300025906 Ga0207699_10108963 Ga0207699_101089632 322
35 3300025915 Ga0207693_10007490 Ga0207693_100074909 322
36 3300025916 Ga0207663_10014741 Ga0207663_100147415 322
37 3300025928 Ga0207700_10012800 Ga0207700_100128003 322
38 3300025929 Ga0207664_10004015 Ga0207664_1000401510 322
39 3300048924 Ga0496121_0064130 Ga0496121_0064130_882_1853 322
40 iso_pu_bacteria 2513237096 2513661054 322
41 iso_pu_bacteria 2513237137 2513860573 322
42 iso_pu_bacteria 2513237145 2513918980 322
43 iso_pu_bacteria 2517572143 2517888301 322
44 iso_pu_bacteria 2524023228 2524539886 322
45 iso_pu_bacteria 2602042107 2603857988 322
46 iso_pu_bacteria 2667528175 2671123349 322
47 iso_pu_bacteria 2728368998 2728750727 322
48 iso_pu_bacteria 2791355197 2793067118 322
49 iso_pu_bacteria 2857524615 2857527369 322
50 iso_pu_bacteria 2885374607 2885378997 322
51 iso_pu_bacteria 2893066018 2893071908 322
52 iso_pu_bacteria 2903748898 2903756715 322
53 iso_pu_bacteria 2904690495 2904692186 322
54 iso_pu_bacteria 2904699407 2904709778 322
55 iso_pu_bacteria 2906610324 2906614343 322
56 iso_pu_bacteria 2906635258 2906639160 322
57 iso_pu_bacteria 2906660503 2906666727 322
58 iso_pu_bacteria 2908739725 2908746832 322
59 iso_pu_bacteria 2908756301 2908756725 322
60 iso_pu_bacteria 2919073203 2919078482 322
61 iso_pu_bacteria 2922425934 2922426172 322
62 iso_pu_bacteria 2935630451 2935632561 322
63 iso_pu_bacteria 2941507105 2941508775 322
64 iso_pu_bacteria 2941515067 2941516605 322
65 iso_pu_bacteria 2941523033 2941524379 322
66 iso_pu_bacteria 3005474847 3005483371 322
67 iso_pu_bacteria 8006933436 8006936875 322
68 iso_pu_bacteria 8006973647 8006976845 322
69 iso_pu_bacteria 8019555841 8019561813 322
70 iso_pu_bacteria 8019565922 8019571883 322
71 iso_pu_bacteria 8056689827 8056690928 322
72 3300009147 Ga0114129_10229803 Ga0114129_102298033 323
73 3300013307 Ga0157372_10519055 Ga0157372_105190552 323
74 3300021358 Ga0213873_10014582 Ga0213873_100145821 323
75 3300021384 Ga0213876_10013493 Ga0213876_100134936 323
76 3300039437 Ga0436365_0877008 Ga0436365_0877008_21394_22368 323
77 3300039453 Ga0436362_1015371 Ga0436362_1015371_782_1756 323
78 3300048928 Ga0496125_0162615 Ga0496125_0162615_526_1500 323
79 iso_pu_bacteria 2508501128 2509149977 323
80 iso_pu_bacteria 2513237098 2513672952 323
81 iso_pu_bacteria 2524023210 2524466434 323
82 iso_pu_bacteria 2643221651 2644290648 323
83 iso_pu_bacteria 2885383462 2885385650 323
84 iso_pu_bacteria 2903768456 2903770457 323
85 iso_pu_bacteria 2935959822 2935964044 323
86 iso_pu_bacteria 8056681323 8056683072 323
87 3300021384 Ga0213876_10158781 Ga0213876_101587812 324
88 3300021384 Ga0213876_10164378 Ga0213876_101643782 324
89 3300039437 Ga0436365_1727551 Ga0436365_1727551_462_1439 324
90 3300044694 Ga0466963_0141252 Ga0466963_0141252_102_1079 324
91 iso_pu_bacteria 2507262055 2507504720 324
92 iso_pu_bacteria 2508501009 2508539863 324
93 iso_pu_bacteria 2508501042 2508695005 324
94 iso_pu_bacteria 2511231028 2511394948 324
95 iso_pu_bacteria 2513237092 2513624959 324
96 iso_pu_bacteria 2513237094 2513640756 324
97 iso_pu_bacteria 2513237095 2513651736 324
98 iso_pu_bacteria 2513237101 2513698184 324
99 iso_pu_bacteria 2513237102 2513705652 324
100 iso_pu_bacteria 2513237139 2513879218 324
101 iso_pu_bacteria 2513237141 2513889694 324
102 iso_pu_bacteria 2513237161 2514010230 324
103 iso_pu_bacteria 2515154112 2515627804 324
104 iso_pu_bacteria 2517093001 2517106513 324
105 iso_pu_bacteria 2524023205 2524440168 324
106 iso_pu_bacteria 2528768022 2528850645 324
107 iso_pu_bacteria 2617270735 2617350131 324
108 iso_pu_bacteria 2617270741 2617377179 324
109 iso_pu_bacteria 2721755755 2723849235 324
110 iso_pu_bacteria 2744054633 2745077722 324
111 iso_pu_bacteria 2791355196 2793065739 324
112 iso_pu_bacteria 2791355199 2793078398 324
113 iso_pu_bacteria 2802429603 2805920358 324
114 iso_pu_bacteria 2816332527 2818239360 324
115 iso_pu_bacteria 2824600985 2824605856 324
116 iso_pu_bacteria 2824609381 2824611930 324
117 iso_pu_bacteria 2824617872 2824622806 324
118 iso_pu_bacteria 2824626560 2824631894 324
119 iso_pu_bacteria 2824635225 2824639158 324
120 iso_pu_bacteria 2824644064 2824650402 324
121 iso_pu_bacteria 2824653114 2824660231 324
122 iso_pu_bacteria 2824661429 2824664260 324
123 iso_pu_bacteria 2824671348 2824676077 324
124 iso_pu_bacteria 2824679649 2824681965 324
125 iso_pu_bacteria 2824687955 2824692505 324
126 iso_pu_bacteria 2824696289 2824699806 324
127 iso_pu_bacteria 2824704595 2824711045 324
128 iso_pu_bacteria 2824714736 2824720281 324
129 iso_pu_bacteria 2824723954 2824730690 324
130 iso_pu_bacteria 2824732956 2824734158 324
131 iso_pu_bacteria 2824746037 2824749568 324
132 iso_pu_bacteria 2824753945 2824762801 324
133 iso_pu_bacteria 2824763712 2824772851 324
134 iso_pu_bacteria 2824773399 2824780979 324
135 iso_pu_bacteria 2838122688 2838125854 324
136 iso_pu_bacteria 2841941048 2841948447 324
137 iso_pu_bacteria 2841949485 2841952894 324
138 iso_pu_bacteria 2841957949 2841963492 324
139 iso_pu_bacteria 2841966195 2841971074 324
140 iso_pu_bacteria 2841974524 2841977667 324
141 iso_pu_bacteria 2841983080 2841984772 324
142 iso_pu_bacteria 2842038055 2842041507 324
143 iso_pu_bacteria 2842045827 2842049549 324
144 iso_pu_bacteria 2844315083 2844315952 324
145 iso_pu_bacteria 2847930680 2847939812 324
146 iso_pu_bacteria 2847939898 2847942789 324
147 iso_pu_bacteria 2849076700 2849076787 324
148 iso_pu_bacteria 2857509624 2857515742 324
149 iso_pu_bacteria 2874590934 2874593683 324
150 iso_pu_bacteria 2874604998 2874608532 324
151 iso_pu_bacteria 2874612657 2874617646 324
152 iso_pu_bacteria 2874620515 2874622049 324
153 iso_pu_bacteria 2874628541 2874629280 324
154 iso_pu_bacteria 2874645413 2874647947 324
155 iso_pu_bacteria 2876761206 2876769779 324
156 iso_pu_bacteria 2876771140 2876772774 324
157 iso_pu_bacteria 2876808645 2876813476 324
158 iso_pu_bacteria 2876818435 2876826497 324
159 iso_pu_bacteria 2879074833 2879077470 324
160 iso_pu_bacteria 2879083081 2879088247 324
161 iso_pu_bacteria 2879099564 2879105557 324
162 iso_pu_bacteria 2879110137 2879112687 324
163 iso_pu_bacteria 2879127579 2879134425 324
164 iso_pu_bacteria 2879142872 2879147384 324
165 iso_pu_bacteria 2881364244 2881364446 324
166 iso_pu_bacteria 2881665667 2881666063 324
167 iso_pu_bacteria 2885366525 2885369039 324
168 iso_pu_bacteria 2885409591 2885415478 324
169 iso_pu_bacteria 2888378607 2888379007 324
170 iso_pu_bacteria 2888388044 2888390177 324
171 iso_pu_bacteria 2888419890 2888427316 324
172 iso_pu_bacteria 2889033259 2889035988 324
173 iso_pu_bacteria 2903727486 2903731901 324
174 iso_pu_bacteria 2904666416 2904669359 324
175 iso_pu_bacteria 2904711408 2904716110 324
176 iso_pu_bacteria 2906602504 2906606158 324
177 iso_pu_bacteria 2906626472 2906631618 324
178 iso_pu_bacteria 2906643746 2906649339 324
179 iso_pu_bacteria 2908775508 2908775694 324
180 iso_pu_bacteria 2922361189 2922364457 324
181 iso_pu_bacteria 2922368715 2922377887 324
182 iso_pu_bacteria 2922386360 2922389143 324
183 iso_pu_bacteria 2922393267 2922400874 324
184 iso_pu_bacteria 2929615660 2929623904 324
185 iso_pu_bacteria 2929624759 2929633062 324
186 iso_pu_bacteria 2932784394 2932789155 324
187 iso_pu_bacteria 2932794094 2932800116 324
188 iso_pu_bacteria 2932801729 2932808300 324
189 iso_pu_bacteria 2932809354 2932814208 324
190 iso_pu_bacteria 2932818245 2932820334 324
191 iso_pu_bacteria 2932828146 2932834404 324
192 iso_pu_bacteria 2933577622 2933585807 324
193 iso_pu_bacteria 2935608549 2935615087 324
194 iso_pu_bacteria 2935616580 2935620089 324
195 iso_pu_bacteria 2935638405 2935640407 324
196 iso_pu_bacteria 2935648319 2935651563 324
197 iso_pu_bacteria 2935656913 2935659669 324
198 iso_pu_bacteria 2935665750 2935668601 324
199 iso_pu_bacteria 2935675223 2935681903 324
200 iso_pu_bacteria 2935684952 2935686910 324
201 iso_pu_bacteria 2935694250 2935702052 324
202 iso_pu_bacteria 2935703347 2935709889 324
203 iso_pu_bacteria 2935713505 2935716598 324
204 iso_pu_bacteria 2935722832 2935723277 324
205 iso_pu_bacteria 2935732158 2935734834 324
206 iso_pu_bacteria 2935741537 2935744375 324
207 iso_pu_bacteria 2935750917 2935752876 324
208 iso_pu_bacteria 2935760218 2935769266 324
209 iso_pu_bacteria 2935769743 2935774771 324
210 iso_pu_bacteria 2935777560 2935779664 324
211 iso_pu_bacteria 2935785616 2935789714 324
212 iso_pu_bacteria 2935793552 2935797918 324
213 iso_pu_bacteria 2935801545 2935806307 324
214 iso_pu_bacteria 2935810662 2935818162 324
215 iso_pu_bacteria 2935819856 2935825875 324
216 iso_pu_bacteria 2935827899 2935831913 324
217 iso_pu_bacteria 2935837841 2935841256 324
218 iso_pu_bacteria 2935847175 2935851494 324
219 iso_pu_bacteria 2935855204 2935858975 324
220 iso_pu_bacteria 2935864058 2935864156 324
221 iso_pu_bacteria 2935873716 2935875492 324
222 iso_pu_bacteria 2935883170 2935883406 324
223 iso_pu_bacteria 2935908558 2935910482 324
224 iso_pu_bacteria 2935916978 2935918116 324
225 iso_pu_bacteria 2935926038 2935927607 324
226 iso_pu_bacteria 2935934488 2935936521 324
227 iso_pu_bacteria 2935942939 2935943926 324
228 iso_pu_bacteria 2935951376 2935952363 324
229 iso_pu_bacteria 2935967501 2935969203 324
230 iso_pu_bacteria 2935975950 2935978035 324
231 iso_pu_bacteria 2935984226 2935984664 324
232 iso_pu_bacteria 2935992306 2935995528 324
233 iso_pu_bacteria 2936002035 2936007950 324
234 iso_pu_bacteria 2936011229 2936014085 324
235 iso_pu_bacteria 2936019824 2936023006 324
236 iso_pu_bacteria 2936028420 2936031142 324
237 iso_pu_bacteria 2936037263 2936044772 324
238 iso_pu_bacteria 2936046547 2936049264 324
239 iso_pu_bacteria 2936055302 2936055807 324
240 iso_pu_bacteria 2940556831 2940558789 324
241 iso_pu_bacteria 2941531003 2941535818 324
242 iso_pu_bacteria 2941538514 2941543482 324
243 iso_pu_bacteria 3005483717 3005490586 324
244 iso_pu_bacteria 3005506211 3005506404 324
245 iso_pu_bacteria 3005587118 3005588952 324
246 iso_pu_bacteria 3005594810 3005595545 324
247 iso_pu_bacteria 3005710791 3005711532 324
248 iso_pu_bacteria 3005718088 3005718770 324
249 iso_pu_bacteria 8006926726 8006932910 324
250 iso_pu_bacteria 8006964411 8006967769 324
251 iso_pu_bacteria 8006984368 8006992562 324
252 iso_pu_bacteria 8006994254 8006998440 324
253 iso_pu_bacteria 8016511872 8016517641 324
254 iso_pu_bacteria 8016522445 8016525704 324
255 iso_pu_bacteria 8016539877 8016543587 324
256 iso_pu_bacteria 8016548790 8016549704 324
257 iso_pu_bacteria 8016557553 8016558121 324
258 iso_pu_bacteria 8016575299 8016581632 324
259 iso_pu_bacteria 8016595262 8016596129 324
260 iso_pu_bacteria 8016613128 8016618929 324
261 iso_pu_bacteria 8016622563 8016622617 324
262 iso_pu_bacteria 8016630954 8016636431 324
263 iso_pu_bacteria 8017057580 8017058984 324
264 iso_pu_bacteria 8019530166 8019530580 324
265 iso_pu_bacteria 8019538911 8019541014 324
266 iso_pu_bacteria 8019547302 8019549607 324
267 iso_pu_bacteria 8019576017 8019576657 324
268 iso_pu_bacteria 8019586578 8019594709 324
