F493081
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1331 | 686 | 1100 | 327 |
Family's Representative Sequence
| Representative Sequence | 3300048924|Ga0496121_0004071|Ga0496121_0004071_313_1293 |
| Length | 326 |
| Sequence | MSDQVHILSIGQMMPAVDAALEQQFVLHQADIHNIKSVLAQAGDQIRGIATRGRQKTDAALIAALPRLEIVSNFGVGYDSIDIAAAVKRGIVITNTPDVLNAEVADFTVGLLLATIRELPQADRYLRDGKWPTSPFHLTQTLRDRTIGLIGMGRIGQAIAKRIAAFDVPVVYHSRKSQPNVSYRYYPDLKAMASEVDTLIAIVPGGAATKHMINAEILRALGSRGILINVARGSVVDQGALIDALRDGTIHGAGLDVFADEPNVPPELMAMQNTVRVPHVGSGTHHTRAVMGELVVDNLRSWFAGKGPVTPVPETPWPKSQTSSHL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 7 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 8 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 9 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 10 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 11 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 12 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 13 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 14 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 15 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 16 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 17 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 18 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 19 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 20 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 21 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 22 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 23 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 24 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 25 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 26 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 27 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 28 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 29 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 30 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 31 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 32 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 33 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 34 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 35 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 36 | 2791355199 | |||
| 37 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 38 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 39 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 40 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 41 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 42 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 43 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 44 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 45 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 46 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 47 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 48 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 49 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 50 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 51 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 52 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 53 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 54 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 55 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 56 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 57 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 58 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 59 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 60 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 61 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 62 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 63 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 64 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 65 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 66 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 67 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 68 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 69 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 70 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 71 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 72 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 73 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 74 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 75 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 76 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 77 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 78 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 79 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 80 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 81 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 82 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 83 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 84 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 85 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 86 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 87 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 88 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 89 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 90 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 91 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 92 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 93 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 94 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 95 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 96 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 97 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 98 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 99 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 100 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 101 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 102 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 103 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 104 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 105 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 106 | 2904699407 | |||
| 107 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 108 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 109 | 2906610324 | |||
| 110 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 111 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 112 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 113 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 114 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 115 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 116 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 117 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 118 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 119 | 2922368715 | |||
| 120 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 121 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 122 | 2922425934 | |||
| 123 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 124 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 125 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 126 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 127 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 128 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 129 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 130 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 131 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 132 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 133 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 134 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 135 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 136 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 137 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 138 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 139 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 140 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 141 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 142 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 143 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 144 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 145 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 146 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 147 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 148 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 149 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 150 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 151 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 152 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 153 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 154 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 155 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 156 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 157 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 158 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 159 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 160 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 161 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 162 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 163 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 164 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 165 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 166 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 167 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 168 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 169 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 170 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 171 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 172 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 173 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 174 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 175 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 176 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 177 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 178 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 179 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 180 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 181 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 182 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 183 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 184 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 185 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 186 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 187 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 188 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 189 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 190 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 191 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 192 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 193 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 194 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 195 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 196 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 197 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 198 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 199 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 200 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 201 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 202 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 203 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 204 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 205 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 206 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 207 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 208 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 209 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 210 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 211 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 212 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 213 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 214 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 215 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 216 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 217 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 218 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 219 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 220 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 221 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 222 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 223 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 224 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 225 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 226 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 227 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 228 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 229 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 230 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 231 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 232 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 233 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 234 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 235 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 236 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 237 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 238 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 239 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 240 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 241 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 242 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 243 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 244 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 245 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 246 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 247 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 248 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 249 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 250 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 251 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 252 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 253 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 254 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 255 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 256 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 257 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 258 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 259 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 260 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 261 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 262 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 263 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 264 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 265 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 266 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 267 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 268 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 269 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 270 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 271 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 273 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 274 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 275 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 276 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 278 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 279 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 280 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 281 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 282 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 283 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 284 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 286 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 287 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 289 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 290 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 291 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 292 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 293 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 294 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 295 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 296 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 297 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 298 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 299 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 300 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 301 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 302 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 303 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 304 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 305 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 306 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 307 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 308 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 309 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 310 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 311 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 312 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 313 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 314 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 315 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 316 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 317 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 318 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 319 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 320 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 321 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 322 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 323 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 324 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 325 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 326 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 327 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 373 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 374 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 375 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 376 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 377 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 379 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 380 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 381 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 382 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 383 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 384 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 385 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 386 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 387 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 388 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 389 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 390 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 391 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 392 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 393 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 394 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 395 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 396 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 397 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 398 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 399 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 400 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 401 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 402 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 403 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 404 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 405 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 406 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 407 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 408 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 409 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 410 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 411 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 412 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 413 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 414 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 415 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 416 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 417 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 418 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 419 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 420 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 421 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 422 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 423 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 424 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 425 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 426 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 427 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 428 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 429 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 430 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 431 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 432 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 433 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 434 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 435 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 436 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 437 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 438 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 439 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 440 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 441 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 442 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 443 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 444 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 445 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 446 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 447 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 448 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 449 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 450 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 451 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 452 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 453 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 454 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 455 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 456 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 457 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 458 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 459 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 460 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 537 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 538 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 539 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 540 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 541 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 542 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 543 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 544 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 545 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 546 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 547 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 548 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 549 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 550 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 551 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 552 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 553 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 554 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 555 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 556 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 557 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 558 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 559 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 560 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 561 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 562 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 563 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 564 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 565 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 566 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 567 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 568 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 569 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 570 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 571 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 572 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 573 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 574 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 575 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 576 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 577 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 578 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 579 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 580 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 581 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 582 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 583 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 584 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 585 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 586 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 587 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 588 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 589 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 590 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 591 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 592 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 593 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 594 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 595 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 596 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 597 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 598 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 599 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 600 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 601 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 602 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 603 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 604 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 605 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 606 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 607 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 608 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 609 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 610 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 611 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 612 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 613 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 614 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 615 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 616 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 617 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 618 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 619 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 620 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 621 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 622 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 623 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 624 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 625 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 626 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 627 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 628 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 629 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 630 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 631 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 632 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 633 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 634 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 635 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 636 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 637 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 638 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 639 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 640 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 641 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 642 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 643 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 644 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 645 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 646 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 647 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 648 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 649 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 650 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 651 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 652 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 653 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 654 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 655 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 656 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 657 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 658 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 659 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 660 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 661 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 662 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 663 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 664 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 665 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 666 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 667 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 668 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 669 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 670 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 671 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 672 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 673 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 674 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 675 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 676 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 677 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 678 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 679 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 680 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 681 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 682 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 683 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 684 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 685 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 686 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.88 |
| Metatranscriptomes | 0.08 |
| Isolates | 17.04 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.99 |
| Nodule | 13.6 |
| Rhizoplane | 5.79 |
| Rhizosphere | 58.98 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000425 | 3300001979 | Bacteria | 18047 |
| 2 | JGI24735J21928_10004541 | 3300002067 | Bacteria | 4666 |
| 3 | JGI25406J46586_10000170 | 3300003203 | Bacteria | 29119 |
| 4 | JGI25406J46586_10020229 | 3300003203 | Bacteria | 2696 |
| 5 | JGI25153J46596_10007605 | 3300003215 | Bacteria | 5297 |
| 6 | JGI25153J46596_10014183 | 3300003215 | Bacteria | 3328 |
| 7 | JGI25404J52841_10002788 | 3300003659 | Bacteria | 3363 |
| 8 | JGI25404J52841_10020255 | 3300003659 | Bacteria | 1441 |
| 9 | JGI25404J52841_10020816 | 3300003659 | Bacteria | 1420 |
| 10 | Ga0055539_1005620 | 3300003752 | Bacteria | 1622 |
| 11 | Ga0055524_1025744 | 3300003775 | Bacteria | 1834 |
| 12 | Ga0055531_10001969 | 3300003794 | Bacteria | 14324 |
| 13 | Ga0055543_1007718 | 3300004625 | Bacteria | 2456 |
| 14 | Ga0065165_1002418 | 3300005262 | Bacteria | 15912 |
| 15 | Ga0065165_1004254 | 3300005262 | Bacteria | 9053 |
| 16 | Ga0070658_10022210 | 3300005327 | Bacteria | 5092 |
| 17 | Ga0070658_10418233 | 3300005327 | Bacteria | 1152 |
| 18 | Ga0070676_10007989 | 3300005328 | Bacteria | 5689 |
| 19 | Ga0070683_100050728 | 3300005329 | Bacteria | 3842 |
| 20 | Ga0070683_100349627 | 3300005329 | Bacteria | 1408 |
| 21 | Ga0070683_100417424 | 3300005329 | Bacteria | 1280 |
| 22 | Ga0070680_100067985 | 3300005336 | Bacteria | 2924 |
| 23 | Ga0070680_100473476 | 3300005336 | Bacteria | 1070 |
| 24 | Ga0070682_100023808 | 3300005337 | Bacteria | 3639 |
| 25 | Ga0070682_100108793 | 3300005337 | Bacteria | 1844 |
| 26 | Ga0070660_100382763 | 3300005339 | Bacteria | 1161 |
| 27 | Ga0070689_100141027 | 3300005340 | Bacteria | 1938 |
| 28 | Ga0070689_100314067 | 3300005340 | Bacteria | 1307 |
| 29 | Ga0070661_100295139 | 3300005344 | Bacteria | 1260 |
| 30 | Ga0070661_100298027 | 3300005344 | Bacteria | 1254 |
| 31 | Ga0070692_10185132 | 3300005345 | Bacteria | 1209 |
| 32 | Ga0070668_100015166 | 3300005347 | Bacteria | 5758 |
| 33 | Ga0070668_100016551 | 3300005347 | Bacteria | 5512 |
| 34 | Ga0070668_100192363 | 3300005347 | Bacteria | 1671 |
| 35 | Ga0070675_100291316 | 3300005354 | Bacteria | 1437 |
| 36 | Ga0070675_100445646 | 3300005354 | Bacteria | 1160 |
| 37 | Ga0070671_100013043 | 3300005355 | Bacteria | 6698 |
| 38 | Ga0070671_100193799 | 3300005355 | Bacteria | 1722 |
| 39 | Ga0070671_100264604 | 3300005355 | Bacteria | 1461 |
| 40 | Ga0070671_100370648 | 3300005355 | Bacteria | 1223 |
| 41 | Ga0070674_100038335 | 3300005356 | Bacteria | 3229 |
| 42 | Ga0070674_100052473 | 3300005356 | Bacteria | 2813 |
| 43 | Ga0070673_100251779 | 3300005364 | Bacteria | 1540 |
| 44 | Ga0070659_100060018 | 3300005366 | Bacteria | 3004 |
| 45 | Ga0070667_100025504 | 3300005367 | Bacteria | 4914 |
| 46 | Ga0070709_10006483 | 3300005434 | Bacteria | 6378 |
| 47 | Ga0070709_10033865 | 3300005434 | Bacteria | 3093 |
| 48 | Ga0070709_10107221 | 3300005434 | Bacteria | 1872 |
| 49 | Ga0070714_100003521 | 3300005435 | Bacteria | 11689 |
| 50 | Ga0070714_100004001 | 3300005435 | Bacteria | 11083 |
| 51 | Ga0070714_100012654 | 3300005435 | Bacteria | 6739 |
| 52 | Ga0070714_100061329 | 3300005435 | Bacteria | 3230 |
| 53 | Ga0070714_100155992 | 3300005435 | Bacteria | 2061 |
| 54 | Ga0070714_100559230 | 3300005435 | Bacteria | 1096 |
| 55 | Ga0070713_100006580 | 3300005436 | Bacteria | 8075 |
| 56 | Ga0070713_100006616 | 3300005436 | Bacteria | 8057 |
| 57 | Ga0070713_100055790 | 3300005436 | Bacteria | 3285 |
| 58 | Ga0070713_100080610 | 3300005436 | Bacteria | 2776 |
| 59 | Ga0070713_100101588 | 3300005436 | Bacteria | 2492 |
| 60 | Ga0070710_10000219 | 3300005437 | Bacteria | 26539 |
| 61 | Ga0070710_10015416 | 3300005437 | Bacteria | 3868 |
| 62 | Ga0070710_10070845 | 3300005437 | Bacteria | 2009 |
| 63 | Ga0070710_10078935 | 3300005437 | Bacteria | 1917 |
| 64 | Ga0070711_100002404 | 3300005439 | Bacteria | 10676 |
| 65 | Ga0070711_100002832 | 3300005439 | Bacteria | 9961 |
| 66 | Ga0070711_100007523 | 3300005439 | Bacteria | 6631 |
| 67 | Ga0070711_100023994 | 3300005439 | Bacteria | 3974 |
| 68 | Ga0070711_100200420 | 3300005439 | Bacteria | 1540 |
| 69 | Ga0070705_100040255 | 3300005440 | Bacteria | 2657 |
| 70 | Ga0070708_100061161 | 3300005445 | Bacteria | 3364 |
| 71 | Ga0070663_100003302 | 3300005455 | Bacteria | 9291 |
| 72 | Ga0070663_100012874 | 3300005455 | Bacteria | 5311 |
| 73 | Ga0070663_100089732 | 3300005455 | Bacteria | 2275 |
| 74 | Ga0070663_100119546 | 3300005455 | Bacteria | 1989 |
| 75 | Ga0070663_100216284 | 3300005455 | Bacteria | 1503 |
| 76 | Ga0070678_100121198 | 3300005456 | Bacteria | 2063 |
| 77 | Ga0070678_100369908 | 3300005456 | Bacteria | 1237 |
| 78 | Ga0070662_100362989 | 3300005457 | Bacteria | 1189 |
| 79 | Ga0070681_10009562 | 3300005458 | Bacteria | 9537 |
| 80 | Ga0070681_10058567 | 3300005458 | Bacteria | 3831 |
| 81 | Ga0070681_10369461 | 3300005458 | Bacteria | 1345 |
| 82 | Ga0070706_100206761 | 3300005467 | Bacteria | 1833 |
| 83 | Ga0070707_100039062 | 3300005468 | Bacteria | 4536 |
| 84 | Ga0070679_100022307 | 3300005530 | Bacteria | 6188 |
| 85 | Ga0070679_100083660 | 3300005530 | Bacteria | 3179 |
| 86 | Ga0070679_100106676 | 3300005530 | Bacteria | 2787 |
| 87 | Ga0070679_100263811 | 3300005530 | Bacteria | 1677 |
| 88 | Ga0070679_100327180 | 3300005530 | Bacteria | 1481 |
| 89 | Ga0070684_100011463 | 3300005535 | Bacteria | 7061 |
| 90 | Ga0070684_100112861 | 3300005535 | Bacteria | 2438 |
| 91 | Ga0070697_100156128 | 3300005536 | Bacteria | 1926 |
| 92 | Ga0068853_100036694 | 3300005539 | Bacteria | 4169 |
| 93 | Ga0068853_100038220 | 3300005539 | Bacteria | 4087 |
| 94 | Ga0068853_100122686 | 3300005539 | Bacteria | 2319 |
| 95 | Ga0068853_100156671 | 3300005539 | Bacteria | 2052 |
| 96 | Ga0068853_100249648 | 3300005539 | Bacteria | 1628 |
| 97 | Ga0068853_100387183 | 3300005539 | Bacteria | 1306 |
| 98 | Ga0070672_100282173 | 3300005543 | Bacteria | 1404 |
| 99 | Ga0070696_100122749 | 3300005546 | Bacteria | 1882 |
| 100 | Ga0070693_100126214 | 3300005547 | Bacteria | 1593 |
| 101 | Ga0070665_100063100 | 3300005548 | Bacteria | 3715 |
| 102 | Ga0070665_100113564 | 3300005548 | Bacteria | 2712 |
| 103 | Ga0070665_100230562 | 3300005548 | Bacteria | 1852 |
| 104 | Ga0070704_100145198 | 3300005549 | Bacteria | 1858 |
| 105 | Ga0068855_100025942 | 3300005563 | Bacteria | 7011 |
| 106 | Ga0068855_100055336 | 3300005563 | Bacteria | 4660 |
| 107 | Ga0068855_100087122 | 3300005563 | Bacteria | 3610 |
| 108 | Ga0068855_100121183 | 3300005563 | Bacteria | 2993 |
| 109 | Ga0068855_100145326 | 3300005563 | Bacteria | 2700 |
| 110 | Ga0070664_100143577 | 3300005564 | Bacteria | 2103 |
| 111 | Ga0070664_100345887 | 3300005564 | Bacteria | 1352 |
| 112 | Ga0068857_100014108 | 3300005577 | Bacteria | 6957 |
| 113 | Ga0068857_100017627 | 3300005577 | Bacteria | 6261 |
| 114 | Ga0068854_100004314 | 3300005578 | Bacteria | 8961 |
| 115 | Ga0068854_100040592 | 3300005578 | Bacteria | 3284 |
| 116 | Ga0068854_100085691 | 3300005578 | Bacteria | 2334 |
| 117 | Ga0068856_100002788 | 3300005614 | Bacteria | 17883 |
| 118 | Ga0068856_100021565 | 3300005614 | Bacteria | 6261 |
| 119 | Ga0068856_100037771 | 3300005614 | Bacteria | 4739 |
| 120 | Ga0068856_100050275 | 3300005614 | Bacteria | 4109 |
| 121 | Ga0068856_100147691 | 3300005614 | Bacteria | 2359 |
| 122 | Ga0068856_100151030 | 3300005614 | Bacteria | 2332 |
| 123 | Ga0068856_100209451 | 3300005614 | Bacteria | 1964 |
| 124 | Ga0068852_100017600 | 3300005616 | Bacteria | 5612 |
| 125 | Ga0068852_100027985 | 3300005616 | Bacteria | 4605 |
| 126 | Ga0068859_100160315 | 3300005617 | Bacteria | 2328 |
| 127 | Ga0068864_100041943 | 3300005618 | Bacteria | 3915 |
| 128 | Ga0068864_100133125 | 3300005618 | Bacteria | 2236 |
| 129 | Ga0068861_100059504 | 3300005719 | Bacteria | 2925 |
| 130 | Ga0068861_100229769 | 3300005719 | Bacteria | 1572 |
| 131 | Ga0068851_10003007 | 3300005834 | Bacteria | 7445 |
| 132 | Ga0068851_10049292 | 3300005834 | Bacteria | 2136 |
| 133 | Ga0068870_10060797 | 3300005840 | Bacteria | 2029 |
| 134 | Ga0068863_100049355 | 3300005841 | Bacteria | 3991 |
| 135 | Ga0068863_100278379 | 3300005841 | Bacteria | 1620 |
| 136 | Ga0068858_100039032 | 3300005842 | Bacteria | 4405 |
| 137 | Ga0068858_100097972 | 3300005842 | Bacteria | 2734 |
| 138 | Ga0068858_100115183 | 3300005842 | Bacteria | 2511 |
| 139 | Ga0068858_100165975 | 3300005842 | Bacteria | 2080 |
| 140 | Ga0068858_100213226 | 3300005842 | Bacteria | 1827 |
| 141 | Ga0068858_100453615 | 3300005842 | Bacteria | 1236 |
| 142 | Ga0068860_100001070 | 3300005843 | Bacteria | 30180 |
| 143 | Ga0068862_100123022 | 3300005844 | Bacteria | 2288 |
| 144 | Ga0068862_100193688 | 3300005844 | Bacteria | 1830 |
| 145 | Ga0081455_10003639 | 3300005937 | Bacteria | 17660 |
| 146 | Ga0081455_10016498 | 3300005937 | Bacteria | 7128 |
| 147 | Ga0081455_10018914 | 3300005937 | Bacteria | 6535 |
| 148 | Ga0081455_10023899 | 3300005937 | Bacteria | 5676 |
| 149 | Ga0081540_1001561 | 3300005983 | Bacteria | 19619 |
| 150 | Ga0081540_1002615 | 3300005983 | Bacteria | 14634 |
| 151 | Ga0081540_1003198 | 3300005983 | Bacteria | 13049 |
| 152 | Ga0081540_1003591 | 3300005983 | Bacteria | 12180 |
| 153 | Ga0081540_1011508 | 3300005983 | Bacteria | 5911 |
| 154 | Ga0081540_1016877 | 3300005983 | Bacteria | 4546 |
| 155 | Ga0081540_1055762 | 3300005983 | Bacteria | 1923 |
| 156 | Ga0081540_1098118 | 3300005983 | Bacteria | 1269 |
| 157 | Ga0081540_1098526 | 3300005983 | Bacteria | 1265 |
| 158 | Ga0081539_10000040 | 3300005985 | Bacteria | 292753 |
| 159 | Ga0081539_10000629 | 3300005985 | Bacteria | 71410 |
| 160 | Ga0081539_10010272 | 3300005985 | Bacteria | 7644 |
| 161 | Ga0081539_10080264 | 3300005985 | Bacteria | 1717 |
| 162 | Ga0070717_10042834 | 3300006028 | Bacteria | 3693 |
| 163 | Ga0070717_10060673 | 3300006028 | Bacteria | 3132 |
| 164 | Ga0070717_10066529 | 3300006028 | Bacteria | 2997 |
| 165 | Ga0075365_10000230 | 3300006038 | Bacteria | 19070 |
| 166 | Ga0075365_10043037 | 3300006038 | Bacteria | 2955 |
| 167 | Ga0075365_10066569 | 3300006038 | Bacteria | 2417 |
| 168 | Ga0075365_10111342 | 3300006038 | Bacteria | 1881 |
| 169 | Ga0075365_10233866 | 3300006038 | Bacteria | 1290 |
| 170 | Ga0075368_10043216 | 3300006042 | Bacteria | 1775 |
| 171 | Ga0075363_100002768 | 3300006048 | Bacteria | 7271 |
| 172 | Ga0075363_100026974 | 3300006048 | Bacteria | 2942 |
| 173 | Ga0075363_100051359 | 3300006048 | Bacteria | 2198 |
| 174 | Ga0075364_10117059 | 3300006051 | Bacteria | 1782 |
| 175 | Ga0070715_10083250 | 3300006163 | Bacteria | 1456 |
| 176 | Ga0070716_100009512 | 3300006173 | Bacteria | 4845 |
| 177 | Ga0070716_100055019 | 3300006173 | Bacteria | 2275 |
| 178 | Ga0070716_100238052 | 3300006173 | Bacteria | 1233 |
| 179 | Ga0070712_100009393 | 3300006175 | Bacteria | 6161 |
| 180 | Ga0070712_100024020 | 3300006175 | Bacteria | 4033 |
| 181 | Ga0070712_100073619 | 3300006175 | Bacteria | 2451 |
| 182 | Ga0075362_10058839 | 3300006177 | Bacteria | 1734 |
| 183 | Ga0075362_10140496 | 3300006177 | Bacteria | 1154 |
| 184 | Ga0075367_10040880 | 3300006178 | Bacteria | 2708 |
| 185 | Ga0075367_10128164 | 3300006178 | Bacteria | 1567 |
| 186 | Ga0075367_10151234 | 3300006178 | Bacteria | 1440 |
| 187 | Ga0075369_10082099 | 3300006186 | Bacteria | 1430 |
| 188 | Ga0097621_100076401 | 3300006237 | Bacteria | 2778 |
| 189 | Ga0097621_100223747 | 3300006237 | Bacteria | 1641 |
| 190 | Ga0075370_10047914 | 3300006353 | Bacteria | 2420 |
| 191 | Ga0075370_10105722 | 3300006353 | Bacteria | 1632 |
| 192 | Ga0075370_10119165 | 3300006353 | Bacteria | 1536 |
| 193 | Ga0068871_100313797 | 3300006358 | Bacteria | 1379 |
| 194 | Ga0068871_100341879 | 3300006358 | Bacteria | 1322 |
| 195 | Ga0075428_100152807 | 3300006844 | Bacteria | 2507 |
| 196 | Ga0068865_100051894 | 3300006881 | Bacteria | 2840 |
| 197 | Ga0068865_100192205 | 3300006881 | Bacteria | 1579 |
| 198 | Ga0068865_100240795 | 3300006881 | Bacteria | 1423 |
| 199 | Ga0097620_100160321 | 3300006931 | Bacteria | 2328 |
| 200 | Ga0099824_1010813 | 3300006942 | Bacteria | 10575 |
| 201 | Ga0099824_1016377 | 3300006942 | Bacteria | 6735 |
| 202 | Ga0099822_1002332 | 3300006943 | Bacteria | 23535 |
| 203 | Ga0099823_1037534 | 3300006944 | Bacteria | 3658 |
| 204 | Ga0075435_100035211 | 3300007076 | Bacteria | 3973 |
| 205 | Ga0099794_10023536 | 3300007265 | Bacteria | 2819 |
| 206 | Ga0099794_10185797 | 3300007265 | Bacteria | 1062 |
| 207 | Ga0099795_10009237 | 3300007788 | Bacteria | 2851 |
| 208 | Ga0099795_10014635 | 3300007788 | Bacteria | 2437 |
| 209 | Ga0105240_10034054 | 3300009093 | Bacteria | 6575 |
| 210 | Ga0105240_10046615 | 3300009093 | Bacteria | 5491 |
| 211 | Ga0105240_10061416 | 3300009093 | Bacteria | 4683 |
| 212 | Ga0105240_10088594 | 3300009093 | Bacteria | 3787 |
| 213 | Ga0105240_10090182 | 3300009093 | Bacteria | 3747 |
| 214 | Ga0105240_10133219 | 3300009093 | Bacteria | 2978 |
| 215 | Ga0111539_10036660 | 3300009094 | Bacteria | 5926 |
| 216 | Ga0105245_10108732 | 3300009098 | Bacteria | 2576 |
| 217 | Ga0105247_10048921 | 3300009101 | Bacteria | 2598 |
| 218 | Ga0105247_10162695 | 3300009101 | Bacteria | 1479 |
| 219 | Ga0105247_10301216 | 3300009101 | Bacteria | 1112 |
| 220 | Ga0114129_10089335 | 3300009147 | Bacteria | 4271 |
| 221 | Ga0114129_10229803 | 3300009147 | Bacteria | 2499 |
| 222 | Ga0105243_10074455 | 3300009148 | Bacteria | 2754 |
| 223 | Ga0105241_10009598 | 3300009174 | Bacteria | 7115 |
| 224 | Ga0105241_10074950 | 3300009174 | Bacteria | 2636 |
| 225 | Ga0105241_10108202 | 3300009174 | Bacteria | 2222 |
| 226 | Ga0105241_10134760 | 3300009174 | Bacteria | 2004 |
| 227 | Ga0105241_10396602 | 3300009174 | Bacteria | 1209 |
| 228 | Ga0105242_10058731 | 3300009176 | Bacteria | 3155 |
| 229 | Ga0105237_10002092 | 3300009545 | Bacteria | 25220 |
| 230 | Ga0105237_10023476 | 3300009545 | Bacteria | 6319 |
| 231 | Ga0105237_10036215 | 3300009545 | Bacteria | 4992 |
| 232 | Ga0105237_10062720 | 3300009545 | Bacteria | 3716 |
| 233 | Ga0105237_10139508 | 3300009545 | Bacteria | 2418 |
| 234 | Ga0105238_10029551 | 3300009551 | Bacteria | 5583 |
| 235 | Ga0105238_10043421 | 3300009551 | Bacteria | 4549 |
| 236 | Ga0105238_10067329 | 3300009551 | Bacteria | 3583 |
| 237 | Ga0105249_10041299 | 3300009553 | Bacteria | 4192 |
| 238 | Ga0105249_10121599 | 3300009553 | Bacteria | 2481 |
| 239 | Ga0099796_10020991 | 3300010159 | Bacteria | 2005 |
| 240 | Ga0105239_10021610 | 3300010375 | Bacteria | 7095 |
| 241 | Ga0105239_10027243 | 3300010375 | Bacteria | 6291 |
| 242 | Ga0105239_10031504 | 3300010375 | Bacteria | 5830 |
| 243 | Ga0105239_10053186 | 3300010375 | Bacteria | 4442 |
| 244 | Ga0105239_10065469 | 3300010375 | Bacteria | 3991 |
| 245 | Ga0105239_10075985 | 3300010375 | Bacteria | 3694 |
| 246 | Ga0105239_10286135 | 3300010375 | Bacteria | 1856 |
| 247 | Ga0105239_10373033 | 3300010375 | Bacteria | 1613 |
| 248 | Ga0105246_10138697 | 3300011119 | Bacteria | 1826 |
| 249 | Ga0157371_10023801 | 3300013102 | Bacteria | 4476 |
| 250 | Ga0157370_10029759 | 3300013104 | Bacteria | 5356 |
| 251 | Ga0157370_10056752 | 3300013104 | Bacteria | 3726 |
| 252 | Ga0157369_10008687 | 3300013105 | Bacteria | 11646 |
| 253 | Ga0157369_10014863 | 3300013105 | Bacteria | 8787 |
| 254 | Ga0157369_10015000 | 3300013105 | Bacteria | 8746 |
| 255 | Ga0157369_10078819 | 3300013105 | Bacteria | 3529 |
| 256 | Ga0157374_10007266 | 3300013296 | Bacteria | 9438 |
| 257 | Ga0157378_10275946 | 3300013297 | Bacteria | 1619 |
| 258 | Ga0157378_10367787 | 3300013297 | Bacteria | 1409 |
| 259 | Ga0163162_10058930 | 3300013306 | Bacteria | 3870 |
| 260 | Ga0163162_10178735 | 3300013306 | Bacteria | 2248 |
| 261 | Ga0157372_10132015 | 3300013307 | Bacteria | 2874 |
| 262 | Ga0157372_10519055 | 3300013307 | Bacteria | 1389 |
| 263 | Ga0157375_10156807 | 3300013308 | Bacteria | 2416 |
| 264 | Ga0163163_10032478 | 3300014325 | Bacteria | 5040 |
| 265 | Ga0163163_10112864 | 3300014325 | Bacteria | 2747 |
| 266 | Ga0163163_10279135 | 3300014325 | Bacteria | 1722 |
| 267 | Ga0157379_10147786 | 3300014968 | Bacteria | 2119 |
| 268 | Ga0157376_10108045 | 3300014969 | Bacteria | 2443 |
| 269 | Ga0163161_10312521 | 3300017792 | Bacteria | 1240 |