269 iso_pu_bacteria 8019597564 8019607028 324
270 iso_pu_bacteria 8019608314 8019611482 324
271 iso_pu_bacteria 8019629233 8019630869 324
272 iso_pu_bacteria 8019638758 8019639728 324
273 iso_pu_bacteria 8019648815 8019653086 324
274 iso_pu_bacteria 8019659431 8019667884 324
275 iso_pu_bacteria 8019668869 8019677299 324
276 iso_pu_bacteria 8019678201 8019678679 324
277 iso_pu_bacteria 8019687851 8019696834 324
278 iso_pu_bacteria 8055742211 8055742961 324
279 iso_pu_bacteria 8056673599 8056678485 324
280 iso_pu_bacteria 8056967851 8056970744 324
281 3300005327 Ga0070658_10418233 Ga0070658_104182331 325
282 3300005455 Ga0070663_100003302 Ga0070663_10000330212 325
283 3300005530 Ga0070679_100083660 Ga0070679_1000836603 325
284 3300005548 Ga0070665_100063100 Ga0070665_1000631004 325
285 3300005563 Ga0068855_100121183 Ga0068855_1001211832 325
286 3300006048 Ga0075363_100002768 Ga0075363_1000027688 325
287 3300006178 Ga0075367_10128164 Ga0075367_101281642 325
288 3300006353 Ga0075370_10119165 Ga0075370_101191652 325
289 3300025917 Ga0207660_10071421 Ga0207660_100714213 325
290 3300026067 Ga0207678_10008196 Ga0207678_100081962 325
291 3300027866 Ga0209813_10016710 Ga0209813_100167102 325
292 3300028379 Ga0268266_10172700 Ga0268266_101727002 325
293 3300037466 Ga0395898_0078628 Ga0395898_0078628_924_1904 325
294 3300048913 Ga0496110_0408864 Ga0496110_0408864_103_1083 325
295 3300049569 Ga0501032_0097504 Ga0501032_0097504_354_1334 325
296 3300049570 Ga0501033_0070751 Ga0501033_0070751_285_1265 325
297 3300049571 Ga0501034_0165791 Ga0501034_0165791_608_1588 325
298 3300049575 Ga0501039_0114143 Ga0501039_0114143_252_1232 325
299 3300049586 Ga0501070_0267606 Ga0501070_0267606_88_1068 325
300 3300049822 Ga0501035_0197410 Ga0501035_0197410_534_1514 325
301 3300049823 Ga0501044_0054727 Ga0501044_0054727_1691_2671 325
302 3300049823 Ga0501044_0083357 Ga0501044_0083357_2208_3188 325
303 3300049824 Ga0501045_0292267 Ga0501045_0292267_69_1049 325
304 3300050495 nmdc:mga04h51_14481_c1 nmdc:mga04h51_14481_c1_413_1393 325
305 3300050496 nmdc:mga07m45_31507_c1 nmdc:mga07m45_31507_c1_952_1932 325
306 iso_pu_bacteria 2513237104 2513714944 325
307 3300003203 JGI25406J46586_10020229 JGI25406J46586_100202293 326
308 3300005329 Ga0070683_100417424 Ga0070683_1004174242 326
309 3300005436 Ga0070713_100101588 Ga0070713_1001015882 326
310 3300005539 Ga0068853_100249648 Ga0068853_1002496482 326
311 3300005563 Ga0068855_100055336 Ga0068855_1000553365 326
312 3300005563 Ga0068855_100087122 Ga0068855_1000871224 326
313 3300005578 Ga0068854_100040592 Ga0068854_1000405922 326
314 3300005614 Ga0068856_100002788 Ga0068856_1000027887 326
315 3300005842 Ga0068858_100097972 Ga0068858_1000979723 326
316 3300005983 Ga0081540_1055762 Ga0081540_10557622 326
317 3300005985 Ga0081539_10000629 Ga0081539_1000062926 326
318 3300005985 Ga0081539_10080264 Ga0081539_100802642 326
319 3300006028 Ga0070717_10060673 Ga0070717_100606734 326
320 3300006051 Ga0075364_10117059 Ga0075364_101170592 326
321 3300006353 Ga0075370_10105722 Ga0075370_101057222 326
322 3300006942 Ga0099824_1010813 Ga0099824_10108136 326
323 3300006943 Ga0099822_1002332 Ga0099822_100233215 326
324 3300009093 Ga0105240_10061416 Ga0105240_100614164 326
325 3300009093 Ga0105240_10090182 Ga0105240_100901822 326
326 3300009101 Ga0105247_10162695 Ga0105247_101626952 326
327 3300009174 Ga0105241_10108202 Ga0105241_101082023 326
328 3300009551 Ga0105238_10043421 Ga0105238_100434214 326
329 3300009551 Ga0105238_10067329 Ga0105238_100673293 326
330 3300010375 Ga0105239_10031504 Ga0105239_100315047 326
331 3300010375 Ga0105239_10075985 Ga0105239_100759853 326
332 3300010375 Ga0105239_10286135 Ga0105239_102861352 326
333 3300013102 Ga0157371_10023801 Ga0157371_100238015 326
334 3300013104 Ga0157370_10056752 Ga0157370_100567524 326
335 3300013105 Ga0157369_10008687 Ga0157369_100086878 326
336 3300013105 Ga0157369_10015000 Ga0157369_100150005 326
337 3300013307 Ga0157372_10132015 Ga0157372_101320152 326
338 3300021384 Ga0213876_10057406 Ga0213876_100574062 326
339 3300025261 Ga0209233_1002405 Ga0209233_10024054 326
340 3300025295 Ga0209564_1001154 Ga0209564_100115424 326
341 3300025295 Ga0209564_1023468 Ga0209564_10234682 326
342 3300025904 Ga0207647_10059968 Ga0207647_100599683 326
343 3300025909 Ga0207705_10178962 Ga0207705_101789622 326
344 3300025913 Ga0207695_10032098 Ga0207695_100320983 326
345 3300025913 Ga0207695_10141453 Ga0207695_101414532 326
346 3300025924 Ga0207694_10047790 Ga0207694_100477903 326
347 3300025928 Ga0207700_10029515 Ga0207700_100295154 326
348 3300025944 Ga0207661_10191275 Ga0207661_101912752 326
349 3300025949 Ga0207667_10161752 Ga0207667_101617522 326
350 3300025981 Ga0207640_10029111 Ga0207640_100291114 326
351 3300026035 Ga0207703_10094594 Ga0207703_100945942 326
352 3300026041 Ga0207639_10194085 Ga0207639_101940852 326
353 3300026078 Ga0207702_10000623 Ga0207702_1000062324 326
354 3300026116 Ga0207674_10085543 Ga0207674_100855433 326
355 3300027357 Ga0209589_1000015 Ga0209589_100001541 326
356 3300027361 Ga0209489_100015 Ga0209489_10001541 326
357 3300027363 Ga0209700_100025 Ga0209700_10002541 326
358 3300028556 Ga0265337_1025017 Ga0265337_10250172 326
359 3300028563 Ga0265319_1019294 Ga0265319_10192942 326
360 3300028573 Ga0265334_10001242 Ga0265334_100012424 326
361 3300028577 Ga0265318_10009393 Ga0265318_100093933 326
362 3300028653 Ga0265323_10001035 Ga0265323_1000103510 326
363 3300028666 Ga0265336_10000363 Ga0265336_1000036323 326
364 3300028800 Ga0265338_10000155 Ga0265338_1000015585 326
365 3300029957 Ga0265324_10021334 Ga0265324_100213342 326
366 3300031711 Ga0265314_10001992 Ga0265314_1000199221 326
367 3300031911 Ga0307412_10018506 Ga0307412_100185063 326
368 3300033180 Ga0307510_10090387 Ga0307510_100903872 326
369 3300033442 Ga0315911_1000021 Ga0315911_10000219 326
370 3300035691 Ga0373931_0040942 Ga0373931_0040942_730_1713 326
371 3300037418 Ga0395900_0021796 Ga0395900_0021796_796_1779 326
372 3300037466 Ga0395898_0003151 Ga0395898_0003151_2445_3428 326
373 3300037466 Ga0395898_0132975 Ga0395898_0132975_1356_2339 326
374 3300038443 Ga0395901_0083638 Ga0395901_0083638_387_1370 326
375 3300039437 Ga0436365_1301685 Ga0436365_1301685_36_1019 326
376 3300039437 Ga0436365_1606403 Ga0436365_1606403_1022_2005 326
377 3300046455 Ga0495603_0123234 Ga0495603_0123234_42_1025 326
378 3300046460 Ga0495638_0037800 Ga0495638_0037800_156_1139 326
379 3300046460 Ga0495638_0037825 Ga0495638_0037825_1536_2519 326
380 3300046513 Ga0495616_0020323 Ga0495616_0020323_2459_3442 326
381 3300046524 Ga0495648_0001116 Ga0495648_0001116_22557_23540 326
382 3300046557 Ga0495622_0033105 Ga0495622_0033105_773_1756 326
383 3300046616 Ga0495668_0106360 Ga0495668_0106360_238_1221 326
384 3300046660 Ga0495625_0094667 Ga0495625_0094667_490_1473 326
385 3300046660 Ga0495625_0135023 Ga0495625_0135023_638_1621 326
386 3300046665 Ga0495661_0037219 Ga0495661_0037219_171_1154 326
387 3300047315 Ga0495581_0044765 Ga0495581_0044765_779_1762 326
388 3300047320 Ga0495672_0095558 Ga0495672_0095558_332_1315 326
389 3300047470 Ga0495681_0053640 Ga0495681_0053640_431_1414 326
390 3300047472 Ga0495686_0093652 Ga0495686_0093652_672_1658 326
391 3300047472 Ga0495686_0093920 Ga0495686_0093920_211_1194 326
392 3300048091 Ga0495626_0037089 Ga0495626_0037089_1163_2146 326
393 3300048906 Ga0496103_0214465 Ga0496103_0214465_114_1097 326
394 3300048909 Ga0496106_0348566 Ga0496106_0348566_165_1148 326
395 3300048919 Ga0496116_0020888 Ga0496116_0020888_187_1170 326
396 3300048920 Ga0496117_0079592 Ga0496117_0079592_1046_2029 326
397 3300048921 Ga0496118_0045268 Ga0496118_0045268_33_1016 326
398 3300048923 Ga0496120_0016606 Ga0496120_0016606_1447_2430 326
399 3300048923 Ga0496120_0105296 Ga0496120_0105296_422_1405 326
400 3300048924 Ga0496121_0004123 Ga0496121_0004123_15909_16892 326
401 3300048924 Ga0496121_0072706 Ga0496121_0072706_1709_2692 326
402 3300048925 Ga0496122_0014770 Ga0496122_0014770_1752_2735 326
403 3300048925 Ga0496122_0073007 Ga0496122_0073007_612_1595 326
404 3300048925 Ga0496122_0125829 Ga0496122_0125829_31_1014 326
405 3300048926 Ga0496123_0056676 Ga0496123_0056676_262_1245 326
406 3300048927 Ga0496124_0056207 Ga0496124_0056207_1655_2638 326
407 3300048927 Ga0496124_0075008 Ga0496124_0075008_402_1385 326
408 3300048927 Ga0496124_0188417 Ga0496124_0188417_510_1493 326
409 3300048928 Ga0496125_0000099 Ga0496125_0000099_178225_179208 326
410 3300048928 Ga0496125_0001377 Ga0496125_0001377_26605_27588 326
411 3300048928 Ga0496125_0004112 Ga0496125_0004112_3228_4211 326
412 3300048928 Ga0496125_0015326 Ga0496125_0015326_2794_3777 326
413 3300048929 Ga0496126_0027035 Ga0496126_0027035_2681_3664 326
414 3300048929 Ga0496126_0032694 Ga0496126_0032694_1445_2428 326
415 3300048929 Ga0496126_0178353 Ga0496126_0178353_297_1280 326
416 3300049568 Ga0501031_0002180 Ga0501031_0002180_2640_3623 326
417 3300049568 Ga0501031_0027770 Ga0501031_0027770_401_1384 326
418 3300049569 Ga0501032_0000136 Ga0501032_0000136_33364_34347 326
419 3300049569 Ga0501032_0047408 Ga0501032_0047408_897_1880 326
420 3300049570 Ga0501033_0000202 Ga0501033_0000202_42404_43387 326
421 3300049570 Ga0501033_0006530 Ga0501033_0006530_7422_8405 326
422 3300049571 Ga0501034_0000113 Ga0501034_0000113_89354_90337 326
423 3300049572 Ga0501036_0000059 Ga0501036_0000059_57642_58625 326
424 3300049572 Ga0501036_0062741 Ga0501036_0062741_881_1864 326
425 3300049572 Ga0501036_0199024 Ga0501036_0199024_558_1541 326
426 3300049573 Ga0501037_0000214 Ga0501037_0000214_6153_7136 326
427 3300049573 Ga0501037_0010785 Ga0501037_0010785_4739_5722 326
428 3300049574 Ga0501038_0001243 Ga0501038_0001243_21154_22137 326
429 3300049574 Ga0501038_0002129 Ga0501038_0002129_15318_16301 326
430 3300049574 Ga0501038_0002810 Ga0501038_0002810_6071_7054 326
431 3300049575 Ga0501039_0036146 Ga0501039_0036146_142_1125 326
432 3300049575 Ga0501039_0074470 Ga0501039_0074470_222_1205 326
433 3300049575 Ga0501039_0239346 Ga0501039_0239346_271_1254 326
434 3300049575 Ga0501039_0270543 Ga0501039_0270543_257_1240 326
435 3300049579 Ga0501043_0000017 Ga0501043_0000017_6806_7789 326
436 3300049579 Ga0501043_0018948 Ga0501043_0018948_4260_5243 326
437 3300049579 Ga0501043_0059965 Ga0501043_0059965_578_1561 326
438 3300049579 Ga0501043_0197084 Ga0501043_0197084_348_1331 326
439 3300049580 Ga0501046_0000174 Ga0501046_0000174_29399_30382 326
440 3300049580 Ga0501046_0169447 Ga0501046_0169447_435_1418 326
441 3300049581 Ga0501047_0000044 Ga0501047_0000044_162917_163900 326
442 3300049581 Ga0501047_0199396 Ga0501047_0199396_382_1365 326
443 3300049581 Ga0501047_0508402 Ga0501047_0508402_31_1014 326
444 3300049582 Ga0501048_0000837 Ga0501048_0000837_6951_7934 326
445 3300049582 Ga0501048_0019094 Ga0501048_0019094_449_1432 326
446 3300049583 Ga0501067_0003781 Ga0501067_0003781_3274_4257 326
447 3300049583 Ga0501067_0012443 Ga0501067_0012443_1152_2135 326
448 3300049584 Ga0501068_0000629 Ga0501068_0000629_13675_14658 326
449 3300049584 Ga0501068_0021249 Ga0501068_0021249_400_1383 326