| 270 | Ga0206356_10611048 | 3300020070 | Bacteria | 1718 |
| 271 | Ga0214544_1000007 | 3300021320 | Bacteria | 379989 |
| 272 | Ga0214542_1000216 | 3300021321 | Bacteria | 92614 |
| 273 | Ga0214545_1000118 | 3300021324 | Bacteria | 92737 |
| 274 | Ga0214543_1000009 | 3300021327 | Bacteria | 384302 |
| 275 | Ga0213873_10014582 | 3300021358 | Bacteria | 1744 |
| 276 | Ga0213872_10022262 | 3300021361 | Bacteria | 2919 |
| 277 | Ga0213876_10013493 | 3300021384 | Bacteria | 4336 |
| 278 | Ga0213876_10057406 | 3300021384 | Bacteria | 2055 |
| 279 | Ga0213876_10158781 | 3300021384 | Bacteria | 1203 |
| 280 | Ga0213876_10164378 | 3300021384 | Bacteria | 1181 |
| 281 | Ga0209563_101733 | 3300025230 | Bacteria | 5500 |
| 282 | Ga0209677_100395 | 3300025253 | Bacteria | 26466 |
| 283 | Ga0209677_101305 | 3300025253 | Bacteria | 11059 |
| 284 | Ga0209148_1000388 | 3300025254 | Bacteria | 52495 |
| 285 | Ga0209148_1007027 | 3300025254 | Bacteria | 2376 |
| 286 | Ga0209233_1000949 | 3300025261 | Bacteria | 12587 |
| 287 | Ga0209233_1002242 | 3300025261 | Bacteria | 7224 |
| 288 | Ga0209233_1002405 | 3300025261 | Bacteria | 6911 |
| 289 | Ga0209233_1019667 | 3300025261 | Bacteria | 1789 |
| 290 | Ga0209455_1007359 | 3300025272 | Bacteria | 3119 |
| 291 | Ga0209564_1001154 | 3300025295 | Bacteria | 30904 |
| 292 | Ga0209564_1018635 | 3300025295 | Bacteria | 2635 |
| 293 | Ga0209564_1023468 | 3300025295 | Bacteria | 2142 |
| 294 | Ga0209758_1000030 | 3300025297 | Bacteria | 509217 |
| 295 | Ga0209758_1000429 | 3300025297 | Bacteria | 71157 |
| 296 | Ga0209758_1001015 | 3300025297 | Bacteria | 37162 |
| 297 | Ga0209758_1002652 | 3300025297 | Bacteria | 17708 |
| 298 | Ga0209758_1003562 | 3300025297 | Bacteria | 14000 |
| 299 | Ga0209256_1003190 | 3300025299 | Bacteria | 11867 |
| 300 | Ga0207426_1000347 | 3300025302 | Bacteria | 85420 |
| 301 | Ga0207426_1001408 | 3300025302 | Bacteria | 20164 |
| 302 | Ga0207426_1003607 | 3300025302 | Bacteria | 8216 |
| 303 | Ga0209257_1004526 | 3300025304 | Bacteria | 10674 |
| 304 | Ga0207656_10009178 | 3300025321 | Bacteria | 3668 |
| 305 | Ga0207656_10024823 | 3300025321 | Bacteria | 2428 |
| 306 | Ga0207653_10014357 | 3300025885 | Bacteria | 2486 |
| 307 | Ga0207692_10000213 | 3300025898 | Bacteria | 19497 |
| 308 | Ga0207692_10034398 | 3300025898 | Bacteria | 2453 |
| 309 | Ga0207692_10041308 | 3300025898 | Bacteria | 2282 |
| 310 | Ga0207710_10031263 | 3300025900 | Bacteria | 2327 |
| 311 | Ga0207647_10059968 | 3300025904 | Bacteria | 2327 |
| 312 | Ga0207699_10035638 | 3300025906 | Bacteria | 2832 |
| 313 | Ga0207699_10040885 | 3300025906 | Bacteria | 2674 |
| 314 | Ga0207699_10108963 | 3300025906 | Bacteria | 1771 |
| 315 | Ga0207699_10149410 | 3300025906 | Bacteria | 1544 |
| 316 | Ga0207645_10048434 | 3300025907 | Bacteria | 2714 |
| 317 | Ga0207643_10185510 | 3300025908 | Bacteria | 1261 |
| 318 | Ga0207705_10034575 | 3300025909 | Bacteria | 3614 |
| 319 | Ga0207705_10178962 | 3300025909 | Bacteria | 1599 |
| 320 | Ga0207654_10000073 | 3300025911 | Bacteria | 66148 |
| 321 | Ga0207654_10050613 | 3300025911 | Bacteria | 2388 |
| 322 | Ga0207654_10099770 | 3300025911 | Bacteria | 1787 |
| 323 | Ga0207707_10000398 | 3300025912 | Bacteria | 45384 |
| 324 | Ga0207707_10024840 | 3300025912 | Bacteria | 5241 |
| 325 | Ga0207707_10063900 | 3300025912 | Bacteria | 3204 |
| 326 | Ga0207707_10081956 | 3300025912 | Bacteria | 2816 |
| 327 | Ga0207695_10000006 | 3300025913 | Bacteria | 1135309 |
| 328 | Ga0207695_10000366 | 3300025913 | Bacteria | 103345 |
| 329 | Ga0207695_10032098 | 3300025913 | Bacteria | 5751 |
| 330 | Ga0207695_10141453 | 3300025913 | Bacteria | 2354 |
| 331 | Ga0207695_10433465 | 3300025913 | Bacteria | 1198 |
| 332 | Ga0207671_10013114 | 3300025914 | Bacteria | 6620 |
| 333 | Ga0207671_10018633 | 3300025914 | Bacteria | 5320 |
| 334 | Ga0207671_10146459 | 3300025914 | Bacteria | 1822 |
| 335 | Ga0207671_10160882 | 3300025914 | Bacteria | 1739 |
| 336 | Ga0207671_10214977 | 3300025914 | Bacteria | 1505 |
| 337 | Ga0207693_10007490 | 3300025915 | Bacteria | 8973 |
| 338 | Ga0207693_10015350 | 3300025915 | Bacteria | 6146 |
| 339 | Ga0207693_10120128 | 3300025915 | Bacteria | 2064 |
| 340 | Ga0207663_10000167 | 3300025916 | Bacteria | 29694 |
| 341 | Ga0207663_10009487 | 3300025916 | Bacteria | 5142 |
| 342 | Ga0207663_10014741 | 3300025916 | Bacteria | 4292 |
| 343 | Ga0207663_10018460 | 3300025916 | Bacteria | 3909 |
| 344 | Ga0207663_10250868 | 3300025916 | Bacteria | 1302 |
| 345 | Ga0207660_10003186 | 3300025917 | Bacteria | 10733 |
| 346 | Ga0207660_10071421 | 3300025917 | Bacteria | 2526 |
| 347 | Ga0207660_10095433 | 3300025917 | Bacteria | 2213 |
| 348 | Ga0207657_10020195 | 3300025919 | Bacteria | 6302 |
| 349 | Ga0207657_10076584 | 3300025919 | Bacteria | 2821 |
| 350 | Ga0207657_10169523 | 3300025919 | Bacteria | 1769 |
| 351 | Ga0207649_10158912 | 3300025920 | Bacteria | 1564 |
| 352 | Ga0207649_10166512 | 3300025920 | Bacteria | 1532 |
| 353 | Ga0207652_10014407 | 3300025921 | Bacteria | 6405 |
| 354 | Ga0207652_10038391 | 3300025921 | Bacteria | 4059 |
| 355 | Ga0207652_10041401 | 3300025921 | Bacteria | 3916 |
| 356 | Ga0207652_10074840 | 3300025921 | Bacteria | 2949 |
| 357 | Ga0207652_10108192 | 3300025921 | Bacteria | 2463 |
| 358 | Ga0207646_10038053 | 3300025922 | Bacteria | 4335 |
| 359 | Ga0207681_10127401 | 3300025923 | Bacteria | 1877 |
| 360 | Ga0207694_10000139 | 3300025924 | Bacteria | 74561 |
| 361 | Ga0207694_10000268 | 3300025924 | Bacteria | 49480 |
| 362 | Ga0207694_10012864 | 3300025924 | Bacteria | 6302 |
| 363 | Ga0207694_10047790 | 3300025924 | Bacteria | 3309 |
| 364 | Ga0207659_10403621 | 3300025926 | Bacteria | 1144 |
| 365 | Ga0207687_10142316 | 3300025927 | Bacteria | 1821 |
| 366 | Ga0207700_10012800 | 3300025928 | Bacteria | 5426 |
| 367 | Ga0207700_10029515 | 3300025928 | Bacteria | 3871 |
| 368 | Ga0207700_10038034 | 3300025928 | Bacteria | 3490 |
| 369 | Ga0207700_10047186 | 3300025928 | Bacteria | 3191 |
| 370 | Ga0207700_10053226 | 3300025928 | Bacteria | 3031 |
| 371 | Ga0207664_10004015 | 3300025929 | Bacteria | 9921 |
| 372 | Ga0207664_10124051 | 3300025929 | Bacteria | 2166 |
| 373 | Ga0207664_10159517 | 3300025929 | Bacteria | 1923 |
| 374 | Ga0207664_10202228 | 3300025929 | Bacteria | 1715 |
| 375 | Ga0207644_10183029 | 3300025931 | Bacteria | 1643 |
| 376 | Ga0207690_10042002 | 3300025932 | Bacteria | 3000 |
| 377 | Ga0207706_10034285 | 3300025933 | Bacteria | 4516 |
| 378 | Ga0207706_10037506 | 3300025933 | Bacteria | 4303 |
| 379 | Ga0207686_10092473 | 3300025934 | Bacteria | 2000 |
| 380 | Ga0207669_10179405 | 3300025937 | Bacteria | 1516 |
| 381 | Ga0207704_10014864 | 3300025938 | Bacteria | 3946 |
| 382 | Ga0207704_10205136 | 3300025938 | Bacteria | 1446 |
| 383 | Ga0207665_10001098 | 3300025939 | Bacteria | 18235 |
| 384 | Ga0207665_10020658 | 3300025939 | Bacteria | 4328 |
| 385 | Ga0207665_10095577 | 3300025939 | Bacteria | 2065 |
| 386 | Ga0207665_10125637 | 3300025939 | Bacteria | 1816 |
| 387 | Ga0207665_10149912 | 3300025939 | Bacteria | 1670 |
| 388 | Ga0207691_10281564 | 3300025940 | Bacteria | 1430 |
| 389 | Ga0207691_10285813 | 3300025940 | Bacteria | 1419 |
| 390 | Ga0207711_10281964 | 3300025941 | Bacteria | 1530 |
| 391 | Ga0207689_10046448 | 3300025942 | Bacteria | 3589 |
| 392 | Ga0207689_10057354 | 3300025942 | Bacteria | 3204 |
| 393 | Ga0207689_10059449 | 3300025942 | Bacteria | 3144 |
| 394 | Ga0207661_10010897 | 3300025944 | Bacteria | 6562 |
| 395 | Ga0207661_10025129 | 3300025944 | Bacteria | 4525 |
| 396 | Ga0207661_10191275 | 3300025944 | Bacteria | 1794 |
| 397 | Ga0207661_10201049 | 3300025944 | Bacteria | 1752 |
| 398 | Ga0207679_10231633 | 3300025945 | Bacteria | 1560 |
| 399 | Ga0207667_10015832 | 3300025949 | Bacteria | 8547 |
| 400 | Ga0207667_10020820 | 3300025949 | Bacteria | 7283 |
| 401 | Ga0207667_10027659 | 3300025949 | Bacteria | 6169 |
| 402 | Ga0207667_10161752 | 3300025949 | Bacteria | 2303 |
| 403 | Ga0207667_10317256 | 3300025949 | Bacteria | 1592 |
| 404 | Ga0207651_10205511 | 3300025960 | Bacteria | 1582 |
| 405 | Ga0207668_10141199 | 3300025972 | Bacteria | 1853 |
| 406 | Ga0207668_10161880 | 3300025972 | Bacteria | 1744 |
| 407 | Ga0207668_10251917 | 3300025972 | Bacteria | 1434 |
| 408 | Ga0207640_10006813 | 3300025981 | Bacteria | 6283 |
| 409 | Ga0207640_10009040 | 3300025981 | Bacteria | 5559 |
| 410 | Ga0207640_10029111 | 3300025981 | Bacteria | 3385 |
| 411 | Ga0207640_10100200 | 3300025981 | Bacteria | 2029 |
| 412 | Ga0207640_10195500 | 3300025981 | Bacteria | 1528 |
| 413 | Ga0207640_10379698 | 3300025981 | Bacteria | 1144 |
| 414 | Ga0207703_10094594 | 3300026035 | Bacteria | 2520 |
| 415 | Ga0207703_10213157 | 3300026035 | Bacteria | 1723 |
| 416 | Ga0207703_10227884 | 3300026035 | Bacteria | 1669 |
| 417 | Ga0207703_10354502 | 3300026035 | Bacteria | 1352 |
| 418 | Ga0207639_10007864 | 3300026041 | Bacteria | 7282 |
| 419 | Ga0207639_10031296 | 3300026041 | Bacteria | 3909 |
| 420 | Ga0207639_10038411 | 3300026041 | Bacteria | 3560 |
| 421 | Ga0207639_10075127 | 3300026041 | Bacteria | 2656 |
| 422 | Ga0207639_10171307 | 3300026041 | Bacteria | 1839 |
| 423 | Ga0207639_10194085 | 3300026041 | Bacteria | 1736 |
| 424 | Ga0207639_10209354 | 3300026041 | Bacteria | 1677 |
| 425 | Ga0207639_10242035 | 3300026041 | Bacteria | 1569 |
| 426 | Ga0207678_10008196 | 3300026067 | Bacteria | 9212 |
| 427 | Ga0207678_10022440 | 3300026067 | Bacteria | 5527 |
| 428 | Ga0207678_10065204 | 3300026067 | Bacteria | 3128 |
| 429 | Ga0207678_10107187 | 3300026067 | Bacteria | 2383 |
| 430 | Ga0207678_10235605 | 3300026067 | Bacteria | 1567 |
| 431 | Ga0207678_10438878 | 3300026067 | Bacteria | 1134 |
| 432 | Ga0207708_10088023 | 3300026075 | Bacteria | 2392 |
| 433 | Ga0207702_10000491 | 3300026078 | Bacteria | 44501 |
| 434 | Ga0207702_10000623 | 3300026078 | Bacteria | 38970 |
| 435 | Ga0207702_10012083 | 3300026078 | Bacteria | 7181 |
| 436 | Ga0207702_10023961 | 3300026078 | Bacteria | 5064 |
| 437 | Ga0207702_10205087 | 3300026078 | Bacteria | 1830 |
| 438 | Ga0207641_10038292 | 3300026088 | Bacteria | 4009 |
| 439 | Ga0207641_10358752 | 3300026088 | Bacteria | 1391 |
| 440 | Ga0207648_10415314 | 3300026089 | Bacteria | 1221 |
| 441 | Ga0207676_10229465 | 3300026095 | Bacteria | 1659 |
| 442 | Ga0207674_10008730 | 3300026116 | Bacteria | 11666 |
| 443 | Ga0207674_10008835 | 3300026116 | Bacteria | 11595 |
| 444 | Ga0207674_10085543 | 3300026116 | Bacteria | 3148 |
| 445 | Ga0207674_10143540 | 3300026116 | Bacteria | 2346 |
| 446 | Ga0207675_100025313 | 3300026118 | Bacteria | 5522 |
| 447 | Ga0207675_100049103 | 3300026118 | Bacteria | 3939 |
| 448 | Ga0207675_100263583 | 3300026118 | Bacteria | 1671 |
| 449 | Ga0207683_10017559 | 3300026121 | Bacteria | 6100 |
| 450 | Ga0207683_10057950 | 3300026121 | Bacteria | 3400 |
| 451 | Ga0207683_10178146 | 3300026121 | Bacteria | 1927 |
| 452 | Ga0207683_10381196 | 3300026121 | Bacteria | 1296 |
| 453 | Ga0207698_10027962 | 3300026142 | Bacteria | 4013 |
| 454 | Ga0207698_10170342 | 3300026142 | Bacteria | 1916 |
| 455 | Ga0209389_1000015 | 3300027296 | Bacteria | 188311 |
| 456 | Ga0209389_1000035 | 3300027296 | Bacteria | 127089 |
| 457 | Ga0209589_1000015 | 3300027357 | Bacteria | 225913 |
| 458 | Ga0209589_1000039 | 3300027357 | Bacteria | 127084 |
| 459 | Ga0209489_100015 | 3300027361 | Bacteria | 225913 |
| 460 | Ga0209489_100072 | 3300027361 | Bacteria | 138111 |
| 461 | Ga0209489_100084 | 3300027361 | Bacteria | 127094 |
| 462 | Ga0209700_100025 | 3300027363 | Bacteria | 225913 |
| 463 | Ga0209700_100034 | 3300027363 | Bacteria | 197276 |
| 464 | Ga0209179_1014575 | 3300027512 | Bacteria | 1446 |
| 465 | Ga0209179_1017579 | 3300027512 | Bacteria | 1357 |
| 466 | Ga0209813_10016710 | 3300027866 | Bacteria | 2006 |
| 467 | Ga0268266_10007778 | 3300028379 | Bacteria | 9611 |
| 468 | Ga0268266_10008893 | 3300028379 | Bacteria | 8891 |
| 469 | Ga0268266_10172700 | 3300028379 | Bacteria | 1962 |
| 470 | Ga0268264_10000107 | 3300028381 | Bacteria | 209105 |
| 471 | Ga0265337_1025017 | 3300028556 | Bacteria | 1820 |
| 472 | Ga0265319_1019294 | 3300028563 | Bacteria | 2548 |
| 473 | Ga0265334_10001242 | 3300028573 | Bacteria | 12451 |
| 474 | Ga0265318_10009393 | 3300028577 | Bacteria | 4302 |
| 475 | Ga0265323_10001035 | 3300028653 | Bacteria | 14454 |
| 476 | Ga0265336_10000363 | 3300028666 | Bacteria | 29266 |
| 477 | Ga0307517_10001780 | 3300028786 | Bacteria | 35475 |
| 478 | Ga0307515_10054512 | 3300028794 | Bacteria | 5868 |
| 479 | Ga0265338_10000155 | 3300028800 | Bacteria | 125121 |
| 480 | Ga0265324_10021334 | 3300029957 | Bacteria | 2323 |
| 481 | Ga0265330_10021950 | 3300031235 | Bacteria | 2909 |
| 482 | Ga0265332_10006675 | 3300031238 | Bacteria | 5226 |
| 483 | Ga0265325_10058919 | 3300031241 | Bacteria | 1954 |
| 484 | Ga0265340_10054987 | 3300031247 | Bacteria | 1918 |
| 485 | Ga0265339_10000326 | 3300031249 | Bacteria | 38178 |
| 486 | Ga0265339_10006252 | 3300031249 | Bacteria | 7840 |
| 487 | Ga0265339_10119973 | 3300031249 | Bacteria | 1353 |
| 488 | Ga0265331_10017323 | 3300031250 | Bacteria | 3762 |
| 489 | Ga0265316_10036469 | 3300031344 | Bacteria | 3976 |
| 490 | Ga0307513_10066655 | 3300031456 | Bacteria | 3781 |
| 491 | Ga0307408_100403235 | 3300031548 | Bacteria | 1175 |
| 492 | Ga0307508_10000088 | 3300031616 | Bacteria | 107883 |
| 493 | Ga0307508_10033626 | 3300031616 | Bacteria | 4628 |
| 494 | Ga0307508_10089914 | 3300031616 | Bacteria | 2656 |
| 495 | Ga0307508_10187216 | 3300031616 | Bacteria | 1672 |
| 496 | Ga0265314_10001992 | 3300031711 | Bacteria | 21668 |
| 497 | Ga0265314_10013803 | 3300031711 | Bacteria | 6506 |
| 498 | Ga0265342_10007871 | 3300031712 | Bacteria | 7736 |
| 499 | Ga0307516_10008774 | 3300031730 | Bacteria | 11362 |
| 500 | Ga0307516_10042852 | 3300031730 | Bacteria | 4487 |
| 501 | Ga0307405_10191561 | 3300031731 | Bacteria | 1477 |
| 502 | Ga0307412_10018506 | 3300031911 | Bacteria | 4194 |
| 503 | Ga0307416_100160220 | 3300032002 | Bacteria | 2079 |
| 504 | Ga0307416_100232550 | 3300032002 | Bacteria | 1778 |
| 505 | Ga0307411_10141884 | 3300032005 | Bacteria | 1772 |
| 506 | Ga0307415_100069402 | 3300032126 | Bacteria | 2471 |
| 507 | Ga0307415_100091856 | 3300032126 | Bacteria | 2200 |
| 508 | Ga0307507_10068020 | 3300033179 | Bacteria | 3253 |
| 509 | Ga0307510_10017889 | 3300033180 | Bacteria | 8351 |
| 510 | Ga0307510_10076564 | 3300033180 | Bacteria | 3290 |
| 511 | Ga0307510_10090387 | 3300033180 | Bacteria | 2909 |
| 512 | Ga0307510_10103456 | 3300033180 | Bacteria | 2625 |
| 513 | Ga0307510_10112752 | 3300033180 | Bacteria | 2455 |
| 514 | Ga0315911_1000021 | 3300033442 | Bacteria | 124874 |
| 515 | Ga0316215_1004766 | 3300033544 | Bacteria | 1302 |
| 516 | Ga0373929_0025195 | 3300035085 | Bacteria | 1234 |
| 517 | Ga0373934_0010050 | 3300035086 | Bacteria | 3552 |
| 518 | Ga0373944_0109761 | 3300035089 | Bacteria | 941 |
| 519 | Ga0373923_0000546 | 3300035111 | Bacteria | 9199 |
| 520 | Ga0373923_0041206 | 3300035111 | Bacteria | 1903 |
| 521 | Ga0373936_0020991 | 3300035113 | Bacteria | 2539 |
| 522 | Ga0373936_0059115 | 3300035113 | Bacteria | 1562 |
| 523 | Ga0373945_0014927 | 3300035116 | Bacteria | 2608 |
| 524 | Ga0373953_0027393 | 3300035117 | Bacteria | 2190 |
| 525 | Ga0373954_0000782 | 3300035118 | Bacteria | 12269 |
| 526 | Ga0373954_0011586 | 3300035118 | Bacteria | 3910 |
| 527 | Ga0373954_0043866 | 3300035118 | Bacteria | 2086 |
| 528 | Ga0373956_0033694 | 3300035119 | Bacteria | 2253 |
| 529 | Ga0373956_0065721 | 3300035119 | Bacteria | 1648 |
| 530 | Ga0373957_0009651 | 3300035120 | Bacteria | 3163 |
| 531 | Ga0373943_0001276 | 3300035170 | Bacteria | 11264 |
| 532 | Ga0373943_0030259 | 3300035170 | Bacteria | 2561 |
| 533 | Ga0373943_0034911 | 3300035170 | Bacteria | 2401 |
| 534 | Ga0373946_0026191 | 3300035171 | Bacteria | 2298 |
| 535 | Ga0373946_0144167 | 3300035171 | Bacteria | 1106 |
| 536 | Ga0373955_0002870 | 3300035172 | Bacteria | 7557 |
| 537 | Ga0373955_0034153 | 3300035172 | Bacteria | 2683 |
| 538 | Ga0373955_0242146 | 3300035172 | Bacteria | 1080 |
| 539 | Ga0373924_0001544 | 3300035410 | Bacteria | 7518 |
| 540 | Ga0373924_0055987 | 3300035410 | Bacteria | 1642 |
| 541 | Ga0373931_0009956 | 3300035691 | Bacteria | 4556 |
| 542 | Ga0373931_0040942 | 3300035691 | Bacteria | 2433 |
| 543 | Ga0373935_0002629 | 3300035692 | Bacteria | 10329 |
| 544 | Ga0373935_0032233 | 3300035692 | Bacteria | 3255 |
| 545 | Ga0373935_0117670 | 3300035692 | Bacteria | 1771 |
| 546 | Ga0373935_0130896 | 3300035692 | Bacteria | 1686 |
| 547 | Ga0373927_0000136 | 3300035695 | Bacteria | 56656 |
| 548 | Ga0373927_0017818 | 3300035695 | Bacteria | 4671 |
| 549 | Ga0373927_0047249 | 3300035695 | Bacteria | 2784 |
| 550 | Ga0373927_0102789 | 3300035695 | Bacteria | 1859 |
| 551 | Ga0373933_0000160 | 3300035724 | Bacteria | 43896 |
| 552 | Ga0373933_0001268 | 3300035724 | Bacteria | 14904 |
| 553 | Ga0373933_0026697 | 3300035724 | Bacteria | 3318 |
| 554 | Ga0373933_0140529 | 3300035724 | Bacteria | 1524 |
| 555 | Ga0373947_0008188 | 3300035725 | Bacteria | 6028 |
| 556 | Ga0373947_0008868 | 3300035725 | Bacteria | 5788 |
| 557 | Ga0373947_0009170 | 3300035725 | Bacteria | 5688 |
| 558 | Ga0373947_0031678 | 3300035725 | Bacteria | 3113 |
| 559 | Ga0373937_0007853 | 3300036401 | Bacteria | 9249 |
| 560 | Ga0373937_0011985 | 3300036401 | Bacteria | 7611 |
| 561 | Ga0373925_0001167 | 3300037068 | Bacteria | 23303 |
| 562 | Ga0373925_0026045 | 3300037068 | Bacteria | 4276 |
| 563 | Ga0373925_0063889 | 3300037068 | Bacteria | 2770 |
| 564 | Ga0373925_0138170 | 3300037068 | Bacteria | 1905 |
| 565 | Ga0395900_0001546 | 3300037418 | Bacteria | 27342 |
| 566 | Ga0395900_0021796 | 3300037418 | Bacteria | 6550 |
| 567 | Ga0395898_0002015 | 3300037466 | Bacteria | 25472 |
| 568 | Ga0395898_0003151 | 3300037466 | Bacteria | 18627 |
| 569 | Ga0395898_0078628 | 3300037466 | Bacteria | 3182 |
| 570 | Ga0395898_0109793 | 3300037466 | Bacteria | 2644 |
| 571 | Ga0395898_0132975 | 3300037466 | Bacteria | 2382 |
| 572 | Ga0395905_0003722 | 3300037471 | Bacteria | 16157 |
| 573 | Ga0395905_0051982 | 3300037471 | Bacteria | 3837 |
| 574 | Ga0395901_0083638 | 3300038443 | Bacteria | 3336 |
| 575 | Ga0436365_0877008 | 3300039437 | Bacteria | 23245 |
| 576 | Ga0436365_1301685 | 3300039437 | Bacteria | 1634 |
| 577 | Ga0436365_1606403 | 3300039437 | Bacteria | 2062 |
| 578 | Ga0436365_1727551 | 3300039437 | Bacteria | 1751 |
| 579 | Ga0436361_0935166 | 3300039447 | Bacteria | 5677 |
| 580 | Ga0436363_0101344 | 3300039450 | Bacteria | 4293 |
| 581 | Ga0436363_0321331 | 3300039450 | Bacteria | 1021 |
| 582 | Ga0436363_0583495 | 3300039450 | Bacteria | 1927 |
| 583 | Ga0436363_1407757 | 3300039450 | Bacteria | 15958 |
| 584 | Ga0436362_1015371 | 3300039453 | Bacteria | 9547 |
| 585 | Ga0466972_0000048 | 3300044658 | Bacteria | 119165 |
| 586 | Ga0466972_0005127 | 3300044658 | Bacteria | 6561 |
| 587 | Ga0466966_0000542 | 3300044684 | Bacteria | 24049 |
| 588 | Ga0466966_0088054 | 3300044684 | Bacteria | 1930 |
| 589 | Ga0466961_0000018 | 3300044693 | Bacteria | 109837 |
| 590 | Ga0466961_0077546 | 3300044693 | Bacteria | 2105 |
| 591 | Ga0466963_0007846 | 3300044694 | Bacteria | 6389 |
| 592 | Ga0466963_0141252 | 3300044694 | Bacteria | 1668 |
| 593 | Ga0466964_0076792 | 3300044706 | Bacteria | 1425 |
| 594 | Ga0466971_0025243 | 3300044719 | Bacteria | 2654 |
| 595 | Ga0466971_0041232 | 3300044719 | Bacteria | 2073 |
| 596 | Ga0466957_0023546 | 3300044842 | Bacteria | 3641 |
| 597 | Ga0466960_0008711 | 3300044901 | Bacteria | 4162 |
| 598 | Ga0466960_0058540 | 3300044901 | Bacteria | 1882 |
| 599 | Ga0466959_0017920 | 3300045049 | Bacteria | 5195 |
| 600 | Ga0466959_0117802 | 3300045049 | Bacteria | 1890 |
| 601 | Ga0466967_0022021 | 3300045976 | Bacteria | 5190 |
| 602 | Ga0466967_0059151 | 3300045976 | Bacteria | 3391 |
| 603 | Ga0466967_0238754 | 3300045976 | Bacteria | 1733 |
| 604 | Ga0466967_0372054 | 3300045976 | Bacteria | 1386 |
| 605 | Ga0495592_0001707 | 3300046454 | Bacteria | 15427 |
| 606 | Ga0495592_0012511 | 3300046454 | Bacteria | 6448 |
| 607 | Ga0495592_0030832 | 3300046454 | Bacteria | 4056 |
| 608 | Ga0495603_0000019 | 3300046455 | Bacteria | 65316 |
| 609 | Ga0495603_0019786 | 3300046455 | Bacteria | 4075 |
| 610 | Ga0495603_0123234 | 3300046455 | Bacteria | 1510 |
| 611 | Ga0495629_0000151 | 3300046459 | Bacteria | 60632 |
| 612 | Ga0495629_0002944 | 3300046459 | Bacteria | 12975 |
| 613 | Ga0495629_0004909 | 3300046459 | Bacteria | 10038 |
| 614 | Ga0495629_0034018 | 3300046459 | Bacteria | 3604 |
| 615 | Ga0495638_0037800 | 3300046460 | Bacteria | 3070 |
| 616 | Ga0495638_0037825 | 3300046460 | Bacteria | 3069 |
| 617 | Ga0495638_0137263 | 3300046460 | Bacteria | 1430 |
| 618 | Ga0495641_0004241 | 3300046461 | Bacteria | 10254 |
| 619 | Ga0495641_0038764 | 3300046461 | Bacteria | 2225 |
| 620 | Ga0495651_0001421 | 3300046462 | Bacteria | 18588 |
| 621 | Ga0495651_0010977 | 3300046462 | Bacteria | 6968 |
| 622 | Ga0495651_0011269 | 3300046462 | Bacteria | 6872 |
| 623 | Ga0495651_0043692 | 3300046462 | Bacteria | 3476 |
| 624 | Ga0495651_0187577 | 3300046462 | Bacteria | 1458 |
| 625 | Ga0495651_0266405 | 3300046462 | Bacteria | 1164 |
| 626 | Ga0495653_0004360 | 3300046463 | Bacteria | 11448 |
| 627 | Ga0495653_0054417 | 3300046463 | Bacteria | 3058 |
| 628 | Ga0495650_0066871 | 3300046471 | Bacteria | 1421 |
| 629 | Ga0495580_0001229 | 3300046472 | Bacteria | 22603 |
| 630 | Ga0495580_0007090 | 3300046472 | Bacteria | 9031 |
| 631 | Ga0495582_0000019 | 3300046473 | Bacteria | 91143 |
| 632 | Ga0495582_0004005 | 3300046473 | Bacteria | 8272 |
| 633 | Ga0495605_0085233 | 3300046474 | Bacteria | 1472 |
| 634 | Ga0495605_0094464 | 3300046474 | Bacteria | 1381 |
| 635 | Ga0495605_0110747 | 3300046474 | Bacteria | 1253 |
| 636 | Ga0495639_0000159 | 3300046475 | Bacteria | 34872 |
| 637 | Ga0495639_0062908 | 3300046475 | Bacteria | 1703 |
| 638 | Ga0495662_0000798 | 3300046476 | Bacteria | 15288 |
| 639 | Ga0495664_0004893 | 3300046477 | Bacteria | 7329 |
| 640 | Ga0495664_0009417 | 3300046477 | Bacteria | 5465 |
| 641 | Ga0495664_0040201 | 3300046477 | Bacteria | 2764 |
| 642 | Ga0495664_0059446 | 3300046477 | Bacteria | 2275 |
| 643 | Ga0495664_0076735 | 3300046477 | Bacteria | 2000 |
| 644 | Ga0495584_0085432 | 3300046491 | Bacteria | 1590 |
| 645 | Ga0495585_0079005 | 3300046492 | Bacteria | 1784 |
| 646 | Ga0495594_0000235 | 3300046499 | Bacteria | 26790 |
| 647 | Ga0495594_0015471 | 3300046499 | Bacteria | 4008 |
| 648 | Ga0495606_0000234 | 3300046507 | Bacteria | 98166 |
| 649 | Ga0495606_0018376 | 3300046507 | Bacteria | 5244 |
| 650 | Ga0495608_0010956 | 3300046511 | Bacteria | 6320 |
| 651 | Ga0495608_0020201 | 3300046511 | Bacteria | 4578 |
| 652 | Ga0495608_0085652 | 3300046511 | Bacteria | 2042 |
| 653 | Ga0495608_0344313 | 3300046511 | Bacteria | 918 |
| 654 | Ga0495610_0061594 | 3300046512 | Bacteria | 1782 |
| 655 | Ga0495616_0020323 | 3300046513 | Bacteria | 3615 |
| 656 | Ga0495618_0033917 | 3300046514 | Bacteria | 3200 |
| 657 | Ga0495620_0063225 | 3300046515 | Bacteria | 1535 |
| 658 | Ga0495628_0016475 | 3300046516 | Bacteria | 6165 |
| 659 | Ga0495628_0034223 | 3300046516 | Bacteria | 4088 |
| 660 | Ga0495628_0232120 | 3300046516 | Bacteria | 1383 |
| 661 | Ga0495630_0008130 | 3300046517 | Bacteria | 7538 |
| 662 | Ga0495630_0036438 | 3300046517 | Bacteria | 3677 |
| 663 | Ga0495630_0090128 | 3300046517 | Bacteria | 2317 |
| 664 | Ga0495648_0001116 | 3300046524 | Bacteria | 27214 |
| 665 | Ga0495648_0008002 | 3300046524 | Bacteria | 8382 |
| 666 | Ga0495648_0028040 | 3300046524 | Bacteria | 3757 |
| 667 | Ga0495648_0032290 | 3300046524 | Bacteria | 3437 |
| 668 | Ga0495666_0015247 | 3300046526 | Bacteria | 3828 |
| 669 | Ga0495652_0013238 | 3300046529 | Bacteria | 7425 |
| 670 | Ga0495652_0031261 | 3300046529 | Bacteria | 4663 |
| 671 | Ga0495652_0032740 | 3300046529 | Bacteria | 4543 |
| 672 | Ga0495652_0052170 | 3300046529 | Bacteria | 3489 |
| 673 | Ga0495665_0000093 | 3300046531 | Bacteria | 40936 |
| 674 | Ga0495665_0063631 | 3300046531 | Bacteria | 1947 |
| 675 | Ga0495640_0005573 | 3300046533 | Bacteria | 10012 |
| 676 | Ga0495640_0030012 | 3300046533 | Bacteria | 3897 |
| 677 | Ga0495640_0053002 | 3300046533 | Bacteria | 2783 |
| 678 | Ga0495640_0244693 | 3300046533 | Bacteria | 1125 |
| 679 | Ga0495586_0029710 | 3300046535 | Bacteria | 2926 |
| 680 | Ga0495587_0002440 | 3300046536 | Bacteria | 12404 |
| 681 | Ga0495598_0004856 | 3300046537 | Bacteria | 2940 |
| 682 | Ga0495609_0068648 | 3300046538 | Bacteria | 1559 |
| 683 | Ga0495621_0142561 | 3300046539 | Bacteria | 938 |
| 684 | Ga0495597_0044137 | 3300046542 | Bacteria | 1983 |
| 685 | Ga0495645_0007006 | 3300046543 | Bacteria | 7838 |
| 686 | Ga0495645_0044063 | 3300046543 | Bacteria | 3254 |
| 687 | Ga0495645_0114078 | 3300046543 | Bacteria | 1910 |
| 688 | Ga0495645_0146194 | 3300046543 | Bacteria | 1646 |
| 689 | Ga0495622_0000571 | 3300046557 | Bacteria | 22078 |
| 690 | Ga0495622_0023862 | 3300046557 | Bacteria | 2853 |
| 691 | Ga0495622_0033105 | 3300046557 | Bacteria | 2413 |
| 692 | Ga0495622_0076309 | 3300046557 | Bacteria | 1544 |
| 693 | Ga0495633_0159353 | 3300046558 | Bacteria | 1041 |
| 694 | Ga0495667_0029704 | 3300046559 | Bacteria | 3678 |
| 695 | Ga0495667_0059712 | 3300046559 | Bacteria | 2502 |
| 696 | Ga0495656_0091876 | 3300046615 | Bacteria | 1389 |
| 697 | Ga0495668_0047773 | 3300046616 | Bacteria | 2376 |
| 698 | Ga0495668_0102905 | 3300046616 | Bacteria | 1562 |
| 699 | Ga0495668_0106360 | 3300046616 | Bacteria | 1535 |
| 700 | Ga0495634_0003979 | 3300046642 | Bacteria | 11723 |
| 701 | Ga0495634_0004199 | 3300046642 | Bacteria | 11374 |
| 702 | Ga0495634_0034102 | 3300046642 | Bacteria | 3494 |
| 703 | Ga0495625_0094667 | 3300046660 | Bacteria | 2060 |
| 704 | Ga0495625_0135023 | 3300046660 | Bacteria | 1668 |
| 705 | Ga0495625_0157229 | 3300046660 | Bacteria | 1525 |
| 706 | Ga0495635_0000322 | 3300046663 | Bacteria | 30913 |
| 707 | Ga0495635_0001817 | 3300046663 | Bacteria | 14418 |
| 708 | Ga0495635_0002995 | 3300046663 | Bacteria | 11592 |
| 709 | Ga0495635_0046009 | 3300046663 | Bacteria | 3010 |
| 710 | Ga0495661_0037219 | 3300046665 | Bacteria | 3039 |
| 711 | Ga0495588_0010061 | 3300046674 | Bacteria | 4385 |
| 712 | Ga0495588_0107436 | 3300046674 | Bacteria | 1469 |
| 713 | Ga0495657_0005003 | 3300046675 | Bacteria | 10533 |
| 714 | Ga0495657_0008039 | 3300046675 | Bacteria | 8087 |
| 715 | Ga0495657_0041298 | 3300046675 | Bacteria | 3157 |
| 716 | Ga0495657_0184582 | 3300046675 | Bacteria | 1278 |
| 717 | Ga0495599_0010948 | 3300046678 | Bacteria | 5562 |
| 718 | Ga0495599_0014770 | 3300046678 | Bacteria | 4834 |
| 719 | Ga0495599_0068418 | 3300046678 | Bacteria | 2217 |
| 720 | Ga0495599_0081125 | 3300046678 | Bacteria | 2026 |
| 721 | Ga0495623_0003342 | 3300046679 | Bacteria | 10604 |
| 722 | Ga0495623_0003554 | 3300046679 | Bacteria | 10313 |
| 723 | Ga0495623_0072456 | 3300046679 | Bacteria | 2142 |
| 724 | Ga0495623_0075559 | 3300046679 | Bacteria | 2092 |
| 725 | Ga0495646_0008241 | 3300046680 | Bacteria | 6626 |
| 726 | Ga0495646_0070591 | 3300046680 | Bacteria | 2057 |
| 727 | Ga0495647_0000250 | 3300046681 | Bacteria | 14710 |
| 728 | Ga0495658_0000054 | 3300046683 | Bacteria | 57414 |
| 729 | Ga0495658_0023308 | 3300046683 | Bacteria | 3285 |
| 730 | Ga0495658_0110449 | 3300046683 | Bacteria | 1653 |
| 731 | Ga0495669_0014235 | 3300046684 | Bacteria | 3401 |
| 732 | Ga0495669_0082900 | 3300046684 | Bacteria | 1473 |
| 733 | Ga0495613_0002331 | 3300046689 | Bacteria | 14372 |
| 734 | Ga0495613_0085459 | 3300046689 | Bacteria | 2289 |
| 735 | Ga0495624_0007986 | 3300046690 | Bacteria | 7417 |
| 736 | Ga0495624_0035811 | 3300046690 | Bacteria | 3203 |
| 737 | Ga0495671_0057594 | 3300046692 | Bacteria | 1923 |
| 738 | Ga0495589_0118225 | 3300046794 | Bacteria | 1277 |
| 739 | Ga0495600_0001578 | 3300046809 | Bacteria | 12679 |
| 740 | Ga0495600_0003823 | 3300046809 | Bacteria | 8919 |
| 741 | Ga0495600_0006664 | 3300046809 | Bacteria | 7038 |
| 742 | Ga0495581_0000247 | 3300047315 | Bacteria | 25790 |
| 743 | Ga0495581_0044765 | 3300047315 | Bacteria | 2559 |
| 744 | Ga0495581_0070132 | 3300047315 | Bacteria | 2027 |
| 745 | Ga0495581_0136570 | 3300047315 | Bacteria | 1429 |
| 746 | Ga0495604_0001719 | 3300047317 | Bacteria | 17960 |
| 747 | Ga0495604_0004125 | 3300047317 | Bacteria | 11539 |
| 748 | Ga0495604_0063355 | 3300047317 | Bacteria | 2820 |
| 749 | Ga0495604_0148477 | 3300047317 | Bacteria | 1668 |
| 750 | Ga0495636_0103829 | 3300047318 | Bacteria | 1245 |
| 751 | Ga0495674_0000871 | 3300047319 | Bacteria | 28857 |
| 752 | Ga0495674_0107558 | 3300047319 | Bacteria | 2367 |
| 753 | Ga0495674_0186365 | 3300047319 | Bacteria | 1726 |
| 754 | Ga0495672_0018857 | 3300047320 | Bacteria | 4570 |
| 755 | Ga0495672_0095558 | 3300047320 | Bacteria | 1622 |
| 756 | Ga0495676_0041253 | 3300047321 | Bacteria | 3801 |
| 757 | Ga0495676_0131114 | 3300047321 | Bacteria | 1809 |
| 758 | Ga0495680_0006451 | 3300047322 | Bacteria | 10899 |
| 759 | Ga0495680_0007673 | 3300047322 | Bacteria | 9850 |
| 760 | Ga0495680_0164774 | 3300047322 | Bacteria | 1608 |
| 761 | Ga0495683_0073925 | 3300047323 | Bacteria | 1671 |
| 762 | Ga0495687_012431 | 3300047443 | Bacteria | 4502 |
| 763 | Ga0495675_0005025 | 3300047444 | Bacteria | 8045 |
| 764 | Ga0495675_0005708 | 3300047444 | Bacteria | 7610 |
| 765 | Ga0495675_0178501 | 3300047444 | Bacteria | 1301 |
| 766 | Ga0495685_038131 | 3300047447 | Bacteria | 1647 |
| 767 | Ga0495681_0053640 | 3300047470 | Bacteria | 1887 |
| 768 | Ga0495681_0114680 | 3300047470 | Bacteria | 1163 |
| 769 | Ga0495684_0001840 | 3300047471 | Bacteria | 17040 |
| 770 | Ga0495684_0024950 | 3300047471 | Bacteria | 4598 |
| 771 | Ga0495684_0041304 | 3300047471 | Bacteria | 3534 |
| 772 | Ga0495684_0211558 | 3300047471 | Bacteria | 1426 |
| 773 | Ga0495686_0053491 | 3300047472 | Bacteria | 2530 |
| 774 | Ga0495686_0069667 | 3300047472 | Bacteria | 2168 |
| 775 | Ga0495686_0071333 | 3300047472 | Bacteria | 2138 |
| 776 | Ga0495686_0093652 | 3300047472 | Bacteria | 1821 |
| 777 | Ga0495686_0093920 | 3300047472 | Bacteria | 1818 |
| 778 | Ga0495593_0000063 | 3300047673 | Bacteria | 45066 |
| 779 | Ga0495593_0002843 | 3300047673 | Bacteria | 10428 |
| 780 | Ga0495593_0090543 | 3300047673 | Bacteria | 1576 |
| 781 | Ga0495602_0009382 | 3300048088 | Bacteria | 10180 |
| 782 | Ga0495602_0016924 | 3300048088 | Bacteria | 7316 |
| 783 | Ga0495602_0051263 | 3300048088 | Bacteria | 3677 |
| 784 | Ga0495626_0037089 | 3300048091 | Bacteria | 2318 |
| 785 | Ga0496100_0040777 | 3300048903 | Bacteria | 2956 |
| 786 | Ga0496100_0048959 | 3300048903 | Bacteria | 2730 |
| 787 | Ga0496100_0091951 | 3300048903 | Bacteria | 2072 |
| 788 | Ga0496101_0007477 | 3300048904 | Bacteria | 7082 |
| 789 | Ga0496101_0033278 | 3300048904 | Bacteria | 3634 |
| 790 | Ga0496101_0042350 | 3300048904 | Bacteria | 3250 |
| 791 | Ga0496101_0160283 | 3300048904 | Bacteria | 1725 |
| 792 | Ga0496102_0001177 | 3300048905 | Bacteria | 23840 |
| 793 | Ga0496102_0015035 | 3300048905 | Bacteria | 6736 |
| 794 | Ga0496102_0035246 | 3300048905 | Bacteria | 4503 |
| 795 | Ga0496102_0182525 | 3300048905 | Bacteria | 1977 |
| 796 | Ga0496102_0298131 | 3300048905 | Bacteria | 1519 |
| 797 | Ga0496103_0214465 | 3300048906 | Bacteria | 1238 |
| 798 | Ga0496103_0233707 | 3300048906 | Bacteria | 1183 |
| 799 | Ga0496104_0008588 | 3300048907 | Bacteria | 9085 |
| 800 | Ga0496104_0009097 | 3300048907 | Bacteria | 8834 |
| 801 | Ga0496104_0021540 | 3300048907 | Bacteria | 5919 |
| 802 | Ga0496104_0024076 | 3300048907 | Bacteria | 5602 |
| 803 | Ga0496104_0103423 | 3300048907 | Bacteria | 2728 |
| 804 | Ga0496104_0104398 | 3300048907 | Bacteria | 2715 |
| 805 | Ga0496104_0120288 | 3300048907 | Bacteria | 2521 |
| 806 | Ga0496105_0021408 | 3300048908 | Bacteria | 5232 |
| 807 | Ga0496105_0022649 | 3300048908 | Bacteria | 5089 |
| 808 | Ga0496105_0048912 | 3300048908 | Bacteria | 3490 |
| 809 | Ga0496105_0070475 | 3300048908 | Bacteria | 2890 |
| 810 | Ga0496106_0001271 | 3300048909 | Bacteria | 18905 |
| 811 | Ga0496106_0030896 | 3300048909 | Bacteria | 3993 |
| 812 | Ga0496106_0037087 | 3300048909 | Bacteria | 3646 |
| 813 | Ga0496106_0348566 | 3300048909 | Bacteria | 1189 |
| 814 | Ga0496107_0025796 | 3300048910 | Bacteria | 4164 |
| 815 | Ga0496107_0026598 | 3300048910 | Bacteria | 4102 |
| 816 | Ga0496107_0035617 | 3300048910 | Bacteria | 3568 |
| 817 | Ga0496108_0000507 | 3300048911 | Bacteria | 30629 |
| 818 | Ga0496108_0017223 | 3300048911 | Bacteria | 5911 |
| 819 | Ga0496108_0030002 | 3300048911 | Bacteria | 4507 |
| 820 | Ga0496108_0041867 | 3300048911 | Bacteria | 3824 |
| 821 | Ga0496108_0042694 | 3300048911 | Bacteria | 3786 |
| 822 | Ga0496108_0170617 | 3300048911 | Bacteria | 1882 |
| 823 | Ga0496108_0181261 | 3300048911 | Bacteria | 1824 |
| 824 | Ga0496109_0008835 | 3300048912 | Bacteria | 8579 |
| 825 | Ga0496109_0015980 | 3300048912 | Bacteria | 6558 |
| 826 | Ga0496109_0024123 | 3300048912 | Bacteria | 5404 |
| 827 | Ga0496109_0077384 | 3300048912 | Bacteria | 3061 |
| 828 | Ga0496109_0361566 | 3300048912 | Bacteria | 1371 |
| 829 | Ga0496110_0002891 | 3300048913 | Bacteria | 12991 |
| 830 | Ga0496110_0014981 | 3300048913 | Bacteria | 6446 |
| 831 | Ga0496110_0120504 | 3300048913 | Bacteria | 2363 |
| 832 | Ga0496110_0131722 | 3300048913 | Bacteria | 2258 |
| 833 | Ga0496110_0199167 | 3300048913 | Bacteria | 1819 |
| 834 | Ga0496110_0408864 | 3300048913 | Bacteria | 1237 |
| 835 | Ga0496111_0013376 | 3300048914 | Bacteria | 5582 |
| 836 | Ga0496111_0035880 | 3300048914 | Bacteria | 3545 |
| 837 | Ga0496111_0047402 | 3300048914 | Bacteria | 3095 |
| 838 | Ga0496111_0053924 | 3300048914 | Bacteria | 2905 |
| 839 | Ga0496111_0372141 | 3300048914 | Bacteria | 1057 |
| 840 | Ga0496112_0000051 | 3300048915 | Bacteria | 82351 |
| 841 | Ga0496112_0007653 | 3300048915 | Bacteria | 9607 |
| 842 | Ga0496112_0018304 | 3300048915 | Bacteria | 6594 |
| 843 | Ga0496112_0027083 | 3300048915 | Bacteria | 5525 |
| 844 | Ga0496112_0046746 | 3300048915 | Bacteria | 4246 |
| 845 | Ga0496112_0069445 | 3300048915 | Bacteria | 3480 |
| 846 | Ga0496112_0145021 | 3300048915 | Bacteria | 2342 |
| 847 | Ga0496112_0410985 | 3300048915 | Bacteria | 1292 |
| 848 | Ga0496113_0019566 | 3300048916 | Bacteria | 4739 |
| 849 | Ga0496113_0063378 | 3300048916 | Bacteria | 2793 |
| 850 | Ga0496113_0081284 | 3300048916 | Bacteria | 2483 |
| 851 | Ga0496113_0316421 | 3300048916 | Bacteria | 1251 |
| 852 | Ga0496114_0036732 | 3300048917 | Bacteria | 4050 |
| 853 | Ga0496114_0081821 | 3300048917 | Bacteria | 2728 |
| 854 | Ga0496115_0003395 | 3300048918 | Bacteria | 11436 |
| 855 | Ga0496115_0017793 | 3300048918 | Bacteria | 5442 |
| 856 | Ga0496115_0070407 | 3300048918 | Bacteria | 2835 |
| 857 | Ga0496115_0114485 | 3300048918 | Bacteria | 2217 |
| 858 | Ga0496115_0154044 | 3300048918 | Bacteria | 1898 |
| 859 | Ga0496115_0344973 | 3300048918 | Bacteria | 1215 |
| 860 | Ga0496116_0020888 | 3300048919 | Bacteria | 4955 |
| 861 | Ga0496116_0080857 | 3300048919 | Bacteria | 2017 |
| 862 | Ga0496117_0022107 | 3300048920 | Bacteria | 5110 |
| 863 | Ga0496117_0076968 | 3300048920 | Bacteria | 2209 |
| 864 | Ga0496117_0079592 | 3300048920 | Bacteria | 2158 |
| 865 | Ga0496118_0028837 | 3300048921 | Bacteria | 4666 |
| 866 | Ga0496118_0032916 | 3300048921 | Bacteria | 4261 |
| 867 | Ga0496118_0045268 | 3300048921 | Bacteria | 3437 |
| 868 | Ga0496118_0292353 | 3300048921 | Bacteria | 900 |
| 869 | Ga0496119_0020199 | 3300048922 | Bacteria | 4866 |
| 870 | Ga0496119_0033954 | 3300048922 | Bacteria | 3370 |
| 871 | Ga0496120_0016606 | 3300048923 | Bacteria | 4807 |
| 872 | Ga0496120_0030057 | 3300048923 | Bacteria | 3308 |
| 873 | Ga0496120_0105296 | 3300048923 | Bacteria | 1483 |
| 874 | Ga0496120_0116144 | 3300048923 | Bacteria | 1390 |
| 875 | Ga0496121_0000091 | 3300048924 | Bacteria | 216685 |
| 876 | Ga0496121_0000451 | 3300048924 | Bacteria | 80840 |
| 877 | Ga0496121_0004071 | 3300048924 | Bacteria | 20076 |
| 878 | Ga0496121_0004123 | 3300048924 | Bacteria | 19914 |
| 879 | Ga0496121_0007759 | 3300048924 | Bacteria | 12856 |
| 880 | Ga0496121_0064130 | 3300048924 | Bacteria | 2997 |
| 881 | Ga0496121_0072706 | 3300048924 | Bacteria | 2760 |
| 882 | Ga0496121_0079491 | 3300048924 | Bacteria | 2603 |
| 883 | Ga0496121_0115304 | 3300048924 | Bacteria | 2040 |
| 884 | Ga0496121_0119263 | 3300048924 | Bacteria | 1995 |
| 885 | Ga0496121_0133285 | 3300048924 | Bacteria | 1855 |
| 886 | Ga0496121_0137565 | 3300048924 | Bacteria | 1817 |
| 887 | Ga0496121_0191703 | 3300048924 | Bacteria | 1465 |
| 888 | Ga0496121_0321646 | 3300048924 | Bacteria | 1041 |
| 889 | Ga0496122_0014770 | 3300048925 | Bacteria | 7527 |
| 890 | Ga0496122_0073007 | 3300048925 | Bacteria | 2436 |
| 891 | Ga0496122_0125829 | 3300048925 | Bacteria | 1641 |
| 892 | Ga0496123_0056676 | 3300048926 | Bacteria | 2558 |
| 893 | Ga0496124_0002796 | 3300048927 | Bacteria | 22105 |
| 894 | Ga0496124_0048273 | 3300048927 | Bacteria | 3639 |
| 895 | Ga0496124_0056207 | 3300048927 | Bacteria | 3320 |
| 896 | Ga0496124_0075008 | 3300048927 | Bacteria | 2795 |
| 897 | Ga0496124_0100870 | 3300048927 | Bacteria | 2339 |
| 898 | Ga0496124_0188417 | 3300048927 | Bacteria | 1581 |
| 899 | Ga0496125_0000099 | 3300048928 | Bacteria | 203333 |
| 900 | Ga0496125_0001377 | 3300048928 | Bacteria | 35705 |
| 901 | Ga0496125_0004112 | 3300048928 | Bacteria | 16995 |
| 902 | Ga0496125_0015326 | 3300048928 | Bacteria | 7419 |
| 903 | Ga0496125_0040920 | 3300048928 | Bacteria | 3968 |
| 904 | Ga0496125_0068010 | 3300048928 | Bacteria | 2804 |
| 905 | Ga0496125_0162615 | 3300048928 | Bacteria | 1513 |
| 906 | Ga0496126_0002876 | 3300048929 | Bacteria | 22465 |
| 907 | Ga0496126_0007845 | 3300048929 | Bacteria | 11635 |
| 908 | Ga0496126_0013193 | 3300048929 | Bacteria | 8428 |
| 909 | Ga0496126_0023656 | 3300048929 | Bacteria | 5950 |
| 910 | Ga0496126_0027035 | 3300048929 | Bacteria | 5489 |
| 911 | Ga0496126_0032694 | 3300048929 | Bacteria | 4898 |
| 912 | Ga0496126_0033644 | 3300048929 | Bacteria | 4820 |
| 913 | Ga0496126_0053184 | 3300048929 | Bacteria | 3675 |
| 914 | Ga0496126_0078080 | 3300048929 | Bacteria | 2934 |
| 915 | Ga0496126_0092750 | 3300048929 | Bacteria | 2653 |
| 916 | Ga0496126_0094056 | 3300048929 | Bacteria | 2631 |
| 917 | Ga0496126_0178353 | 3300048929 | Bacteria | 1806 |
| 918 | Ga0496126_0195423 | 3300048929 | Bacteria | 1711 |
| 919 | Ga0496126_0291947 | 3300048929 | Bacteria | 1348 |
| 920 | Ga0496126_0341069 | 3300048929 | Bacteria | 1227 |
| 921 | Ga0496126_0351053 | 3300048929 | Bacteria | 1206 |
| 922 | Ga0495682_0033394 | 3300049460 | Bacteria | 1899 |
| 923 | Ga0501031_0002180 | 3300049568 | Bacteria | 12363 |
| 924 | Ga0501031_0027770 | 3300049568 | Bacteria | 3689 |
| 925 | Ga0501032_0000136 | 3300049569 | Bacteria | 59896 |
| 926 | Ga0501032_0047408 | 3300049569 | Bacteria | 2901 |
| 927 | Ga0501032_0097504 | 3300049569 | Bacteria | 1948 |
| 928 | Ga0501032_0190178 | 3300049569 | Bacteria | 1342 |
| 929 | Ga0501033_0000202 | 3300049570 | Bacteria | 57109 |
| 930 | Ga0501033_0006530 | 3300049570 | Bacteria | 9124 |
| 931 | Ga0501033_0070751 | 3300049570 | Bacteria | 2563 |
| 932 | Ga0501034_0000113 | 3300049571 | Bacteria | 149824 |
| 933 | Ga0501034_0165791 | 3300049571 | Bacteria | 2178 |
| 934 | Ga0501036_0000059 | 3300049572 | Bacteria | 72347 |
| 935 | Ga0501036_0062741 | 3300049572 | Bacteria | 3147 |
| 936 | Ga0501036_0181833 | 3300049572 | Bacteria | 1770 |
| 937 | Ga0501036_0199024 | 3300049572 | Bacteria | 1685 |
| 938 | Ga0501037_0000214 | 3300049573 | Bacteria | 51638 |
| 939 | Ga0501037_0010785 | 3300049573 | Bacteria | 6716 |
| 940 | Ga0501038_0001243 | 3300049574 | Bacteria | 23113 |
| 941 | Ga0501038_0002129 | 3300049574 | Bacteria | 18373 |
| 942 | Ga0501038_0002810 | 3300049574 | Bacteria | 16214 |
| 943 | Ga0501038_0215636 | 3300049574 | Bacteria | 1534 |
| 944 | Ga0501039_0036146 | 3300049575 | Bacteria | 3811 |
| 945 | Ga0501039_0074470 | 3300049575 | Bacteria | 2638 |
| 946 | Ga0501039_0114143 | 3300049575 | Bacteria | 2113 |
| 947 | Ga0501039_0239346 | 3300049575 | Bacteria | 1427 |
| 948 | Ga0501039_0270543 | 3300049575 | Bacteria | 1335 |
| 949 | Ga0501043_0000017 | 3300049579 | Bacteria | 166630 |
| 950 | Ga0501043_0018948 | 3300049579 | Bacteria | 5401 |
| 951 | Ga0501043_0033269 | 3300049579 | Bacteria | 4055 |
| 952 | Ga0501043_0059965 | 3300049579 | Bacteria | 2986 |
| 953 | Ga0501043_0197084 | 3300049579 | Bacteria | 1564 |
| 954 | Ga0501046_0000174 | 3300049580 | Bacteria | 65566 |
| 955 | Ga0501046_0169447 | 3300049580 | Bacteria | 1639 |
| 956 | Ga0501047_0000044 | 3300049581 | Bacteria | 174789 |
| 957 | Ga0501047_0036235 | 3300049581 | Bacteria | 4767 |
| 958 | Ga0501047_0199396 | 3300049581 | Bacteria | 1862 |
| 959 | Ga0501047_0508402 | 3300049581 | Bacteria | 1031 |
| 960 | Ga0501048_0000837 | 3300049582 | Bacteria | 22705 |
| 961 | Ga0501048_0019094 | 3300049582 | Bacteria | 5035 |
| 962 | Ga0501067_0003781 | 3300049583 | Bacteria | 8344 |
| 963 | Ga0501067_0012443 | 3300049583 | Bacteria | 4720 |
| 964 | Ga0501068_0000629 | 3300049584 | Bacteria | 17991 |
| 965 | Ga0501068_0021249 | 3300049584 | Bacteria | 3788 |
| 966 | Ga0501069_0016580 | 3300049585 | Bacteria | 3959 |
| 967 | Ga0501069_0031229 | 3300049585 | Bacteria | 2928 |
| 968 | Ga0501070_0024300 | 3300049586 | Bacteria | 5082 |
| 969 | Ga0501070_0030735 | 3300049586 | Bacteria | 4498 |
| 970 | Ga0501070_0100759 | 3300049586 | Bacteria | 2389 |
| 971 | Ga0501070_0149135 | 3300049586 | Bacteria | 1930 |
| 972 | Ga0501070_0187188 | 3300049586 | Bacteria | 1703 |
| 973 | Ga0501070_0267606 | 3300049586 | Bacteria | 1396 |
| 974 | Ga0501070_0286940 | 3300049586 | Bacteria | 1342 |
| 975 | Ga0501071_0034192 | 3300049587 | Bacteria | 3616 |
| 976 | Ga0501072_0025631 | 3300049588 | Bacteria | 4593 |
| 977 | Ga0501072_0226773 | 3300049588 | Bacteria | 1488 |
| 978 | Ga0501073_0000069 | 3300049589 | Bacteria | 63198 |
| 979 | Ga0501074_0000507 | 3300049590 | Bacteria | 23842 |
| 980 | Ga0501074_0004738 | 3300049590 | Bacteria | 9749 |
| 981 | Ga0501074_0012661 | 3300049590 | Bacteria | 6135 |
| 982 | Ga0501075_0154652 | 3300049591 | Bacteria | 1749 |
| 983 | Ga0501076_0143975 | 3300049592 | Bacteria | 1937 |
| 984 | Ga0501077_0097333 | 3300049593 | Bacteria | 1865 |
| 985 | Ga0501079_0012649 | 3300049741 | Bacteria | 6446 |
| 986 | Ga0501080_0000613 | 3300049742 | Bacteria | 28256 |
| 987 | Ga0501080_0096116 | 3300049742 | Bacteria | 2750 |
| 988 | Ga0501083_0000838 | 3300049744 | Bacteria | 20228 |
| 989 | Ga0501083_0005759 | 3300049744 | Bacteria | 8767 |
| 990 | Ga0501035_0000393 | 3300049822 | Bacteria | 49959 |
| 991 | Ga0501035_0069498 | 3300049822 | Bacteria | 3121 |
| 992 | Ga0501035_0196089 | 3300049822 | Bacteria | 1735 |
| 993 | Ga0501035_0197410 | 3300049822 | Bacteria | 1727 |
| 994 | Ga0501044_0000108 | 3300049823 | Bacteria | 100968 |
| 995 | Ga0501044_0054727 | 3300049823 | Bacteria | 4100 |
| 996 | Ga0501044_0056673 | 3300049823 | Bacteria | 4023 |
| 997 | Ga0501044_0083357 | 3300049823 | Bacteria | 3233 |
| 998 | Ga0501044_0108063 | 3300049823 | Bacteria | 2792 |
| 999 | Ga0501044_0260936 | 3300049823 | Bacteria | 1671 |
| 1000 | Ga0501045_0003166 | 3300049824 | Bacteria | 11244 |
| 1001 | Ga0501045_0210214 | 3300049824 | Bacteria | 1449 |
| 1002 | Ga0501045_0292267 | 3300049824 | Bacteria | 1213 |
| 1003 | nmdc:mga03683_82564_c1 | 3300050489 | Bacteria | 1390 |
| 1004 | nmdc:mga03n38_15385_c1 | 3300050490 | Bacteria | 2953 |
| 1005 | nmdc:mga03n38_25648_c1 | 3300050490 | Bacteria | 2424 |
| 1006 | nmdc:mga00v17_136747_c1 | 3300050491 | Bacteria | 1569 |
| 1007 | nmdc:mga0yw44_187613_c1 | 3300050492 | Bacteria | 1363 |
| 1008 | nmdc:mga0yw44_30927_c1 | 3300050492 | Bacteria | 3109 |
| 1009 | nmdc:mga0yw44_8056_c1 | 3300050492 | Bacteria | 5226 |
| 1010 | nmdc:mga0yw44_87129_c1 | 3300050492 | Bacteria | 1968 |
| 1011 | nmdc:mga0k408_73151_c1 | 3300050493 | Bacteria | 2002 |
| 1012 | nmdc:mga06z11_152157_c1 | 3300050494 | Bacteria | 1316 |
| 1013 | nmdc:mga06z11_19961_c1 | 3300050494 | Bacteria | 3090 |
| 1014 | nmdc:mga04h51_14481_c1 | 3300050495 | Bacteria | 2254 |
| 1015 | nmdc:mga07m45_144408_c1 | 3300050496 | Bacteria | 1379 |
| 1016 | nmdc:mga07m45_31507_c1 | 3300050496 | Bacteria | 2939 |
| 1017 | nmdc:mga07m45_35943_c1 | 3300050496 | Bacteria | 2757 |
| 1018 | nmdc:mga07m45_88026_c1 | 3300050496 | Bacteria | 1777 |
| 1019 | nmdc:mga05p37_197856_c1 | 3300050507 | Bacteria | 2436 |
| 1020 | nmdc:mga08y16_669221_c1 | 3300050511 | Bacteria | 1040 |
| 1021 | nmdc:mga0rr50_65960_c1 | 3300050513 | Bacteria | 2744 |
| 1022 | nmdc:mga0sz30_173256_c1 | 3300050516 | Bacteria | 957 |
| 1023 | nmdc:mga0sz30_18533_c1 | 3300050516 | Bacteria | 2787 |
| 1024 | Ga0495601_0035637 | 3300053077 | Bacteria | 3107 |
| 1025 | Ga0500635_0004703 | 3300053080 | Bacteria | 3531 |
| 1026 | Ga0495655_0009258 | 3300053083 | Bacteria | 1903 |
| 1027 | Ga0495655_0030609 | 3300053083 | Bacteria | 1303 |
| 1028 | Ga0495595_0004533 | 3300053084 | Bacteria | 5589 |
| 1029 | Ga0495595_0013998 | 3300053084 | Bacteria | 3396 |
| 1030 | Ga0495619_0001285 | 3300053085 | Bacteria | 16486 |
| 1031 | Ga0495619_0021537 | 3300053085 | Bacteria | 4117 |
| 1032 | Ga0495619_0027673 | 3300053085 | Bacteria | 3654 |
| 1033 | Ga0495619_0030366 | 3300053085 | Bacteria | 3499 |
| 1034 | Ga0500643_000517 | 3300053087 | Bacteria | 27366 |
| 1035 | Ga0500643_019874 | 3300053087 | Bacteria | 2206 |
| 1036 | Ga0500647_0002370 | 3300053091 | Bacteria | 6991 |
| 1037 | Ga0500647_0011549 | 3300053091 | Bacteria | 3949 |
| 1038 | Ga0500651_0111545 | 3300053093 | Bacteria | 1668 |
| 1039 | Ga0500651_0190199 | 3300053093 | Bacteria | 1215 |
| 1040 | Ga0500566_0000470 | 3300053094 | Bacteria | 22447 |
| 1041 | Ga0500566_0000491 | 3300053094 | Bacteria | 22023 |
| 1042 | Ga0500566_0001030 | 3300053094 | Bacteria | 16089 |
| 1043 | Ga0500566_0006845 | 3300053094 | Bacteria | 6749 |
| 1044 | Ga0500640_073975 | 3300053095 | Bacteria | 1457 |
| 1045 | Ga0500640_082273 | 3300053095 | Bacteria | 1363 |
| 1046 | Ga0500641_0035129 | 3300053096 | Bacteria | 1998 |
| 1047 | Ga0500650_0002265 | 3300053098 | Bacteria | 6261 |
| 1048 | Ga0500555_001517 | 3300053103 | Bacteria | 7030 |
| 1049 | Ga0500556_0000005 | 3300053104 | Bacteria | 581135 |
| 1050 | Ga0500556_0015602 | 3300053104 | Bacteria | 2347 |
| 1051 | Ga0500557_000019 | 3300053105 | Bacteria | 93216 |
| 1052 | Ga0500562_004121 | 3300053108 | Bacteria | 3664 |
| 1053 | Ga0500562_038472 | 3300053108 | Bacteria | 1270 |
| 1054 | Ga0500569_003665 | 3300053109 | Bacteria | 3167 |
| 1055 | Ga0500569_036979 | 3300053109 | Bacteria | 1408 |
| 1056 | Ga0500572_000144 | 3300053111 | Bacteria | 24401 |
| 1057 | Ga0500572_008726 | 3300053111 | Bacteria | 2377 |
| 1058 | Ga0500595_014574 | 3300053119 | Bacteria | 2979 |
| 1059 | Ga0500595_047421 | 3300053119 | Bacteria | 1346 |
| 1060 | Ga0500607_096979 | 3300053121 | Bacteria | 1472 |
| 1061 | Ga0500607_104804 | 3300053121 | Bacteria | 1397 |
| 1062 | Ga0500608_000126 | 3300053122 | Bacteria | 31144 |
| 1063 | Ga0500608_020655 | 3300053122 | Bacteria | 3032 |
| 1064 | Ga0500618_013409 | 3300053125 | Bacteria | 2117 |
| 1065 | Ga0500642_0000009 | 3300053130 | Bacteria | 286829 |
| 1066 | Ga0500642_0000835 | 3300053130 | Bacteria | 8983 |
| 1067 | Ga0500652_000259 | 3300053131 | Bacteria | 19823 |
| 1068 | Ga0500559_0000222 | 3300053136 | Bacteria | 45603 |
| 1069 | Ga0500559_0000386 | 3300053136 | Bacteria | 32337 |
| 1070 | Ga0500568_0003199 | 3300053139 | Bacteria | 9308 |
| 1071 | Ga0500568_0093125 | 3300053139 | Bacteria | 1135 |
| 1072 | Ga0500573_0048305 | 3300053140 | Bacteria | 2449 |
| 1073 | Ga0500586_000081 | 3300053145 | Bacteria | 16471 |
| 1074 | Ga0500590_013765 | 3300053148 | Bacteria | 4157 |
| 1075 | Ga0500590_031683 | 3300053148 | Bacteria | 2742 |
| 1076 | Ga0500590_109997 | 3300053148 | Bacteria | 1309 |
| 1077 | Ga0500603_000143 | 3300053150 | Bacteria | 17272 |
| 1078 | Ga0500603_004087 | 3300053150 | Bacteria | 3123 |
| 1079 | Ga0500604_0005397 | 3300053151 | Bacteria | 3375 |
| 1080 | Ga0500616_0000035 | 3300053153 | Bacteria | 394242 |
| 1081 | Ga0500616_0026411 | 3300053153 | Bacteria | 3214 |
| 1082 | Ga0500622_0000355 | 3300053156 | Bacteria | 44648 |
| 1083 | Ga0500638_000229 | 3300053162 | Bacteria | 11997 |
| 1084 | Ga0500638_056822 | 3300053162 | Bacteria | 1885 |
| 1085 | Ga0500639_005961 | 3300053163 | Bacteria | 6271 |
| 1086 | Ga0500639_013425 | 3300053163 | Bacteria | 4308 |
| 1087 | Ga0500636_0000168 | 3300053177 | Bacteria | 34492 |
| 1088 | Ga0500636_0012018 | 3300053177 | Bacteria | 5071 |