450 3300049585 Ga0501069_0016580 Ga0501069_0016580_16_999 326
451 3300049585 Ga0501069_0031229 Ga0501069_0031229_932_1915 326
452 3300049586 Ga0501070_0024300 Ga0501070_0024300_602_1585 326
453 3300049586 Ga0501070_0100759 Ga0501070_0100759_435_1418 326
454 3300049586 Ga0501070_0149135 Ga0501070_0149135_203_1186 326
455 3300049586 Ga0501070_0286940 Ga0501070_0286940_175_1158 326
456 3300049587 Ga0501071_0034192 Ga0501071_0034192_2312_3295 326
457 3300049588 Ga0501072_0025631 Ga0501072_0025631_347_1330 326
458 3300049588 Ga0501072_0226773 Ga0501072_0226773_58_1041 326
459 3300049589 Ga0501073_0000069 Ga0501073_0000069_25054_26037 326
460 3300049590 Ga0501074_0000507 Ga0501074_0000507_19825_20808 326
461 3300049590 Ga0501074_0004738 Ga0501074_0004738_1549_2532 326
462 3300049592 Ga0501076_0143975 Ga0501076_0143975_250_1233 326
463 3300049593 Ga0501077_0097333 Ga0501077_0097333_391_1374 326
464 3300049741 Ga0501079_0012649 Ga0501079_0012649_5332_6315 326
465 3300049742 Ga0501080_0000613 Ga0501080_0000613_9674_10657 326
466 3300049744 Ga0501083_0000838 Ga0501083_0000838_14991_15974 326
467 3300049744 Ga0501083_0005759 Ga0501083_0005759_4401_5384 326
468 3300049822 Ga0501035_0000393 Ga0501035_0000393_18778_19761 326
469 3300049822 Ga0501035_0069498 Ga0501035_0069498_1917_2900 326
470 3300049822 Ga0501035_0196089 Ga0501035_0196089_565_1548 326
471 3300049823 Ga0501044_0000108 Ga0501044_0000108_96138_97121 326
472 3300049823 Ga0501044_0056673 Ga0501044_0056673_1441_2424 326
473 3300049823 Ga0501044_0108063 Ga0501044_0108063_1090_2073 326
474 3300049823 Ga0501044_0260936 Ga0501044_0260936_515_1498 326
475 3300049824 Ga0501045_0003166 Ga0501045_0003166_4187_5170 326
476 3300049824 Ga0501045_0210214 Ga0501045_0210214_419_1402 326
477 3300050491 nmdc:mga00v17_136747_c1 nmdc:mga00v17_136747_c1_299_1282 326
478 3300050492 nmdc:mga0yw44_30927_c1 nmdc:mga0yw44_30927_c1_2050_3033 326
479 3300053093 Ga0500651_0111545 Ga0500651_0111545_163_1146 326
480 3300053094 Ga0500566_0000470 Ga0500566_0000470_290_1273 326
481 3300053096 Ga0500641_0035129 Ga0500641_0035129_378_1361 326
482 3300053098 Ga0500650_0002265 Ga0500650_0002265_2537_3520 326
483 3300053104 Ga0500556_0000005 Ga0500556_0000005_456144_457127 326
484 3300053108 Ga0500562_038472 Ga0500562_038472_223_1206 326
485 3300053109 Ga0500569_036979 Ga0500569_036979_95_1078 326
486 3300053121 Ga0500607_096979 Ga0500607_096979_102_1085 326
487 3300053122 Ga0500608_000126 Ga0500608_000126_15540_16523 326
488 3300053125 Ga0500618_013409 Ga0500618_013409_1057_2040 326
489 3300053130 Ga0500642_0000009 Ga0500642_0000009_143078_144061 326
490 3300053131 Ga0500652_000259 Ga0500652_000259_15407_16390 326
491 3300053136 Ga0500559_0000222 Ga0500559_0000222_15555_16538 326
492 3300053139 Ga0500568_0003199 Ga0500568_0003199_95_1078 326
493 3300053145 Ga0500586_000081 Ga0500586_000081_8160_9143 326
494 3300053151 Ga0500604_0005397 Ga0500604_0005397_201_1184 326
495 3300053153 Ga0500616_0000035 Ga0500616_0000035_44925_45908 326
496 3300053156 Ga0500622_0000355 Ga0500622_0000355_38142_39125 326
497 3300053177 Ga0500636_0012018 Ga0500636_0012018_415_1398 326
498 3300053177 Ga0500636_0029876 Ga0500636_0029876_1655_2641 326
499 3300053730 Ga0500645_025680 Ga0500645_025680_479_1462 326
500 3300054114 Ga0501084_0012311 Ga0501084_0012311_157_1140 326
501 3300054114 Ga0501084_0036311 Ga0501084_0036311_2153_3136 326
502 3300060353 Ga0501082_0029005 Ga0501082_0029005_2326_3309 326
503 3300060353 Ga0501082_0070850 Ga0501082_0070850_397_1380 326
504 3300003203 JGI25406J46586_10000170 JGI25406J46586_1000017015 327
505 3300003659 JGI25404J52841_10002788 JGI25404J52841_100027882 327
506 3300003659 JGI25404J52841_10020816 JGI25404J52841_100208161 327
507 3300005337 Ga0070682_100023808 Ga0070682_1000238082 327
508 3300005337 Ga0070682_100108793 Ga0070682_1001087932 327
509 3300005355 Ga0070671_100193799 Ga0070671_1001937992 327
510 3300005435 Ga0070714_100061329 Ga0070714_1000613293 327
511 3300005436 Ga0070713_100006616 Ga0070713_1000066165 327
512 3300005437 Ga0070710_10078935 Ga0070710_100789351 327
513 3300005439 Ga0070711_100007523 Ga0070711_1000075233 327
514 3300005455 Ga0070663_100012874 Ga0070663_1000128744 327
515 3300005456 Ga0070678_100121198 Ga0070678_1001211982 327
516 3300005458 Ga0070681_10369461 Ga0070681_103694612 327
517 3300005530 Ga0070679_100263811 Ga0070679_1002638112 327
518 3300005535 Ga0070684_100112861 Ga0070684_1001128612 327
519 3300005548 Ga0070665_100230562 Ga0070665_1002305622 327
520 3300005614 Ga0068856_100147691 Ga0068856_1001476913 327
521 3300005616 Ga0068852_100017600 Ga0068852_1000176002 327
522 3300005834 Ga0068851_10049292 Ga0068851_100492922 327
523 3300005937 Ga0081455_10016498 Ga0081455_100164983 327
524 3300005937 Ga0081455_10018914 Ga0081455_100189147 327
525 3300005983 Ga0081540_1001561 Ga0081540_10015614 327
526 3300005985 Ga0081539_10000040 Ga0081539_1000004014 327
527 3300006038 Ga0075365_10000230 Ga0075365_100002307 327
528 3300006048 Ga0075363_100051359 Ga0075363_1000513591 327
529 3300006175 Ga0070712_100024020 Ga0070712_1000240203 327
530 3300006177 Ga0075362_10140496 Ga0075362_101404961 327
531 3300006178 Ga0075367_10040880 Ga0075367_100408804 327
532 3300006881 Ga0068865_100051894 Ga0068865_1000518942 327
533 3300009093 Ga0105240_10133219 Ga0105240_101332192 327
534 3300009098 Ga0105245_10108732 Ga0105245_101087322 327
535 3300011119 Ga0105246_10138697 Ga0105246_101386972 327
536 3300013296 Ga0157374_10007266 Ga0157374_100072662 327
537 3300013297 Ga0157378_10275946 Ga0157378_102759462 327
538 3300013306 Ga0163162_10058930 Ga0163162_100589304 327
539 3300013306 Ga0163162_10178735 Ga0163162_101787353 327
540 3300013308 Ga0157375_10156807 Ga0157375_101568073 327
541 3300014325 Ga0163163_10279135 Ga0163163_102791353 327
542 3300014969 Ga0157376_10108045 Ga0157376_101080453 327
543 3300017792 Ga0163161_10312521 Ga0163161_103125212 327
544 3300025915 Ga0207693_10015350 Ga0207693_100153505 327
545 3300025916 Ga0207663_10018460 Ga0207663_100184603 327
546 3300025921 Ga0207652_10038391 Ga0207652_100383912 327
547 3300025929 Ga0207664_10124051 Ga0207664_101240511 327
548 3300025938 Ga0207704_10014864 Ga0207704_100148644 327
549 3300025939 Ga0207665_10020658 Ga0207665_100206583 327
550 3300025939 Ga0207665_10095577 Ga0207665_100955773 327
551 3300025939 Ga0207665_10125637 Ga0207665_101256372 327
552 3300025940 Ga0207691_10285813 Ga0207691_102858132 327
553 3300025942 Ga0207689_10057354 Ga0207689_100573543 327
554 3300025944 Ga0207661_10010897 Ga0207661_100108972 327
555 3300025944 Ga0207661_10201049 Ga0207661_102010492 327
556 3300026067 Ga0207678_10022440 Ga0207678_100224404 327
557 3300026116 Ga0207674_10143540 Ga0207674_101435402 327
558 3300026121 Ga0207683_10017559 Ga0207683_100175592 327
559 3300026121 Ga0207683_10057950 Ga0207683_100579503 327
560 3300026142 Ga0207698_10027962 Ga0207698_100279625 327
561 3300035170 Ga0373943_0030259 Ga0373943_0030259_1188_2174 327
562 3300037466 Ga0395898_0109793 Ga0395898_0109793_1157_2143 327
563 3300037471 Ga0395905_0051982 Ga0395905_0051982_975_1961 327
564 3300039450 Ga0436363_0583495 Ga0436363_0583495_348_1334 327
565 3300044684 Ga0466966_0088054 Ga0466966_0088054_56_1042 327
566 3300044693 Ga0466961_0077546 Ga0466961_0077546_1019_2005 327
567 3300044706 Ga0466964_0076792 Ga0466964_0076792_231_1217 327
568 3300044719 Ga0466971_0025243 Ga0466971_0025243_1480_2466 327
569 3300044842 Ga0466957_0023546 Ga0466957_0023546_1394_2380 327
570 3300045976 Ga0466967_0372054 Ga0466967_0372054_152_1138 327
571 3300046477 Ga0495664_0009417 Ga0495664_0009417_4357_5343 327
572 3300046507 Ga0495606_0000234 Ga0495606_0000234_9894_10880 327
573 3300046512 Ga0495610_0061594 Ga0495610_0061594_18_1004 327
574 3300046543 Ga0495645_0007006 Ga0495645_0007006_6311_7297 327
575 3300046678 Ga0495599_0081125 Ga0495599_0081125_217_1203 327
576 3300047320 Ga0495672_0018857 Ga0495672_0018857_951_1937 327
577 3300047472 Ga0495686_0069667 Ga0495686_0069667_676_1662 327
578 3300048903 Ga0496100_0040777 Ga0496100_0040777_887_1873 327
579 3300048904 Ga0496101_0007477 Ga0496101_0007477_5452_6438 327
580 3300048905 Ga0496102_0001177 Ga0496102_0001177_9426_10412 327
581 3300048907 Ga0496104_0104398 Ga0496104_0104398_789_1775 327
582 3300048908 Ga0496105_0048912 Ga0496105_0048912_1683_2669 327
583 3300048909 Ga0496106_0037087 Ga0496106_0037087_1226_2212 327
584 3300048911 Ga0496108_0041867 Ga0496108_0041867_224_1210 327
585 3300048912 Ga0496109_0008835 Ga0496109_0008835_3366_4352 327
586 3300048913 Ga0496110_0014981 Ga0496110_0014981_811_1797 327
587 3300048914 Ga0496111_0035880 Ga0496111_0035880_2457_3443 327
588 3300048915 Ga0496112_0000051 Ga0496112_0000051_47898_48884 327
589 3300048915 Ga0496112_0145021 Ga0496112_0145021_1047_2033 327
590 3300048916 Ga0496113_0081284 Ga0496113_0081284_838_1824 327
591 3300048917 Ga0496114_0036732 Ga0496114_0036732_2516_3502 327
592 3300048918 Ga0496115_0003395 Ga0496115_0003395_3645_4631 327
593 3300048918 Ga0496115_0344973 Ga0496115_0344973_59_1045 327
594 3300048924 Ga0496121_0000091 Ga0496121_0000091_68019_69005 327
595 3300048929 Ga0496126_0013193 Ga0496126_0013193_6133_7119 327
596 3300048929 Ga0496126_0023656 Ga0496126_0023656_356_1342 327
597 3300048929 Ga0496126_0033644 Ga0496126_0033644_759_1745 327
598 3300048929 Ga0496126_0094056 Ga0496126_0094056_342_1328 327
599 3300050492 nmdc:mga0yw44_8056_c1 nmdc:mga0yw44_8056_c1_3513_4499 327
600 3300050494 nmdc:mga06z11_152157_c1 nmdc:mga06z11_152157_c1_74_1060 327
601 3300050494 nmdc:mga06z11_19961_c1 nmdc:mga06z11_19961_c1_1992_2978 327
602 3300053119 Ga0500595_014574 Ga0500595_014574_1296_2282 327
603 3300053139 Ga0500568_0093125 Ga0500568_0093125_137_1123 327
604 3300003215 JGI25153J46596_10007605 JGI25153J46596_100076051 328
605 3300003215 JGI25153J46596_10014183 JGI25153J46596_100141833 328
606 3300003659 JGI25404J52841_10020255 JGI25404J52841_100202551 328
607 3300003752 Ga0055539_1005620 Ga0055539_10056202 328
608 3300003775 Ga0055524_1025744 Ga0055524_10257442 328
609 3300003794 Ga0055531_10001969 Ga0055531_100019696 328
610 3300004625 Ga0055543_1007718 Ga0055543_10077182 328
611 3300005262 Ga0065165_1002418 Ga0065165_100241810 328
612 3300005262 Ga0065165_1004254 Ga0065165_10042543 328
613 3300005327 Ga0070658_10022210 Ga0070658_100222102 328
614 3300005328 Ga0070676_10007989 Ga0070676_100079896 328
615 3300005329 Ga0070683_100050728 Ga0070683_1000507281 328
616 3300005329 Ga0070683_100349627 Ga0070683_1003496272 328
617 3300005336 Ga0070680_100067985 Ga0070680_1000679854 328
618 3300005336 Ga0070680_100473476 Ga0070680_1004734761 328
619 3300005339 Ga0070660_100382763 Ga0070660_1003827631 328
620 3300005340 Ga0070689_100141027 Ga0070689_1001410272 328
621 3300005344 Ga0070661_100295139 Ga0070661_1002951392 328
622 3300005344 Ga0070661_100298027 Ga0070661_1002980272 328
623 3300005345 Ga0070692_10185132 Ga0070692_101851321 328
624 3300005347 Ga0070668_100015166 Ga0070668_1000151665 328
625 3300005347 Ga0070668_100016551 Ga0070668_1000165515 328
626 3300005347 Ga0070668_100192363 Ga0070668_1001923631 328
627 3300005354 Ga0070675_100291316 Ga0070675_1002913162 328
628 3300005354 Ga0070675_100445646 Ga0070675_1004456461 328
629 3300005355 Ga0070671_100013043 Ga0070671_1000130433 328
630 3300005355 Ga0070671_100264604 Ga0070671_1002646042 328
631 3300005355 Ga0070671_100370648 Ga0070671_1003706482 328
632 3300005356 Ga0070674_100038335 Ga0070674_1000383353 328
633 3300005356 Ga0070674_100052473 Ga0070674_1000524733 328
634 3300005364 Ga0070673_100251779 Ga0070673_1002517792 328
635 3300005366 Ga0070659_100060018 Ga0070659_1000600183 328
636 3300005367 Ga0070667_100025504 Ga0070667_1000255044 328
637 3300005434 Ga0070709_10006483 Ga0070709_100064832 328
638 3300005434 Ga0070709_10033865 Ga0070709_100338651 328
639 3300005434 Ga0070709_10107221 Ga0070709_101072212 328
640 3300005435 Ga0070714_100004001 Ga0070714_10000400111 328
641 3300005435 Ga0070714_100012654 Ga0070714_1000126542 328
642 3300005435 Ga0070714_100155992 Ga0070714_1001559921 328
643 3300005435 Ga0070714_100559230 Ga0070714_1005592301 328
644 3300005436 Ga0070713_100006580 Ga0070713_1000065809 328
645 3300005436 Ga0070713_100055790 Ga0070713_1000557904 328
646 3300005436 Ga0070713_100080610 Ga0070713_1000806102 328
647 3300005437 Ga0070710_10015416 Ga0070710_100154162 328
648 3300005437 Ga0070710_10070845 Ga0070710_100708451 328
649 3300005439 Ga0070711_100002404 Ga0070711_1000024047 328
650 3300005439 Ga0070711_100023994 Ga0070711_1000239943 328
651 3300005439 Ga0070711_100200420 Ga0070711_1002004201 328
652 3300005440 Ga0070705_100040255 Ga0070705_1000402552 328
653 3300005445 Ga0070708_100061161 Ga0070708_1000611612 328
654 3300005455 Ga0070663_100089732 Ga0070663_1000897321 328
655 3300005455 Ga0070663_100119546 Ga0070663_1001195462 328
656 3300005455 Ga0070663_100216284 Ga0070663_1002162842 328
657 3300005456 Ga0070678_100369908 Ga0070678_1003699082 328
658 3300005458 Ga0070681_10009562 Ga0070681_100095629 328
659 3300005458 Ga0070681_10058567 Ga0070681_100585674 328
660 3300005467 Ga0070706_100206761 Ga0070706_1002067612 328
661 3300005468 Ga0070707_100039062 Ga0070707_1000390622 328
662 3300005530 Ga0070679_100022307 Ga0070679_1000223077 328
663 3300005530 Ga0070679_100106676 Ga0070679_1001066762 328
664 3300005530 Ga0070679_100327180 Ga0070679_1003271802 328
665 3300005535 Ga0070684_100011463 Ga0070684_1000114636 328
666 3300005536 Ga0070697_100156128 Ga0070697_1001561282 328
667 3300005539 Ga0068853_100038220 Ga0068853_1000382202 328
668 3300005539 Ga0068853_100122686 Ga0068853_1001226862 328
669 3300005539 Ga0068853_100156671 Ga0068853_1001566712 328
670 3300005539 Ga0068853_100387183 Ga0068853_1003871832 328
671 3300005543 Ga0070672_100282173 Ga0070672_1002821732 328
672 3300005546 Ga0070696_100122749 Ga0070696_1001227492 328
673 3300005547 Ga0070693_100126214 Ga0070693_1001262142 328
674 3300005548 Ga0070665_100113564 Ga0070665_1001135642 328
675 3300005549 Ga0070704_100145198 Ga0070704_1001451982 328
676 3300005563 Ga0068855_100025942 Ga0068855_1000259426 328
677 3300005564 Ga0070664_100143577 Ga0070664_1001435772 328
678 3300005564 Ga0070664_100345887 Ga0070664_1003458872 328
679 3300005578 Ga0068854_100085691 Ga0068854_1000856913 328
680 3300005614 Ga0068856_100050275 Ga0068856_1000502755 328
681 3300005614 Ga0068856_100151030 Ga0068856_1001510302 328
682 3300005614 Ga0068856_100209451 Ga0068856_1002094512 328
683 3300005616 Ga0068852_100027985 Ga0068852_1000279852 328
684 3300005617 Ga0068859_100160315 Ga0068859_1001603152 328
685 3300005618 Ga0068864_100041943 Ga0068864_1000419435 328
686 3300005618 Ga0068864_100133125 Ga0068864_1001331252 328
687 3300005719 Ga0068861_100059504 Ga0068861_1000595042 328
688 3300005719 Ga0068861_100229769 Ga0068861_1002297692 328
689 3300005840 Ga0068870_10060797 Ga0068870_100607972 328
690 3300005841 Ga0068863_100049355 Ga0068863_1000493554 328
691 3300005841 Ga0068863_100278379 Ga0068863_1002783792 328
692 3300005842 Ga0068858_100039032 Ga0068858_1000390325 328
693 3300005842 Ga0068858_100115183 Ga0068858_1001151832 328
694 3300005842 Ga0068858_100165975 Ga0068858_1001659753 328
695 3300005842 Ga0068858_100213226 Ga0068858_1002132262 328
696 3300005842 Ga0068858_100453615 Ga0068858_1004536152 328
697 3300005843 Ga0068860_100001070 Ga0068860_10000107016 328
698 3300005844 Ga0068862_100123022 Ga0068862_1001230223 328
699 3300005844 Ga0068862_100193688 Ga0068862_1001936882 328
700 3300005937 Ga0081455_10003639 Ga0081455_100036399 328
701 3300005937 Ga0081455_10023899 Ga0081455_100238996 328
702 3300005983 Ga0081540_1002615 Ga0081540_10026157 328
703 3300005983 Ga0081540_1003198 Ga0081540_10031984 328
704 3300005983 Ga0081540_1003591 Ga0081540_100359113 328
705 3300005983 Ga0081540_1011508 Ga0081540_10115086 328
706 3300005983 Ga0081540_1016877 Ga0081540_10168774 328
707 3300005983 Ga0081540_1098118 Ga0081540_10981181 328
708 3300005983 Ga0081540_1098526 Ga0081540_10985262 328
709 3300005985 Ga0081539_10010272 Ga0081539_1001027211 328
710 3300006028 Ga0070717_10042834 Ga0070717_100428341 328
711 3300006028 Ga0070717_10066529 Ga0070717_100665294 328
712 3300006038 Ga0075365_10043037 Ga0075365_100430373 328
713 3300006038 Ga0075365_10066569 Ga0075365_100665693 328
714 3300006038 Ga0075365_10111342 Ga0075365_101113422 328
715 3300006038 Ga0075365_10233866 Ga0075365_102338662 328
716 3300006042 Ga0075368_10043216 Ga0075368_100432162 328
717 3300006048 Ga0075363_100026974 Ga0075363_1000269742 328
718 3300006163 Ga0070715_10083250 Ga0070715_100832501 328
719 3300006173 Ga0070716_100009512 Ga0070716_1000095122 328
720 3300006173 Ga0070716_100055019 Ga0070716_1000550192 328
721 3300006173 Ga0070716_100238052 Ga0070716_1002380522 328
722 3300006175 Ga0070712_100009393 Ga0070712_1000093937 328
723 3300006175 Ga0070712_100073619 Ga0070712_1000736193 328
724 3300006177 Ga0075362_10058839 Ga0075362_100588392 328
725 3300006178 Ga0075367_10151234 Ga0075367_101512341 328
726 3300006186 Ga0075369_10082099 Ga0075369_100820992 328
727 3300006237 Ga0097621_100076401 Ga0097621_1000764013 328
728 3300006237 Ga0097621_100223747 Ga0097621_1002237472 328
729 3300006353 Ga0075370_10047914 Ga0075370_100479141 328
730 3300006358 Ga0068871_100313797 Ga0068871_1003137972 328
731 3300006358 Ga0068871_100341879 Ga0068871_1003418792 328
732 3300006844 Ga0075428_100152807 Ga0075428_1001528073 328
733 3300006881 Ga0068865_100192205 Ga0068865_1001922052 328
734 3300006881 Ga0068865_100240795 Ga0068865_1002407952 328
735 3300006931 Ga0097620_100160321 Ga0097620_1001603213 328
736 3300006942 Ga0099824_1016377 Ga0099824_10163776 328
737 3300006944 Ga0099823_1037534 Ga0099823_10375344 328
738 3300007076 Ga0075435_100035211 Ga0075435_1000352113 328
739 3300007265 Ga0099794_10023536 Ga0099794_100235362 328
740 3300007265 Ga0099794_10185797 Ga0099794_101857971 328
741 3300007788 Ga0099795_10009237 Ga0099795_100092372 328
742 3300007788 Ga0099795_10014635 Ga0099795_100146352 328
743 3300009093 Ga0105240_10034054 Ga0105240_100340545 328
744 3300009093 Ga0105240_10046615 Ga0105240_100466155 328
745 3300009093 Ga0105240_10088594 Ga0105240_100885945 328
746 3300009094 Ga0111539_10036660 Ga0111539_100366602 328
747 3300009101 Ga0105247_10048921 Ga0105247_100489212 328
748 3300009101 Ga0105247_10301216 Ga0105247_103012162 328
749 3300009147 Ga0114129_10089335 Ga0114129_100893354 328
750 3300009148 Ga0105243_10074455 Ga0105243_100744553 328
751 3300009174 Ga0105241_10074950 Ga0105241_100749502 328
752 3300009174 Ga0105241_10134760 Ga0105241_101347602 328
753 3300009174 Ga0105241_10396602 Ga0105241_103966022 328
754 3300009176 Ga0105242_10058731 Ga0105242_100587312 328
755 3300009545 Ga0105237_10002092 Ga0105237_1000209214 328
756 3300009545 Ga0105237_10023476 Ga0105237_100234767 328
757 3300009545 Ga0105237_10036215 Ga0105237_100362154 328
758 3300009545 Ga0105237_10139508 Ga0105237_101395081 328
759 3300009553 Ga0105249_10041299 Ga0105249_100412994 328
760 3300009553 Ga0105249_10121599 Ga0105249_101215992 328
761 3300010159 Ga0099796_10020991 Ga0099796_100209912 328
762 3300010375 Ga0105239_10053186 Ga0105239_100531864 328
763 3300010375 Ga0105239_10065469 Ga0105239_100654694 328
764 3300010375 Ga0105239_10373033 Ga0105239_103730332 328
765 3300013104 Ga0157370_10029759 Ga0157370_100297594 328
766 3300013105 Ga0157369_10014863 Ga0157369_100148637 328
767 3300013105 Ga0157369_10078819 Ga0157369_100788194 328
768 3300013297 Ga0157378_10367787 Ga0157378_103677872 328
769 3300014325 Ga0163163_10032478 Ga0163163_100324785 328
770 3300014325 Ga0163163_10112864 Ga0163163_101128642 328
771 3300014968 Ga0157379_10147786 Ga0157379_101477862 328
772 3300020070 Ga0206356_10611048 Ga0206356_106110482 328
773 3300021320 Ga0214544_1000007 Ga0214544_100000759 328
774 3300021321 Ga0214542_1000216 Ga0214542_100021632 328
775 3300021324 Ga0214545_1000118 Ga0214545_100011859 328
776 3300021327 Ga0214543_1000009 Ga0214543_100000959 328
777 3300021361 Ga0213872_10022262 Ga0213872_100222623 328
778 3300025230 Ga0209563_101733 Ga0209563_1017333 328
779 3300025253 Ga0209677_100395 Ga0209677_10039510 328
780 3300025253 Ga0209677_101305 Ga0209677_10130510 328
781 3300025254 Ga0209148_1000388 Ga0209148_100038834 328
782 3300025254 Ga0209148_1007027 Ga0209148_10070273 328
783 3300025261 Ga0209233_1000949 Ga0209233_10009492 328
784 3300025261 Ga0209233_1002242 Ga0209233_10022427 328
785 3300025261 Ga0209233_1019667 Ga0209233_10196672 328
786 3300025272 Ga0209455_1007359 Ga0209455_10073593 328
787 3300025295 Ga0209564_1018635 Ga0209564_10186353 328
788 3300025297 Ga0209758_1000030 Ga0209758_1000030278 328
789 3300025297 Ga0209758_1000429 Ga0209758_100042921 328
790 3300025297 Ga0209758_1001015 Ga0209758_100101535 328
791 3300025297 Ga0209758_1002652 Ga0209758_100265212 328
792 3300025297 Ga0209758_1003562 Ga0209758_10035622 328
793 3300025299 Ga0209256_1003190 Ga0209256_10031904 328
794 3300025302 Ga0207426_1000347 Ga0207426_100034751 328
795 3300025302 Ga0207426_1001408 Ga0207426_10014084 328
796 3300025302 Ga0207426_1003607 Ga0207426_10036072 328
797 3300025304 Ga0209257_1004526 Ga0209257_10045268 328
798 3300025321 Ga0207656_10024823 Ga0207656_100248233 328
799 3300025885 Ga0207653_10014357 Ga0207653_100143573 328
800 3300025898 Ga0207692_10000213 Ga0207692_1000021317 328
801 3300025898 Ga0207692_10034398 Ga0207692_100343982 328
802 3300025900 Ga0207710_10031263 Ga0207710_100312632 328
803 3300025906 Ga0207699_10035638 Ga0207699_100356382 328
804 3300025906 Ga0207699_10040885 Ga0207699_100408851 328
805 3300025906 Ga0207699_10149410 Ga0207699_101494102 328
806 3300025907 Ga0207645_10048434 Ga0207645_100484344 328
807 3300025908 Ga0207643_10185510 Ga0207643_101855102 328
808 3300025909 Ga0207705_10034575 Ga0207705_100345753 328
809 3300025911 Ga0207654_10050613 Ga0207654_100506133 328
810 3300025911 Ga0207654_10099770 Ga0207654_100997702 328
811 3300025912 Ga0207707_10000398 Ga0207707_100003989 328
812 3300025912 Ga0207707_10024840 Ga0207707_100248405 328