| 1089 | Ga0500636_0029876 | 3300053177 | Bacteria | 3221 |
| 1090 | Ga0500637_0000134 | 3300053178 | Bacteria | 27110 |
| 1091 | Ga0500637_0010521 | 3300053178 | Bacteria | 4745 |
| 1092 | Ga0500649_024644 | 3300053722 | Bacteria | 2483 |
| 1093 | Ga0500625_022425 | 3300053729 | Bacteria | 2981 |
| 1094 | Ga0500645_025680 | 3300053730 | Bacteria | 1797 |
| 1095 | Ga0500596_001188 | 3300053735 | Bacteria | 5257 |
| 1096 | Ga0501084_0012311 | 3300054114 | Bacteria | 7084 |
| 1097 | Ga0501084_0036311 | 3300054114 | Bacteria | 4116 |
| 1098 | Ga0500661_000037 | 3300055283 | Bacteria | 19843 |
| 1099 | Ga0501082_0029005 | 3300060353 | Bacteria | 4767 |
| 1100 | Ga0501082_0070850 | 3300060353 | Bacteria | 3001 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049579 | Ga0501043_0033269 | Ga0501043_0033269_3230_4045 | 270 |
| 2 | 3300039450 | Ga0436363_0321331 | Ga0436363_0321331_186_1010 | 273 |
| 3 | 3300045049 | Ga0466959_0117802 | Ga0466959_0117802_1050_1874 | 273 |
| 4 | 3300046462 | Ga0495651_0266405 | Ga0495651_0266405_315_1139 | 273 |
| 5 | 3300046511 | Ga0495608_0344313 | Ga0495608_0344313_16_840 | 273 |
| 6 | 3300046557 | Ga0495622_0076309 | Ga0495622_0076309_706_1530 | 273 |
| 7 | 3300048914 | Ga0496111_0372141 | Ga0496111_0372141_200_1024 | 273 |
| 8 | 3300035171 | Ga0373946_0144167 | Ga0373946_0144167_34_861 | 274 |
| 9 | 3300025981 | Ga0207640_10379698 | Ga0207640_103796982 | 276 |
| 10 | 3300035692 | Ga0373935_0130896 | Ga0373935_0130896_816_1673 | 284 |
| 11 | 3300046539 | Ga0495621_0142561 | Ga0495621_0142561_25_882 | 284 |
| 12 | 3300046558 | Ga0495633_0159353 | Ga0495633_0159353_14_871 | 284 |
| 13 | 3300048921 | Ga0496118_0292353 | Ga0496118_0292353_31_888 | 284 |
| 14 | 3300048923 | Ga0496120_0116144 | Ga0496120_0116144_20_877 | 284 |
| 15 | 3300035089 | Ga0373944_0109761 | Ga0373944_0109761_37_924 | 294 |
| 16 | 3300050516 | nmdc:mga0sz30_173256_c1 | nmdc:mga0sz30_173256_c1_52_942 | 295 |
| 17 | 3300050511 | nmdc:mga08y16_669221_c1 | nmdc:mga08y16_669221_c1_111_1028 | 302 |
| 18 | 3300048924 | Ga0496121_0321646 | Ga0496121_0321646_95_1012 | 304 |
| 19 | 3300048923 | Ga0496120_0030057 | Ga0496120_0030057_20_955 | 310 |
| 20 | 3300035172 | Ga0373955_0242146 | Ga0373955_0242146_50_988 | 311 |
| 21 | 3300037068 | Ga0373925_0138170 | Ga0373925_0138170_50_988 | 311 |
| 22 | 3300005340 | Ga0070689_100314067 | Ga0070689_1003140672 | 313 |
| 23 | 3300047322 | Ga0495680_0164774 | Ga0495680_0164774_86_1030 | 313 |
| 24 | 3300026089 | Ga0207648_10415314 | Ga0207648_104153142 | 315 |
| 25 | 3300026118 | Ga0207675_100263583 | Ga0207675_1002635831 | 315 |
| 26 | 3300047317 | Ga0495604_0148477 | Ga0495604_0148477_155_1171 | 318 |
| 27 | 3300048910 | Ga0496107_0035617 | Ga0496107_0035617_116_1096 | 320 |
| 28 | 3300048924 | Ga0496121_0004071 | Ga0496121_0004071_313_1293 | 320 |
| 29 | 3300053087 | Ga0500643_019874 | Ga0500643_019874_655_1641 | 320 |
| 30 | 3300005435 | Ga0070714_100003521 | Ga0070714_1000035213 | 322 |
| 31 | 3300005437 | Ga0070710_10000219 | Ga0070710_1000021916 | 322 |
| 32 | 3300005439 | Ga0070711_100002832 | Ga0070711_1000028323 | 322 |
| 33 | 3300025898 | Ga0207692_10041308 | Ga0207692_100413083 | 322 |
| 34 | 3300025906 | Ga0207699_10108963 | Ga0207699_101089632 | 322 |
| 35 | 3300025915 | Ga0207693_10007490 | Ga0207693_100074909 | 322 |
| 36 | 3300025916 | Ga0207663_10014741 | Ga0207663_100147415 | 322 |
| 37 | 3300025928 | Ga0207700_10012800 | Ga0207700_100128003 | 322 |
| 38 | 3300025929 | Ga0207664_10004015 | Ga0207664_1000401510 | 322 |
| 39 | 3300048924 | Ga0496121_0064130 | Ga0496121_0064130_882_1853 | 322 |
| 40 | iso_pu_bacteria | 2513237096 | 2513661054 | 322 |
| 41 | iso_pu_bacteria | 2513237137 | 2513860573 | 322 |
| 42 | iso_pu_bacteria | 2513237145 | 2513918980 | 322 |
| 43 | iso_pu_bacteria | 2517572143 | 2517888301 | 322 |
| 44 | iso_pu_bacteria | 2524023228 | 2524539886 | 322 |
| 45 | iso_pu_bacteria | 2602042107 | 2603857988 | 322 |
| 46 | iso_pu_bacteria | 2667528175 | 2671123349 | 322 |
| 47 | iso_pu_bacteria | 2728368998 | 2728750727 | 322 |
| 48 | iso_pu_bacteria | 2791355197 | 2793067118 | 322 |
| 49 | iso_pu_bacteria | 2857524615 | 2857527369 | 322 |
| 50 | iso_pu_bacteria | 2885374607 | 2885378997 | 322 |
| 51 | iso_pu_bacteria | 2893066018 | 2893071908 | 322 |
| 52 | iso_pu_bacteria | 2903748898 | 2903756715 | 322 |
| 53 | iso_pu_bacteria | 2904690495 | 2904692186 | 322 |
| 54 | iso_pu_bacteria | 2904699407 | 2904709778 | 322 |
| 55 | iso_pu_bacteria | 2906610324 | 2906614343 | 322 |
| 56 | iso_pu_bacteria | 2906635258 | 2906639160 | 322 |
| 57 | iso_pu_bacteria | 2906660503 | 2906666727 | 322 |
| 58 | iso_pu_bacteria | 2908739725 | 2908746832 | 322 |
| 59 | iso_pu_bacteria | 2908756301 | 2908756725 | 322 |
| 60 | iso_pu_bacteria | 2919073203 | 2919078482 | 322 |
| 61 | iso_pu_bacteria | 2922425934 | 2922426172 | 322 |
| 62 | iso_pu_bacteria | 2935630451 | 2935632561 | 322 |
| 63 | iso_pu_bacteria | 2941507105 | 2941508775 | 322 |
| 64 | iso_pu_bacteria | 2941515067 | 2941516605 | 322 |
| 65 | iso_pu_bacteria | 2941523033 | 2941524379 | 322 |
| 66 | iso_pu_bacteria | 3005474847 | 3005483371 | 322 |
| 67 | iso_pu_bacteria | 8006933436 | 8006936875 | 322 |
| 68 | iso_pu_bacteria | 8006973647 | 8006976845 | 322 |
| 69 | iso_pu_bacteria | 8019555841 | 8019561813 | 322 |
| 70 | iso_pu_bacteria | 8019565922 | 8019571883 | 322 |
| 71 | iso_pu_bacteria | 8056689827 | 8056690928 | 322 |
| 72 | 3300009147 | Ga0114129_10229803 | Ga0114129_102298033 | 323 |
| 73 | 3300013307 | Ga0157372_10519055 | Ga0157372_105190552 | 323 |
| 74 | 3300021358 | Ga0213873_10014582 | Ga0213873_100145821 | 323 |
| 75 | 3300021384 | Ga0213876_10013493 | Ga0213876_100134936 | 323 |
| 76 | 3300039437 | Ga0436365_0877008 | Ga0436365_0877008_21394_22368 | 323 |
| 77 | 3300039453 | Ga0436362_1015371 | Ga0436362_1015371_782_1756 | 323 |
| 78 | 3300048928 | Ga0496125_0162615 | Ga0496125_0162615_526_1500 | 323 |
| 79 | iso_pu_bacteria | 2508501128 | 2509149977 | 323 |
| 80 | iso_pu_bacteria | 2513237098 | 2513672952 | 323 |
| 81 | iso_pu_bacteria | 2524023210 | 2524466434 | 323 |
| 82 | iso_pu_bacteria | 2643221651 | 2644290648 | 323 |
| 83 | iso_pu_bacteria | 2885383462 | 2885385650 | 323 |
| 84 | iso_pu_bacteria | 2903768456 | 2903770457 | 323 |
| 85 | iso_pu_bacteria | 2935959822 | 2935964044 | 323 |
| 86 | iso_pu_bacteria | 8056681323 | 8056683072 | 323 |
| 87 | 3300021384 | Ga0213876_10158781 | Ga0213876_101587812 | 324 |
| 88 | 3300021384 | Ga0213876_10164378 | Ga0213876_101643782 | 324 |
| 89 | 3300039437 | Ga0436365_1727551 | Ga0436365_1727551_462_1439 | 324 |
| 90 | 3300044694 | Ga0466963_0141252 | Ga0466963_0141252_102_1079 | 324 |
| 91 | iso_pu_bacteria | 2507262055 | 2507504720 | 324 |
| 92 | iso_pu_bacteria | 2508501009 | 2508539863 | 324 |
| 93 | iso_pu_bacteria | 2508501042 | 2508695005 | 324 |
| 94 | iso_pu_bacteria | 2511231028 | 2511394948 | 324 |
| 95 | iso_pu_bacteria | 2513237092 | 2513624959 | 324 |
| 96 | iso_pu_bacteria | 2513237094 | 2513640756 | 324 |
| 97 | iso_pu_bacteria | 2513237095 | 2513651736 | 324 |
| 98 | iso_pu_bacteria | 2513237101 | 2513698184 | 324 |
| 99 | iso_pu_bacteria | 2513237102 | 2513705652 | 324 |
| 100 | iso_pu_bacteria | 2513237139 | 2513879218 | 324 |
| 101 | iso_pu_bacteria | 2513237141 | 2513889694 | 324 |
| 102 | iso_pu_bacteria | 2513237161 | 2514010230 | 324 |
| 103 | iso_pu_bacteria | 2515154112 | 2515627804 | 324 |
| 104 | iso_pu_bacteria | 2517093001 | 2517106513 | 324 |
| 105 | iso_pu_bacteria | 2524023205 | 2524440168 | 324 |
| 106 | iso_pu_bacteria | 2528768022 | 2528850645 | 324 |
| 107 | iso_pu_bacteria | 2617270735 | 2617350131 | 324 |
| 108 | iso_pu_bacteria | 2617270741 | 2617377179 | 324 |
| 109 | iso_pu_bacteria | 2721755755 | 2723849235 | 324 |
| 110 | iso_pu_bacteria | 2744054633 | 2745077722 | 324 |
| 111 | iso_pu_bacteria | 2791355196 | 2793065739 | 324 |
| 112 | iso_pu_bacteria | 2791355199 | 2793078398 | 324 |
| 113 | iso_pu_bacteria | 2802429603 | 2805920358 | 324 |
| 114 | iso_pu_bacteria | 2816332527 | 2818239360 | 324 |
| 115 | iso_pu_bacteria | 2824600985 | 2824605856 | 324 |
| 116 | iso_pu_bacteria | 2824609381 | 2824611930 | 324 |
| 117 | iso_pu_bacteria | 2824617872 | 2824622806 | 324 |
| 118 | iso_pu_bacteria | 2824626560 | 2824631894 | 324 |
| 119 | iso_pu_bacteria | 2824635225 | 2824639158 | 324 |
| 120 | iso_pu_bacteria | 2824644064 | 2824650402 | 324 |
| 121 | iso_pu_bacteria | 2824653114 | 2824660231 | 324 |
| 122 | iso_pu_bacteria | 2824661429 | 2824664260 | 324 |
| 123 | iso_pu_bacteria | 2824671348 | 2824676077 | 324 |
| 124 | iso_pu_bacteria | 2824679649 | 2824681965 | 324 |
| 125 | iso_pu_bacteria | 2824687955 | 2824692505 | 324 |
| 126 | iso_pu_bacteria | 2824696289 | 2824699806 | 324 |
| 127 | iso_pu_bacteria | 2824704595 | 2824711045 | 324 |
| 128 | iso_pu_bacteria | 2824714736 | 2824720281 | 324 |
| 129 | iso_pu_bacteria | 2824723954 | 2824730690 | 324 |
| 130 | iso_pu_bacteria | 2824732956 | 2824734158 | 324 |
| 131 | iso_pu_bacteria | 2824746037 | 2824749568 | 324 |
| 132 | iso_pu_bacteria | 2824753945 | 2824762801 | 324 |
| 133 | iso_pu_bacteria | 2824763712 | 2824772851 | 324 |
| 134 | iso_pu_bacteria | 2824773399 | 2824780979 | 324 |
| 135 | iso_pu_bacteria | 2838122688 | 2838125854 | 324 |
| 136 | iso_pu_bacteria | 2841941048 | 2841948447 | 324 |
| 137 | iso_pu_bacteria | 2841949485 | 2841952894 | 324 |
| 138 | iso_pu_bacteria | 2841957949 | 2841963492 | 324 |
| 139 | iso_pu_bacteria | 2841966195 | 2841971074 | 324 |
| 140 | iso_pu_bacteria | 2841974524 | 2841977667 | 324 |
| 141 | iso_pu_bacteria | 2841983080 | 2841984772 | 324 |
| 142 | iso_pu_bacteria | 2842038055 | 2842041507 | 324 |
| 143 | iso_pu_bacteria | 2842045827 | 2842049549 | 324 |
| 144 | iso_pu_bacteria | 2844315083 | 2844315952 | 324 |
| 145 | iso_pu_bacteria | 2847930680 | 2847939812 | 324 |
| 146 | iso_pu_bacteria | 2847939898 | 2847942789 | 324 |
| 147 | iso_pu_bacteria | 2849076700 | 2849076787 | 324 |
| 148 | iso_pu_bacteria | 2857509624 | 2857515742 | 324 |
| 149 | iso_pu_bacteria | 2874590934 | 2874593683 | 324 |
| 150 | iso_pu_bacteria | 2874604998 | 2874608532 | 324 |
| 151 | iso_pu_bacteria | 2874612657 | 2874617646 | 324 |
| 152 | iso_pu_bacteria | 2874620515 | 2874622049 | 324 |
| 153 | iso_pu_bacteria | 2874628541 | 2874629280 | 324 |
| 154 | iso_pu_bacteria | 2874645413 | 2874647947 | 324 |
| 155 | iso_pu_bacteria | 2876761206 | 2876769779 | 324 |
| 156 | iso_pu_bacteria | 2876771140 | 2876772774 | 324 |
| 157 | iso_pu_bacteria | 2876808645 | 2876813476 | 324 |
| 158 | iso_pu_bacteria | 2876818435 | 2876826497 | 324 |
| 159 | iso_pu_bacteria | 2879074833 | 2879077470 | 324 |
| 160 | iso_pu_bacteria | 2879083081 | 2879088247 | 324 |
| 161 | iso_pu_bacteria | 2879099564 | 2879105557 | 324 |
| 162 | iso_pu_bacteria | 2879110137 | 2879112687 | 324 |
| 163 | iso_pu_bacteria | 2879127579 | 2879134425 | 324 |
| 164 | iso_pu_bacteria | 2879142872 | 2879147384 | 324 |
| 165 | iso_pu_bacteria | 2881364244 | 2881364446 | 324 |
| 166 | iso_pu_bacteria | 2881665667 | 2881666063 | 324 |
| 167 | iso_pu_bacteria | 2885366525 | 2885369039 | 324 |
| 168 | iso_pu_bacteria | 2885409591 | 2885415478 | 324 |
| 169 | iso_pu_bacteria | 2888378607 | 2888379007 | 324 |
| 170 | iso_pu_bacteria | 2888388044 | 2888390177 | 324 |
| 171 | iso_pu_bacteria | 2888419890 | 2888427316 | 324 |
| 172 | iso_pu_bacteria | 2889033259 | 2889035988 | 324 |
| 173 | iso_pu_bacteria | 2903727486 | 2903731901 | 324 |
| 174 | iso_pu_bacteria | 2904666416 | 2904669359 | 324 |
| 175 | iso_pu_bacteria | 2904711408 | 2904716110 | 324 |
| 176 | iso_pu_bacteria | 2906602504 | 2906606158 | 324 |
| 177 | iso_pu_bacteria | 2906626472 | 2906631618 | 324 |
| 178 | iso_pu_bacteria | 2906643746 | 2906649339 | 324 |
| 179 | iso_pu_bacteria | 2908775508 | 2908775694 | 324 |
| 180 | iso_pu_bacteria | 2922361189 | 2922364457 | 324 |
| 181 | iso_pu_bacteria | 2922368715 | 2922377887 | 324 |
| 182 | iso_pu_bacteria | 2922386360 | 2922389143 | 324 |
| 183 | iso_pu_bacteria | 2922393267 | 2922400874 | 324 |
| 184 | iso_pu_bacteria | 2929615660 | 2929623904 | 324 |
| 185 | iso_pu_bacteria | 2929624759 | 2929633062 | 324 |
| 186 | iso_pu_bacteria | 2932784394 | 2932789155 | 324 |
| 187 | iso_pu_bacteria | 2932794094 | 2932800116 | 324 |
| 188 | iso_pu_bacteria | 2932801729 | 2932808300 | 324 |
| 189 | iso_pu_bacteria | 2932809354 | 2932814208 | 324 |
| 190 | iso_pu_bacteria | 2932818245 | 2932820334 | 324 |
| 191 | iso_pu_bacteria | 2932828146 | 2932834404 | 324 |
| 192 | iso_pu_bacteria | 2933577622 | 2933585807 | 324 |
| 193 | iso_pu_bacteria | 2935608549 | 2935615087 | 324 |
| 194 | iso_pu_bacteria | 2935616580 | 2935620089 | 324 |
| 195 | iso_pu_bacteria | 2935638405 | 2935640407 | 324 |
| 196 | iso_pu_bacteria | 2935648319 | 2935651563 | 324 |
| 197 | iso_pu_bacteria | 2935656913 | 2935659669 | 324 |
| 198 | iso_pu_bacteria | 2935665750 | 2935668601 | 324 |
| 199 | iso_pu_bacteria | 2935675223 | 2935681903 | 324 |
| 200 | iso_pu_bacteria | 2935684952 | 2935686910 | 324 |
| 201 | iso_pu_bacteria | 2935694250 | 2935702052 | 324 |
| 202 | iso_pu_bacteria | 2935703347 | 2935709889 | 324 |
| 203 | iso_pu_bacteria | 2935713505 | 2935716598 | 324 |
| 204 | iso_pu_bacteria | 2935722832 | 2935723277 | 324 |
| 205 | iso_pu_bacteria | 2935732158 | 2935734834 | 324 |
| 206 | iso_pu_bacteria | 2935741537 | 2935744375 | 324 |
| 207 | iso_pu_bacteria | 2935750917 | 2935752876 | 324 |
| 208 | iso_pu_bacteria | 2935760218 | 2935769266 | 324 |
| 209 | iso_pu_bacteria | 2935769743 | 2935774771 | 324 |
| 210 | iso_pu_bacteria | 2935777560 | 2935779664 | 324 |
| 211 | iso_pu_bacteria | 2935785616 | 2935789714 | 324 |
| 212 | iso_pu_bacteria | 2935793552 | 2935797918 | 324 |
| 213 | iso_pu_bacteria | 2935801545 | 2935806307 | 324 |
| 214 | iso_pu_bacteria | 2935810662 | 2935818162 | 324 |
| 215 | iso_pu_bacteria | 2935819856 | 2935825875 | 324 |
| 216 | iso_pu_bacteria | 2935827899 | 2935831913 | 324 |
| 217 | iso_pu_bacteria | 2935837841 | 2935841256 | 324 |
| 218 | iso_pu_bacteria | 2935847175 | 2935851494 | 324 |
| 219 | iso_pu_bacteria | 2935855204 | 2935858975 | 324 |
| 220 | iso_pu_bacteria | 2935864058 | 2935864156 | 324 |
| 221 | iso_pu_bacteria | 2935873716 | 2935875492 | 324 |
| 222 | iso_pu_bacteria | 2935883170 | 2935883406 | 324 |
| 223 | iso_pu_bacteria | 2935908558 | 2935910482 | 324 |
| 224 | iso_pu_bacteria | 2935916978 | 2935918116 | 324 |
| 225 | iso_pu_bacteria | 2935926038 | 2935927607 | 324 |
| 226 | iso_pu_bacteria | 2935934488 | 2935936521 | 324 |
| 227 | iso_pu_bacteria | 2935942939 | 2935943926 | 324 |
| 228 | iso_pu_bacteria | 2935951376 | 2935952363 | 324 |
| 229 | iso_pu_bacteria | 2935967501 | 2935969203 | 324 |
| 230 | iso_pu_bacteria | 2935975950 | 2935978035 | 324 |
| 231 | iso_pu_bacteria | 2935984226 | 2935984664 | 324 |
| 232 | iso_pu_bacteria | 2935992306 | 2935995528 | 324 |
| 233 | iso_pu_bacteria | 2936002035 | 2936007950 | 324 |
| 234 | iso_pu_bacteria | 2936011229 | 2936014085 | 324 |
| 235 | iso_pu_bacteria | 2936019824 | 2936023006 | 324 |
| 236 | iso_pu_bacteria | 2936028420 | 2936031142 | 324 |
| 237 | iso_pu_bacteria | 2936037263 | 2936044772 | 324 |
| 238 | iso_pu_bacteria | 2936046547 | 2936049264 | 324 |
| 239 | iso_pu_bacteria | 2936055302 | 2936055807 | 324 |
| 240 | iso_pu_bacteria | 2940556831 | 2940558789 | 324 |
| 241 | iso_pu_bacteria | 2941531003 | 2941535818 | 324 |
| 242 | iso_pu_bacteria | 2941538514 | 2941543482 | 324 |
| 243 | iso_pu_bacteria | 3005483717 | 3005490586 | 324 |
| 244 | iso_pu_bacteria | 3005506211 | 3005506404 | 324 |
| 245 | iso_pu_bacteria | 3005587118 | 3005588952 | 324 |
| 246 | iso_pu_bacteria | 3005594810 | 3005595545 | 324 |
| 247 | iso_pu_bacteria | 3005710791 | 3005711532 | 324 |
| 248 | iso_pu_bacteria | 3005718088 | 3005718770 | 324 |
| 249 | iso_pu_bacteria | 8006926726 | 8006932910 | 324 |
| 250 | iso_pu_bacteria | 8006964411 | 8006967769 | 324 |
| 251 | iso_pu_bacteria | 8006984368 | 8006992562 | 324 |
| 252 | iso_pu_bacteria | 8006994254 | 8006998440 | 324 |
| 253 | iso_pu_bacteria | 8016511872 | 8016517641 | 324 |
| 254 | iso_pu_bacteria | 8016522445 | 8016525704 | 324 |
| 255 | iso_pu_bacteria | 8016539877 | 8016543587 | 324 |
| 256 | iso_pu_bacteria | 8016548790 | 8016549704 | 324 |
| 257 | iso_pu_bacteria | 8016557553 | 8016558121 | 324 |
| 258 | iso_pu_bacteria | 8016575299 | 8016581632 | 324 |
| 259 | iso_pu_bacteria | 8016595262 | 8016596129 | 324 |
| 260 | iso_pu_bacteria | 8016613128 | 8016618929 | 324 |
| 261 | iso_pu_bacteria | 8016622563 | 8016622617 | 324 |
| 262 | iso_pu_bacteria | 8016630954 | 8016636431 | 324 |
| 263 | iso_pu_bacteria | 8017057580 | 8017058984 | 324 |
| 264 | iso_pu_bacteria | 8019530166 | 8019530580 | 324 |
| 265 | iso_pu_bacteria | 8019538911 | 8019541014 | 324 |
| 266 | iso_pu_bacteria | 8019547302 | 8019549607 | 324 |
| 267 | iso_pu_bacteria | 8019576017 | 8019576657 | 324 |
| 268 | iso_pu_bacteria | 8019586578 | 8019594709 | 324 |
| 269 | iso_pu_bacteria | 8019597564 | 8019607028 | 324 |
| 270 | iso_pu_bacteria | 8019608314 | 8019611482 | 324 |
| 271 | iso_pu_bacteria | 8019629233 | 8019630869 | 324 |
| 272 | iso_pu_bacteria | 8019638758 | 8019639728 | 324 |
| 273 | iso_pu_bacteria | 8019648815 | 8019653086 | 324 |
| 274 | iso_pu_bacteria | 8019659431 | 8019667884 | 324 |
| 275 | iso_pu_bacteria | 8019668869 | 8019677299 | 324 |
| 276 | iso_pu_bacteria | 8019678201 | 8019678679 | 324 |
| 277 | iso_pu_bacteria | 8019687851 | 8019696834 | 324 |
| 278 | iso_pu_bacteria | 8055742211 | 8055742961 | 324 |
| 279 | iso_pu_bacteria | 8056673599 | 8056678485 | 324 |
| 280 | iso_pu_bacteria | 8056967851 | 8056970744 | 324 |
| 281 | 3300005327 | Ga0070658_10418233 | Ga0070658_104182331 | 325 |
| 282 | 3300005455 | Ga0070663_100003302 | Ga0070663_10000330212 | 325 |
| 283 | 3300005530 | Ga0070679_100083660 | Ga0070679_1000836603 | 325 |
| 284 | 3300005548 | Ga0070665_100063100 | Ga0070665_1000631004 | 325 |
| 285 | 3300005563 | Ga0068855_100121183 | Ga0068855_1001211832 | 325 |
| 286 | 3300006048 | Ga0075363_100002768 | Ga0075363_1000027688 | 325 |
| 287 | 3300006178 | Ga0075367_10128164 | Ga0075367_101281642 | 325 |
| 288 | 3300006353 | Ga0075370_10119165 | Ga0075370_101191652 | 325 |
| 289 | 3300025917 | Ga0207660_10071421 | Ga0207660_100714213 | 325 |
| 290 | 3300026067 | Ga0207678_10008196 | Ga0207678_100081962 | 325 |
| 291 | 3300027866 | Ga0209813_10016710 | Ga0209813_100167102 | 325 |
| 292 | 3300028379 | Ga0268266_10172700 | Ga0268266_101727002 | 325 |
| 293 | 3300037466 | Ga0395898_0078628 | Ga0395898_0078628_924_1904 | 325 |
| 294 | 3300048913 | Ga0496110_0408864 | Ga0496110_0408864_103_1083 | 325 |
| 295 | 3300049569 | Ga0501032_0097504 | Ga0501032_0097504_354_1334 | 325 |
| 296 | 3300049570 | Ga0501033_0070751 | Ga0501033_0070751_285_1265 | 325 |
| 297 | 3300049571 | Ga0501034_0165791 | Ga0501034_0165791_608_1588 | 325 |
| 298 | 3300049575 | Ga0501039_0114143 | Ga0501039_0114143_252_1232 | 325 |
| 299 | 3300049586 | Ga0501070_0267606 | Ga0501070_0267606_88_1068 | 325 |
| 300 | 3300049822 | Ga0501035_0197410 | Ga0501035_0197410_534_1514 | 325 |
| 301 | 3300049823 | Ga0501044_0054727 | Ga0501044_0054727_1691_2671 | 325 |
| 302 | 3300049823 | Ga0501044_0083357 | Ga0501044_0083357_2208_3188 | 325 |
| 303 | 3300049824 | Ga0501045_0292267 | Ga0501045_0292267_69_1049 | 325 |
| 304 | 3300050495 | nmdc:mga04h51_14481_c1 | nmdc:mga04h51_14481_c1_413_1393 | 325 |
| 305 | 3300050496 | nmdc:mga07m45_31507_c1 | nmdc:mga07m45_31507_c1_952_1932 | 325 |
| 306 | iso_pu_bacteria | 2513237104 | 2513714944 | 325 |
| 307 | 3300003203 | JGI25406J46586_10020229 | JGI25406J46586_100202293 | 326 |
| 308 | 3300005329 | Ga0070683_100417424 | Ga0070683_1004174242 | 326 |
| 309 | 3300005436 | Ga0070713_100101588 | Ga0070713_1001015882 | 326 |
| 310 | 3300005539 | Ga0068853_100249648 | Ga0068853_1002496482 | 326 |
| 311 | 3300005563 | Ga0068855_100055336 | Ga0068855_1000553365 | 326 |
| 312 | 3300005563 | Ga0068855_100087122 | Ga0068855_1000871224 | 326 |
| 313 | 3300005578 | Ga0068854_100040592 | Ga0068854_1000405922 | 326 |
| 314 | 3300005614 | Ga0068856_100002788 | Ga0068856_1000027887 | 326 |
| 315 | 3300005842 | Ga0068858_100097972 | Ga0068858_1000979723 | 326 |
| 316 | 3300005983 | Ga0081540_1055762 | Ga0081540_10557622 | 326 |
| 317 | 3300005985 | Ga0081539_10000629 | Ga0081539_1000062926 | 326 |
| 318 | 3300005985 | Ga0081539_10080264 | Ga0081539_100802642 | 326 |
| 319 | 3300006028 | Ga0070717_10060673 | Ga0070717_100606734 | 326 |
| 320 | 3300006051 | Ga0075364_10117059 | Ga0075364_101170592 | 326 |
| 321 | 3300006353 | Ga0075370_10105722 | Ga0075370_101057222 | 326 |
| 322 | 3300006942 | Ga0099824_1010813 | Ga0099824_10108136 | 326 |
| 323 | 3300006943 | Ga0099822_1002332 | Ga0099822_100233215 | 326 |
| 324 | 3300009093 | Ga0105240_10061416 | Ga0105240_100614164 | 326 |
| 325 | 3300009093 | Ga0105240_10090182 | Ga0105240_100901822 | 326 |
| 326 | 3300009101 | Ga0105247_10162695 | Ga0105247_101626952 | 326 |
| 327 | 3300009174 | Ga0105241_10108202 | Ga0105241_101082023 | 326 |
| 328 | 3300009551 | Ga0105238_10043421 | Ga0105238_100434214 | 326 |
| 329 | 3300009551 | Ga0105238_10067329 | Ga0105238_100673293 | 326 |
| 330 | 3300010375 | Ga0105239_10031504 | Ga0105239_100315047 | 326 |
| 331 | 3300010375 | Ga0105239_10075985 | Ga0105239_100759853 | 326 |
| 332 | 3300010375 | Ga0105239_10286135 | Ga0105239_102861352 | 326 |
| 333 | 3300013102 | Ga0157371_10023801 | Ga0157371_100238015 | 326 |
| 334 | 3300013104 | Ga0157370_10056752 | Ga0157370_100567524 | 326 |
| 335 | 3300013105 | Ga0157369_10008687 | Ga0157369_100086878 | 326 |
| 336 | 3300013105 | Ga0157369_10015000 | Ga0157369_100150005 | 326 |
| 337 | 3300013307 | Ga0157372_10132015 | Ga0157372_101320152 | 326 |
| 338 | 3300021384 | Ga0213876_10057406 | Ga0213876_100574062 | 326 |
| 339 | 3300025261 | Ga0209233_1002405 | Ga0209233_10024054 | 326 |
| 340 | 3300025295 | Ga0209564_1001154 | Ga0209564_100115424 | 326 |
| 341 | 3300025295 | Ga0209564_1023468 | Ga0209564_10234682 | 326 |
| 342 | 3300025904 | Ga0207647_10059968 | Ga0207647_100599683 | 326 |
| 343 | 3300025909 | Ga0207705_10178962 | Ga0207705_101789622 | 326 |
| 344 | 3300025913 | Ga0207695_10032098 | Ga0207695_100320983 | 326 |
| 345 | 3300025913 | Ga0207695_10141453 | Ga0207695_101414532 | 326 |
| 346 | 3300025924 | Ga0207694_10047790 | Ga0207694_100477903 | 326 |
| 347 | 3300025928 | Ga0207700_10029515 | Ga0207700_100295154 | 326 |
| 348 | 3300025944 | Ga0207661_10191275 | Ga0207661_101912752 | 326 |
| 349 | 3300025949 | Ga0207667_10161752 | Ga0207667_101617522 | 326 |
| 350 | 3300025981 | Ga0207640_10029111 | Ga0207640_100291114 | 326 |
| 351 | 3300026035 | Ga0207703_10094594 | Ga0207703_100945942 | 326 |
| 352 | 3300026041 | Ga0207639_10194085 | Ga0207639_101940852 | 326 |
| 353 | 3300026078 | Ga0207702_10000623 | Ga0207702_1000062324 | 326 |
| 354 | 3300026116 | Ga0207674_10085543 | Ga0207674_100855433 | 326 |
| 355 | 3300027357 | Ga0209589_1000015 | Ga0209589_100001541 | 326 |
| 356 | 3300027361 | Ga0209489_100015 | Ga0209489_10001541 | 326 |
| 357 | 3300027363 | Ga0209700_100025 | Ga0209700_10002541 | 326 |
| 358 | 3300028556 | Ga0265337_1025017 | Ga0265337_10250172 | 326 |
| 359 | 3300028563 | Ga0265319_1019294 | Ga0265319_10192942 | 326 |
| 360 | 3300028573 | Ga0265334_10001242 | Ga0265334_100012424 | 326 |
| 361 | 3300028577 | Ga0265318_10009393 | Ga0265318_100093933 | 326 |
| 362 | 3300028653 | Ga0265323_10001035 | Ga0265323_1000103510 | 326 |
| 363 | 3300028666 | Ga0265336_10000363 | Ga0265336_1000036323 | 326 |
| 364 | 3300028800 | Ga0265338_10000155 | Ga0265338_1000015585 | 326 |
| 365 | 3300029957 | Ga0265324_10021334 | Ga0265324_100213342 | 326 |
| 366 | 3300031711 | Ga0265314_10001992 | Ga0265314_1000199221 | 326 |
| 367 | 3300031911 | Ga0307412_10018506 | Ga0307412_100185063 | 326 |
| 368 | 3300033180 | Ga0307510_10090387 | Ga0307510_100903872 | 326 |
| 369 | 3300033442 | Ga0315911_1000021 | Ga0315911_10000219 | 326 |
| 370 | 3300035691 | Ga0373931_0040942 | Ga0373931_0040942_730_1713 | 326 |
| 371 | 3300037418 | Ga0395900_0021796 | Ga0395900_0021796_796_1779 | 326 |
| 372 | 3300037466 | Ga0395898_0003151 | Ga0395898_0003151_2445_3428 | 326 |
| 373 | 3300037466 | Ga0395898_0132975 | Ga0395898_0132975_1356_2339 | 326 |
| 374 | 3300038443 | Ga0395901_0083638 | Ga0395901_0083638_387_1370 | 326 |
| 375 | 3300039437 | Ga0436365_1301685 | Ga0436365_1301685_36_1019 | 326 |
| 376 | 3300039437 | Ga0436365_1606403 | Ga0436365_1606403_1022_2005 | 326 |
| 377 | 3300046455 | Ga0495603_0123234 | Ga0495603_0123234_42_1025 | 326 |
| 378 | 3300046460 | Ga0495638_0037800 | Ga0495638_0037800_156_1139 | 326 |
| 379 | 3300046460 | Ga0495638_0037825 | Ga0495638_0037825_1536_2519 | 326 |
| 380 | 3300046513 | Ga0495616_0020323 | Ga0495616_0020323_2459_3442 | 326 |
| 381 | 3300046524 | Ga0495648_0001116 | Ga0495648_0001116_22557_23540 | 326 |
| 382 | 3300046557 | Ga0495622_0033105 | Ga0495622_0033105_773_1756 | 326 |
| 383 | 3300046616 | Ga0495668_0106360 | Ga0495668_0106360_238_1221 | 326 |
| 384 | 3300046660 | Ga0495625_0094667 | Ga0495625_0094667_490_1473 | 326 |
| 385 | 3300046660 | Ga0495625_0135023 | Ga0495625_0135023_638_1621 | 326 |
| 386 | 3300046665 | Ga0495661_0037219 | Ga0495661_0037219_171_1154 | 326 |
| 387 | 3300047315 | Ga0495581_0044765 | Ga0495581_0044765_779_1762 | 326 |
| 388 | 3300047320 | Ga0495672_0095558 | Ga0495672_0095558_332_1315 | 326 |
| 389 | 3300047470 | Ga0495681_0053640 | Ga0495681_0053640_431_1414 | 326 |
| 390 | 3300047472 | Ga0495686_0093652 | Ga0495686_0093652_672_1658 | 326 |
| 391 | 3300047472 | Ga0495686_0093920 | Ga0495686_0093920_211_1194 | 326 |
| 392 | 3300048091 | Ga0495626_0037089 | Ga0495626_0037089_1163_2146 | 326 |
| 393 | 3300048906 | Ga0496103_0214465 | Ga0496103_0214465_114_1097 | 326 |
| 394 | 3300048909 | Ga0496106_0348566 | Ga0496106_0348566_165_1148 | 326 |
| 395 | 3300048919 | Ga0496116_0020888 | Ga0496116_0020888_187_1170 | 326 |
| 396 | 3300048920 | Ga0496117_0079592 | Ga0496117_0079592_1046_2029 | 326 |
| 397 | 3300048921 | Ga0496118_0045268 | Ga0496118_0045268_33_1016 | 326 |
| 398 | 3300048923 | Ga0496120_0016606 | Ga0496120_0016606_1447_2430 | 326 |
| 399 | 3300048923 | Ga0496120_0105296 | Ga0496120_0105296_422_1405 | 326 |
| 400 | 3300048924 | Ga0496121_0004123 | Ga0496121_0004123_15909_16892 | 326 |
| 401 | 3300048924 | Ga0496121_0072706 | Ga0496121_0072706_1709_2692 | 326 |
| 402 | 3300048925 | Ga0496122_0014770 | Ga0496122_0014770_1752_2735 | 326 |
| 403 | 3300048925 | Ga0496122_0073007 | Ga0496122_0073007_612_1595 | 326 |
| 404 | 3300048925 | Ga0496122_0125829 | Ga0496122_0125829_31_1014 | 326 |
| 405 | 3300048926 | Ga0496123_0056676 | Ga0496123_0056676_262_1245 | 326 |
| 406 | 3300048927 | Ga0496124_0056207 | Ga0496124_0056207_1655_2638 | 326 |
| 407 | 3300048927 | Ga0496124_0075008 | Ga0496124_0075008_402_1385 | 326 |
| 408 | 3300048927 | Ga0496124_0188417 | Ga0496124_0188417_510_1493 | 326 |
| 409 | 3300048928 | Ga0496125_0000099 | Ga0496125_0000099_178225_179208 | 326 |
| 410 | 3300048928 | Ga0496125_0001377 | Ga0496125_0001377_26605_27588 | 326 |
| 411 | 3300048928 | Ga0496125_0004112 | Ga0496125_0004112_3228_4211 | 326 |
| 412 | 3300048928 | Ga0496125_0015326 | Ga0496125_0015326_2794_3777 | 326 |
| 413 | 3300048929 | Ga0496126_0027035 | Ga0496126_0027035_2681_3664 | 326 |
| 414 | 3300048929 | Ga0496126_0032694 | Ga0496126_0032694_1445_2428 | 326 |
| 415 | 3300048929 | Ga0496126_0178353 | Ga0496126_0178353_297_1280 | 326 |
| 416 | 3300049568 | Ga0501031_0002180 | Ga0501031_0002180_2640_3623 | 326 |
| 417 | 3300049568 | Ga0501031_0027770 | Ga0501031_0027770_401_1384 | 326 |
| 418 | 3300049569 | Ga0501032_0000136 | Ga0501032_0000136_33364_34347 | 326 |
| 419 | 3300049569 | Ga0501032_0047408 | Ga0501032_0047408_897_1880 | 326 |
| 420 | 3300049570 | Ga0501033_0000202 | Ga0501033_0000202_42404_43387 | 326 |
| 421 | 3300049570 | Ga0501033_0006530 | Ga0501033_0006530_7422_8405 | 326 |
| 422 | 3300049571 | Ga0501034_0000113 | Ga0501034_0000113_89354_90337 | 326 |
| 423 | 3300049572 | Ga0501036_0000059 | Ga0501036_0000059_57642_58625 | 326 |
| 424 | 3300049572 | Ga0501036_0062741 | Ga0501036_0062741_881_1864 | 326 |
| 425 | 3300049572 | Ga0501036_0199024 | Ga0501036_0199024_558_1541 | 326 |
| 426 | 3300049573 | Ga0501037_0000214 | Ga0501037_0000214_6153_7136 | 326 |
| 427 | 3300049573 | Ga0501037_0010785 | Ga0501037_0010785_4739_5722 | 326 |
| 428 | 3300049574 | Ga0501038_0001243 | Ga0501038_0001243_21154_22137 | 326 |
| 429 | 3300049574 | Ga0501038_0002129 | Ga0501038_0002129_15318_16301 | 326 |
| 430 | 3300049574 | Ga0501038_0002810 | Ga0501038_0002810_6071_7054 | 326 |
| 431 | 3300049575 | Ga0501039_0036146 | Ga0501039_0036146_142_1125 | 326 |
| 432 | 3300049575 | Ga0501039_0074470 | Ga0501039_0074470_222_1205 | 326 |
| 433 | 3300049575 | Ga0501039_0239346 | Ga0501039_0239346_271_1254 | 326 |
| 434 | 3300049575 | Ga0501039_0270543 | Ga0501039_0270543_257_1240 | 326 |
| 435 | 3300049579 | Ga0501043_0000017 | Ga0501043_0000017_6806_7789 | 326 |
| 436 | 3300049579 | Ga0501043_0018948 | Ga0501043_0018948_4260_5243 | 326 |
| 437 | 3300049579 | Ga0501043_0059965 | Ga0501043_0059965_578_1561 | 326 |
| 438 | 3300049579 | Ga0501043_0197084 | Ga0501043_0197084_348_1331 | 326 |
| 439 | 3300049580 | Ga0501046_0000174 | Ga0501046_0000174_29399_30382 | 326 |
| 440 | 3300049580 | Ga0501046_0169447 | Ga0501046_0169447_435_1418 | 326 |
| 441 | 3300049581 | Ga0501047_0000044 | Ga0501047_0000044_162917_163900 | 326 |
| 442 | 3300049581 | Ga0501047_0199396 | Ga0501047_0199396_382_1365 | 326 |
| 443 | 3300049581 | Ga0501047_0508402 | Ga0501047_0508402_31_1014 | 326 |
| 444 | 3300049582 | Ga0501048_0000837 | Ga0501048_0000837_6951_7934 | 326 |
| 445 | 3300049582 | Ga0501048_0019094 | Ga0501048_0019094_449_1432 | 326 |
| 446 | 3300049583 | Ga0501067_0003781 | Ga0501067_0003781_3274_4257 | 326 |
| 447 | 3300049583 | Ga0501067_0012443 | Ga0501067_0012443_1152_2135 | 326 |
| 448 | 3300049584 | Ga0501068_0000629 | Ga0501068_0000629_13675_14658 | 326 |
| 449 | 3300049584 | Ga0501068_0021249 | Ga0501068_0021249_400_1383 | 326 |
| 450 | 3300049585 | Ga0501069_0016580 | Ga0501069_0016580_16_999 | 326 |
| 451 | 3300049585 | Ga0501069_0031229 | Ga0501069_0031229_932_1915 | 326 |
| 452 | 3300049586 | Ga0501070_0024300 | Ga0501070_0024300_602_1585 | 326 |
| 453 | 3300049586 | Ga0501070_0100759 | Ga0501070_0100759_435_1418 | 326 |
| 454 | 3300049586 | Ga0501070_0149135 | Ga0501070_0149135_203_1186 | 326 |
| 455 | 3300049586 | Ga0501070_0286940 | Ga0501070_0286940_175_1158 | 326 |
| 456 | 3300049587 | Ga0501071_0034192 | Ga0501071_0034192_2312_3295 | 326 |
| 457 | 3300049588 | Ga0501072_0025631 | Ga0501072_0025631_347_1330 | 326 |
| 458 | 3300049588 | Ga0501072_0226773 | Ga0501072_0226773_58_1041 | 326 |
| 459 | 3300049589 | Ga0501073_0000069 | Ga0501073_0000069_25054_26037 | 326 |
| 460 | 3300049590 | Ga0501074_0000507 | Ga0501074_0000507_19825_20808 | 326 |
| 461 | 3300049590 | Ga0501074_0004738 | Ga0501074_0004738_1549_2532 | 326 |
| 462 | 3300049592 | Ga0501076_0143975 | Ga0501076_0143975_250_1233 | 326 |
| 463 | 3300049593 | Ga0501077_0097333 | Ga0501077_0097333_391_1374 | 326 |
| 464 | 3300049741 | Ga0501079_0012649 | Ga0501079_0012649_5332_6315 | 326 |
| 465 | 3300049742 | Ga0501080_0000613 | Ga0501080_0000613_9674_10657 | 326 |
| 466 | 3300049744 | Ga0501083_0000838 | Ga0501083_0000838_14991_15974 | 326 |
| 467 | 3300049744 | Ga0501083_0005759 | Ga0501083_0005759_4401_5384 | 326 |
| 468 | 3300049822 | Ga0501035_0000393 | Ga0501035_0000393_18778_19761 | 326 |
| 469 | 3300049822 | Ga0501035_0069498 | Ga0501035_0069498_1917_2900 | 326 |
| 470 | 3300049822 | Ga0501035_0196089 | Ga0501035_0196089_565_1548 | 326 |
| 471 | 3300049823 | Ga0501044_0000108 | Ga0501044_0000108_96138_97121 | 326 |
| 472 | 3300049823 | Ga0501044_0056673 | Ga0501044_0056673_1441_2424 | 326 |
| 473 | 3300049823 | Ga0501044_0108063 | Ga0501044_0108063_1090_2073 | 326 |
| 474 | 3300049823 | Ga0501044_0260936 | Ga0501044_0260936_515_1498 | 326 |
| 475 | 3300049824 | Ga0501045_0003166 | Ga0501045_0003166_4187_5170 | 326 |
| 476 | 3300049824 | Ga0501045_0210214 | Ga0501045_0210214_419_1402 | 326 |
| 477 | 3300050491 | nmdc:mga00v17_136747_c1 | nmdc:mga00v17_136747_c1_299_1282 | 326 |
| 478 | 3300050492 | nmdc:mga0yw44_30927_c1 | nmdc:mga0yw44_30927_c1_2050_3033 | 326 |
| 479 | 3300053093 | Ga0500651_0111545 | Ga0500651_0111545_163_1146 | 326 |
| 480 | 3300053094 | Ga0500566_0000470 | Ga0500566_0000470_290_1273 | 326 |
| 481 | 3300053096 | Ga0500641_0035129 | Ga0500641_0035129_378_1361 | 326 |
| 482 | 3300053098 | Ga0500650_0002265 | Ga0500650_0002265_2537_3520 | 326 |
| 483 | 3300053104 | Ga0500556_0000005 | Ga0500556_0000005_456144_457127 | 326 |
| 484 | 3300053108 | Ga0500562_038472 | Ga0500562_038472_223_1206 | 326 |
| 485 | 3300053109 | Ga0500569_036979 | Ga0500569_036979_95_1078 | 326 |
| 486 | 3300053121 | Ga0500607_096979 | Ga0500607_096979_102_1085 | 326 |
| 487 | 3300053122 | Ga0500608_000126 | Ga0500608_000126_15540_16523 | 326 |
| 488 | 3300053125 | Ga0500618_013409 | Ga0500618_013409_1057_2040 | 326 |
| 489 | 3300053130 | Ga0500642_0000009 | Ga0500642_0000009_143078_144061 | 326 |
| 490 | 3300053131 | Ga0500652_000259 | Ga0500652_000259_15407_16390 | 326 |
| 491 | 3300053136 | Ga0500559_0000222 | Ga0500559_0000222_15555_16538 | 326 |
| 492 | 3300053139 | Ga0500568_0003199 | Ga0500568_0003199_95_1078 | 326 |
| 493 | 3300053145 | Ga0500586_000081 | Ga0500586_000081_8160_9143 | 326 |
| 494 | 3300053151 | Ga0500604_0005397 | Ga0500604_0005397_201_1184 | 326 |
| 495 | 3300053153 | Ga0500616_0000035 | Ga0500616_0000035_44925_45908 | 326 |
| 496 | 3300053156 | Ga0500622_0000355 | Ga0500622_0000355_38142_39125 | 326 |
| 497 | 3300053177 | Ga0500636_0012018 | Ga0500636_0012018_415_1398 | 326 |
| 498 | 3300053177 | Ga0500636_0029876 | Ga0500636_0029876_1655_2641 | 326 |
| 499 | 3300053730 | Ga0500645_025680 | Ga0500645_025680_479_1462 | 326 |
| 500 | 3300054114 | Ga0501084_0012311 | Ga0501084_0012311_157_1140 | 326 |
| 501 | 3300054114 | Ga0501084_0036311 | Ga0501084_0036311_2153_3136 | 326 |
| 502 | 3300060353 | Ga0501082_0029005 | Ga0501082_0029005_2326_3309 | 326 |
| 503 | 3300060353 | Ga0501082_0070850 | Ga0501082_0070850_397_1380 | 326 |
| 504 | 3300003203 | JGI25406J46586_10000170 | JGI25406J46586_1000017015 | 327 |
| 505 | 3300003659 | JGI25404J52841_10002788 | JGI25404J52841_100027882 | 327 |
| 506 | 3300003659 | JGI25404J52841_10020816 | JGI25404J52841_100208161 | 327 |
| 507 | 3300005337 | Ga0070682_100023808 | Ga0070682_1000238082 | 327 |
| 508 | 3300005337 | Ga0070682_100108793 | Ga0070682_1001087932 | 327 |
| 509 | 3300005355 | Ga0070671_100193799 | Ga0070671_1001937992 | 327 |
| 510 | 3300005435 | Ga0070714_100061329 | Ga0070714_1000613293 | 327 |
| 511 | 3300005436 | Ga0070713_100006616 | Ga0070713_1000066165 | 327 |
| 512 | 3300005437 | Ga0070710_10078935 | Ga0070710_100789351 | 327 |
| 513 | 3300005439 | Ga0070711_100007523 | Ga0070711_1000075233 | 327 |
| 514 | 3300005455 | Ga0070663_100012874 | Ga0070663_1000128744 | 327 |
| 515 | 3300005456 | Ga0070678_100121198 | Ga0070678_1001211982 | 327 |
| 516 | 3300005458 | Ga0070681_10369461 | Ga0070681_103694612 | 327 |
| 517 | 3300005530 | Ga0070679_100263811 | Ga0070679_1002638112 | 327 |
| 518 | 3300005535 | Ga0070684_100112861 | Ga0070684_1001128612 | 327 |
| 519 | 3300005548 | Ga0070665_100230562 | Ga0070665_1002305622 | 327 |
| 520 | 3300005614 | Ga0068856_100147691 | Ga0068856_1001476913 | 327 |
| 521 | 3300005616 | Ga0068852_100017600 | Ga0068852_1000176002 | 327 |
| 522 | 3300005834 | Ga0068851_10049292 | Ga0068851_100492922 | 327 |
| 523 | 3300005937 | Ga0081455_10016498 | Ga0081455_100164983 | 327 |
| 524 | 3300005937 | Ga0081455_10018914 | Ga0081455_100189147 | 327 |
| 525 | 3300005983 | Ga0081540_1001561 | Ga0081540_10015614 | 327 |
| 526 | 3300005985 | Ga0081539_10000040 | Ga0081539_1000004014 | 327 |
| 527 | 3300006038 | Ga0075365_10000230 | Ga0075365_100002307 | 327 |
| 528 | 3300006048 | Ga0075363_100051359 | Ga0075363_1000513591 | 327 |
| 529 | 3300006175 | Ga0070712_100024020 | Ga0070712_1000240203 | 327 |
| 530 | 3300006177 | Ga0075362_10140496 | Ga0075362_101404961 | 327 |
| 531 | 3300006178 | Ga0075367_10040880 | Ga0075367_100408804 | 327 |
| 532 | 3300006881 | Ga0068865_100051894 | Ga0068865_1000518942 | 327 |
| 533 | 3300009093 | Ga0105240_10133219 | Ga0105240_101332192 | 327 |
| 534 | 3300009098 | Ga0105245_10108732 | Ga0105245_101087322 | 327 |
| 535 | 3300011119 | Ga0105246_10138697 | Ga0105246_101386972 | 327 |
| 536 | 3300013296 | Ga0157374_10007266 | Ga0157374_100072662 | 327 |
| 537 | 3300013297 | Ga0157378_10275946 | Ga0157378_102759462 | 327 |
| 538 | 3300013306 | Ga0163162_10058930 | Ga0163162_100589304 | 327 |
| 539 | 3300013306 | Ga0163162_10178735 | Ga0163162_101787353 | 327 |
| 540 | 3300013308 | Ga0157375_10156807 | Ga0157375_101568073 | 327 |
| 541 | 3300014325 | Ga0163163_10279135 | Ga0163163_102791353 | 327 |
| 542 | 3300014969 | Ga0157376_10108045 | Ga0157376_101080453 | 327 |
| 543 | 3300017792 | Ga0163161_10312521 | Ga0163161_103125212 | 327 |
| 544 | 3300025915 | Ga0207693_10015350 | Ga0207693_100153505 | 327 |
| 545 | 3300025916 | Ga0207663_10018460 | Ga0207663_100184603 | 327 |
| 546 | 3300025921 | Ga0207652_10038391 | Ga0207652_100383912 | 327 |
| 547 | 3300025929 | Ga0207664_10124051 | Ga0207664_101240511 | 327 |
| 548 | 3300025938 | Ga0207704_10014864 | Ga0207704_100148644 | 327 |
| 549 | 3300025939 | Ga0207665_10020658 | Ga0207665_100206583 | 327 |
| 550 | 3300025939 | Ga0207665_10095577 | Ga0207665_100955773 | 327 |
| 551 | 3300025939 | Ga0207665_10125637 | Ga0207665_101256372 | 327 |
| 552 | 3300025940 | Ga0207691_10285813 | Ga0207691_102858132 | 327 |
| 553 | 3300025942 | Ga0207689_10057354 | Ga0207689_100573543 | 327 |
| 554 | 3300025944 | Ga0207661_10010897 | Ga0207661_100108972 | 327 |
| 555 | 3300025944 | Ga0207661_10201049 | Ga0207661_102010492 | 327 |
| 556 | 3300026067 | Ga0207678_10022440 | Ga0207678_100224404 | 327 |
| 557 | 3300026116 | Ga0207674_10143540 | Ga0207674_101435402 | 327 |
| 558 | 3300026121 | Ga0207683_10017559 | Ga0207683_100175592 | 327 |
| 559 | 3300026121 | Ga0207683_10057950 | Ga0207683_100579503 | 327 |
| 560 | 3300026142 | Ga0207698_10027962 | Ga0207698_100279625 | 327 |
| 561 | 3300035170 | Ga0373943_0030259 | Ga0373943_0030259_1188_2174 | 327 |
| 562 | 3300037466 | Ga0395898_0109793 | Ga0395898_0109793_1157_2143 | 327 |
| 563 | 3300037471 | Ga0395905_0051982 | Ga0395905_0051982_975_1961 | 327 |
| 564 | 3300039450 | Ga0436363_0583495 | Ga0436363_0583495_348_1334 | 327 |
| 565 | 3300044684 | Ga0466966_0088054 | Ga0466966_0088054_56_1042 | 327 |
| 566 | 3300044693 | Ga0466961_0077546 | Ga0466961_0077546_1019_2005 | 327 |
| 567 | 3300044706 | Ga0466964_0076792 | Ga0466964_0076792_231_1217 | 327 |
| 568 | 3300044719 | Ga0466971_0025243 | Ga0466971_0025243_1480_2466 | 327 |
| 569 | 3300044842 | Ga0466957_0023546 | Ga0466957_0023546_1394_2380 | 327 |
| 570 | 3300045976 | Ga0466967_0372054 | Ga0466967_0372054_152_1138 | 327 |
| 571 | 3300046477 | Ga0495664_0009417 | Ga0495664_0009417_4357_5343 | 327 |
| 572 | 3300046507 | Ga0495606_0000234 | Ga0495606_0000234_9894_10880 | 327 |
| 573 | 3300046512 | Ga0495610_0061594 | Ga0495610_0061594_18_1004 | 327 |
| 574 | 3300046543 | Ga0495645_0007006 | Ga0495645_0007006_6311_7297 | 327 |
| 575 | 3300046678 | Ga0495599_0081125 | Ga0495599_0081125_217_1203 | 327 |
| 576 | 3300047320 | Ga0495672_0018857 | Ga0495672_0018857_951_1937 | 327 |
| 577 | 3300047472 | Ga0495686_0069667 | Ga0495686_0069667_676_1662 | 327 |
| 578 | 3300048903 | Ga0496100_0040777 | Ga0496100_0040777_887_1873 | 327 |
| 579 | 3300048904 | Ga0496101_0007477 | Ga0496101_0007477_5452_6438 | 327 |
| 580 | 3300048905 | Ga0496102_0001177 | Ga0496102_0001177_9426_10412 | 327 |
| 581 | 3300048907 | Ga0496104_0104398 | Ga0496104_0104398_789_1775 | 327 |
| 582 | 3300048908 | Ga0496105_0048912 | Ga0496105_0048912_1683_2669 | 327 |
| 583 | 3300048909 | Ga0496106_0037087 | Ga0496106_0037087_1226_2212 | 327 |
| 584 | 3300048911 | Ga0496108_0041867 | Ga0496108_0041867_224_1210 | 327 |
| 585 | 3300048912 | Ga0496109_0008835 | Ga0496109_0008835_3366_4352 | 327 |
| 586 | 3300048913 | Ga0496110_0014981 | Ga0496110_0014981_811_1797 | 327 |
| 587 | 3300048914 | Ga0496111_0035880 | Ga0496111_0035880_2457_3443 | 327 |
| 588 | 3300048915 | Ga0496112_0000051 | Ga0496112_0000051_47898_48884 | 327 |
| 589 | 3300048915 | Ga0496112_0145021 | Ga0496112_0145021_1047_2033 | 327 |
| 590 | 3300048916 | Ga0496113_0081284 | Ga0496113_0081284_838_1824 | 327 |
| 591 | 3300048917 | Ga0496114_0036732 | Ga0496114_0036732_2516_3502 | 327 |
| 592 | 3300048918 | Ga0496115_0003395 | Ga0496115_0003395_3645_4631 | 327 |
| 593 | 3300048918 | Ga0496115_0344973 | Ga0496115_0344973_59_1045 | 327 |
| 594 | 3300048924 | Ga0496121_0000091 | Ga0496121_0000091_68019_69005 | 327 |
| 595 | 3300048929 | Ga0496126_0013193 | Ga0496126_0013193_6133_7119 | 327 |
| 596 | 3300048929 | Ga0496126_0023656 | Ga0496126_0023656_356_1342 | 327 |
| 597 | 3300048929 | Ga0496126_0033644 | Ga0496126_0033644_759_1745 | 327 |
| 598 | 3300048929 | Ga0496126_0094056 | Ga0496126_0094056_342_1328 | 327 |
| 599 | 3300050492 | nmdc:mga0yw44_8056_c1 | nmdc:mga0yw44_8056_c1_3513_4499 | 327 |
| 600 | 3300050494 | nmdc:mga06z11_152157_c1 | nmdc:mga06z11_152157_c1_74_1060 | 327 |
| 601 | 3300050494 | nmdc:mga06z11_19961_c1 | nmdc:mga06z11_19961_c1_1992_2978 | 327 |
| 602 | 3300053119 | Ga0500595_014574 | Ga0500595_014574_1296_2282 | 327 |
| 603 | 3300053139 | Ga0500568_0093125 | Ga0500568_0093125_137_1123 | 327 |
| 604 | 3300003215 | JGI25153J46596_10007605 | JGI25153J46596_100076051 | 328 |
| 605 | 3300003215 | JGI25153J46596_10014183 | JGI25153J46596_100141833 | 328 |
| 606 | 3300003659 | JGI25404J52841_10020255 | JGI25404J52841_100202551 | 328 |
| 607 | 3300003752 | Ga0055539_1005620 | Ga0055539_10056202 | 328 |
| 608 | 3300003775 | Ga0055524_1025744 | Ga0055524_10257442 | 328 |
| 609 | 3300003794 | Ga0055531_10001969 | Ga0055531_100019696 | 328 |
| 610 | 3300004625 | Ga0055543_1007718 | Ga0055543_10077182 | 328 |
| 611 | 3300005262 | Ga0065165_1002418 | Ga0065165_100241810 | 328 |
| 612 | 3300005262 | Ga0065165_1004254 | Ga0065165_10042543 | 328 |
| 613 | 3300005327 | Ga0070658_10022210 | Ga0070658_100222102 | 328 |
| 614 | 3300005328 | Ga0070676_10007989 | Ga0070676_100079896 | 328 |
| 615 | 3300005329 | Ga0070683_100050728 | Ga0070683_1000507281 | 328 |
| 616 | 3300005329 | Ga0070683_100349627 | Ga0070683_1003496272 | 328 |
| 617 | 3300005336 | Ga0070680_100067985 | Ga0070680_1000679854 | 328 |
| 618 | 3300005336 | Ga0070680_100473476 | Ga0070680_1004734761 | 328 |
| 619 | 3300005339 | Ga0070660_100382763 | Ga0070660_1003827631 | 328 |
| 620 | 3300005340 | Ga0070689_100141027 | Ga0070689_1001410272 | 328 |
| 621 | 3300005344 | Ga0070661_100295139 | Ga0070661_1002951392 | 328 |
| 622 | 3300005344 | Ga0070661_100298027 | Ga0070661_1002980272 | 328 |
| 623 | 3300005345 | Ga0070692_10185132 | Ga0070692_101851321 | 328 |
| 624 | 3300005347 | Ga0070668_100015166 | Ga0070668_1000151665 | 328 |
| 625 | 3300005347 | Ga0070668_100016551 | Ga0070668_1000165515 | 328 |
| 626 | 3300005347 | Ga0070668_100192363 | Ga0070668_1001923631 | 328 |
| 627 | 3300005354 | Ga0070675_100291316 | Ga0070675_1002913162 | 328 |
| 628 | 3300005354 | Ga0070675_100445646 | Ga0070675_1004456461 | 328 |
| 629 | 3300005355 | Ga0070671_100013043 | Ga0070671_1000130433 | 328 |
| 630 | 3300005355 | Ga0070671_100264604 | Ga0070671_1002646042 | 328 |
| 631 | 3300005355 | Ga0070671_100370648 | Ga0070671_1003706482 | 328 |
| 632 | 3300005356 | Ga0070674_100038335 | Ga0070674_1000383353 | 328 |
| 633 | 3300005356 | Ga0070674_100052473 | Ga0070674_1000524733 | 328 |
| 634 | 3300005364 | Ga0070673_100251779 | Ga0070673_1002517792 | 328 |
| 635 | 3300005366 | Ga0070659_100060018 | Ga0070659_1000600183 | 328 |
| 636 | 3300005367 | Ga0070667_100025504 | Ga0070667_1000255044 | 328 |
| 637 | 3300005434 | Ga0070709_10006483 | Ga0070709_100064832 | 328 |
| 638 | 3300005434 | Ga0070709_10033865 | Ga0070709_100338651 | 328 |
| 639 | 3300005434 | Ga0070709_10107221 | Ga0070709_101072212 | 328 |
| 640 | 3300005435 | Ga0070714_100004001 | Ga0070714_10000400111 | 328 |
| 641 | 3300005435 | Ga0070714_100012654 | Ga0070714_1000126542 | 328 |
| 642 | 3300005435 | Ga0070714_100155992 | Ga0070714_1001559921 | 328 |
| 643 | 3300005435 | Ga0070714_100559230 | Ga0070714_1005592301 | 328 |
| 644 | 3300005436 | Ga0070713_100006580 | Ga0070713_1000065809 | 328 |
| 645 | 3300005436 | Ga0070713_100055790 | Ga0070713_1000557904 | 328 |
| 646 | 3300005436 | Ga0070713_100080610 | Ga0070713_1000806102 | 328 |
| 647 | 3300005437 | Ga0070710_10015416 | Ga0070710_100154162 | 328 |
| 648 | 3300005437 | Ga0070710_10070845 | Ga0070710_100708451 | 328 |
| 649 | 3300005439 | Ga0070711_100002404 | Ga0070711_1000024047 | 328 |
| 650 | 3300005439 | Ga0070711_100023994 | Ga0070711_1000239943 | 328 |
| 651 | 3300005439 | Ga0070711_100200420 | Ga0070711_1002004201 | 328 |
| 652 | 3300005440 | Ga0070705_100040255 | Ga0070705_1000402552 | 328 |
| 653 | 3300005445 | Ga0070708_100061161 | Ga0070708_1000611612 | 328 |
| 654 | 3300005455 | Ga0070663_100089732 | Ga0070663_1000897321 | 328 |
| 655 | 3300005455 | Ga0070663_100119546 | Ga0070663_1001195462 | 328 |
| 656 | 3300005455 | Ga0070663_100216284 | Ga0070663_1002162842 | 328 |
| 657 | 3300005456 | Ga0070678_100369908 | Ga0070678_1003699082 | 328 |
| 658 | 3300005458 | Ga0070681_10009562 | Ga0070681_100095629 | 328 |
| 659 | 3300005458 | Ga0070681_10058567 | Ga0070681_100585674 | 328 |
| 660 | 3300005467 | Ga0070706_100206761 | Ga0070706_1002067612 | 328 |
| 661 | 3300005468 | Ga0070707_100039062 | Ga0070707_1000390622 | 328 |
| 662 | 3300005530 | Ga0070679_100022307 | Ga0070679_1000223077 | 328 |
| 663 | 3300005530 | Ga0070679_100106676 | Ga0070679_1001066762 | 328 |
| 664 | 3300005530 | Ga0070679_100327180 | Ga0070679_1003271802 | 328 |
| 665 | 3300005535 | Ga0070684_100011463 | Ga0070684_1000114636 | 328 |
| 666 | 3300005536 | Ga0070697_100156128 | Ga0070697_1001561282 | 328 |
| 667 | 3300005539 | Ga0068853_100038220 | Ga0068853_1000382202 | 328 |
| 668 | 3300005539 | Ga0068853_100122686 | Ga0068853_1001226862 | 328 |
| 669 | 3300005539 | Ga0068853_100156671 | Ga0068853_1001566712 | 328 |
| 670 | 3300005539 | Ga0068853_100387183 | Ga0068853_1003871832 | 328 |
| 671 | 3300005543 | Ga0070672_100282173 | Ga0070672_1002821732 | 328 |
| 672 | 3300005546 | Ga0070696_100122749 | Ga0070696_1001227492 | 328 |
| 673 | 3300005547 | Ga0070693_100126214 | Ga0070693_1001262142 | 328 |
| 674 | 3300005548 | Ga0070665_100113564 | Ga0070665_1001135642 | 328 |
| 675 | 3300005549 | Ga0070704_100145198 | Ga0070704_1001451982 | 328 |
| 676 | 3300005563 | Ga0068855_100025942 | Ga0068855_1000259426 | 328 |
| 677 | 3300005564 | Ga0070664_100143577 | Ga0070664_1001435772 | 328 |
| 678 | 3300005564 | Ga0070664_100345887 | Ga0070664_1003458872 | 328 |
| 679 | 3300005578 | Ga0068854_100085691 | Ga0068854_1000856913 | 328 |
| 680 | 3300005614 | Ga0068856_100050275 | Ga0068856_1000502755 | 328 |
| 681 | 3300005614 | Ga0068856_100151030 | Ga0068856_1001510302 | 328 |
| 682 | 3300005614 | Ga0068856_100209451 | Ga0068856_1002094512 | 328 |
| 683 | 3300005616 | Ga0068852_100027985 | Ga0068852_1000279852 | 328 |
| 684 | 3300005617 | Ga0068859_100160315 | Ga0068859_1001603152 | 328 |
| 685 | 3300005618 | Ga0068864_100041943 | Ga0068864_1000419435 | 328 |
| 686 | 3300005618 | Ga0068864_100133125 | Ga0068864_1001331252 | 328 |
| 687 | 3300005719 | Ga0068861_100059504 | Ga0068861_1000595042 | 328 |
| 688 | 3300005719 | Ga0068861_100229769 | Ga0068861_1002297692 | 328 |
| 689 | 3300005840 | Ga0068870_10060797 | Ga0068870_100607972 | 328 |
| 690 | 3300005841 | Ga0068863_100049355 | Ga0068863_1000493554 | 328 |
| 691 | 3300005841 | Ga0068863_100278379 | Ga0068863_1002783792 | 328 |
| 692 | 3300005842 | Ga0068858_100039032 | Ga0068858_1000390325 | 328 |
| 693 | 3300005842 | Ga0068858_100115183 | Ga0068858_1001151832 | 328 |
| 694 | 3300005842 | Ga0068858_100165975 | Ga0068858_1001659753 | 328 |
| 695 | 3300005842 | Ga0068858_100213226 | Ga0068858_1002132262 | 328 |
| 696 | 3300005842 | Ga0068858_100453615 | Ga0068858_1004536152 | 328 |
| 697 | 3300005843 | Ga0068860_100001070 | Ga0068860_10000107016 | 328 |
| 698 | 3300005844 | Ga0068862_100123022 | Ga0068862_1001230223 | 328 |
| 699 | 3300005844 | Ga0068862_100193688 | Ga0068862_1001936882 | 328 |
| 700 | 3300005937 | Ga0081455_10003639 | Ga0081455_100036399 | 328 |
| 701 | 3300005937 | Ga0081455_10023899 | Ga0081455_100238996 | 328 |
| 702 | 3300005983 | Ga0081540_1002615 | Ga0081540_10026157 | 328 |
| 703 | 3300005983 | Ga0081540_1003198 | Ga0081540_10031984 | 328 |