813 3300025912 Ga0207707_10063900 Ga0207707_100639002 328
814 3300025912 Ga0207707_10081956 Ga0207707_100819562 328
815 3300025913 Ga0207695_10000006 Ga0207695_1000000640 328
816 3300025914 Ga0207671_10013114 Ga0207671_100131147 328
817 3300025914 Ga0207671_10018633 Ga0207671_100186334 328
818 3300025914 Ga0207671_10146459 Ga0207671_101464592 328
819 3300025914 Ga0207671_10160882 Ga0207671_101608822 328
820 3300025914 Ga0207671_10214977 Ga0207671_102149772 328
821 3300025915 Ga0207693_10120128 Ga0207693_101201282 328
822 3300025916 Ga0207663_10000167 Ga0207663_1000016728 328
823 3300025916 Ga0207663_10009487 Ga0207663_100094873 328
824 3300025916 Ga0207663_10250868 Ga0207663_102508682 328
825 3300025917 Ga0207660_10003186 Ga0207660_100031862 328
826 3300025917 Ga0207660_10095433 Ga0207660_100954331 328
827 3300025919 Ga0207657_10020195 Ga0207657_100201957 328
828 3300025919 Ga0207657_10076584 Ga0207657_100765842 328
829 3300025919 Ga0207657_10169523 Ga0207657_101695232 328
830 3300025920 Ga0207649_10158912 Ga0207649_101589122 328
831 3300025920 Ga0207649_10166512 Ga0207649_101665122 328
832 3300025921 Ga0207652_10014407 Ga0207652_100144078 328
833 3300025921 Ga0207652_10041401 Ga0207652_100414012 328
834 3300025921 Ga0207652_10074840 Ga0207652_100748402 328
835 3300025921 Ga0207652_10108192 Ga0207652_101081923 328
836 3300025922 Ga0207646_10038053 Ga0207646_100380533 328
837 3300025923 Ga0207681_10127401 Ga0207681_101274012 328
838 3300025926 Ga0207659_10403621 Ga0207659_104036211 328
839 3300025927 Ga0207687_10142316 Ga0207687_101423162 328
840 3300025928 Ga0207700_10038034 Ga0207700_100380342 328
841 3300025928 Ga0207700_10047186 Ga0207700_100471863 328
842 3300025928 Ga0207700_10053226 Ga0207700_100532264 328
843 3300025929 Ga0207664_10159517 Ga0207664_101595172 328
844 3300025929 Ga0207664_10202228 Ga0207664_102022282 328
845 3300025931 Ga0207644_10183029 Ga0207644_101830292 328
846 3300025932 Ga0207690_10042002 Ga0207690_100420023 328
847 3300025933 Ga0207706_10034285 Ga0207706_100342855 328
848 3300025933 Ga0207706_10037506 Ga0207706_100375065 328
849 3300025934 Ga0207686_10092473 Ga0207686_100924732 328
850 3300025937 Ga0207669_10179405 Ga0207669_101794052 328
851 3300025938 Ga0207704_10205136 Ga0207704_102051362 328
852 3300025939 Ga0207665_10001098 Ga0207665_100010986 328
853 3300025939 Ga0207665_10149912 Ga0207665_101499122 328
854 3300025940 Ga0207691_10281564 Ga0207691_102815641 328
855 3300025941 Ga0207711_10281964 Ga0207711_102819642 328
856 3300025942 Ga0207689_10046448 Ga0207689_100464484 328
857 3300025942 Ga0207689_10059449 Ga0207689_100594493 328
858 3300025944 Ga0207661_10025129 Ga0207661_100251293 328
859 3300025945 Ga0207679_10231633 Ga0207679_102316332 328
860 3300025949 Ga0207667_10027659 Ga0207667_100276595 328
861 3300025949 Ga0207667_10317256 Ga0207667_103172562 328
862 3300025960 Ga0207651_10205511 Ga0207651_102055112 328
863 3300025972 Ga0207668_10141199 Ga0207668_101411992 328
864 3300025972 Ga0207668_10161880 Ga0207668_101618802 328
865 3300025972 Ga0207668_10251917 Ga0207668_102519172 328
866 3300025981 Ga0207640_10100200 Ga0207640_101002002 328
867 3300025981 Ga0207640_10195500 Ga0207640_101955002 328
868 3300026035 Ga0207703_10213157 Ga0207703_102131572 328
869 3300026035 Ga0207703_10227884 Ga0207703_102278842 328
870 3300026035 Ga0207703_10354502 Ga0207703_103545022 328
871 3300026041 Ga0207639_10038411 Ga0207639_100384113 328
872 3300026041 Ga0207639_10075127 Ga0207639_100751272 328
873 3300026041 Ga0207639_10171307 Ga0207639_101713072 328
874 3300026041 Ga0207639_10209354 Ga0207639_102093542 328
875 3300026041 Ga0207639_10242035 Ga0207639_102420352 328
876 3300026067 Ga0207678_10065204 Ga0207678_100652043 328
877 3300026067 Ga0207678_10107187 Ga0207678_101071872 328
878 3300026067 Ga0207678_10235605 Ga0207678_102356052 328
879 3300026067 Ga0207678_10438878 Ga0207678_104388781 328
880 3300026075 Ga0207708_10088023 Ga0207708_100880232 328
881 3300026078 Ga0207702_10023961 Ga0207702_100239612 328
882 3300026078 Ga0207702_10205087 Ga0207702_102050872 328
883 3300026088 Ga0207641_10038292 Ga0207641_100382922 328
884 3300026088 Ga0207641_10358752 Ga0207641_103587522 328
885 3300026095 Ga0207676_10229465 Ga0207676_102294652 328
886 3300026118 Ga0207675_100025313 Ga0207675_1000253136 328
887 3300026118 Ga0207675_100049103 Ga0207675_1000491034 328
888 3300026121 Ga0207683_10178146 Ga0207683_101781462 328
889 3300026121 Ga0207683_10381196 Ga0207683_103811962 328
890 3300026142 Ga0207698_10170342 Ga0207698_101703422 328
891 3300027296 Ga0209389_1000015 Ga0209389_100001580 328
892 3300027296 Ga0209389_1000035 Ga0209389_100003591 328
893 3300027357 Ga0209589_1000039 Ga0209589_100003991 328
894 3300027361 Ga0209489_100072 Ga0209489_10007241 328
895 3300027361 Ga0209489_100084 Ga0209489_10008491 328
896 3300027363 Ga0209700_100034 Ga0209700_100034103 328
897 3300027512 Ga0209179_1014575 Ga0209179_10145752 328
898 3300027512 Ga0209179_1017579 Ga0209179_10175792 328
899 3300028379 Ga0268266_10007778 Ga0268266_100077784 328
900 3300028379 Ga0268266_10008893 Ga0268266_100088937 328
901 3300028381 Ga0268264_10000107 Ga0268264_1000010713 328
902 3300028786 Ga0307517_10001780 Ga0307517_1000178019 328
903 3300028794 Ga0307515_10054512 Ga0307515_100545124 328
904 3300031235 Ga0265330_10021950 Ga0265330_100219501 328
905 3300031238 Ga0265332_10006675 Ga0265332_100066755 328
906 3300031241 Ga0265325_10058919 Ga0265325_100589192 328
907 3300031247 Ga0265340_10054987 Ga0265340_100549872 328
908 3300031249 Ga0265339_10000326 Ga0265339_1000032620 328
909 3300031249 Ga0265339_10006252 Ga0265339_100062524 328
910 3300031249 Ga0265339_10119973 Ga0265339_101199732 328
911 3300031250 Ga0265331_10017323 Ga0265331_100173232 328
912 3300031344 Ga0265316_10036469 Ga0265316_100364693 328
913 3300031456 Ga0307513_10066655 Ga0307513_100666555 328
914 3300031548 Ga0307408_100403235 Ga0307408_1004032351 328
915 3300031616 Ga0307508_10000088 Ga0307508_1000008870 328
916 3300031616 Ga0307508_10033626 Ga0307508_100336263 328
917 3300031616 Ga0307508_10089914 Ga0307508_100899142 328
918 3300031616 Ga0307508_10187216 Ga0307508_101872162 328
919 3300031711 Ga0265314_10013803 Ga0265314_100138032 328
920 3300031712 Ga0265342_10007871 Ga0265342_100078718 328
921 3300031730 Ga0307516_10008774 Ga0307516_1000877411 328
922 3300031730 Ga0307516_10042852 Ga0307516_100428523 328
923 3300031731 Ga0307405_10191561 Ga0307405_101915612 328
924 3300032002 Ga0307416_100160220 Ga0307416_1001602202 328
925 3300032002 Ga0307416_100232550 Ga0307416_1002325502 328
926 3300032005 Ga0307411_10141884 Ga0307411_101418842 328
927 3300032126 Ga0307415_100069402 Ga0307415_1000694022 328
928 3300032126 Ga0307415_100091856 Ga0307415_1000918561 328
929 3300033179 Ga0307507_10068020 Ga0307507_100680202 328
930 3300033180 Ga0307510_10017889 Ga0307510_100178896 328
931 3300033180 Ga0307510_10076564 Ga0307510_100765642 328
932 3300033180 Ga0307510_10103456 Ga0307510_101034562 328
933 3300033180 Ga0307510_10112752 Ga0307510_101127522 328
934 3300035085 Ga0373929_0025195 Ga0373929_0025195_52_1041 328
935 3300035086 Ga0373934_0010050 Ga0373934_0010050_540_1529 328
936 3300035111 Ga0373923_0000546 Ga0373923_0000546_665_1654 328
937 3300035111 Ga0373923_0041206 Ga0373923_0041206_523_1512 328
938 3300035113 Ga0373936_0020991 Ga0373936_0020991_155_1144 328
939 3300035113 Ga0373936_0059115 Ga0373936_0059115_51_1040 328
940 3300035116 Ga0373945_0014927 Ga0373945_0014927_961_1950 328
941 3300035117 Ga0373953_0027393 Ga0373953_0027393_124_1113 328
942 3300035118 Ga0373954_0000782 Ga0373954_0000782_7887_8876 328
943 3300035118 Ga0373954_0011586 Ga0373954_0011586_2187_3176 328
944 3300035118 Ga0373954_0043866 Ga0373954_0043866_441_1430 328
945 3300035119 Ga0373956_0033694 Ga0373956_0033694_477_1466 328
946 3300035119 Ga0373956_0065721 Ga0373956_0065721_309_1298 328
947 3300035120 Ga0373957_0009651 Ga0373957_0009651_45_1034 328
948 3300035170 Ga0373943_0001276 Ga0373943_0001276_1079_2068 328
949 3300035170 Ga0373943_0034911 Ga0373943_0034911_436_1425 328
950 3300035171 Ga0373946_0026191 Ga0373946_0026191_614_1603 328
951 3300035172 Ga0373955_0002870 Ga0373955_0002870_1431_2420 328
952 3300035172 Ga0373955_0034153 Ga0373955_0034153_1341_2330 328
953 3300035410 Ga0373924_0001544 Ga0373924_0001544_4679_5668 328
954 3300035410 Ga0373924_0055987 Ga0373924_0055987_154_1143 328
955 3300035691 Ga0373931_0009956 Ga0373931_0009956_3534_4523 328
956 3300035692 Ga0373935_0002629 Ga0373935_0002629_8699_9688 328
957 3300035692 Ga0373935_0032233 Ga0373935_0032233_412_1401 328
958 3300035692 Ga0373935_0117670 Ga0373935_0117670_431_1420 328
959 3300035695 Ga0373927_0000136 Ga0373927_0000136_46828_47817 328
960 3300035695 Ga0373927_0017818 Ga0373927_0017818_3130_4119 328
961 3300035695 Ga0373927_0047249 Ga0373927_0047249_1385_2374 328
962 3300035695 Ga0373927_0102789 Ga0373927_0102789_534_1523 328
963 3300035724 Ga0373933_0000160 Ga0373933_0000160_17256_18245 328
964 3300035724 Ga0373933_0001268 Ga0373933_0001268_8425_9414 328
965 3300035724 Ga0373933_0026697 Ga0373933_0026697_1018_2007 328
966 3300035724 Ga0373933_0140529 Ga0373933_0140529_524_1513 328
967 3300035725 Ga0373947_0008188 Ga0373947_0008188_859_1848 328
968 3300035725 Ga0373947_0008868 Ga0373947_0008868_2883_3872 328
969 3300035725 Ga0373947_0009170 Ga0373947_0009170_1638_2627 328
970 3300035725 Ga0373947_0031678 Ga0373947_0031678_480_1469 328
971 3300036401 Ga0373937_0007853 Ga0373937_0007853_6173_7162 328
972 3300036401 Ga0373937_0011985 Ga0373937_0011985_1569_2558 328
973 3300037068 Ga0373925_0001167 Ga0373925_0001167_14134_15123 328
974 3300037068 Ga0373925_0026045 Ga0373925_0026045_831_1820 328
975 3300037068 Ga0373925_0063889 Ga0373925_0063889_1618_2607 328
976 3300037418 Ga0395900_0001546 Ga0395900_0001546_6818_7807 328
977 3300037466 Ga0395898_0002015 Ga0395898_0002015_4844_5833 328
978 3300037471 Ga0395905_0003722 Ga0395905_0003722_13800_14789 328
979 3300039447 Ga0436361_0935166 Ga0436361_0935166_2970_3959 328
980 3300039450 Ga0436363_0101344 Ga0436363_0101344_864_1853 328
981 3300044658 Ga0466972_0000048 Ga0466972_0000048_61654_62643 328
982 3300044658 Ga0466972_0005127 Ga0466972_0005127_4417_5406 328
983 3300044684 Ga0466966_0000542 Ga0466966_0000542_7532_8521 328
984 3300044693 Ga0466961_0000018 Ga0466961_0000018_56068_57057 328
985 3300044694 Ga0466963_0007846 Ga0466963_0007846_3543_4532 328
986 3300044719 Ga0466971_0041232 Ga0466971_0041232_703_1692 328
987 3300044901 Ga0466960_0008711 Ga0466960_0008711_1707_2696 328
988 3300044901 Ga0466960_0058540 Ga0466960_0058540_34_1023 328
989 3300045049 Ga0466959_0017920 Ga0466959_0017920_2576_3565 328
990 3300045976 Ga0466967_0022021 Ga0466967_0022021_2507_3496 328
991 3300045976 Ga0466967_0059151 Ga0466967_0059151_1912_2901 328
992 3300045976 Ga0466967_0238754 Ga0466967_0238754_299_1288 328
993 3300046454 Ga0495592_0001707 Ga0495592_0001707_9412_10401 328
994 3300046454 Ga0495592_0012511 Ga0495592_0012511_501_1490 328
995 3300046454 Ga0495592_0030832 Ga0495592_0030832_145_1134 328
996 3300046455 Ga0495603_0000019 Ga0495603_0000019_42341_43330 328
997 3300046455 Ga0495603_0019786 Ga0495603_0019786_1134_2123 328
998 3300046459 Ga0495629_0000151 Ga0495629_0000151_4125_5114 328
999 3300046459 Ga0495629_0002944 Ga0495629_0002944_5829_6818 328
1000 3300046459 Ga0495629_0004909 Ga0495629_0004909_7173_8162 328
1001 3300046459 Ga0495629_0034018 Ga0495629_0034018_150_1139 328
1002 3300046460 Ga0495638_0137263 Ga0495638_0137263_287_1276 328
1003 3300046461 Ga0495641_0004241 Ga0495641_0004241_428_1417 328
1004 3300046461 Ga0495641_0038764 Ga0495641_0038764_121_1110 328
1005 3300046462 Ga0495651_0001421 Ga0495651_0001421_8894_9883 328
1006 3300046462 Ga0495651_0010977 Ga0495651_0010977_583_1572 328
1007 3300046462 Ga0495651_0011269 Ga0495651_0011269_607_1596 328
1008 3300046462 Ga0495651_0043692 Ga0495651_0043692_1543_2532 328
1009 3300046462 Ga0495651_0187577 Ga0495651_0187577_19_1008 328
1010 3300046463 Ga0495653_0004360 Ga0495653_0004360_6353_7342 328
1011 3300046463 Ga0495653_0054417 Ga0495653_0054417_928_1917 328
1012 3300046471 Ga0495650_0066871 Ga0495650_0066871_43_1032 328
1013 3300046472 Ga0495580_0001229 Ga0495580_0001229_15544_16533 328
1014 3300046472 Ga0495580_0007090 Ga0495580_0007090_6243_7232 328
1015 3300046473 Ga0495582_0000019 Ga0495582_0000019_8965_9954 328
1016 3300046473 Ga0495582_0004005 Ga0495582_0004005_876_1865 328
1017 3300046474 Ga0495605_0085233 Ga0495605_0085233_221_1210 328
1018 3300046474 Ga0495605_0094464 Ga0495605_0094464_147_1136 328
1019 3300046474 Ga0495605_0110747 Ga0495605_0110747_141_1130 328
1020 3300046475 Ga0495639_0000159 Ga0495639_0000159_24406_25395 328
1021 3300046475 Ga0495639_0062908 Ga0495639_0062908_547_1536 328
1022 3300046476 Ga0495662_0000798 Ga0495662_0000798_6227_7216 328
1023 3300046477 Ga0495664_0004893 Ga0495664_0004893_2497_3486 328
1024 3300046477 Ga0495664_0040201 Ga0495664_0040201_786_1775 328
1025 3300046477 Ga0495664_0059446 Ga0495664_0059446_1042_2031 328
1026 3300046477 Ga0495664_0076735 Ga0495664_0076735_689_1678 328
1027 3300046491 Ga0495584_0085432 Ga0495584_0085432_440_1429 328
1028 3300046492 Ga0495585_0079005 Ga0495585_0079005_386_1375 328
1029 3300046499 Ga0495594_0000235 Ga0495594_0000235_19686_20675 328
1030 3300046499 Ga0495594_0015471 Ga0495594_0015471_702_1691 328
1031 3300046507 Ga0495606_0018376 Ga0495606_0018376_2157_3146 328
1032 3300046511 Ga0495608_0010956 Ga0495608_0010956_1855_2844 328
1033 3300046511 Ga0495608_0020201 Ga0495608_0020201_771_1760 328
1034 3300046511 Ga0495608_0085652 Ga0495608_0085652_890_1879 328
1035 3300046514 Ga0495618_0033917 Ga0495618_0033917_1994_2983 328
1036 3300046515 Ga0495620_0063225 Ga0495620_0063225_46_1035 328
1037 3300046516 Ga0495628_0016475 Ga0495628_0016475_4570_5559 328
1038 3300046516 Ga0495628_0034223 Ga0495628_0034223_2139_3128 328
1039 3300046516 Ga0495628_0232120 Ga0495628_0232120_286_1275 328
1040 3300046517 Ga0495630_0008130 Ga0495630_0008130_538_1527 328
1041 3300046517 Ga0495630_0036438 Ga0495630_0036438_2485_3474 328
1042 3300046517 Ga0495630_0090128 Ga0495630_0090128_515_1504 328
1043 3300046524 Ga0495648_0008002 Ga0495648_0008002_107_1096 328
1044 3300046524 Ga0495648_0028040 Ga0495648_0028040_2145_3134 328
1045 3300046524 Ga0495648_0032290 Ga0495648_0032290_346_1335 328
1046 3300046526 Ga0495666_0015247 Ga0495666_0015247_503_1492 328
1047 3300046529 Ga0495652_0013238 Ga0495652_0013238_4947_5936 328
1048 3300046529 Ga0495652_0031261 Ga0495652_0031261_392_1381 328
1049 3300046529 Ga0495652_0032740 Ga0495652_0032740_3382_4371 328
1050 3300046529 Ga0495652_0052170 Ga0495652_0052170_2388_3377 328
1051 3300046531 Ga0495665_0000093 Ga0495665_0000093_30830_31819 328
1052 3300046531 Ga0495665_0063631 Ga0495665_0063631_196_1185 328
1053 3300046533 Ga0495640_0005573 Ga0495640_0005573_4282_5271 328
1054 3300046533 Ga0495640_0030012 Ga0495640_0030012_1833_2822 328
1055 3300046533 Ga0495640_0053002 Ga0495640_0053002_431_1420 328
1056 3300046533 Ga0495640_0244693 Ga0495640_0244693_52_1041 328
1057 3300046535 Ga0495586_0029710 Ga0495586_0029710_217_1206 328
1058 3300046536 Ga0495587_0002440 Ga0495587_0002440_2991_3980 328
1059 3300046537 Ga0495598_0004856 Ga0495598_0004856_553_1542 328
1060 3300046538 Ga0495609_0068648 Ga0495609_0068648_413_1402 328
1061 3300046542 Ga0495597_0044137 Ga0495597_0044137_424_1413 328
1062 3300046543 Ga0495645_0044063 Ga0495645_0044063_2146_3135 328
1063 3300046543 Ga0495645_0114078 Ga0495645_0114078_536_1525 328
1064 3300046543 Ga0495645_0146194 Ga0495645_0146194_98_1087 328
1065 3300046557 Ga0495622_0000571 Ga0495622_0000571_2125_3114 328
1066 3300046557 Ga0495622_0023862 Ga0495622_0023862_957_1946 328
1067 3300046559 Ga0495667_0029704 Ga0495667_0029704_2677_3666 328
1068 3300046559 Ga0495667_0059712 Ga0495667_0059712_788_1777 328
1069 3300046615 Ga0495656_0091876 Ga0495656_0091876_343_1332 328
1070 3300046616 Ga0495668_0047773 Ga0495668_0047773_684_1673 328
1071 3300046616 Ga0495668_0102905 Ga0495668_0102905_516_1505 328
1072 3300046642 Ga0495634_0003979 Ga0495634_0003979_7940_8929 328
1073 3300046642 Ga0495634_0004199 Ga0495634_0004199_6861_7850 328
1074 3300046642 Ga0495634_0034102 Ga0495634_0034102_118_1107 328
1075 3300046660 Ga0495625_0157229 Ga0495625_0157229_47_1036 328
1076 3300046663 Ga0495635_0000322 Ga0495635_0000322_27748_28737 328
1077 3300046663 Ga0495635_0001817 Ga0495635_0001817_5506_6495 328
1078 3300046663 Ga0495635_0002995 Ga0495635_0002995_7383_8372 328
1079 3300046663 Ga0495635_0046009 Ga0495635_0046009_976_1965 328
1080 3300046674 Ga0495588_0010061 Ga0495588_0010061_2118_3107 328
1081 3300046674 Ga0495588_0107436 Ga0495588_0107436_63_1052 328
1082 3300046675 Ga0495657_0005003 Ga0495657_0005003_1317_2306 328
1083 3300046675 Ga0495657_0008039 Ga0495657_0008039_2338_3327 328
1084 3300046675 Ga0495657_0041298 Ga0495657_0041298_1386_2375 328
1085 3300046675 Ga0495657_0184582 Ga0495657_0184582_118_1107 328
1086 3300046678 Ga0495599_0010948 Ga0495599_0010948_480_1469 328
1087 3300046678 Ga0495599_0014770 Ga0495599_0014770_1301_2290 328
1088 3300046678 Ga0495599_0068418 Ga0495599_0068418_945_1934 328
1089 3300046679 Ga0495623_0003342 Ga0495623_0003342_2819_3808 328
1090 3300046679 Ga0495623_0003554 Ga0495623_0003554_7078_8067 328
1091 3300046679 Ga0495623_0072456 Ga0495623_0072456_150_1139 328
1092 3300046679 Ga0495623_0075559 Ga0495623_0075559_916_1905 328
1093 3300046680 Ga0495646_0008241 Ga0495646_0008241_5020_6009 328
1094 3300046680 Ga0495646_0070591 Ga0495646_0070591_951_1940 328
1095 3300046681 Ga0495647_0000250 Ga0495647_0000250_9171_10160 328
1096 3300046683 Ga0495658_0000054 Ga0495658_0000054_48176_49165 328
1097 3300046683 Ga0495658_0023308 Ga0495658_0023308_2223_3212 328
1098 3300046683 Ga0495658_0110449 Ga0495658_0110449_154_1143 328
1099 3300046684 Ga0495669_0014235 Ga0495669_0014235_1413_2402 328
1100 3300046684 Ga0495669_0082900 Ga0495669_0082900_417_1406 328
1101 3300046689 Ga0495613_0002331 Ga0495613_0002331_8054_9043 328
1102 3300046689 Ga0495613_0085459 Ga0495613_0085459_1110_2099 328
1103 3300046690 Ga0495624_0007986 Ga0495624_0007986_5397_6386 328
1104 3300046690 Ga0495624_0035811 Ga0495624_0035811_33_1022 328
1105 3300046692 Ga0495671_0057594 Ga0495671_0057594_911_1900 328
1106 3300046794 Ga0495589_0118225 Ga0495589_0118225_169_1158 328
1107 3300046809 Ga0495600_0001578 Ga0495600_0001578_6930_7919 328
1108 3300046809 Ga0495600_0003823 Ga0495600_0003823_5119_6108 328
1109 3300046809 Ga0495600_0006664 Ga0495600_0006664_3825_4814 328
1110 3300047315 Ga0495581_0000247 Ga0495581_0000247_396_1385 328
1111 3300047315 Ga0495581_0070132 Ga0495581_0070132_1017_2006 328
1112 3300047315 Ga0495581_0136570 Ga0495581_0136570_158_1147 328
1113 3300047317 Ga0495604_0001719 Ga0495604_0001719_16032_17021 328
1114 3300047317 Ga0495604_0004125 Ga0495604_0004125_6305_7294 328
1115 3300047317 Ga0495604_0063355 Ga0495604_0063355_90_1079 328
1116 3300047318 Ga0495636_0103829 Ga0495636_0103829_72_1061 328
1117 3300047319 Ga0495674_0000871 Ga0495674_0000871_8904_9893 328
1118 3300047319 Ga0495674_0107558 Ga0495674_0107558_394_1383 328
1119 3300047319 Ga0495674_0186365 Ga0495674_0186365_435_1424 328
1120 3300047321 Ga0495676_0041253 Ga0495676_0041253_270_1259 328
1121 3300047321 Ga0495676_0131114 Ga0495676_0131114_284_1273 328
1122 3300047322 Ga0495680_0006451 Ga0495680_0006451_7382_8371 328
1123 3300047322 Ga0495680_0007673 Ga0495680_0007673_6481_7470 328
1124 3300047323 Ga0495683_0073925 Ga0495683_0073925_504_1493 328
1125 3300047443 Ga0495687_012431 Ga0495687_012431_2113_3102 328
1126 3300047444 Ga0495675_0005025 Ga0495675_0005025_1590_2579 328
1127 3300047444 Ga0495675_0005708 Ga0495675_0005708_5019_6008 328
1128 3300047444 Ga0495675_0178501 Ga0495675_0178501_104_1093 328
1129 3300047447 Ga0495685_038131 Ga0495685_038131_477_1466 328
1130 3300047470 Ga0495681_0114680 Ga0495681_0114680_45_1034 328
1131 3300047471 Ga0495684_0001840 Ga0495684_0001840_2050_3039 328
1132 3300047471 Ga0495684_0024950 Ga0495684_0024950_1907_2896 328
1133 3300047471 Ga0495684_0041304 Ga0495684_0041304_2513_3502 328
1134 3300047471 Ga0495684_0211558 Ga0495684_0211558_79_1068 328
1135 3300047472 Ga0495686_0053491 Ga0495686_0053491_24_1013 328
1136 3300047472 Ga0495686_0071333 Ga0495686_0071333_422_1411 328
1137 3300047673 Ga0495593_0000063 Ga0495593_0000063_4304_5293 328
1138 3300047673 Ga0495593_0002843 Ga0495593_0002843_1553_2542 328
1139 3300047673 Ga0495593_0090543 Ga0495593_0090543_441_1430 328
1140 3300048088 Ga0495602_0009382 Ga0495602_0009382_6373_7362 328
1141 3300048088 Ga0495602_0016924 Ga0495602_0016924_3428_4417 328
1142 3300048088 Ga0495602_0051263 Ga0495602_0051263_1893_2882 328
1143 3300048903 Ga0496100_0048959 Ga0496100_0048959_263_1252 328
1144 3300048903 Ga0496100_0091951 Ga0496100_0091951_688_1677 328
1145 3300048904 Ga0496101_0033278 Ga0496101_0033278_2217_3206 328
1146 3300048904 Ga0496101_0042350 Ga0496101_0042350_2144_3133 328
1147 3300048904 Ga0496101_0160283 Ga0496101_0160283_715_1704 328
1148 3300048905 Ga0496102_0015035 Ga0496102_0015035_2155_3144 328
1149 3300048905 Ga0496102_0035246 Ga0496102_0035246_2200_3189 328
1150 3300048905 Ga0496102_0182525 Ga0496102_0182525_112_1101 328
1151 3300048905 Ga0496102_0298131 Ga0496102_0298131_509_1498 328
1152 3300048906 Ga0496103_0233707 Ga0496103_0233707_141_1130 328
1153 3300048907 Ga0496104_0008588 Ga0496104_0008588_848_1837 328
1154 3300048907 Ga0496104_0009097 Ga0496104_0009097_4888_5877 328
1155 3300048907 Ga0496104_0021540 Ga0496104_0021540_2562_3551 328
1156 3300048907 Ga0496104_0024076 Ga0496104_0024076_4210_5199 328
1157 3300048907 Ga0496104_0103423 Ga0496104_0103423_996_1985 328
1158 3300048907 Ga0496104_0120288 Ga0496104_0120288_1154_2143 328
1159 3300048908 Ga0496105_0021408 Ga0496105_0021408_250_1239 328
1160 3300048908 Ga0496105_0022649 Ga0496105_0022649_2393_3382 328
1161 3300048908 Ga0496105_0070475 Ga0496105_0070475_502_1491 328
1162 3300048909 Ga0496106_0001271 Ga0496106_0001271_2960_3949 328
1163 3300048909 Ga0496106_0030896 Ga0496106_0030896_418_1407 328
1164 3300048910 Ga0496107_0025796 Ga0496107_0025796_919_1908 328
1165 3300048910 Ga0496107_0026598 Ga0496107_0026598_2687_3676 328
1166 3300048911 Ga0496108_0000507 Ga0496108_0000507_28675_29664 328
1167 3300048911 Ga0496108_0017223 Ga0496108_0017223_529_1518 328
1168 3300048911 Ga0496108_0030002 Ga0496108_0030002_2835_3824 328
1169 3300048911 Ga0496108_0042694 Ga0496108_0042694_392_1381 328
1170 3300048911 Ga0496108_0170617 Ga0496108_0170617_343_1332 328
1171 3300048911 Ga0496108_0181261 Ga0496108_0181261_701_1690 328
1172 3300048912 Ga0496109_0015980 Ga0496109_0015980_198_1187 328
1173 3300048912 Ga0496109_0024123 Ga0496109_0024123_3831_4820 328
1174 3300048912 Ga0496109_0077384 Ga0496109_0077384_595_1584 328
1175 3300048912 Ga0496109_0361566 Ga0496109_0361566_193_1182 328
1176 3300048913 Ga0496110_0002891 Ga0496110_0002891_9956_10945 328
1177 3300048913 Ga0496110_0120504 Ga0496110_0120504_360_1349 328
1178 3300048913 Ga0496110_0131722 Ga0496110_0131722_1116_2105 328
1179 3300048913 Ga0496110_0199167 Ga0496110_0199167_305_1294 328
1180 3300048914 Ga0496111_0013376 Ga0496111_0013376_3474_4463 328
1181 3300048914 Ga0496111_0047402 Ga0496111_0047402_1365_2354 328
1182 3300048914 Ga0496111_0053924 Ga0496111_0053924_500_1489 328
1183 3300048915 Ga0496112_0007653 Ga0496112_0007653_6375_7364 328
1184 3300048915 Ga0496112_0018304 Ga0496112_0018304_2388_3377 328
1185 3300048915 Ga0496112_0027083 Ga0496112_0027083_4025_5014 328
1186 3300048915 Ga0496112_0046746 Ga0496112_0046746_765_1754 328
1187 3300048915 Ga0496112_0069445 Ga0496112_0069445_835_1824 328
1188 3300048915 Ga0496112_0410985 Ga0496112_0410985_182_1171 328
1189 3300048916 Ga0496113_0019566 Ga0496113_0019566_3596_4585 328
1190 3300048916 Ga0496113_0063378 Ga0496113_0063378_799_1788 328
1191 3300048916 Ga0496113_0316421 Ga0496113_0316421_172_1161 328
1192 3300048917 Ga0496114_0081821 Ga0496114_0081821_1525_2514 328
1193 3300048918 Ga0496115_0017793 Ga0496115_0017793_1921_2910 328
1194 3300048918 Ga0496115_0070407 Ga0496115_0070407_685_1674 328
1195 3300048918 Ga0496115_0114485 Ga0496115_0114485_616_1605 328
1196 3300048918 Ga0496115_0154044 Ga0496115_0154044_343_1332 328
1197 3300048919 Ga0496116_0080857 Ga0496116_0080857_876_1865 328
1198 3300048920 Ga0496117_0022107 Ga0496117_0022107_2826_3815 328
1199 3300048920 Ga0496117_0076968 Ga0496117_0076968_558_1547 328
1200 3300048921 Ga0496118_0028837 Ga0496118_0028837_728_1717 328
1201 3300048921 Ga0496118_0032916 Ga0496118_0032916_1280_2269 328
1202 3300048922 Ga0496119_0020199 Ga0496119_0020199_3866_4855 328
1203 3300048922 Ga0496119_0033954 Ga0496119_0033954_1501_2490 328
1204 3300048924 Ga0496121_0000451 Ga0496121_0000451_25319_26308 328
1205 3300048924 Ga0496121_0007759 Ga0496121_0007759_7756_8745 328
1206 3300048924 Ga0496121_0079491 Ga0496121_0079491_47_1036 328
1207 3300048924 Ga0496121_0115304 Ga0496121_0115304_294_1283 328
1208 3300048924 Ga0496121_0119263 Ga0496121_0119263_691_1680 328
1209 3300048924 Ga0496121_0133285 Ga0496121_0133285_722_1711 328
1210 3300048924 Ga0496121_0137565 Ga0496121_0137565_510_1499 328
1211 3300048924 Ga0496121_0191703 Ga0496121_0191703_424_1413 328
1212 3300048927 Ga0496124_0002796 Ga0496124_0002796_11976_12965 328
1213 3300048927 Ga0496124_0048273 Ga0496124_0048273_1281_2270 328
1214 3300048927 Ga0496124_0100870 Ga0496124_0100870_1265_2254 328
1215 3300048928 Ga0496125_0040920 Ga0496125_0040920_2145_3134 328
1216 3300048928 Ga0496125_0068010 Ga0496125_0068010_1704_2693 328
1217 3300048929 Ga0496126_0002876 Ga0496126_0002876_13477_14466 328
1218 3300048929 Ga0496126_0007845 Ga0496126_0007845_5886_6875 328
1219 3300048929 Ga0496126_0053184 Ga0496126_0053184_747_1736 328
1220 3300048929 Ga0496126_0078080 Ga0496126_0078080_363_1352 328
1221 3300048929 Ga0496126_0092750 Ga0496126_0092750_853_1842 328
1222 3300048929 Ga0496126_0195423 Ga0496126_0195423_426_1415 328
1223 3300048929 Ga0496126_0291947 Ga0496126_0291947_320_1309 328
1224 3300048929 Ga0496126_0341069 Ga0496126_0341069_147_1136 328
1225 3300048929 Ga0496126_0351053 Ga0496126_0351053_33_1022 328
1226 3300049460 Ga0495682_0033394 Ga0495682_0033394_43_1032 328
1227 3300049569 Ga0501032_0190178 Ga0501032_0190178_92_1081 328
1228 3300049572 Ga0501036_0181833 Ga0501036_0181833_558_1547 328
1229 3300049574 Ga0501038_0215636 Ga0501038_0215636_296_1285 328
1230 3300049581 Ga0501047_0036235 Ga0501047_0036235_3435_4424 328
1231 3300049586 Ga0501070_0030735 Ga0501070_0030735_3386_4375 328
1232 3300049586 Ga0501070_0187188 Ga0501070_0187188_316_1305 328
1233 3300049590 Ga0501074_0012661 Ga0501074_0012661_1432_2421 328
1234 3300049591 Ga0501075_0154652 Ga0501075_0154652_261_1250 328
1235 3300049742 Ga0501080_0096116 Ga0501080_0096116_1695_2684 328
1236 3300050489 nmdc:mga03683_82564_c1 nmdc:mga03683_82564_c1_170_1159 328
1237 3300050490 nmdc:mga03n38_15385_c1 nmdc:mga03n38_15385_c1_313_1302 328
1238 3300050490 nmdc:mga03n38_25648_c1 nmdc:mga03n38_25648_c1_125_1114 328
1239 3300050492 nmdc:mga0yw44_187613_c1 nmdc:mga0yw44_187613_c1_107_1096 328
1240 3300050492 nmdc:mga0yw44_87129_c1 nmdc:mga0yw44_87129_c1_134_1123 328
1241 3300050493 nmdc:mga0k408_73151_c1 nmdc:mga0k408_73151_c1_951_1940 328
1242 3300050496 nmdc:mga07m45_144408_c1 nmdc:mga07m45_144408_c1_45_1034 328
1243 3300050496 nmdc:mga07m45_35943_c1 nmdc:mga07m45_35943_c1_588_1577 328
1244 3300050496 nmdc:mga07m45_88026_c1 nmdc:mga07m45_88026_c1_488_1477 328
1245 3300050507 nmdc:mga05p37_197856_c1 nmdc:mga05p37_197856_c1_332_1321 328
1246 3300050513 nmdc:mga0rr50_65960_c1 nmdc:mga0rr50_65960_c1_813_1802 328
1247 3300050516 nmdc:mga0sz30_18533_c1 nmdc:mga0sz30_18533_c1_848_1837 328
1248 3300053077 Ga0495601_0035637 Ga0495601_0035637_65_1054 328
1249 3300053080 Ga0500635_0004703 Ga0500635_0004703_814_1803 328
1250 3300053083 Ga0495655_0009258 Ga0495655_0009258_367_1356 328
1251 3300053083 Ga0495655_0030609 Ga0495655_0030609_79_1068 328
1252 3300053084 Ga0495595_0004533 Ga0495595_0004533_2841_3830 328
1253 3300053084 Ga0495595_0013998 Ga0495595_0013998_1468_2457 328
1254 3300053085 Ga0495619_0001285 Ga0495619_0001285_10737_11726 328
1255 3300053085 Ga0495619_0021537 Ga0495619_0021537_673_1662 328
1256 3300053085 Ga0495619_0027673 Ga0495619_0027673_2388_3377 328
1257 3300053085 Ga0495619_0030366 Ga0495619_0030366_540_1529 328
1258 3300053087 Ga0500643_000517 Ga0500643_000517_11145_12134 328
1259 3300053091 Ga0500647_0002370 Ga0500647_0002370_215_1204 328
1260 3300053091 Ga0500647_0011549 Ga0500647_0011549_1910_2899 328
1261 3300053093 Ga0500651_0190199 Ga0500651_0190199_138_1127 328
1262 3300053094 Ga0500566_0000491 Ga0500566_0000491_14279_15268 328
1263 3300053094 Ga0500566_0001030 Ga0500566_0001030_1516_2505 328
1264 3300053094 Ga0500566_0006845 Ga0500566_0006845_3304_4293 328
1265 3300053095 Ga0500640_073975 Ga0500640_073975_388_1377 328
1266 3300053095 Ga0500640_082273 Ga0500640_082273_25_1014 328
1267 3300053103 Ga0500555_001517 Ga0500555_001517_4205_5194 328
1268 3300053104 Ga0500556_0015602 Ga0500556_0015602_1019_2008 328
1269 3300053105 Ga0500557_000019 Ga0500557_000019_55667_56656 328
1270 3300053108 Ga0500562_004121 Ga0500562_004121_570_1559 328
1271 3300053109 Ga0500569_003665 Ga0500569_003665_1693_2682 328
1272 3300053111 Ga0500572_000144 Ga0500572_000144_9641_10630 328
1273 3300053111 Ga0500572_008726 Ga0500572_008726_994_1983 328
1274 3300053119 Ga0500595_047421 Ga0500595_047421_233_1222 328
1275 3300053121 Ga0500607_104804 Ga0500607_104804_191_1180 328
1276 3300053122 Ga0500608_020655 Ga0500608_020655_1995_2984 328
1277 3300053130 Ga0500642_0000835 Ga0500642_0000835_1569_2558 328
1278 3300053136 Ga0500559_0000386 Ga0500559_0000386_17088_18077 328
1279 3300053140 Ga0500573_0048305 Ga0500573_0048305_676_1665 328
1280 3300053148 Ga0500590_013765 Ga0500590_013765_416_1405 328
1281 3300053148 Ga0500590_031683 Ga0500590_031683_719_1708 328
1282 3300053148 Ga0500590_109997 Ga0500590_109997_46_1038 328
1283 3300053150 Ga0500603_000143 Ga0500603_000143_11590_12579 328
1284 3300053150 Ga0500603_004087 Ga0500603_004087_729_1718 328
1285 3300053153 Ga0500616_0026411 Ga0500616_0026411_1542_2531 328
1286 3300053162 Ga0500638_000229 Ga0500638_000229_784_1773 328
1287 3300053162 Ga0500638_056822 Ga0500638_056822_846_1835 328
1288 3300053163 Ga0500639_005961 Ga0500639_005961_1537_2526 328
1289 3300053163 Ga0500639_013425 Ga0500639_013425_1989_2978 328
1290 3300053177 Ga0500636_0000168 Ga0500636_0000168_27439_28428 328
1291 3300053178 Ga0500637_0000134 Ga0500637_0000134_20991_21980 328
1292 3300053178 Ga0500637_0010521 Ga0500637_0010521_1068_2057 328
1293 3300053722 Ga0500649_024644 Ga0500649_024644_765_1754 328
1294 3300053729 Ga0500625_022425 Ga0500625_022425_470_1459 328
1295 3300053735 Ga0500596_001188 Ga0500596_001188_468_1457 328
1296 3300055283 Ga0500661_000037 Ga0500661_000037_5567_6556 328
1297 3300001979 JGI24740J21852_10000425 JGI24740J21852_100004257 329
1298 3300002067 JGI24735J21928_10004541 JGI24735J21928_100045412 329
1299 3300005457 Ga0070662_100362989 Ga0070662_1003629892 329
1300 3300005539 Ga0068853_100036694 Ga0068853_1000366943 329
1301 3300005563 Ga0068855_100145326 Ga0068855_1001453262 329
1302 3300005577 Ga0068857_100014108 Ga0068857_1000141086 329
1303 3300005577 Ga0068857_100017627 Ga0068857_1000176277 329
1304 3300005578 Ga0068854_100004314 Ga0068854_1000043147 329
1305 3300005614 Ga0068856_100021565 Ga0068856_1000215657 329
1306 3300005614 Ga0068856_100037771 Ga0068856_1000377712 329
1307 3300005834 Ga0068851_10003007 Ga0068851_100030076 329
1308 3300009174 Ga0105241_10009598 Ga0105241_100095986 329
1309 3300009545 Ga0105237_10062720 Ga0105237_100627202 329
1310 3300009551 Ga0105238_10029551 Ga0105238_100295513 329
1311 3300010375 Ga0105239_10021610 Ga0105239_100216104 329
1312 3300010375 Ga0105239_10027243 Ga0105239_100272437 329
1313 3300025321 Ga0207656_10009178 Ga0207656_100091783 329
1314 3300025911 Ga0207654_10000073 Ga0207654_1000007338 329
1315 3300025913 Ga0207695_10000366 Ga0207695_1000036675 329
1316 3300025913 Ga0207695_10433465 Ga0207695_104334652 329
1317 3300025924 Ga0207694_10000139 Ga0207694_1000013933 329
1318 3300025924 Ga0207694_10000268 Ga0207694_1000026836 329
1319 3300025924 Ga0207694_10012864 Ga0207694_100128642 329
1320 3300025949 Ga0207667_10015832 Ga0207667_100158322 329
1321 3300025949 Ga0207667_10020820 Ga0207667_100208203 329
1322 3300025981 Ga0207640_10006813 Ga0207640_100068132 329
1323 3300025981 Ga0207640_10009040 Ga0207640_100090405 329
1324 3300026041 Ga0207639_10007864 Ga0207639_100078646 329
1325 3300026041 Ga0207639_10031296 Ga0207639_100312962 329
1326 3300026078 Ga0207702_10000491 Ga0207702_1000049137 329
1327 3300026078 Ga0207702_10012083 Ga0207702_100120832 329
1328 3300026116 Ga0207674_10008730 Ga0207674_100087308 329
1329 3300026116 Ga0207674_10008835 Ga0207674_100088357 329
1330 3300033544 Ga0316215_1004766 Ga0316215_10047662 329
1331 3300039450 Ga0436363_1407757 Ga0436363_1407757_11299_12291 329

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02826

2-Hacid_dh_C

D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain

109

281

0.96

PF00389

2-Hacid_dh

D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain

7

313

0.94

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

146

257

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5unn-assembly1.cif.gz_B crystal structure of nadph-dependent glyoxylate/hydroxypyruvate reductase smc02828 (smghra) from sinorhizobium meliloti in apo form 0.8458 107 294
7va1-assembly1.cif.gz_B crystal structure of human 3-phosphoglycerate dehydrogenase in complex with gdd-04-35 0.8365 108 294
7cvp-assembly1.cif.gz_B the crystal structure of human phgdh from biortus. 0.8315 102 304
6rj6-assembly1.cif.gz_A crystal structure of phgdh in complex with bi-4924 0.8315 110 303
7va1-assembly1.cif.gz_B crystal structure of human 3-phosphoglycerate dehydrogenase in complex with gdd-04-35 0.8198 108 294
ID Description Score Start End Superfamily
af_Q7XRA3_150_294_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9777 150 287 3.40.50.720
af_Q2FVW4_141_284_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.956 150 288 3.40.50.720
af_K7KCB6_141_256_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9527 179 293 3.40.50.720
af_A0A0R0KIU5_101_193_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9517 201 293 3.40.50.720
af_Q7SZY8_153_293_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9476 153 288 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A357G1I8-F1-model_v4 Hydroxyacid dehydrogenase 0.9875 150 288 GO:0005829
GO:0016618
GO:0030267
GO:0051287
AF-A0A5K1GTK6-F1-model_v4 D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding domain-containing protein 0.9718 153 297 GO:0005829
GO:0016618
GO:0030267
GO:0051287
AF-D9ILU2-F1-model_v4 Hydroxyphenylpyruvate reductase 0.9471 140 287 GO:0005829
GO:0016618
GO:0030267
GO:0051287
AF-A0A357G1I8-F1-model_v4 Hydroxyacid dehydrogenase 0.9404 150 288 GO:0005829
GO:0016618
GO:0030267
GO:0051287
AF-A0A5K1GTK6-F1-model_v4 D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding domain-containing protein 0.94 153 297 GO:0005829
GO:0016618
GO:0030267
GO:0051287

Feature Viewer

pLDDT pTM Quality
91.11 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map