| 704 | 3300005983 | Ga0081540_1003591 | Ga0081540_100359113 | 328 |
| 705 | 3300005983 | Ga0081540_1011508 | Ga0081540_10115086 | 328 |
| 706 | 3300005983 | Ga0081540_1016877 | Ga0081540_10168774 | 328 |
| 707 | 3300005983 | Ga0081540_1098118 | Ga0081540_10981181 | 328 |
| 708 | 3300005983 | Ga0081540_1098526 | Ga0081540_10985262 | 328 |
| 709 | 3300005985 | Ga0081539_10010272 | Ga0081539_1001027211 | 328 |
| 710 | 3300006028 | Ga0070717_10042834 | Ga0070717_100428341 | 328 |
| 711 | 3300006028 | Ga0070717_10066529 | Ga0070717_100665294 | 328 |
| 712 | 3300006038 | Ga0075365_10043037 | Ga0075365_100430373 | 328 |
| 713 | 3300006038 | Ga0075365_10066569 | Ga0075365_100665693 | 328 |
| 714 | 3300006038 | Ga0075365_10111342 | Ga0075365_101113422 | 328 |
| 715 | 3300006038 | Ga0075365_10233866 | Ga0075365_102338662 | 328 |
| 716 | 3300006042 | Ga0075368_10043216 | Ga0075368_100432162 | 328 |
| 717 | 3300006048 | Ga0075363_100026974 | Ga0075363_1000269742 | 328 |
| 718 | 3300006163 | Ga0070715_10083250 | Ga0070715_100832501 | 328 |
| 719 | 3300006173 | Ga0070716_100009512 | Ga0070716_1000095122 | 328 |
| 720 | 3300006173 | Ga0070716_100055019 | Ga0070716_1000550192 | 328 |
| 721 | 3300006173 | Ga0070716_100238052 | Ga0070716_1002380522 | 328 |
| 722 | 3300006175 | Ga0070712_100009393 | Ga0070712_1000093937 | 328 |
| 723 | 3300006175 | Ga0070712_100073619 | Ga0070712_1000736193 | 328 |
| 724 | 3300006177 | Ga0075362_10058839 | Ga0075362_100588392 | 328 |
| 725 | 3300006178 | Ga0075367_10151234 | Ga0075367_101512341 | 328 |
| 726 | 3300006186 | Ga0075369_10082099 | Ga0075369_100820992 | 328 |
| 727 | 3300006237 | Ga0097621_100076401 | Ga0097621_1000764013 | 328 |
| 728 | 3300006237 | Ga0097621_100223747 | Ga0097621_1002237472 | 328 |
| 729 | 3300006353 | Ga0075370_10047914 | Ga0075370_100479141 | 328 |
| 730 | 3300006358 | Ga0068871_100313797 | Ga0068871_1003137972 | 328 |
| 731 | 3300006358 | Ga0068871_100341879 | Ga0068871_1003418792 | 328 |
| 732 | 3300006844 | Ga0075428_100152807 | Ga0075428_1001528073 | 328 |
| 733 | 3300006881 | Ga0068865_100192205 | Ga0068865_1001922052 | 328 |
| 734 | 3300006881 | Ga0068865_100240795 | Ga0068865_1002407952 | 328 |
| 735 | 3300006931 | Ga0097620_100160321 | Ga0097620_1001603213 | 328 |
| 736 | 3300006942 | Ga0099824_1016377 | Ga0099824_10163776 | 328 |
| 737 | 3300006944 | Ga0099823_1037534 | Ga0099823_10375344 | 328 |
| 738 | 3300007076 | Ga0075435_100035211 | Ga0075435_1000352113 | 328 |
| 739 | 3300007265 | Ga0099794_10023536 | Ga0099794_100235362 | 328 |
| 740 | 3300007265 | Ga0099794_10185797 | Ga0099794_101857971 | 328 |
| 741 | 3300007788 | Ga0099795_10009237 | Ga0099795_100092372 | 328 |
| 742 | 3300007788 | Ga0099795_10014635 | Ga0099795_100146352 | 328 |
| 743 | 3300009093 | Ga0105240_10034054 | Ga0105240_100340545 | 328 |
| 744 | 3300009093 | Ga0105240_10046615 | Ga0105240_100466155 | 328 |
| 745 | 3300009093 | Ga0105240_10088594 | Ga0105240_100885945 | 328 |
| 746 | 3300009094 | Ga0111539_10036660 | Ga0111539_100366602 | 328 |
| 747 | 3300009101 | Ga0105247_10048921 | Ga0105247_100489212 | 328 |
| 748 | 3300009101 | Ga0105247_10301216 | Ga0105247_103012162 | 328 |
| 749 | 3300009147 | Ga0114129_10089335 | Ga0114129_100893354 | 328 |
| 750 | 3300009148 | Ga0105243_10074455 | Ga0105243_100744553 | 328 |
| 751 | 3300009174 | Ga0105241_10074950 | Ga0105241_100749502 | 328 |
| 752 | 3300009174 | Ga0105241_10134760 | Ga0105241_101347602 | 328 |
| 753 | 3300009174 | Ga0105241_10396602 | Ga0105241_103966022 | 328 |
| 754 | 3300009176 | Ga0105242_10058731 | Ga0105242_100587312 | 328 |
| 755 | 3300009545 | Ga0105237_10002092 | Ga0105237_1000209214 | 328 |
| 756 | 3300009545 | Ga0105237_10023476 | Ga0105237_100234767 | 328 |
| 757 | 3300009545 | Ga0105237_10036215 | Ga0105237_100362154 | 328 |
| 758 | 3300009545 | Ga0105237_10139508 | Ga0105237_101395081 | 328 |
| 759 | 3300009553 | Ga0105249_10041299 | Ga0105249_100412994 | 328 |
| 760 | 3300009553 | Ga0105249_10121599 | Ga0105249_101215992 | 328 |
| 761 | 3300010159 | Ga0099796_10020991 | Ga0099796_100209912 | 328 |
| 762 | 3300010375 | Ga0105239_10053186 | Ga0105239_100531864 | 328 |
| 763 | 3300010375 | Ga0105239_10065469 | Ga0105239_100654694 | 328 |
| 764 | 3300010375 | Ga0105239_10373033 | Ga0105239_103730332 | 328 |
| 765 | 3300013104 | Ga0157370_10029759 | Ga0157370_100297594 | 328 |
| 766 | 3300013105 | Ga0157369_10014863 | Ga0157369_100148637 | 328 |
| 767 | 3300013105 | Ga0157369_10078819 | Ga0157369_100788194 | 328 |
| 768 | 3300013297 | Ga0157378_10367787 | Ga0157378_103677872 | 328 |
| 769 | 3300014325 | Ga0163163_10032478 | Ga0163163_100324785 | 328 |
| 770 | 3300014325 | Ga0163163_10112864 | Ga0163163_101128642 | 328 |
| 771 | 3300014968 | Ga0157379_10147786 | Ga0157379_101477862 | 328 |
| 772 | 3300020070 | Ga0206356_10611048 | Ga0206356_106110482 | 328 |
| 773 | 3300021320 | Ga0214544_1000007 | Ga0214544_100000759 | 328 |
| 774 | 3300021321 | Ga0214542_1000216 | Ga0214542_100021632 | 328 |
| 775 | 3300021324 | Ga0214545_1000118 | Ga0214545_100011859 | 328 |
| 776 | 3300021327 | Ga0214543_1000009 | Ga0214543_100000959 | 328 |
| 777 | 3300021361 | Ga0213872_10022262 | Ga0213872_100222623 | 328 |
| 778 | 3300025230 | Ga0209563_101733 | Ga0209563_1017333 | 328 |
| 779 | 3300025253 | Ga0209677_100395 | Ga0209677_10039510 | 328 |
| 780 | 3300025253 | Ga0209677_101305 | Ga0209677_10130510 | 328 |
| 781 | 3300025254 | Ga0209148_1000388 | Ga0209148_100038834 | 328 |
| 782 | 3300025254 | Ga0209148_1007027 | Ga0209148_10070273 | 328 |
| 783 | 3300025261 | Ga0209233_1000949 | Ga0209233_10009492 | 328 |
| 784 | 3300025261 | Ga0209233_1002242 | Ga0209233_10022427 | 328 |
| 785 | 3300025261 | Ga0209233_1019667 | Ga0209233_10196672 | 328 |
| 786 | 3300025272 | Ga0209455_1007359 | Ga0209455_10073593 | 328 |
| 787 | 3300025295 | Ga0209564_1018635 | Ga0209564_10186353 | 328 |
| 788 | 3300025297 | Ga0209758_1000030 | Ga0209758_1000030278 | 328 |
| 789 | 3300025297 | Ga0209758_1000429 | Ga0209758_100042921 | 328 |
| 790 | 3300025297 | Ga0209758_1001015 | Ga0209758_100101535 | 328 |
| 791 | 3300025297 | Ga0209758_1002652 | Ga0209758_100265212 | 328 |
| 792 | 3300025297 | Ga0209758_1003562 | Ga0209758_10035622 | 328 |
| 793 | 3300025299 | Ga0209256_1003190 | Ga0209256_10031904 | 328 |
| 794 | 3300025302 | Ga0207426_1000347 | Ga0207426_100034751 | 328 |
| 795 | 3300025302 | Ga0207426_1001408 | Ga0207426_10014084 | 328 |
| 796 | 3300025302 | Ga0207426_1003607 | Ga0207426_10036072 | 328 |
| 797 | 3300025304 | Ga0209257_1004526 | Ga0209257_10045268 | 328 |
| 798 | 3300025321 | Ga0207656_10024823 | Ga0207656_100248233 | 328 |
| 799 | 3300025885 | Ga0207653_10014357 | Ga0207653_100143573 | 328 |
| 800 | 3300025898 | Ga0207692_10000213 | Ga0207692_1000021317 | 328 |
| 801 | 3300025898 | Ga0207692_10034398 | Ga0207692_100343982 | 328 |
| 802 | 3300025900 | Ga0207710_10031263 | Ga0207710_100312632 | 328 |
| 803 | 3300025906 | Ga0207699_10035638 | Ga0207699_100356382 | 328 |
| 804 | 3300025906 | Ga0207699_10040885 | Ga0207699_100408851 | 328 |
| 805 | 3300025906 | Ga0207699_10149410 | Ga0207699_101494102 | 328 |
| 806 | 3300025907 | Ga0207645_10048434 | Ga0207645_100484344 | 328 |
| 807 | 3300025908 | Ga0207643_10185510 | Ga0207643_101855102 | 328 |
| 808 | 3300025909 | Ga0207705_10034575 | Ga0207705_100345753 | 328 |
| 809 | 3300025911 | Ga0207654_10050613 | Ga0207654_100506133 | 328 |
| 810 | 3300025911 | Ga0207654_10099770 | Ga0207654_100997702 | 328 |
| 811 | 3300025912 | Ga0207707_10000398 | Ga0207707_100003989 | 328 |
| 812 | 3300025912 | Ga0207707_10024840 | Ga0207707_100248405 | 328 |
| 813 | 3300025912 | Ga0207707_10063900 | Ga0207707_100639002 | 328 |
| 814 | 3300025912 | Ga0207707_10081956 | Ga0207707_100819562 | 328 |
| 815 | 3300025913 | Ga0207695_10000006 | Ga0207695_1000000640 | 328 |
| 816 | 3300025914 | Ga0207671_10013114 | Ga0207671_100131147 | 328 |
| 817 | 3300025914 | Ga0207671_10018633 | Ga0207671_100186334 | 328 |
| 818 | 3300025914 | Ga0207671_10146459 | Ga0207671_101464592 | 328 |
| 819 | 3300025914 | Ga0207671_10160882 | Ga0207671_101608822 | 328 |
| 820 | 3300025914 | Ga0207671_10214977 | Ga0207671_102149772 | 328 |
| 821 | 3300025915 | Ga0207693_10120128 | Ga0207693_101201282 | 328 |
| 822 | 3300025916 | Ga0207663_10000167 | Ga0207663_1000016728 | 328 |
| 823 | 3300025916 | Ga0207663_10009487 | Ga0207663_100094873 | 328 |
| 824 | 3300025916 | Ga0207663_10250868 | Ga0207663_102508682 | 328 |
| 825 | 3300025917 | Ga0207660_10003186 | Ga0207660_100031862 | 328 |
| 826 | 3300025917 | Ga0207660_10095433 | Ga0207660_100954331 | 328 |
| 827 | 3300025919 | Ga0207657_10020195 | Ga0207657_100201957 | 328 |
| 828 | 3300025919 | Ga0207657_10076584 | Ga0207657_100765842 | 328 |
| 829 | 3300025919 | Ga0207657_10169523 | Ga0207657_101695232 | 328 |
| 830 | 3300025920 | Ga0207649_10158912 | Ga0207649_101589122 | 328 |
| 831 | 3300025920 | Ga0207649_10166512 | Ga0207649_101665122 | 328 |
| 832 | 3300025921 | Ga0207652_10014407 | Ga0207652_100144078 | 328 |
| 833 | 3300025921 | Ga0207652_10041401 | Ga0207652_100414012 | 328 |
| 834 | 3300025921 | Ga0207652_10074840 | Ga0207652_100748402 | 328 |
| 835 | 3300025921 | Ga0207652_10108192 | Ga0207652_101081923 | 328 |
| 836 | 3300025922 | Ga0207646_10038053 | Ga0207646_100380533 | 328 |
| 837 | 3300025923 | Ga0207681_10127401 | Ga0207681_101274012 | 328 |
| 838 | 3300025926 | Ga0207659_10403621 | Ga0207659_104036211 | 328 |
| 839 | 3300025927 | Ga0207687_10142316 | Ga0207687_101423162 | 328 |
| 840 | 3300025928 | Ga0207700_10038034 | Ga0207700_100380342 | 328 |
| 841 | 3300025928 | Ga0207700_10047186 | Ga0207700_100471863 | 328 |
| 842 | 3300025928 | Ga0207700_10053226 | Ga0207700_100532264 | 328 |
| 843 | 3300025929 | Ga0207664_10159517 | Ga0207664_101595172 | 328 |
| 844 | 3300025929 | Ga0207664_10202228 | Ga0207664_102022282 | 328 |
| 845 | 3300025931 | Ga0207644_10183029 | Ga0207644_101830292 | 328 |
| 846 | 3300025932 | Ga0207690_10042002 | Ga0207690_100420023 | 328 |
| 847 | 3300025933 | Ga0207706_10034285 | Ga0207706_100342855 | 328 |
| 848 | 3300025933 | Ga0207706_10037506 | Ga0207706_100375065 | 328 |
| 849 | 3300025934 | Ga0207686_10092473 | Ga0207686_100924732 | 328 |
| 850 | 3300025937 | Ga0207669_10179405 | Ga0207669_101794052 | 328 |
| 851 | 3300025938 | Ga0207704_10205136 | Ga0207704_102051362 | 328 |
| 852 | 3300025939 | Ga0207665_10001098 | Ga0207665_100010986 | 328 |
| 853 | 3300025939 | Ga0207665_10149912 | Ga0207665_101499122 | 328 |
| 854 | 3300025940 | Ga0207691_10281564 | Ga0207691_102815641 | 328 |
| 855 | 3300025941 | Ga0207711_10281964 | Ga0207711_102819642 | 328 |
| 856 | 3300025942 | Ga0207689_10046448 | Ga0207689_100464484 | 328 |
| 857 | 3300025942 | Ga0207689_10059449 | Ga0207689_100594493 | 328 |
| 858 | 3300025944 | Ga0207661_10025129 | Ga0207661_100251293 | 328 |
| 859 | 3300025945 | Ga0207679_10231633 | Ga0207679_102316332 | 328 |
| 860 | 3300025949 | Ga0207667_10027659 | Ga0207667_100276595 | 328 |
| 861 | 3300025949 | Ga0207667_10317256 | Ga0207667_103172562 | 328 |
| 862 | 3300025960 | Ga0207651_10205511 | Ga0207651_102055112 | 328 |
| 863 | 3300025972 | Ga0207668_10141199 | Ga0207668_101411992 | 328 |
| 864 | 3300025972 | Ga0207668_10161880 | Ga0207668_101618802 | 328 |
| 865 | 3300025972 | Ga0207668_10251917 | Ga0207668_102519172 | 328 |
| 866 | 3300025981 | Ga0207640_10100200 | Ga0207640_101002002 | 328 |
| 867 | 3300025981 | Ga0207640_10195500 | Ga0207640_101955002 | 328 |
| 868 | 3300026035 | Ga0207703_10213157 | Ga0207703_102131572 | 328 |
| 869 | 3300026035 | Ga0207703_10227884 | Ga0207703_102278842 | 328 |
| 870 | 3300026035 | Ga0207703_10354502 | Ga0207703_103545022 | 328 |
| 871 | 3300026041 | Ga0207639_10038411 | Ga0207639_100384113 | 328 |
| 872 | 3300026041 | Ga0207639_10075127 | Ga0207639_100751272 | 328 |
| 873 | 3300026041 | Ga0207639_10171307 | Ga0207639_101713072 | 328 |
| 874 | 3300026041 | Ga0207639_10209354 | Ga0207639_102093542 | 328 |
| 875 | 3300026041 | Ga0207639_10242035 | Ga0207639_102420352 | 328 |
| 876 | 3300026067 | Ga0207678_10065204 | Ga0207678_100652043 | 328 |
| 877 | 3300026067 | Ga0207678_10107187 | Ga0207678_101071872 | 328 |
| 878 | 3300026067 | Ga0207678_10235605 | Ga0207678_102356052 | 328 |
| 879 | 3300026067 | Ga0207678_10438878 | Ga0207678_104388781 | 328 |
| 880 | 3300026075 | Ga0207708_10088023 | Ga0207708_100880232 | 328 |
| 881 | 3300026078 | Ga0207702_10023961 | Ga0207702_100239612 | 328 |
| 882 | 3300026078 | Ga0207702_10205087 | Ga0207702_102050872 | 328 |
| 883 | 3300026088 | Ga0207641_10038292 | Ga0207641_100382922 | 328 |
| 884 | 3300026088 | Ga0207641_10358752 | Ga0207641_103587522 | 328 |
| 885 | 3300026095 | Ga0207676_10229465 | Ga0207676_102294652 | 328 |
| 886 | 3300026118 | Ga0207675_100025313 | Ga0207675_1000253136 | 328 |
| 887 | 3300026118 | Ga0207675_100049103 | Ga0207675_1000491034 | 328 |
| 888 | 3300026121 | Ga0207683_10178146 | Ga0207683_101781462 | 328 |
| 889 | 3300026121 | Ga0207683_10381196 | Ga0207683_103811962 | 328 |
| 890 | 3300026142 | Ga0207698_10170342 | Ga0207698_101703422 | 328 |
| 891 | 3300027296 | Ga0209389_1000015 | Ga0209389_100001580 | 328 |
| 892 | 3300027296 | Ga0209389_1000035 | Ga0209389_100003591 | 328 |
| 893 | 3300027357 | Ga0209589_1000039 | Ga0209589_100003991 | 328 |
| 894 | 3300027361 | Ga0209489_100072 | Ga0209489_10007241 | 328 |
| 895 | 3300027361 | Ga0209489_100084 | Ga0209489_10008491 | 328 |
| 896 | 3300027363 | Ga0209700_100034 | Ga0209700_100034103 | 328 |
| 897 | 3300027512 | Ga0209179_1014575 | Ga0209179_10145752 | 328 |
| 898 | 3300027512 | Ga0209179_1017579 | Ga0209179_10175792 | 328 |
| 899 | 3300028379 | Ga0268266_10007778 | Ga0268266_100077784 | 328 |
| 900 | 3300028379 | Ga0268266_10008893 | Ga0268266_100088937 | 328 |
| 901 | 3300028381 | Ga0268264_10000107 | Ga0268264_1000010713 | 328 |
| 902 | 3300028786 | Ga0307517_10001780 | Ga0307517_1000178019 | 328 |
| 903 | 3300028794 | Ga0307515_10054512 | Ga0307515_100545124 | 328 |
| 904 | 3300031235 | Ga0265330_10021950 | Ga0265330_100219501 | 328 |
| 905 | 3300031238 | Ga0265332_10006675 | Ga0265332_100066755 | 328 |
| 906 | 3300031241 | Ga0265325_10058919 | Ga0265325_100589192 | 328 |
| 907 | 3300031247 | Ga0265340_10054987 | Ga0265340_100549872 | 328 |
| 908 | 3300031249 | Ga0265339_10000326 | Ga0265339_1000032620 | 328 |
| 909 | 3300031249 | Ga0265339_10006252 | Ga0265339_100062524 | 328 |
| 910 | 3300031249 | Ga0265339_10119973 | Ga0265339_101199732 | 328 |
| 911 | 3300031250 | Ga0265331_10017323 | Ga0265331_100173232 | 328 |
| 912 | 3300031344 | Ga0265316_10036469 | Ga0265316_100364693 | 328 |
| 913 | 3300031456 | Ga0307513_10066655 | Ga0307513_100666555 | 328 |
| 914 | 3300031548 | Ga0307408_100403235 | Ga0307408_1004032351 | 328 |
| 915 | 3300031616 | Ga0307508_10000088 | Ga0307508_1000008870 | 328 |
| 916 | 3300031616 | Ga0307508_10033626 | Ga0307508_100336263 | 328 |
| 917 | 3300031616 | Ga0307508_10089914 | Ga0307508_100899142 | 328 |
| 918 | 3300031616 | Ga0307508_10187216 | Ga0307508_101872162 | 328 |
| 919 | 3300031711 | Ga0265314_10013803 | Ga0265314_100138032 | 328 |
| 920 | 3300031712 | Ga0265342_10007871 | Ga0265342_100078718 | 328 |
| 921 | 3300031730 | Ga0307516_10008774 | Ga0307516_1000877411 | 328 |
| 922 | 3300031730 | Ga0307516_10042852 | Ga0307516_100428523 | 328 |
| 923 | 3300031731 | Ga0307405_10191561 | Ga0307405_101915612 | 328 |
| 924 | 3300032002 | Ga0307416_100160220 | Ga0307416_1001602202 | 328 |
| 925 | 3300032002 | Ga0307416_100232550 | Ga0307416_1002325502 | 328 |
| 926 | 3300032005 | Ga0307411_10141884 | Ga0307411_101418842 | 328 |
| 927 | 3300032126 | Ga0307415_100069402 | Ga0307415_1000694022 | 328 |
| 928 | 3300032126 | Ga0307415_100091856 | Ga0307415_1000918561 | 328 |
| 929 | 3300033179 | Ga0307507_10068020 | Ga0307507_100680202 | 328 |
| 930 | 3300033180 | Ga0307510_10017889 | Ga0307510_100178896 | 328 |
| 931 | 3300033180 | Ga0307510_10076564 | Ga0307510_100765642 | 328 |
| 932 | 3300033180 | Ga0307510_10103456 | Ga0307510_101034562 | 328 |
| 933 | 3300033180 | Ga0307510_10112752 | Ga0307510_101127522 | 328 |
| 934 | 3300035085 | Ga0373929_0025195 | Ga0373929_0025195_52_1041 | 328 |
| 935 | 3300035086 | Ga0373934_0010050 | Ga0373934_0010050_540_1529 | 328 |
| 936 | 3300035111 | Ga0373923_0000546 | Ga0373923_0000546_665_1654 | 328 |
| 937 | 3300035111 | Ga0373923_0041206 | Ga0373923_0041206_523_1512 | 328 |
| 938 | 3300035113 | Ga0373936_0020991 | Ga0373936_0020991_155_1144 | 328 |
| 939 | 3300035113 | Ga0373936_0059115 | Ga0373936_0059115_51_1040 | 328 |
| 940 | 3300035116 | Ga0373945_0014927 | Ga0373945_0014927_961_1950 | 328 |
| 941 | 3300035117 | Ga0373953_0027393 | Ga0373953_0027393_124_1113 | 328 |
| 942 | 3300035118 | Ga0373954_0000782 | Ga0373954_0000782_7887_8876 | 328 |
| 943 | 3300035118 | Ga0373954_0011586 | Ga0373954_0011586_2187_3176 | 328 |
| 944 | 3300035118 | Ga0373954_0043866 | Ga0373954_0043866_441_1430 | 328 |
| 945 | 3300035119 | Ga0373956_0033694 | Ga0373956_0033694_477_1466 | 328 |
| 946 | 3300035119 | Ga0373956_0065721 | Ga0373956_0065721_309_1298 | 328 |
| 947 | 3300035120 | Ga0373957_0009651 | Ga0373957_0009651_45_1034 | 328 |
| 948 | 3300035170 | Ga0373943_0001276 | Ga0373943_0001276_1079_2068 | 328 |
| 949 | 3300035170 | Ga0373943_0034911 | Ga0373943_0034911_436_1425 | 328 |
| 950 | 3300035171 | Ga0373946_0026191 | Ga0373946_0026191_614_1603 | 328 |
| 951 | 3300035172 | Ga0373955_0002870 | Ga0373955_0002870_1431_2420 | 328 |
| 952 | 3300035172 | Ga0373955_0034153 | Ga0373955_0034153_1341_2330 | 328 |
| 953 | 3300035410 | Ga0373924_0001544 | Ga0373924_0001544_4679_5668 | 328 |
| 954 | 3300035410 | Ga0373924_0055987 | Ga0373924_0055987_154_1143 | 328 |
| 955 | 3300035691 | Ga0373931_0009956 | Ga0373931_0009956_3534_4523 | 328 |
| 956 | 3300035692 | Ga0373935_0002629 | Ga0373935_0002629_8699_9688 | 328 |
| 957 | 3300035692 | Ga0373935_0032233 | Ga0373935_0032233_412_1401 | 328 |
| 958 | 3300035692 | Ga0373935_0117670 | Ga0373935_0117670_431_1420 | 328 |
| 959 | 3300035695 | Ga0373927_0000136 | Ga0373927_0000136_46828_47817 | 328 |
| 960 | 3300035695 | Ga0373927_0017818 | Ga0373927_0017818_3130_4119 | 328 |
| 961 | 3300035695 | Ga0373927_0047249 | Ga0373927_0047249_1385_2374 | 328 |
| 962 | 3300035695 | Ga0373927_0102789 | Ga0373927_0102789_534_1523 | 328 |
| 963 | 3300035724 | Ga0373933_0000160 | Ga0373933_0000160_17256_18245 | 328 |
| 964 | 3300035724 | Ga0373933_0001268 | Ga0373933_0001268_8425_9414 | 328 |
| 965 | 3300035724 | Ga0373933_0026697 | Ga0373933_0026697_1018_2007 | 328 |
| 966 | 3300035724 | Ga0373933_0140529 | Ga0373933_0140529_524_1513 | 328 |
| 967 | 3300035725 | Ga0373947_0008188 | Ga0373947_0008188_859_1848 | 328 |
| 968 | 3300035725 | Ga0373947_0008868 | Ga0373947_0008868_2883_3872 | 328 |
| 969 | 3300035725 | Ga0373947_0009170 | Ga0373947_0009170_1638_2627 | 328 |
| 970 | 3300035725 | Ga0373947_0031678 | Ga0373947_0031678_480_1469 | 328 |
| 971 | 3300036401 | Ga0373937_0007853 | Ga0373937_0007853_6173_7162 | 328 |
| 972 | 3300036401 | Ga0373937_0011985 | Ga0373937_0011985_1569_2558 | 328 |
| 973 | 3300037068 | Ga0373925_0001167 | Ga0373925_0001167_14134_15123 | 328 |
| 974 | 3300037068 | Ga0373925_0026045 | Ga0373925_0026045_831_1820 | 328 |
| 975 | 3300037068 | Ga0373925_0063889 | Ga0373925_0063889_1618_2607 | 328 |
| 976 | 3300037418 | Ga0395900_0001546 | Ga0395900_0001546_6818_7807 | 328 |
| 977 | 3300037466 | Ga0395898_0002015 | Ga0395898_0002015_4844_5833 | 328 |
| 978 | 3300037471 | Ga0395905_0003722 | Ga0395905_0003722_13800_14789 | 328 |
| 979 | 3300039447 | Ga0436361_0935166 | Ga0436361_0935166_2970_3959 | 328 |
| 980 | 3300039450 | Ga0436363_0101344 | Ga0436363_0101344_864_1853 | 328 |
| 981 | 3300044658 | Ga0466972_0000048 | Ga0466972_0000048_61654_62643 | 328 |
| 982 | 3300044658 | Ga0466972_0005127 | Ga0466972_0005127_4417_5406 | 328 |
| 983 | 3300044684 | Ga0466966_0000542 | Ga0466966_0000542_7532_8521 | 328 |
| 984 | 3300044693 | Ga0466961_0000018 | Ga0466961_0000018_56068_57057 | 328 |
| 985 | 3300044694 | Ga0466963_0007846 | Ga0466963_0007846_3543_4532 | 328 |
| 986 | 3300044719 | Ga0466971_0041232 | Ga0466971_0041232_703_1692 | 328 |
| 987 | 3300044901 | Ga0466960_0008711 | Ga0466960_0008711_1707_2696 | 328 |
| 988 | 3300044901 | Ga0466960_0058540 | Ga0466960_0058540_34_1023 | 328 |
| 989 | 3300045049 | Ga0466959_0017920 | Ga0466959_0017920_2576_3565 | 328 |
| 990 | 3300045976 | Ga0466967_0022021 | Ga0466967_0022021_2507_3496 | 328 |
| 991 | 3300045976 | Ga0466967_0059151 | Ga0466967_0059151_1912_2901 | 328 |
| 992 | 3300045976 | Ga0466967_0238754 | Ga0466967_0238754_299_1288 | 328 |
| 993 | 3300046454 | Ga0495592_0001707 | Ga0495592_0001707_9412_10401 | 328 |
| 994 | 3300046454 | Ga0495592_0012511 | Ga0495592_0012511_501_1490 | 328 |
| 995 | 3300046454 | Ga0495592_0030832 | Ga0495592_0030832_145_1134 | 328 |
| 996 | 3300046455 | Ga0495603_0000019 | Ga0495603_0000019_42341_43330 | 328 |
| 997 | 3300046455 | Ga0495603_0019786 | Ga0495603_0019786_1134_2123 | 328 |
| 998 | 3300046459 | Ga0495629_0000151 | Ga0495629_0000151_4125_5114 | 328 |
| 999 | 3300046459 | Ga0495629_0002944 | Ga0495629_0002944_5829_6818 | 328 |
| 1000 | 3300046459 | Ga0495629_0004909 | Ga0495629_0004909_7173_8162 | 328 |
| 1001 | 3300046459 | Ga0495629_0034018 | Ga0495629_0034018_150_1139 | 328 |
| 1002 | 3300046460 | Ga0495638_0137263 | Ga0495638_0137263_287_1276 | 328 |
| 1003 | 3300046461 | Ga0495641_0004241 | Ga0495641_0004241_428_1417 | 328 |
| 1004 | 3300046461 | Ga0495641_0038764 | Ga0495641_0038764_121_1110 | 328 |
| 1005 | 3300046462 | Ga0495651_0001421 | Ga0495651_0001421_8894_9883 | 328 |
| 1006 | 3300046462 | Ga0495651_0010977 | Ga0495651_0010977_583_1572 | 328 |
| 1007 | 3300046462 | Ga0495651_0011269 | Ga0495651_0011269_607_1596 | 328 |
| 1008 | 3300046462 | Ga0495651_0043692 | Ga0495651_0043692_1543_2532 | 328 |
| 1009 | 3300046462 | Ga0495651_0187577 | Ga0495651_0187577_19_1008 | 328 |
| 1010 | 3300046463 | Ga0495653_0004360 | Ga0495653_0004360_6353_7342 | 328 |
| 1011 | 3300046463 | Ga0495653_0054417 | Ga0495653_0054417_928_1917 | 328 |
| 1012 | 3300046471 | Ga0495650_0066871 | Ga0495650_0066871_43_1032 | 328 |
| 1013 | 3300046472 | Ga0495580_0001229 | Ga0495580_0001229_15544_16533 | 328 |
| 1014 | 3300046472 | Ga0495580_0007090 | Ga0495580_0007090_6243_7232 | 328 |
| 1015 | 3300046473 | Ga0495582_0000019 | Ga0495582_0000019_8965_9954 | 328 |
| 1016 | 3300046473 | Ga0495582_0004005 | Ga0495582_0004005_876_1865 | 328 |
| 1017 | 3300046474 | Ga0495605_0085233 | Ga0495605_0085233_221_1210 | 328 |
| 1018 | 3300046474 | Ga0495605_0094464 | Ga0495605_0094464_147_1136 | 328 |
| 1019 | 3300046474 | Ga0495605_0110747 | Ga0495605_0110747_141_1130 | 328 |
| 1020 | 3300046475 | Ga0495639_0000159 | Ga0495639_0000159_24406_25395 | 328 |
| 1021 | 3300046475 | Ga0495639_0062908 | Ga0495639_0062908_547_1536 | 328 |
| 1022 | 3300046476 | Ga0495662_0000798 | Ga0495662_0000798_6227_7216 | 328 |
| 1023 | 3300046477 | Ga0495664_0004893 | Ga0495664_0004893_2497_3486 | 328 |
| 1024 | 3300046477 | Ga0495664_0040201 | Ga0495664_0040201_786_1775 | 328 |
| 1025 | 3300046477 | Ga0495664_0059446 | Ga0495664_0059446_1042_2031 | 328 |
| 1026 | 3300046477 | Ga0495664_0076735 | Ga0495664_0076735_689_1678 | 328 |
| 1027 | 3300046491 | Ga0495584_0085432 | Ga0495584_0085432_440_1429 | 328 |
| 1028 | 3300046492 | Ga0495585_0079005 | Ga0495585_0079005_386_1375 | 328 |
| 1029 | 3300046499 | Ga0495594_0000235 | Ga0495594_0000235_19686_20675 | 328 |
| 1030 | 3300046499 | Ga0495594_0015471 | Ga0495594_0015471_702_1691 | 328 |
| 1031 | 3300046507 | Ga0495606_0018376 | Ga0495606_0018376_2157_3146 | 328 |
| 1032 | 3300046511 | Ga0495608_0010956 | Ga0495608_0010956_1855_2844 | 328 |
| 1033 | 3300046511 | Ga0495608_0020201 | Ga0495608_0020201_771_1760 | 328 |
| 1034 | 3300046511 | Ga0495608_0085652 | Ga0495608_0085652_890_1879 | 328 |
| 1035 | 3300046514 | Ga0495618_0033917 | Ga0495618_0033917_1994_2983 | 328 |
| 1036 | 3300046515 | Ga0495620_0063225 | Ga0495620_0063225_46_1035 | 328 |
| 1037 | 3300046516 | Ga0495628_0016475 | Ga0495628_0016475_4570_5559 | 328 |
| 1038 | 3300046516 | Ga0495628_0034223 | Ga0495628_0034223_2139_3128 | 328 |
| 1039 | 3300046516 | Ga0495628_0232120 | Ga0495628_0232120_286_1275 | 328 |
| 1040 | 3300046517 | Ga0495630_0008130 | Ga0495630_0008130_538_1527 | 328 |
| 1041 | 3300046517 | Ga0495630_0036438 | Ga0495630_0036438_2485_3474 | 328 |
| 1042 | 3300046517 | Ga0495630_0090128 | Ga0495630_0090128_515_1504 | 328 |
| 1043 | 3300046524 | Ga0495648_0008002 | Ga0495648_0008002_107_1096 | 328 |
| 1044 | 3300046524 | Ga0495648_0028040 | Ga0495648_0028040_2145_3134 | 328 |
| 1045 | 3300046524 | Ga0495648_0032290 | Ga0495648_0032290_346_1335 | 328 |
| 1046 | 3300046526 | Ga0495666_0015247 | Ga0495666_0015247_503_1492 | 328 |
| 1047 | 3300046529 | Ga0495652_0013238 | Ga0495652_0013238_4947_5936 | 328 |
| 1048 | 3300046529 | Ga0495652_0031261 | Ga0495652_0031261_392_1381 | 328 |
| 1049 | 3300046529 | Ga0495652_0032740 | Ga0495652_0032740_3382_4371 | 328 |
| 1050 | 3300046529 | Ga0495652_0052170 | Ga0495652_0052170_2388_3377 | 328 |
| 1051 | 3300046531 | Ga0495665_0000093 | Ga0495665_0000093_30830_31819 | 328 |
| 1052 | 3300046531 | Ga0495665_0063631 | Ga0495665_0063631_196_1185 | 328 |
| 1053 | 3300046533 | Ga0495640_0005573 | Ga0495640_0005573_4282_5271 | 328 |
| 1054 | 3300046533 | Ga0495640_0030012 | Ga0495640_0030012_1833_2822 | 328 |
| 1055 | 3300046533 | Ga0495640_0053002 | Ga0495640_0053002_431_1420 | 328 |
| 1056 | 3300046533 | Ga0495640_0244693 | Ga0495640_0244693_52_1041 | 328 |
| 1057 | 3300046535 | Ga0495586_0029710 | Ga0495586_0029710_217_1206 | 328 |
| 1058 | 3300046536 | Ga0495587_0002440 | Ga0495587_0002440_2991_3980 | 328 |
| 1059 | 3300046537 | Ga0495598_0004856 | Ga0495598_0004856_553_1542 | 328 |
| 1060 | 3300046538 | Ga0495609_0068648 | Ga0495609_0068648_413_1402 | 328 |
| 1061 | 3300046542 | Ga0495597_0044137 | Ga0495597_0044137_424_1413 | 328 |
| 1062 | 3300046543 | Ga0495645_0044063 | Ga0495645_0044063_2146_3135 | 328 |
| 1063 | 3300046543 | Ga0495645_0114078 | Ga0495645_0114078_536_1525 | 328 |
| 1064 | 3300046543 | Ga0495645_0146194 | Ga0495645_0146194_98_1087 | 328 |
| 1065 | 3300046557 | Ga0495622_0000571 | Ga0495622_0000571_2125_3114 | 328 |
| 1066 | 3300046557 | Ga0495622_0023862 | Ga0495622_0023862_957_1946 | 328 |
| 1067 | 3300046559 | Ga0495667_0029704 | Ga0495667_0029704_2677_3666 | 328 |
| 1068 | 3300046559 | Ga0495667_0059712 | Ga0495667_0059712_788_1777 | 328 |
| 1069 | 3300046615 | Ga0495656_0091876 | Ga0495656_0091876_343_1332 | 328 |
| 1070 | 3300046616 | Ga0495668_0047773 | Ga0495668_0047773_684_1673 | 328 |
| 1071 | 3300046616 | Ga0495668_0102905 | Ga0495668_0102905_516_1505 | 328 |
| 1072 | 3300046642 | Ga0495634_0003979 | Ga0495634_0003979_7940_8929 | 328 |
| 1073 | 3300046642 | Ga0495634_0004199 | Ga0495634_0004199_6861_7850 | 328 |
| 1074 | 3300046642 | Ga0495634_0034102 | Ga0495634_0034102_118_1107 | 328 |
| 1075 | 3300046660 | Ga0495625_0157229 | Ga0495625_0157229_47_1036 | 328 |
| 1076 | 3300046663 | Ga0495635_0000322 | Ga0495635_0000322_27748_28737 | 328 |
| 1077 | 3300046663 | Ga0495635_0001817 | Ga0495635_0001817_5506_6495 | 328 |
| 1078 | 3300046663 | Ga0495635_0002995 | Ga0495635_0002995_7383_8372 | 328 |
| 1079 | 3300046663 | Ga0495635_0046009 | Ga0495635_0046009_976_1965 | 328 |
| 1080 | 3300046674 | Ga0495588_0010061 | Ga0495588_0010061_2118_3107 | 328 |
| 1081 | 3300046674 | Ga0495588_0107436 | Ga0495588_0107436_63_1052 | 328 |
| 1082 | 3300046675 | Ga0495657_0005003 | Ga0495657_0005003_1317_2306 | 328 |
| 1083 | 3300046675 | Ga0495657_0008039 | Ga0495657_0008039_2338_3327 | 328 |
| 1084 | 3300046675 | Ga0495657_0041298 | Ga0495657_0041298_1386_2375 | 328 |
| 1085 | 3300046675 | Ga0495657_0184582 | Ga0495657_0184582_118_1107 | 328 |
| 1086 | 3300046678 | Ga0495599_0010948 | Ga0495599_0010948_480_1469 | 328 |
| 1087 | 3300046678 | Ga0495599_0014770 | Ga0495599_0014770_1301_2290 | 328 |
| 1088 | 3300046678 | Ga0495599_0068418 | Ga0495599_0068418_945_1934 | 328 |
| 1089 | 3300046679 | Ga0495623_0003342 | Ga0495623_0003342_2819_3808 | 328 |
| 1090 | 3300046679 | Ga0495623_0003554 | Ga0495623_0003554_7078_8067 | 328 |
| 1091 | 3300046679 | Ga0495623_0072456 | Ga0495623_0072456_150_1139 | 328 |
| 1092 | 3300046679 | Ga0495623_0075559 | Ga0495623_0075559_916_1905 | 328 |
| 1093 | 3300046680 | Ga0495646_0008241 | Ga0495646_0008241_5020_6009 | 328 |
| 1094 | 3300046680 | Ga0495646_0070591 | Ga0495646_0070591_951_1940 | 328 |
| 1095 | 3300046681 | Ga0495647_0000250 | Ga0495647_0000250_9171_10160 | 328 |
| 1096 | 3300046683 | Ga0495658_0000054 | Ga0495658_0000054_48176_49165 | 328 |
| 1097 | 3300046683 | Ga0495658_0023308 | Ga0495658_0023308_2223_3212 | 328 |
| 1098 | 3300046683 | Ga0495658_0110449 | Ga0495658_0110449_154_1143 | 328 |
| 1099 | 3300046684 | Ga0495669_0014235 | Ga0495669_0014235_1413_2402 | 328 |
| 1100 | 3300046684 | Ga0495669_0082900 | Ga0495669_0082900_417_1406 | 328 |
| 1101 | 3300046689 | Ga0495613_0002331 | Ga0495613_0002331_8054_9043 | 328 |
| 1102 | 3300046689 | Ga0495613_0085459 | Ga0495613_0085459_1110_2099 | 328 |
| 1103 | 3300046690 | Ga0495624_0007986 | Ga0495624_0007986_5397_6386 | 328 |
| 1104 | 3300046690 | Ga0495624_0035811 | Ga0495624_0035811_33_1022 | 328 |
| 1105 | 3300046692 | Ga0495671_0057594 | Ga0495671_0057594_911_1900 | 328 |
| 1106 | 3300046794 | Ga0495589_0118225 | Ga0495589_0118225_169_1158 | 328 |
| 1107 | 3300046809 | Ga0495600_0001578 | Ga0495600_0001578_6930_7919 | 328 |
| 1108 | 3300046809 | Ga0495600_0003823 | Ga0495600_0003823_5119_6108 | 328 |
| 1109 | 3300046809 | Ga0495600_0006664 | Ga0495600_0006664_3825_4814 | 328 |
| 1110 | 3300047315 | Ga0495581_0000247 | Ga0495581_0000247_396_1385 | 328 |
| 1111 | 3300047315 | Ga0495581_0070132 | Ga0495581_0070132_1017_2006 | 328 |
| 1112 | 3300047315 | Ga0495581_0136570 | Ga0495581_0136570_158_1147 | 328 |
| 1113 | 3300047317 | Ga0495604_0001719 | Ga0495604_0001719_16032_17021 | 328 |
| 1114 | 3300047317 | Ga0495604_0004125 | Ga0495604_0004125_6305_7294 | 328 |
| 1115 | 3300047317 | Ga0495604_0063355 | Ga0495604_0063355_90_1079 | 328 |
| 1116 | 3300047318 | Ga0495636_0103829 | Ga0495636_0103829_72_1061 | 328 |
| 1117 | 3300047319 | Ga0495674_0000871 | Ga0495674_0000871_8904_9893 | 328 |
| 1118 | 3300047319 | Ga0495674_0107558 | Ga0495674_0107558_394_1383 | 328 |
| 1119 | 3300047319 | Ga0495674_0186365 | Ga0495674_0186365_435_1424 | 328 |
| 1120 | 3300047321 | Ga0495676_0041253 | Ga0495676_0041253_270_1259 | 328 |
| 1121 | 3300047321 | Ga0495676_0131114 | Ga0495676_0131114_284_1273 | 328 |
| 1122 | 3300047322 | Ga0495680_0006451 | Ga0495680_0006451_7382_8371 | 328 |
| 1123 | 3300047322 | Ga0495680_0007673 | Ga0495680_0007673_6481_7470 | 328 |
| 1124 | 3300047323 | Ga0495683_0073925 | Ga0495683_0073925_504_1493 | 328 |
| 1125 | 3300047443 | Ga0495687_012431 | Ga0495687_012431_2113_3102 | 328 |
| 1126 | 3300047444 | Ga0495675_0005025 | Ga0495675_0005025_1590_2579 | 328 |
| 1127 | 3300047444 | Ga0495675_0005708 | Ga0495675_0005708_5019_6008 | 328 |
| 1128 | 3300047444 | Ga0495675_0178501 | Ga0495675_0178501_104_1093 | 328 |
| 1129 | 3300047447 | Ga0495685_038131 | Ga0495685_038131_477_1466 | 328 |
| 1130 | 3300047470 | Ga0495681_0114680 | Ga0495681_0114680_45_1034 | 328 |
| 1131 | 3300047471 | Ga0495684_0001840 | Ga0495684_0001840_2050_3039 | 328 |
| 1132 | 3300047471 | Ga0495684_0024950 | Ga0495684_0024950_1907_2896 | 328 |
| 1133 | 3300047471 | Ga0495684_0041304 | Ga0495684_0041304_2513_3502 | 328 |
| 1134 | 3300047471 | Ga0495684_0211558 | Ga0495684_0211558_79_1068 | 328 |
| 1135 | 3300047472 | Ga0495686_0053491 | Ga0495686_0053491_24_1013 | 328 |
| 1136 | 3300047472 | Ga0495686_0071333 | Ga0495686_0071333_422_1411 | 328 |
| 1137 | 3300047673 | Ga0495593_0000063 | Ga0495593_0000063_4304_5293 | 328 |
| 1138 | 3300047673 | Ga0495593_0002843 | Ga0495593_0002843_1553_2542 | 328 |
| 1139 | 3300047673 | Ga0495593_0090543 | Ga0495593_0090543_441_1430 | 328 |
| 1140 | 3300048088 | Ga0495602_0009382 | Ga0495602_0009382_6373_7362 | 328 |
| 1141 | 3300048088 | Ga0495602_0016924 | Ga0495602_0016924_3428_4417 | 328 |
| 1142 | 3300048088 | Ga0495602_0051263 | Ga0495602_0051263_1893_2882 | 328 |
| 1143 | 3300048903 | Ga0496100_0048959 | Ga0496100_0048959_263_1252 | 328 |
| 1144 | 3300048903 | Ga0496100_0091951 | Ga0496100_0091951_688_1677 | 328 |
| 1145 | 3300048904 | Ga0496101_0033278 | Ga0496101_0033278_2217_3206 | 328 |
| 1146 | 3300048904 | Ga0496101_0042350 | Ga0496101_0042350_2144_3133 | 328 |
| 1147 | 3300048904 | Ga0496101_0160283 | Ga0496101_0160283_715_1704 | 328 |
| 1148 | 3300048905 | Ga0496102_0015035 | Ga0496102_0015035_2155_3144 | 328 |
| 1149 | 3300048905 | Ga0496102_0035246 | Ga0496102_0035246_2200_3189 | 328 |
| 1150 | 3300048905 | Ga0496102_0182525 | Ga0496102_0182525_112_1101 | 328 |
| 1151 | 3300048905 | Ga0496102_0298131 | Ga0496102_0298131_509_1498 | 328 |
| 1152 | 3300048906 | Ga0496103_0233707 | Ga0496103_0233707_141_1130 | 328 |
| 1153 | 3300048907 | Ga0496104_0008588 | Ga0496104_0008588_848_1837 | 328 |
| 1154 | 3300048907 | Ga0496104_0009097 | Ga0496104_0009097_4888_5877 | 328 |
| 1155 | 3300048907 | Ga0496104_0021540 | Ga0496104_0021540_2562_3551 | 328 |
| 1156 | 3300048907 | Ga0496104_0024076 | Ga0496104_0024076_4210_5199 | 328 |
| 1157 | 3300048907 | Ga0496104_0103423 | Ga0496104_0103423_996_1985 | 328 |
| 1158 | 3300048907 | Ga0496104_0120288 | Ga0496104_0120288_1154_2143 | 328 |
| 1159 | 3300048908 | Ga0496105_0021408 | Ga0496105_0021408_250_1239 | 328 |
| 1160 | 3300048908 | Ga0496105_0022649 | Ga0496105_0022649_2393_3382 | 328 |
| 1161 | 3300048908 | Ga0496105_0070475 | Ga0496105_0070475_502_1491 | 328 |
| 1162 | 3300048909 | Ga0496106_0001271 | Ga0496106_0001271_2960_3949 | 328 |
| 1163 | 3300048909 | Ga0496106_0030896 | Ga0496106_0030896_418_1407 | 328 |
| 1164 | 3300048910 | Ga0496107_0025796 | Ga0496107_0025796_919_1908 | 328 |
| 1165 | 3300048910 | Ga0496107_0026598 | Ga0496107_0026598_2687_3676 | 328 |
| 1166 | 3300048911 | Ga0496108_0000507 | Ga0496108_0000507_28675_29664 | 328 |
| 1167 | 3300048911 | Ga0496108_0017223 | Ga0496108_0017223_529_1518 | 328 |
| 1168 | 3300048911 | Ga0496108_0030002 | Ga0496108_0030002_2835_3824 | 328 |
| 1169 | 3300048911 | Ga0496108_0042694 | Ga0496108_0042694_392_1381 | 328 |
| 1170 | 3300048911 | Ga0496108_0170617 | Ga0496108_0170617_343_1332 | 328 |
| 1171 | 3300048911 | Ga0496108_0181261 | Ga0496108_0181261_701_1690 | 328 |
| 1172 | 3300048912 | Ga0496109_0015980 | Ga0496109_0015980_198_1187 | 328 |
| 1173 | 3300048912 | Ga0496109_0024123 | Ga0496109_0024123_3831_4820 | 328 |
| 1174 | 3300048912 | Ga0496109_0077384 | Ga0496109_0077384_595_1584 | 328 |
| 1175 | 3300048912 | Ga0496109_0361566 | Ga0496109_0361566_193_1182 | 328 |
| 1176 | 3300048913 | Ga0496110_0002891 | Ga0496110_0002891_9956_10945 | 328 |
| 1177 | 3300048913 | Ga0496110_0120504 | Ga0496110_0120504_360_1349 | 328 |
| 1178 | 3300048913 | Ga0496110_0131722 | Ga0496110_0131722_1116_2105 | 328 |
| 1179 | 3300048913 | Ga0496110_0199167 | Ga0496110_0199167_305_1294 | 328 |
| 1180 | 3300048914 | Ga0496111_0013376 | Ga0496111_0013376_3474_4463 | 328 |
| 1181 | 3300048914 | Ga0496111_0047402 | Ga0496111_0047402_1365_2354 | 328 |
| 1182 | 3300048914 | Ga0496111_0053924 | Ga0496111_0053924_500_1489 | 328 |
| 1183 | 3300048915 | Ga0496112_0007653 | Ga0496112_0007653_6375_7364 | 328 |
| 1184 | 3300048915 | Ga0496112_0018304 | Ga0496112_0018304_2388_3377 | 328 |
| 1185 | 3300048915 | Ga0496112_0027083 | Ga0496112_0027083_4025_5014 | 328 |
| 1186 | 3300048915 | Ga0496112_0046746 | Ga0496112_0046746_765_1754 | 328 |
| 1187 | 3300048915 | Ga0496112_0069445 | Ga0496112_0069445_835_1824 | 328 |
| 1188 | 3300048915 | Ga0496112_0410985 | Ga0496112_0410985_182_1171 | 328 |
| 1189 | 3300048916 | Ga0496113_0019566 | Ga0496113_0019566_3596_4585 | 328 |
| 1190 | 3300048916 | Ga0496113_0063378 | Ga0496113_0063378_799_1788 | 328 |
| 1191 | 3300048916 | Ga0496113_0316421 | Ga0496113_0316421_172_1161 | 328 |
| 1192 | 3300048917 | Ga0496114_0081821 | Ga0496114_0081821_1525_2514 | 328 |
| 1193 | 3300048918 | Ga0496115_0017793 | Ga0496115_0017793_1921_2910 | 328 |
| 1194 | 3300048918 | Ga0496115_0070407 | Ga0496115_0070407_685_1674 | 328 |
| 1195 | 3300048918 | Ga0496115_0114485 | Ga0496115_0114485_616_1605 | 328 |
| 1196 | 3300048918 | Ga0496115_0154044 | Ga0496115_0154044_343_1332 | 328 |
| 1197 | 3300048919 | Ga0496116_0080857 | Ga0496116_0080857_876_1865 | 328 |
| 1198 | 3300048920 | Ga0496117_0022107 | Ga0496117_0022107_2826_3815 | 328 |
| 1199 | 3300048920 | Ga0496117_0076968 | Ga0496117_0076968_558_1547 | 328 |
| 1200 | 3300048921 | Ga0496118_0028837 | Ga0496118_0028837_728_1717 | 328 |
| 1201 | 3300048921 | Ga0496118_0032916 | Ga0496118_0032916_1280_2269 | 328 |
| 1202 | 3300048922 | Ga0496119_0020199 | Ga0496119_0020199_3866_4855 | 328 |
| 1203 | 3300048922 | Ga0496119_0033954 | Ga0496119_0033954_1501_2490 | 328 |
| 1204 | 3300048924 | Ga0496121_0000451 | Ga0496121_0000451_25319_26308 | 328 |
| 1205 | 3300048924 | Ga0496121_0007759 | Ga0496121_0007759_7756_8745 | 328 |
| 1206 | 3300048924 | Ga0496121_0079491 | Ga0496121_0079491_47_1036 | 328 |
| 1207 | 3300048924 | Ga0496121_0115304 | Ga0496121_0115304_294_1283 | 328 |
| 1208 | 3300048924 | Ga0496121_0119263 | Ga0496121_0119263_691_1680 | 328 |
| 1209 | 3300048924 | Ga0496121_0133285 | Ga0496121_0133285_722_1711 | 328 |
| 1210 | 3300048924 | Ga0496121_0137565 | Ga0496121_0137565_510_1499 | 328 |
| 1211 | 3300048924 | Ga0496121_0191703 | Ga0496121_0191703_424_1413 | 328 |
| 1212 | 3300048927 | Ga0496124_0002796 | Ga0496124_0002796_11976_12965 | 328 |
| 1213 | 3300048927 | Ga0496124_0048273 | Ga0496124_0048273_1281_2270 | 328 |
| 1214 | 3300048927 | Ga0496124_0100870 | Ga0496124_0100870_1265_2254 | 328 |
| 1215 | 3300048928 | Ga0496125_0040920 | Ga0496125_0040920_2145_3134 | 328 |
| 1216 | 3300048928 | Ga0496125_0068010 | Ga0496125_0068010_1704_2693 | 328 |
| 1217 | 3300048929 | Ga0496126_0002876 | Ga0496126_0002876_13477_14466 | 328 |
| 1218 | 3300048929 | Ga0496126_0007845 | Ga0496126_0007845_5886_6875 | 328 |
| 1219 | 3300048929 | Ga0496126_0053184 | Ga0496126_0053184_747_1736 | 328 |
| 1220 | 3300048929 | Ga0496126_0078080 | Ga0496126_0078080_363_1352 | 328 |
| 1221 | 3300048929 | Ga0496126_0092750 | Ga0496126_0092750_853_1842 | 328 |
| 1222 | 3300048929 | Ga0496126_0195423 | Ga0496126_0195423_426_1415 | 328 |
| 1223 | 3300048929 | Ga0496126_0291947 | Ga0496126_0291947_320_1309 | 328 |
| 1224 | 3300048929 | Ga0496126_0341069 | Ga0496126_0341069_147_1136 | 328 |
| 1225 | 3300048929 | Ga0496126_0351053 | Ga0496126_0351053_33_1022 | 328 |
| 1226 | 3300049460 | Ga0495682_0033394 | Ga0495682_0033394_43_1032 | 328 |
| 1227 | 3300049569 | Ga0501032_0190178 | Ga0501032_0190178_92_1081 | 328 |
| 1228 | 3300049572 | Ga0501036_0181833 | Ga0501036_0181833_558_1547 | 328 |
| 1229 | 3300049574 | Ga0501038_0215636 | Ga0501038_0215636_296_1285 | 328 |
| 1230 | 3300049581 | Ga0501047_0036235 | Ga0501047_0036235_3435_4424 | 328 |
| 1231 | 3300049586 | Ga0501070_0030735 | Ga0501070_0030735_3386_4375 | 328 |
| 1232 | 3300049586 | Ga0501070_0187188 | Ga0501070_0187188_316_1305 | 328 |
| 1233 | 3300049590 | Ga0501074_0012661 | Ga0501074_0012661_1432_2421 | 328 |
| 1234 | 3300049591 | Ga0501075_0154652 | Ga0501075_0154652_261_1250 | 328 |
| 1235 | 3300049742 | Ga0501080_0096116 | Ga0501080_0096116_1695_2684 | 328 |
| 1236 | 3300050489 | nmdc:mga03683_82564_c1 | nmdc:mga03683_82564_c1_170_1159 | 328 |
| 1237 | 3300050490 | nmdc:mga03n38_15385_c1 | nmdc:mga03n38_15385_c1_313_1302 | 328 |
| 1238 | 3300050490 | nmdc:mga03n38_25648_c1 | nmdc:mga03n38_25648_c1_125_1114 | 328 |
| 1239 | 3300050492 | nmdc:mga0yw44_187613_c1 | nmdc:mga0yw44_187613_c1_107_1096 | 328 |
| 1240 | 3300050492 | nmdc:mga0yw44_87129_c1 | nmdc:mga0yw44_87129_c1_134_1123 | 328 |
| 1241 | 3300050493 | nmdc:mga0k408_73151_c1 | nmdc:mga0k408_73151_c1_951_1940 | 328 |
| 1242 | 3300050496 | nmdc:mga07m45_144408_c1 | nmdc:mga07m45_144408_c1_45_1034 | 328 |
| 1243 | 3300050496 | nmdc:mga07m45_35943_c1 | nmdc:mga07m45_35943_c1_588_1577 | 328 |
| 1244 | 3300050496 | nmdc:mga07m45_88026_c1 | nmdc:mga07m45_88026_c1_488_1477 | 328 |
| 1245 | 3300050507 | nmdc:mga05p37_197856_c1 | nmdc:mga05p37_197856_c1_332_1321 | 328 |
| 1246 | 3300050513 | nmdc:mga0rr50_65960_c1 | nmdc:mga0rr50_65960_c1_813_1802 | 328 |
| 1247 | 3300050516 | nmdc:mga0sz30_18533_c1 | nmdc:mga0sz30_18533_c1_848_1837 | 328 |
| 1248 | 3300053077 | Ga0495601_0035637 | Ga0495601_0035637_65_1054 | 328 |
| 1249 | 3300053080 | Ga0500635_0004703 | Ga0500635_0004703_814_1803 | 328 |
| 1250 | 3300053083 | Ga0495655_0009258 | Ga0495655_0009258_367_1356 | 328 |
| 1251 | 3300053083 | Ga0495655_0030609 | Ga0495655_0030609_79_1068 | 328 |
| 1252 | 3300053084 | Ga0495595_0004533 | Ga0495595_0004533_2841_3830 | 328 |
| 1253 | 3300053084 | Ga0495595_0013998 | Ga0495595_0013998_1468_2457 | 328 |
| 1254 | 3300053085 | Ga0495619_0001285 | Ga0495619_0001285_10737_11726 | 328 |
| 1255 | 3300053085 | Ga0495619_0021537 | Ga0495619_0021537_673_1662 | 328 |
| 1256 | 3300053085 | Ga0495619_0027673 | Ga0495619_0027673_2388_3377 | 328 |
| 1257 | 3300053085 | Ga0495619_0030366 | Ga0495619_0030366_540_1529 | 328 |
| 1258 | 3300053087 | Ga0500643_000517 | Ga0500643_000517_11145_12134 | 328 |
| 1259 | 3300053091 | Ga0500647_0002370 | Ga0500647_0002370_215_1204 | 328 |
| 1260 | 3300053091 | Ga0500647_0011549 | Ga0500647_0011549_1910_2899 | 328 |
| 1261 | 3300053093 | Ga0500651_0190199 | Ga0500651_0190199_138_1127 | 328 |
| 1262 | 3300053094 | Ga0500566_0000491 | Ga0500566_0000491_14279_15268 | 328 |
| 1263 | 3300053094 | Ga0500566_0001030 | Ga0500566_0001030_1516_2505 | 328 |
| 1264 | 3300053094 | Ga0500566_0006845 | Ga0500566_0006845_3304_4293 | 328 |
| 1265 | 3300053095 | Ga0500640_073975 | Ga0500640_073975_388_1377 | 328 |
| 1266 | 3300053095 | Ga0500640_082273 | Ga0500640_082273_25_1014 | 328 |
| 1267 | 3300053103 | Ga0500555_001517 | Ga0500555_001517_4205_5194 | 328 |
| 1268 | 3300053104 | Ga0500556_0015602 | Ga0500556_0015602_1019_2008 | 328 |
| 1269 | 3300053105 | Ga0500557_000019 | Ga0500557_000019_55667_56656 | 328 |
| 1270 | 3300053108 | Ga0500562_004121 | Ga0500562_004121_570_1559 | 328 |
| 1271 | 3300053109 | Ga0500569_003665 | Ga0500569_003665_1693_2682 | 328 |
| 1272 | 3300053111 | Ga0500572_000144 | Ga0500572_000144_9641_10630 | 328 |
| 1273 | 3300053111 | Ga0500572_008726 | Ga0500572_008726_994_1983 | 328 |
| 1274 | 3300053119 | Ga0500595_047421 | Ga0500595_047421_233_1222 | 328 |
| 1275 | 3300053121 | Ga0500607_104804 | Ga0500607_104804_191_1180 | 328 |
| 1276 | 3300053122 | Ga0500608_020655 | Ga0500608_020655_1995_2984 | 328 |
| 1277 | 3300053130 | Ga0500642_0000835 | Ga0500642_0000835_1569_2558 | 328 |
| 1278 | 3300053136 | Ga0500559_0000386 | Ga0500559_0000386_17088_18077 | 328 |
| 1279 | 3300053140 | Ga0500573_0048305 | Ga0500573_0048305_676_1665 | 328 |
| 1280 | 3300053148 | Ga0500590_013765 | Ga0500590_013765_416_1405 | 328 |
| 1281 | 3300053148 | Ga0500590_031683 | Ga0500590_031683_719_1708 | 328 |
| 1282 | 3300053148 | Ga0500590_109997 | Ga0500590_109997_46_1038 | 328 |
| 1283 | 3300053150 | Ga0500603_000143 | Ga0500603_000143_11590_12579 | 328 |
| 1284 | 3300053150 | Ga0500603_004087 | Ga0500603_004087_729_1718 | 328 |
| 1285 | 3300053153 | Ga0500616_0026411 | Ga0500616_0026411_1542_2531 | 328 |
| 1286 | 3300053162 | Ga0500638_000229 | Ga0500638_000229_784_1773 | 328 |
| 1287 | 3300053162 | Ga0500638_056822 | Ga0500638_056822_846_1835 | 328 |
| 1288 | 3300053163 | Ga0500639_005961 | Ga0500639_005961_1537_2526 | 328 |
| 1289 | 3300053163 | Ga0500639_013425 | Ga0500639_013425_1989_2978 | 328 |
| 1290 | 3300053177 | Ga0500636_0000168 | Ga0500636_0000168_27439_28428 | 328 |
| 1291 | 3300053178 | Ga0500637_0000134 | Ga0500637_0000134_20991_21980 | 328 |
| 1292 | 3300053178 | Ga0500637_0010521 | Ga0500637_0010521_1068_2057 | 328 |
| 1293 | 3300053722 | Ga0500649_024644 | Ga0500649_024644_765_1754 | 328 |
| 1294 | 3300053729 | Ga0500625_022425 | Ga0500625_022425_470_1459 | 328 |
| 1295 | 3300053735 | Ga0500596_001188 | Ga0500596_001188_468_1457 | 328 |
| 1296 | 3300055283 | Ga0500661_000037 | Ga0500661_000037_5567_6556 | 328 |
| 1297 | 3300001979 | JGI24740J21852_10000425 | JGI24740J21852_100004257 | 329 |
| 1298 | 3300002067 | JGI24735J21928_10004541 | JGI24735J21928_100045412 | 329 |
| 1299 | 3300005457 | Ga0070662_100362989 | Ga0070662_1003629892 | 329 |
| 1300 | 3300005539 | Ga0068853_100036694 | Ga0068853_1000366943 | 329 |
| 1301 | 3300005563 | Ga0068855_100145326 | Ga0068855_1001453262 | 329 |
| 1302 | 3300005577 | Ga0068857_100014108 | Ga0068857_1000141086 | 329 |
| 1303 | 3300005577 | Ga0068857_100017627 | Ga0068857_1000176277 | 329 |
| 1304 | 3300005578 | Ga0068854_100004314 | Ga0068854_1000043147 | 329 |
| 1305 | 3300005614 | Ga0068856_100021565 | Ga0068856_1000215657 | 329 |
| 1306 | 3300005614 | Ga0068856_100037771 | Ga0068856_1000377712 | 329 |
| 1307 | 3300005834 | Ga0068851_10003007 | Ga0068851_100030076 | 329 |
| 1308 | 3300009174 | Ga0105241_10009598 | Ga0105241_100095986 | 329 |
| 1309 | 3300009545 | Ga0105237_10062720 | Ga0105237_100627202 | 329 |
| 1310 | 3300009551 | Ga0105238_10029551 | Ga0105238_100295513 | 329 |
| 1311 | 3300010375 | Ga0105239_10021610 | Ga0105239_100216104 | 329 |
| 1312 | 3300010375 | Ga0105239_10027243 | Ga0105239_100272437 | 329 |
| 1313 | 3300025321 | Ga0207656_10009178 | Ga0207656_100091783 | 329 |
| 1314 | 3300025911 | Ga0207654_10000073 | Ga0207654_1000007338 | 329 |
| 1315 | 3300025913 | Ga0207695_10000366 | Ga0207695_1000036675 | 329 |
| 1316 | 3300025913 | Ga0207695_10433465 | Ga0207695_104334652 | 329 |
| 1317 | 3300025924 | Ga0207694_10000139 | Ga0207694_1000013933 | 329 |
| 1318 | 3300025924 | Ga0207694_10000268 | Ga0207694_1000026836 | 329 |
| 1319 | 3300025924 | Ga0207694_10012864 | Ga0207694_100128642 | 329 |
| 1320 | 3300025949 | Ga0207667_10015832 | Ga0207667_100158322 | 329 |
| 1321 | 3300025949 | Ga0207667_10020820 | Ga0207667_100208203 | 329 |
| 1322 | 3300025981 | Ga0207640_10006813 | Ga0207640_100068132 | 329 |
| 1323 | 3300025981 | Ga0207640_10009040 | Ga0207640_100090405 | 329 |
| 1324 | 3300026041 | Ga0207639_10007864 | Ga0207639_100078646 | 329 |
| 1325 | 3300026041 | Ga0207639_10031296 | Ga0207639_100312962 | 329 |
| 1326 | 3300026078 | Ga0207702_10000491 | Ga0207702_1000049137 | 329 |
| 1327 | 3300026078 | Ga0207702_10012083 | Ga0207702_100120832 | 329 |
| 1328 | 3300026116 | Ga0207674_10008730 | Ga0207674_100087308 | 329 |
| 1329 | 3300026116 | Ga0207674_10008835 | Ga0207674_100088357 | 329 |
| 1330 | 3300033544 | Ga0316215_1004766 | Ga0316215_10047662 | 329 |
| 1331 | 3300039450 | Ga0436363_1407757 | Ga0436363_1407757_11299_12291 | 329 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5unn-assembly1.cif.gz_B | crystal structure of nadph-dependent glyoxylate/hydroxypyruvate reductase smc02828 (smghra) from sinorhizobium meliloti in apo form | 0.8458 | 107 | 294 |
| 7va1-assembly1.cif.gz_B | crystal structure of human 3-phosphoglycerate dehydrogenase in complex with gdd-04-35 | 0.8365 | 108 | 294 |
| 7cvp-assembly1.cif.gz_B | the crystal structure of human phgdh from biortus. | 0.8315 | 102 | 304 |
| 6rj6-assembly1.cif.gz_A | crystal structure of phgdh in complex with bi-4924 | 0.8315 | 110 | 303 |
| 7va1-assembly1.cif.gz_B | crystal structure of human 3-phosphoglycerate dehydrogenase in complex with gdd-04-35 | 0.8198 | 108 | 294 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q7XRA3_150_294_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9777 | 150 | 287 | 3.40.50.720 |
| af_Q2FVW4_141_284_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.956 | 150 | 288 | 3.40.50.720 |
| af_K7KCB6_141_256_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9527 | 179 | 293 | 3.40.50.720 |
| af_A0A0R0KIU5_101_193_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9517 | 201 | 293 | 3.40.50.720 |
| af_Q7SZY8_153_293_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9476 | 153 | 288 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A357G1I8-F1-model_v4 | Hydroxyacid dehydrogenase | 0.9875 | 150 | 288 |
GO:0005829
GO:0016618 GO:0030267 GO:0051287 |
| AF-A0A5K1GTK6-F1-model_v4 | D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding domain-containing protein | 0.9718 | 153 | 297 |
GO:0005829
GO:0016618 GO:0030267 GO:0051287 |
| AF-D9ILU2-F1-model_v4 | Hydroxyphenylpyruvate reductase | 0.9471 | 140 | 287 |
GO:0005829
GO:0016618 GO:0030267 GO:0051287 |
| AF-A0A357G1I8-F1-model_v4 | Hydroxyacid dehydrogenase | 0.9404 | 150 | 288 |
GO:0005829
GO:0016618 GO:0030267 GO:0051287 |
| AF-A0A5K1GTK6-F1-model_v4 | D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding domain-containing protein | 0.94 | 153 | 297 |
GO:0005829
GO:0016618 GO:0030267 GO:0051287 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar