F493025
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1325 | 468 | 2650 | 82 |
Family's Representative Sequence
| Representative Sequence | 3300005328|Ga0070676_10597365|Ga0070676_105973652 |
| Length | 93 |
| Sequence | VPAPTRRAEPASARRSDVLRPALEHLVKGIVHNPDDVRVRMIDSRRGQRLEVRVHPDDLGTVIGRGGRTAKALRQVIGSIGGRGVRVDIMDSY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 78 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 79 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 81 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 82 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 83 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 84 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 88 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 91 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 92 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 93 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 94 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 95 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 96 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 97 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 112 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 126 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300019179 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI2 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 131 | 3300019183 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 132 | 3300019190 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 133 | 3300019192 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 134 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300023559 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 144 | 3300023563 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 145 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 205 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 209 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 210 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 211 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 212 | 3300029285 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 | Metatranscriptome | Rhizosphere |
| 213 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 214 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 215 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 216 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 217 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 218 | 3300031592 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 219 | 3300031614 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 220 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 221 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 222 | 3300031686 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 223 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 224 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 225 | 3300031810 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Unclassified |
| 226 | 3300031815 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Unclassified |
| 227 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 228 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 229 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 230 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 231 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 232 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 233 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 234 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 235 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 236 | 3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 237 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 238 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 239 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 240 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 241 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 242 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 243 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 244 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 245 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 246 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 247 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 248 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 249 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 250 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 251 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 252 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 253 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 254 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 255 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 256 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 257 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 258 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 259 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 260 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 261 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 262 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 263 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 264 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 265 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 266 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 267 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 268 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 269 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 270 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 271 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 272 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 273 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 274 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 275 | 3300036242 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 276 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 277 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 278 | 3300036458 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 279 | 3300036534 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 280 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 281 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 282 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 283 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 284 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 285 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 286 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 287 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 288 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 289 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 290 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 291 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 292 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 293 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 294 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 295 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 296 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 297 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 298 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 299 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 300 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 301 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 302 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 303 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 304 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 305 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 306 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 307 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 308 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 309 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 310 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 311 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 312 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 313 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 314 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 315 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 316 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 317 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 318 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 319 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 320 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 321 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 376 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 377 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 378 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 379 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 380 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 381 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 382 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 383 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 384 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 385 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 386 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 387 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 388 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 389 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 390 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 391 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 392 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 393 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 394 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 395 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 396 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 398 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 399 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 400 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 401 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 402 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 403 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 404 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 405 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 406 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 407 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 408 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 409 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 410 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 413 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 415 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 416 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 418 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 419 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 422 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 424 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 426 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 427 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 428 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 429 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 430 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 431 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 432 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 433 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 434 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 435 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 436 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 437 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 438 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 439 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 440 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 441 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 447 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 448 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 449 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 450 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 451 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 452 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 453 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 454 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 455 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 456 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 457 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 458 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 459 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 460 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 461 | 2515154088 | Salinispora arenicola CNT800 | Isolate | Rhizosphere |
| 462 | 2515154129 | Salinispora pacifica CNS103 | Isolate | Rhizosphere |
| 463 | 2515154137 | Salinispora arenicola CNX482 | Isolate | Rhizosphere |
| 464 | 2515154203 | Salinispora arenicola CNR921 | Isolate | Rhizosphere |
| 465 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 466 | 2861520306 | Phytomonospora endophytica DSM 45386 | Isolate | Unclassified |
| 467 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 468 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.21 |
| Metatranscriptomes | 6.19 |
| Isolates | 0.6 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.81 |
| Nodule | 0 |
| Rhizoplane | 4.83 |
| Rhizosphere | 87.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070676_10597365 | 3300005328 | Bacteria | 795 |
| 2 | JGI24735J21928_10094755 | 3300002067 | Bacteria | 856 |
| 3 | JGI25406J46586_10248285 | 3300003203 | Bacteria | 523 |
| 4 | rootL2_10152190 | 3300003322 | Bacteria | 1252 |
| 5 | rootL2_10152199 | 3300003322 | Bacteria | 1618 |
| 6 | Ga0058863_11912449 | 3300004799 | Bacteria | 827 |
| 7 | Ga0058860_11883144 | 3300004801 | Bacteria | 569 |
| 8 | Ga0070658_10741959 | 3300005327 | Bacteria | 853 |
| 9 | Ga0070683_100271352 | 3300005329 | Bacteria | 1613 |
| 10 | Ga0070683_100480301 | 3300005329 | Bacteria | 1187 |
| 11 | Ga0070683_100979790 | 3300005329 | Bacteria | 811 |
| 12 | Ga0070683_101566460 | 3300005329 | Bacteria | 633 |
| 13 | Ga0070683_102025771 | 3300005329 | Bacteria | 553 |
| 14 | Ga0070670_101393942 | 3300005331 | Bacteria | 642 |
| 15 | Ga0070677_10679785 | 3300005333 | Bacteria | 578 |
| 16 | Ga0068869_100002087 | 3300005334 | Bacteria | 12015 |
| 17 | Ga0068869_100055256 | 3300005334 | Bacteria | 2893 |
| 18 | Ga0068869_100434613 | 3300005334 | Bacteria | 1085 |
| 19 | Ga0068869_100730136 | 3300005334 | Bacteria | 847 |
| 20 | Ga0068869_101302088 | 3300005334 | Bacteria | 641 |
| 21 | Ga0070666_11203018 | 3300005335 | Bacteria | 564 |
| 22 | Ga0070680_100006507 | 3300005336 | Bacteria | 8884 |
| 23 | Ga0070680_100178674 | 3300005336 | Bacteria | 1787 |
| 24 | Ga0070680_100297789 | 3300005336 | Bacteria | 1368 |
| 25 | Ga0070680_100392404 | 3300005336 | Bacteria | 1182 |
| 26 | Ga0070682_100435295 | 3300005337 | Bacteria | 1001 |
| 27 | Ga0070682_100679787 | 3300005337 | Bacteria | 823 |
| 28 | Ga0070682_101206361 | 3300005337 | Bacteria | 639 |
| 29 | Ga0068868_100029329 | 3300005338 | Bacteria | 4212 |
| 30 | Ga0068868_100346421 | 3300005338 | Bacteria | 1272 |
| 31 | Ga0068868_101676659 | 3300005338 | Bacteria | 599 |
| 32 | Ga0070660_100220960 | 3300005339 | Bacteria | 1540 |
| 33 | Ga0070660_100282278 | 3300005339 | Bacteria | 1359 |
| 34 | Ga0070660_101045355 | 3300005339 | Bacteria | 690 |
| 35 | Ga0070689_101713214 | 3300005340 | Bacteria | 572 |
| 36 | Ga0070689_102221641 | 3300005340 | Bacteria | 503 |
| 37 | Ga0070691_10032956 | 3300005341 | Bacteria | 2436 |
| 38 | Ga0070691_10853827 | 3300005341 | Bacteria | 558 |
| 39 | Ga0070687_100761532 | 3300005343 | Bacteria | 682 |
| 40 | Ga0070687_101089870 | 3300005343 | Bacteria | 584 |
| 41 | Ga0070661_100048109 | 3300005344 | Bacteria | 3121 |
| 42 | Ga0070661_100114537 | 3300005344 | Bacteria | 2016 |
| 43 | Ga0070661_100554227 | 3300005344 | Bacteria | 925 |
| 44 | Ga0070661_100920142 | 3300005344 | Bacteria | 722 |
| 45 | Ga0070661_101718839 | 3300005344 | Bacteria | 532 |
| 46 | Ga0070692_10245196 | 3300005345 | Bacteria | 1070 |
| 47 | Ga0070692_10277039 | 3300005345 | Bacteria | 1015 |
| 48 | Ga0070692_11310856 | 3300005345 | Bacteria | 520 |
| 49 | Ga0070668_100003831 | 3300005347 | Bacteria | 11117 |
| 50 | Ga0070668_101426534 | 3300005347 | Bacteria | 632 |
| 51 | Ga0070668_101870598 | 3300005347 | Bacteria | 552 |
| 52 | Ga0070669_100425383 | 3300005353 | Bacteria | 1091 |
| 53 | Ga0070675_100016825 | 3300005354 | Bacteria | 5806 |
| 54 | Ga0070675_100623215 | 3300005354 | Bacteria | 979 |
| 55 | Ga0070671_100437108 | 3300005355 | Bacteria | 1121 |
| 56 | Ga0070673_100719130 | 3300005364 | Bacteria | 918 |
| 57 | Ga0070688_101589281 | 3300005365 | Bacteria | 534 |
| 58 | Ga0070659_100015201 | 3300005366 | Bacteria | 5760 |
| 59 | Ga0070659_101460572 | 3300005366 | Bacteria | 609 |
| 60 | Ga0070667_100019814 | 3300005367 | Bacteria | 5581 |
| 61 | Ga0070667_100148807 | 3300005367 | Bacteria | 2055 |
| 62 | Ga0070709_10198336 | 3300005434 | Bacteria | 1420 |
| 63 | Ga0070709_10232602 | 3300005434 | Bacteria | 1319 |
| 64 | Ga0070709_11312064 | 3300005434 | Bacteria | 584 |
| 65 | Ga0070709_11572381 | 3300005434 | Bacteria | 535 |
| 66 | Ga0070714_100002405 | 3300005435 | Bacteria | 13788 |
| 67 | Ga0070714_100006462 | 3300005435 | Bacteria | 9055 |
| 68 | Ga0070714_100132470 | 3300005435 | Bacteria | 2229 |
| 69 | Ga0070714_100222719 | 3300005435 | Bacteria | 1734 |
| 70 | Ga0070714_100391412 | 3300005435 | Bacteria | 1312 |
| 71 | Ga0070714_100748413 | 3300005435 | Bacteria | 945 |
| 72 | Ga0070714_100913869 | 3300005435 | Unclassified | 852 |
| 73 | Ga0070714_100914862 | 3300005435 | Bacteria | 852 |
| 74 | Ga0070714_101249829 | 3300005435 | Bacteria | 725 |
| 75 | Ga0070713_100002390 | 3300005436 | Bacteria | 12241 |
| 76 | Ga0070713_100018875 | 3300005436 | Bacteria | 5250 |
| 77 | Ga0070713_100028043 | 3300005436 | Bacteria | 4442 |
| 78 | Ga0070713_100109081 | 3300005436 | Bacteria | 2411 |
| 79 | Ga0070713_100157524 | 3300005436 | Bacteria | 2025 |
| 80 | Ga0070713_100358319 | 3300005436 | Bacteria | 1355 |
| 81 | Ga0070713_100473658 | 3300005436 | Bacteria | 1179 |
| 82 | Ga0070713_100698315 | 3300005436 | Bacteria | 968 |
| 83 | Ga0070713_100946503 | 3300005436 | Bacteria | 829 |
| 84 | Ga0070713_101228130 | 3300005436 | Bacteria | 726 |
| 85 | Ga0070713_102420893 | 3300005436 | Bacteria | 508 |
| 86 | Ga0070710_10073330 | 3300005437 | Bacteria | 1979 |
| 87 | Ga0070710_10205934 | 3300005437 | Bacteria | 1244 |
| 88 | Ga0070710_10317961 | 3300005437 | Bacteria | 1021 |
| 89 | Ga0070710_10786716 | 3300005437 | Bacteria | 678 |
| 90 | Ga0070710_10856629 | 3300005437 | Bacteria | 653 |
| 91 | Ga0070710_11158324 | 3300005437 | Bacteria | 570 |
| 92 | Ga0070711_100053069 | 3300005439 | Bacteria | 2792 |
| 93 | Ga0070711_100082805 | 3300005439 | Bacteria | 2291 |
| 94 | Ga0070711_100189420 | 3300005439 | Bacteria | 1580 |
| 95 | Ga0070711_100194919 | 3300005439 | Bacteria | 1559 |
| 96 | Ga0070711_100436528 | 3300005439 | Bacteria | 1070 |
| 97 | Ga0070705_101162905 | 3300005440 | Bacteria | 634 |
| 98 | Ga0070705_101460768 | 3300005440 | Bacteria | 572 |
| 99 | Ga0070705_101700117 | 3300005440 | Unclassified | 533 |
| 100 | Ga0070700_100068017 | 3300005441 | Bacteria | 2264 |
| 101 | Ga0070700_100991827 | 3300005441 | Bacteria | 690 |
| 102 | Ga0070694_101344423 | 3300005444 | Bacteria | 602 |
| 103 | Ga0070708_100070053 | 3300005445 | Bacteria | 3155 |
| 104 | Ga0070663_100132001 | 3300005455 | Bacteria | 1898 |
| 105 | Ga0070663_100171938 | 3300005455 | Bacteria | 1675 |
| 106 | Ga0070663_100304457 | 3300005455 | Bacteria | 1277 |
| 107 | Ga0070663_100357173 | 3300005455 | Bacteria | 1184 |
| 108 | Ga0070663_100379023 | 3300005455 | Bacteria | 1152 |
| 109 | Ga0070663_100583286 | 3300005455 | Bacteria | 938 |
| 110 | Ga0070678_100063568 | 3300005456 | Bacteria | 2732 |
| 111 | Ga0070678_100739580 | 3300005456 | Bacteria | 889 |
| 112 | Ga0070678_102104182 | 3300005456 | Bacteria | 535 |
| 113 | Ga0070662_100344135 | 3300005457 | Bacteria | 1220 |
| 114 | Ga0070662_101727280 | 3300005457 | Bacteria | 540 |
| 115 | Ga0070681_10000046 | 3300005458 | Bacteria | 84043 |
| 116 | Ga0070681_10122362 | 3300005458 | Bacteria | 2535 |
| 117 | Ga0070681_10574122 | 3300005458 | Bacteria | 1041 |
| 118 | Ga0070681_10809468 | 3300005458 | Bacteria | 854 |
| 119 | Ga0070681_10962034 | 3300005458 | Unclassified | 773 |
| 120 | Ga0068867_100098091 | 3300005459 | Bacteria | 2234 |
| 121 | Ga0070685_10761885 | 3300005466 | Bacteria | 711 |
| 122 | Ga0070706_100001132 | 3300005467 | Bacteria | 28817 |
| 123 | Ga0070706_100523857 | 3300005467 | Bacteria | 1103 |
| 124 | Ga0070707_100906411 | 3300005468 | Bacteria | 846 |
| 125 | Ga0070707_100925546 | 3300005468 | Bacteria | 836 |
| 126 | Ga0070707_101295655 | 3300005468 | Bacteria | 695 |
| 127 | Ga0070698_100114679 | 3300005471 | Bacteria | 2659 |
| 128 | Ga0070699_101518641 | 3300005518 | Bacteria | 614 |
| 129 | Ga0070679_100001357 | 3300005530 | Bacteria | 21606 |
| 130 | Ga0070679_100022895 | 3300005530 | Bacteria | 6110 |
| 131 | Ga0070679_100181873 | 3300005530 | Bacteria | 2074 |
| 132 | Ga0070679_100210065 | 3300005530 | Bacteria | 1910 |
| 133 | Ga0070679_100419985 | 3300005530 | Bacteria | 1283 |
| 134 | Ga0070679_100940056 | 3300005530 | Bacteria | 808 |
| 135 | Ga0070679_101727370 | 3300005530 | Bacteria | 574 |
| 136 | Ga0070679_102164542 | 3300005530 | Bacteria | 506 |
| 137 | Ga0070684_100049491 | 3300005535 | Bacteria | 3647 |
| 138 | Ga0070684_100131673 | 3300005535 | Bacteria | 2256 |
| 139 | Ga0070684_100264811 | 3300005535 | Bacteria | 1573 |
| 140 | Ga0070684_100486982 | 3300005535 | Bacteria | 1142 |
| 141 | Ga0070684_100691945 | 3300005535 | Bacteria | 950 |
| 142 | Ga0070684_100755196 | 3300005535 | Bacteria | 908 |
| 143 | Ga0070684_102320110 | 3300005535 | Unclassified | 506 |
| 144 | Ga0070697_100543948 | 3300005536 | Bacteria | 1018 |
| 145 | Ga0070697_101478412 | 3300005536 | Bacteria | 607 |
| 146 | Ga0068853_102079686 | 3300005539 | Bacteria | 551 |
| 147 | Ga0070672_100345392 | 3300005543 | Bacteria | 1268 |
| 148 | Ga0070672_100656040 | 3300005543 | Bacteria | 917 |
| 149 | Ga0070686_101934728 | 3300005544 | Bacteria | 504 |
| 150 | Ga0070695_100196184 | 3300005545 | Bacteria | 1440 |
| 151 | Ga0070696_100052817 | 3300005546 | Bacteria | 2828 |
| 152 | Ga0070693_100629895 | 3300005547 | Bacteria | 778 |
| 153 | Ga0070693_100911016 | 3300005547 | Bacteria | 659 |
| 154 | Ga0070665_100394988 | 3300005548 | Bacteria | 1391 |
| 155 | Ga0070665_100495817 | 3300005548 | Bacteria | 1232 |
| 156 | Ga0070665_100578220 | 3300005548 | Bacteria | 1136 |
| 157 | Ga0070665_100632856 | 3300005548 | Bacteria | 1083 |
| 158 | Ga0070665_100880729 | 3300005548 | Bacteria | 908 |
| 159 | Ga0070665_101801442 | 3300005548 | Bacteria | 619 |
| 160 | Ga0070704_100627673 | 3300005549 | Bacteria | 947 |
| 161 | Ga0068855_100035979 | 3300005563 | Bacteria | 5896 |
| 162 | Ga0070664_100003346 | 3300005564 | Bacteria | 12959 |
| 163 | Ga0070664_100100342 | 3300005564 | Bacteria | 2517 |
| 164 | Ga0070664_100346276 | 3300005564 | Bacteria | 1351 |
| 165 | Ga0070664_100454415 | 3300005564 | Bacteria | 1176 |
| 166 | Ga0070664_100592347 | 3300005564 | Bacteria | 1028 |
| 167 | Ga0070664_100691719 | 3300005564 | Bacteria | 949 |
| 168 | Ga0068857_100064208 | 3300005577 | Bacteria | 3264 |
| 169 | Ga0068857_100064422 | 3300005577 | Bacteria | 3259 |
| 170 | Ga0068857_100104273 | 3300005577 | Bacteria | 2546 |
| 171 | Ga0068857_100120725 | 3300005577 | Bacteria | 2359 |
| 172 | Ga0068857_100476187 | 3300005577 | Bacteria | 1170 |
| 173 | Ga0068857_100656329 | 3300005577 | Bacteria | 994 |
| 174 | Ga0068857_101007555 | 3300005577 | Bacteria | 802 |
| 175 | Ga0068857_101738368 | 3300005577 | Bacteria | 610 |
| 176 | Ga0068854_100046027 | 3300005578 | Bacteria | 3105 |
| 177 | Ga0068856_100179641 | 3300005614 | Bacteria | 2129 |
| 178 | Ga0068856_100420416 | 3300005614 | Bacteria | 1356 |
| 179 | Ga0068856_100556725 | 3300005614 | Bacteria | 1168 |
| 180 | Ga0068856_100674204 | 3300005614 | Bacteria | 1054 |
| 181 | Ga0068856_101052404 | 3300005614 | Bacteria | 832 |
| 182 | Ga0068852_100126393 | 3300005616 | Bacteria | 2348 |
| 183 | Ga0068852_101270622 | 3300005616 | Bacteria | 758 |
| 184 | Ga0068852_101815648 | 3300005616 | Bacteria | 632 |
| 185 | Ga0068852_102319155 | 3300005616 | Bacteria | 558 |
| 186 | Ga0068859_100471691 | 3300005617 | Bacteria | 1350 |
| 187 | Ga0068859_103053840 | 3300005617 | Bacteria | 511 |
| 188 | Ga0068864_100164539 | 3300005618 | Bacteria | 2019 |
| 189 | Ga0068864_100505344 | 3300005618 | Bacteria | 1163 |
| 190 | Ga0068864_100647361 | 3300005618 | Bacteria | 1029 |
| 191 | Ga0068864_101267194 | 3300005618 | Bacteria | 737 |
| 192 | Ga0068864_101267938 | 3300005618 | Bacteria | 737 |
| 193 | Ga0068866_10364926 | 3300005718 | Bacteria | 922 |
| 194 | Ga0068861_100152280 | 3300005719 | Bacteria | 1899 |
| 195 | Ga0068861_100478272 | 3300005719 | Bacteria | 1122 |
| 196 | Ga0068861_100968215 | 3300005719 | Bacteria | 810 |
| 197 | Ga0068861_102279178 | 3300005719 | Bacteria | 543 |
| 198 | Ga0068851_10833452 | 3300005834 | Bacteria | 575 |
| 199 | Ga0068851_10919132 | 3300005834 | Bacteria | 549 |
| 200 | Ga0068870_10196721 | 3300005840 | Bacteria | 1220 |
| 201 | Ga0068870_11380036 | 3300005840 | Bacteria | 516 |
| 202 | Ga0068863_100112032 | 3300005841 | Bacteria | 2599 |
| 203 | Ga0068863_100295179 | 3300005841 | Bacteria | 1571 |
| 204 | Ga0068863_100398559 | 3300005841 | Bacteria | 1346 |
| 205 | Ga0068863_100438704 | 3300005841 | Bacteria | 1280 |
| 206 | Ga0068863_101175857 | 3300005841 | Bacteria | 772 |
| 207 | Ga0068858_100000003 | 3300005842 | Bacteria | 349151 |
| 208 | Ga0068858_100400596 | 3300005842 | Bacteria | 1318 |
| 209 | Ga0068860_100351412 | 3300005843 | Bacteria | 1451 |
| 210 | Ga0068860_100417467 | 3300005843 | Bacteria | 1329 |
| 211 | Ga0068862_100319573 | 3300005844 | Bacteria | 1432 |
| 212 | Ga0068862_101461276 | 3300005844 | Bacteria | 688 |
| 213 | Ga0081455_10193072 | 3300005937 | Bacteria | 1531 |
| 214 | Ga0081540_1006417 | 3300005983 | Bacteria | 8562 |
| 215 | Ga0081540_1008507 | 3300005983 | Bacteria | 7163 |
| 216 | Ga0081540_1168961 | 3300005983 | Bacteria | 836 |
| 217 | Ga0081539_10000357 | 3300005985 | Bacteria | 100714 |
| 218 | Ga0081539_10000613 | 3300005985 | Bacteria | 72150 |
| 219 | Ga0081539_10001106 | 3300005985 | Bacteria | 48943 |
| 220 | Ga0081539_10021053 | 3300005985 | Bacteria | 4374 |
| 221 | Ga0081539_10050261 | 3300005985 | Bacteria | 2360 |
| 222 | Ga0081539_10210315 | 3300005985 | Bacteria | 892 |
| 223 | Ga0070717_10086914 | 3300006028 | Bacteria | 2632 |
| 224 | Ga0070717_10117948 | 3300006028 | Bacteria | 2270 |
| 225 | Ga0070717_10155742 | 3300006028 | Bacteria | 1979 |
| 226 | Ga0070717_10190102 | 3300006028 | Bacteria | 1794 |
| 227 | Ga0070717_10410061 | 3300006028 | Bacteria | 1218 |
| 228 | Ga0070717_10473276 | 3300006028 | Bacteria | 1131 |
| 229 | Ga0070717_10535337 | 3300006028 | Bacteria | 1060 |
| 230 | Ga0070717_10628381 | 3300006028 | Bacteria | 974 |
| 231 | Ga0070717_10629366 | 3300006028 | Bacteria | 974 |
| 232 | Ga0070717_11406333 | 3300006028 | Bacteria | 633 |
| 233 | Ga0075365_10840437 | 3300006038 | Bacteria | 648 |
| 234 | Ga0075368_10346759 | 3300006042 | Bacteria | 646 |
| 235 | Ga0075363_101029883 | 3300006048 | Bacteria | 508 |
| 236 | Ga0075364_10132326 | 3300006051 | Bacteria | 1675 |
| 237 | Ga0075364_10241111 | 3300006051 | Bacteria | 1228 |
| 238 | Ga0075364_10953457 | 3300006051 | Bacteria | 584 |
| 239 | Ga0070715_10012535 | 3300006163 | Bacteria | 3089 |
| 240 | Ga0070715_10261568 | 3300006163 | Bacteria | 909 |
| 241 | Ga0070715_10337616 | 3300006163 | Bacteria | 818 |
| 242 | Ga0070715_10849165 | 3300006163 | Unclassified | 558 |
| 243 | Ga0070716_100017617 | 3300006173 | Bacteria | 3707 |
| 244 | Ga0070716_100037270 | 3300006173 | Bacteria | 2686 |
| 245 | Ga0070716_100111375 | 3300006173 | Bacteria | 1697 |
| 246 | Ga0070716_100206357 | 3300006173 | Bacteria | 1310 |
| 247 | Ga0070716_100263060 | 3300006173 | Bacteria | 1181 |
| 248 | Ga0070716_101131958 | 3300006173 | Bacteria | 626 |
| 249 | Ga0070712_100001139 | 3300006175 | Bacteria | 16030 |
| 250 | Ga0070712_100062698 | 3300006175 | Bacteria | 2629 |
| 251 | Ga0070712_100260665 | 3300006175 | Bacteria | 1389 |
| 252 | Ga0070712_100970943 | 3300006175 | Bacteria | 734 |
| 253 | Ga0070712_101211530 | 3300006175 | Bacteria | 657 |
| 254 | Ga0070712_101580585 | 3300006175 | Bacteria | 573 |
| 255 | Ga0070712_101957197 | 3300006175 | Bacteria | 513 |
| 256 | Ga0075367_10247009 | 3300006178 | Bacteria | 1119 |
| 257 | Ga0097621_100520562 | 3300006237 | Bacteria | 1079 |
| 258 | Ga0097621_102335498 | 3300006237 | Bacteria | 512 |
| 259 | Ga0068871_100730998 | 3300006358 | Bacteria | 909 |
| 260 | Ga0068871_100904552 | 3300006358 | Bacteria | 818 |
| 261 | Ga0068871_101836048 | 3300006358 | Bacteria | 576 |
| 262 | Ga0068871_102262506 | 3300006358 | Bacteria | 518 |
| 263 | Ga0075428_100131420 | 3300006844 | Bacteria | 2723 |
| 264 | Ga0075428_100176977 | 3300006844 | Bacteria | 2310 |
| 265 | Ga0075428_100749448 | 3300006844 | Bacteria | 1039 |
| 266 | Ga0075430_100311890 | 3300006846 | Bacteria | 1301 |
| 267 | Ga0075430_100811730 | 3300006846 | Bacteria | 771 |
| 268 | Ga0075430_100821997 | 3300006846 | Bacteria | 766 |
| 269 | Ga0075430_100825945 | 3300006846 | Bacteria | 764 |
| 270 | Ga0075431_100110568 | 3300006847 | Bacteria | 2836 |
| 271 | Ga0075431_100262982 | 3300006847 | Bacteria | 1750 |
| 272 | Ga0075431_100602776 | 3300006847 | Bacteria | 1082 |
| 273 | Ga0075431_101403375 | 3300006847 | Bacteria | 658 |
| 274 | Ga0075433_10288283 | 3300006852 | Bacteria | 1454 |
| 275 | Ga0075434_100639575 | 3300006871 | Bacteria | 1082 |
| 276 | Ga0075434_101380961 | 3300006871 | Bacteria | 714 |
| 277 | Ga0075434_102089693 | 3300006871 | Bacteria | 571 |
| 278 | Ga0075429_101497486 | 3300006880 | Bacteria | 587 |
| 279 | Ga0068865_100412981 | 3300006881 | Bacteria | 1108 |
| 280 | Ga0097620_100471682 | 3300006931 | Bacteria | 1350 |
| 281 | Ga0097620_103055042 | 3300006931 | Bacteria | 511 |
| 282 | Ga0105250_10627908 | 3300009092 | Bacteria | 500 |
| 283 | Ga0105240_11588746 | 3300009093 | Bacteria | 684 |
| 284 | Ga0105240_11644620 | 3300009093 | Bacteria | 671 |
| 285 | Ga0111539_10360375 | 3300009094 | Bacteria | 1692 |
| 286 | Ga0111539_10434279 | 3300009094 | Bacteria | 1529 |
| 287 | Ga0105245_10091725 | 3300009098 | Bacteria | 2796 |
| 288 | Ga0105245_11264159 | 3300009098 | Bacteria | 787 |
| 289 | Ga0105247_10000296 | 3300009101 | Bacteria | 44916 |
| 290 | Ga0105247_10113467 | 3300009101 | Bacteria | 1747 |
| 291 | Ga0105247_10534720 | 3300009101 | Bacteria | 859 |
| 292 | Ga0105247_11340477 | 3300009101 | Bacteria | 576 |
| 293 | Ga0114129_10000007 | 3300009147 | Bacteria | 156645 |
| 294 | Ga0114129_10217549 | 3300009147 | Bacteria | 2579 |
| 295 | Ga0114129_10328069 | 3300009147 | Bacteria | 2033 |
| 296 | Ga0114129_10446493 | 3300009147 | Bacteria | 1697 |
| 297 | Ga0114129_10861884 | 3300009147 | Bacteria | 1151 |
| 298 | Ga0114129_12230636 | 3300009147 | Bacteria | 658 |
| 299 | Ga0105243_10229803 | 3300009148 | Bacteria | 1645 |
| 300 | Ga0105243_10578932 | 3300009148 | Bacteria | 1077 |
| 301 | Ga0105241_10073255 | 3300009174 | Bacteria | 2664 |
| 302 | Ga0105241_10349701 | 3300009174 | Bacteria | 1283 |
| 303 | Ga0105242_13090940 | 3300009176 | Bacteria | 516 |
| 304 | Ga0105248_10011254 | 3300009177 | Bacteria | 9867 |
| 305 | Ga0105248_10091447 | 3300009177 | Bacteria | 3427 |
| 306 | Ga0105248_10840973 | 3300009177 | Bacteria | 1036 |
| 307 | Ga0105248_11241542 | 3300009177 | Bacteria | 843 |
| 308 | Ga0105248_11669871 | 3300009177 | Bacteria | 722 |
| 309 | Ga0105237_10579508 | 3300009545 | Bacteria | 1129 |
| 310 | Ga0105237_10707778 | 3300009545 | Bacteria | 1014 |
| 311 | Ga0105237_11472013 | 3300009545 | Bacteria | 687 |
| 312 | Ga0105237_11977573 | 3300009545 | Bacteria | 591 |
| 313 | Ga0105237_12623079 | 3300009545 | Bacteria | 515 |
| 314 | Ga0105238_10658021 | 3300009551 | Bacteria | 1058 |
| 315 | Ga0105238_11845463 | 3300009551 | Bacteria | 637 |
| 316 | Ga0105249_11150985 | 3300009553 | Bacteria | 846 |
| 317 | Ga0099796_10567381 | 3300010159 | Bacteria | 511 |
| 318 | Ga0105239_10466237 | 3300010375 | Bacteria | 1434 |
| 319 | Ga0105239_11445956 | 3300010375 | Bacteria | 794 |
| 320 | Ga0105246_11274535 | 3300011119 | Bacteria | 680 |
| 321 | Ga0105246_11389924 | 3300011119 | Bacteria | 654 |
| 322 | Ga0105246_12246950 | 3300011119 | Bacteria | 532 |
| 323 | Ga0157373_10534193 | 3300013100 | Bacteria | 849 |
| 324 | Ga0157373_11344311 | 3300013100 | Bacteria | 542 |
| 325 | Ga0157371_10390666 | 3300013102 | Bacteria | 1017 |
| 326 | Ga0157370_10315645 | 3300013104 | Bacteria | 1442 |
| 327 | Ga0157370_10762908 | 3300013104 | Bacteria | 881 |
| 328 | Ga0157370_11754187 | 3300013104 | Bacteria | 557 |
| 329 | Ga0157369_10008846 | 3300013105 | Bacteria | 11530 |
| 330 | Ga0157369_10016406 | 3300013105 | Bacteria | 8330 |
| 331 | Ga0157369_10158983 | 3300013105 | Bacteria | 2386 |
| 332 | Ga0157369_10190000 | 3300013105 | Bacteria | 2158 |
| 333 | Ga0157369_10282245 | 3300013105 | Bacteria | 1729 |
| 334 | Ga0157369_10559482 | 3300013105 | Bacteria | 1182 |
| 335 | Ga0157374_11395427 | 3300013296 | Bacteria | 723 |
| 336 | Ga0157374_12050439 | 3300013296 | Bacteria | 599 |
| 337 | Ga0157378_10533847 | 3300013297 | Bacteria | 1176 |
| 338 | Ga0157378_11174705 | 3300013297 | Bacteria | 806 |
| 339 | Ga0157378_13033200 | 3300013297 | Bacteria | 521 |
| 340 | Ga0163162_10833368 | 3300013306 | Bacteria | 1038 |
| 341 | Ga0157372_10000044 | 3300013307 | Bacteria | 152637 |
| 342 | Ga0157372_10695067 | 3300013307 | Bacteria | 1184 |
| 343 | Ga0157372_10726396 | 3300013307 | Bacteria | 1155 |
| 344 | Ga0157372_11537878 | 3300013307 | Bacteria | 766 |
| 345 | Ga0157372_11832187 | 3300013307 | Bacteria | 698 |
| 346 | Ga0157372_12481291 | 3300013307 | Bacteria | 595 |
| 347 | Ga0157372_12621532 | 3300013307 | Bacteria | 578 |
| 348 | Ga0157375_10590344 | 3300013308 | Bacteria | 1270 |
| 349 | Ga0157375_11217677 | 3300013308 | Bacteria | 883 |
| 350 | Ga0157375_11285471 | 3300013308 | Bacteria | 860 |
| 351 | Ga0163163_10134785 | 3300014325 | Bacteria | 2510 |
| 352 | Ga0163163_10426728 | 3300014325 | Bacteria | 1385 |
| 353 | Ga0163163_10933907 | 3300014325 | Bacteria | 931 |
| 354 | Ga0163163_11719462 | 3300014325 | Bacteria | 688 |
| 355 | Ga0163163_11830447 | 3300014325 | Bacteria | 667 |
| 356 | Ga0163163_13202622 | 3300014325 | Bacteria | 510 |
| 357 | Ga0157380_11461675 | 3300014326 | Bacteria | 736 |
| 358 | Ga0157380_12275177 | 3300014326 | Bacteria | 606 |
| 359 | Ga0182008_10804335 | 3300014497 | Bacteria | 546 |
| 360 | Ga0157377_10286550 | 3300014745 | Bacteria | 1082 |
| 361 | Ga0157377_10687599 | 3300014745 | Bacteria | 741 |
| 362 | Ga0157377_10838470 | 3300014745 | Bacteria | 681 |
| 363 | Ga0157379_10000999 | 3300014968 | Bacteria | 22965 |
| 364 | Ga0157379_10346401 | 3300014968 | Bacteria | 1360 |
| 365 | Ga0157379_12180640 | 3300014968 | Bacteria | 550 |
| 366 | Ga0157379_12295691 | 3300014968 | Bacteria | 537 |
| 367 | Ga0157376_10066563 | 3300014969 | Bacteria | 3045 |
| 368 | Ga0157376_10852757 | 3300014969 | Bacteria | 926 |
| 369 | Ga0163161_10742604 | 3300017792 | Bacteria | 820 |
| 370 | Ga0184593_122585 | 3300019179 | Bacteria | 553 |
| 371 | Ga0184601_119431 | 3300019183 | Bacteria | 511 |
| 372 | Ga0184600_119799 | 3300019190 | Bacteria | 639 |
| 373 | Ga0184603_112367 | 3300019192 | Bacteria | 525 |
| 374 | Ga0197907_10027294 | 3300020069 | Bacteria | 1401 |
| 375 | Ga0197907_10220737 | 3300020069 | Bacteria | 661 |
| 376 | Ga0197907_10601364 | 3300020069 | Bacteria | 1097 |
| 377 | Ga0197907_10893729 | 3300020069 | Bacteria | 980 |
| 378 | Ga0206356_10997871 | 3300020070 | Bacteria | 737 |
| 379 | Ga0206356_11372204 | 3300020070 | Bacteria | 1143 |
| 380 | Ga0206356_11671517 | 3300020070 | Bacteria | 2525 |
| 381 | Ga0206349_1553193 | 3300020075 | Bacteria | 690 |
| 382 | Ga0206349_1886438 | 3300020075 | Bacteria | 531 |
| 383 | Ga0206351_10291020 | 3300020077 | Bacteria | 1460 |
| 384 | Ga0206351_10579729 | 3300020077 | Bacteria | 957 |
| 385 | Ga0206351_10889857 | 3300020077 | Bacteria | 560 |
| 386 | Ga0206352_10038242 | 3300020078 | Bacteria | 1306 |
| 387 | Ga0206352_10136420 | 3300020078 | Bacteria | 1063 |
| 388 | Ga0206352_10289056 | 3300020078 | Bacteria | 629 |
| 389 | Ga0206352_11208457 | 3300020078 | Bacteria | 609 |
| 390 | Ga0206350_10168894 | 3300020080 | Bacteria | 1041 |
| 391 | Ga0206350_10655422 | 3300020080 | Bacteria | 670 |
| 392 | Ga0206354_10034819 | 3300020081 | Bacteria | 1150 |
| 393 | Ga0206354_10148362 | 3300020081 | Bacteria | 805 |
| 394 | Ga0206354_10287205 | 3300020081 | Bacteria | 1579 |
| 395 | Ga0206354_10606016 | 3300020081 | Bacteria | 1084 |
| 396 | Ga0206354_10631935 | 3300020081 | Bacteria | 1308 |
| 397 | Ga0206354_10751521 | 3300020081 | Bacteria | 1664 |
| 398 | Ga0206354_11147654 | 3300020081 | Bacteria | 1018 |
| 399 | Ga0206354_11494243 | 3300020081 | Bacteria | 2509 |
| 400 | Ga0206353_10658063 | 3300020082 | Bacteria | 1132 |
| 401 | Ga0206353_10693515 | 3300020082 | Bacteria | 780 |
| 402 | Ga0206353_11116006 | 3300020082 | Bacteria | 1490 |
| 403 | Ga0206353_11271389 | 3300020082 | Bacteria | 1192 |
| 404 | Ga0206353_11430486 | 3300020082 | Bacteria | 4636 |
| 405 | Ga0206353_11796673 | 3300020082 | Bacteria | 1101 |
| 406 | Ga0224712_10060728 | 3300022467 | Bacteria | 1505 |
| 407 | Ga0224712_10067101 | 3300022467 | Bacteria | 1446 |
| 408 | Ga0224712_10073951 | 3300022467 | Bacteria | 1391 |
| 409 | Ga0224712_10107264 | 3300022467 | Bacteria | 1193 |
| 410 | Ga0224712_10145804 | 3300022467 | Bacteria | 1045 |
| 411 | Ga0224712_10203293 | 3300022467 | Bacteria | 901 |
| 412 | Ga0224712_10506274 | 3300022467 | Bacteria | 584 |
| 413 | Ga0247529_114344 | 3300023559 | Bacteria | 661 |
| 414 | Ga0247530_109533 | 3300023563 | Bacteria | 782 |
| 415 | Ga0207682_10170805 | 3300025893 | Bacteria | 989 |
| 416 | Ga0207682_10590075 | 3300025893 | Bacteria | 524 |
| 417 | Ga0207692_10000366 | 3300025898 | Bacteria | 15490 |
| 418 | Ga0207692_10128288 | 3300025898 | Bacteria | 1429 |
| 419 | Ga0207692_10289011 | 3300025898 | Bacteria | 994 |
| 420 | Ga0207692_10344722 | 3300025898 | Bacteria | 917 |
| 421 | Ga0207692_10357241 | 3300025898 | Bacteria | 902 |
| 422 | Ga0207692_10364691 | 3300025898 | Bacteria | 893 |
| 423 | Ga0207692_10714620 | 3300025898 | Bacteria | 651 |
| 424 | Ga0207692_10991139 | 3300025898 | Bacteria | 555 |
| 425 | Ga0207710_10000020 | 3300025900 | Bacteria | 338425 |
| 426 | Ga0207710_10411119 | 3300025900 | Bacteria | 695 |
| 427 | Ga0207688_10896082 | 3300025901 | Bacteria | 562 |
| 428 | Ga0207688_10899589 | 3300025901 | Bacteria | 560 |
| 429 | Ga0207680_10647632 | 3300025903 | Bacteria | 756 |
| 430 | Ga0207680_10889400 | 3300025903 | Bacteria | 638 |
| 431 | Ga0207647_10738399 | 3300025904 | Bacteria | 534 |
| 432 | Ga0207685_10166257 | 3300025905 | Bacteria | 1011 |
| 433 | Ga0207685_10168595 | 3300025905 | Bacteria | 1006 |
| 434 | Ga0207685_10788500 | 3300025905 | Bacteria | 523 |
| 435 | Ga0207699_10003090 | 3300025906 | Bacteria | 7910 |
| 436 | Ga0207699_10015215 | 3300025906 | Bacteria | 3992 |
| 437 | Ga0207699_10258237 | 3300025906 | Bacteria | 1203 |
| 438 | Ga0207699_10382958 | 3300025906 | Bacteria | 999 |
| 439 | Ga0207699_11056717 | 3300025906 | Bacteria | 601 |
| 440 | Ga0207699_11310551 | 3300025906 | Bacteria | 536 |
| 441 | Ga0207645_10169744 | 3300025907 | Bacteria | 1429 |
| 442 | Ga0207643_10246568 | 3300025908 | Bacteria | 1099 |
| 443 | Ga0207643_10720282 | 3300025908 | Bacteria | 645 |
| 444 | Ga0207705_10038088 | 3300025909 | Bacteria | 3442 |
| 445 | Ga0207705_10244273 | 3300025909 | Bacteria | 1368 |
| 446 | Ga0207705_10471205 | 3300025909 | Bacteria | 974 |
| 447 | Ga0207705_10829913 | 3300025909 | Bacteria | 717 |
| 448 | Ga0207684_10001586 | 3300025910 | Bacteria | 24214 |
| 449 | Ga0207684_10021426 | 3300025910 | Bacteria | 5519 |
| 450 | Ga0207684_10522748 | 3300025910 | Bacteria | 1016 |
| 451 | Ga0207684_10576510 | 3300025910 | Bacteria | 962 |
| 452 | Ga0207654_10109048 | 3300025911 | Bacteria | 1719 |
| 453 | Ga0207707_10000418 | 3300025912 | Bacteria | 44561 |
| 454 | Ga0207707_10053472 | 3300025912 | Bacteria | 3515 |
| 455 | Ga0207707_10661347 | 3300025912 | Bacteria | 880 |
| 456 | Ga0207707_11173233 | 3300025912 | Bacteria | 623 |
| 457 | Ga0207707_11173824 | 3300025912 | Bacteria | 622 |
| 458 | Ga0207695_11143221 | 3300025913 | Bacteria | 659 |
| 459 | Ga0207693_10004248 | 3300025915 | Bacteria | 12147 |
| 460 | Ga0207693_10086885 | 3300025915 | Bacteria | 2450 |
| 461 | Ga0207693_10216939 | 3300025915 | Bacteria | 1503 |
| 462 | Ga0207693_10541804 | 3300025915 | Bacteria | 908 |
| 463 | Ga0207693_10920313 | 3300025915 | Bacteria | 670 |
| 464 | Ga0207663_10220500 | 3300025916 | Bacteria | 1380 |
| 465 | Ga0207663_10232307 | 3300025916 | Bacteria | 1348 |
| 466 | Ga0207663_10409515 | 3300025916 | Bacteria | 1039 |
| 467 | Ga0207663_10564624 | 3300025916 | Bacteria | 891 |
| 468 | Ga0207663_10630412 | 3300025916 | Bacteria | 845 |
| 469 | Ga0207663_10938692 | 3300025916 | Bacteria | 693 |
| 470 | Ga0207660_10000168 | 3300025917 | Bacteria | 41428 |
| 471 | Ga0207660_10156392 | 3300025917 | Bacteria | 1755 |
| 472 | Ga0207660_10986639 | 3300025917 | Bacteria | 687 |
| 473 | Ga0207660_11165191 | 3300025917 | Bacteria | 627 |
| 474 | Ga0207662_10344881 | 3300025918 | Bacteria | 999 |
| 475 | Ga0207662_10693094 | 3300025918 | Bacteria | 713 |
| 476 | Ga0207657_10028132 | 3300025919 | Bacteria | 5135 |
| 477 | Ga0207657_10557645 | 3300025919 | Bacteria | 896 |
| 478 | Ga0207649_10021859 | 3300025920 | Bacteria | 3691 |
| 479 | Ga0207649_10333869 | 3300025920 | Bacteria | 1117 |
| 480 | Ga0207649_10844178 | 3300025920 | Bacteria | 716 |
| 481 | Ga0207649_11072046 | 3300025920 | Bacteria | 635 |
| 482 | Ga0207649_11079274 | 3300025920 | Bacteria | 633 |
| 483 | Ga0207652_10000461 | 3300025921 | Bacteria | 41921 |
| 484 | Ga0207652_10209906 | 3300025921 | Bacteria | 1753 |
| 485 | Ga0207652_10478069 | 3300025921 | Bacteria | 1122 |
| 486 | Ga0207652_10600401 | 3300025921 | Bacteria | 987 |
| 487 | Ga0207652_10673217 | 3300025921 | Unclassified | 924 |
| 488 | Ga0207652_11844551 | 3300025921 | Bacteria | 510 |
| 489 | Ga0207646_10011604 | 3300025922 | Bacteria | 8518 |
| 490 | Ga0207646_10082776 | 3300025922 | Bacteria | 2870 |
| 491 | Ga0207646_11432422 | 3300025922 | Bacteria | 600 |
| 492 | Ga0207646_11694505 | 3300025922 | Bacteria | 543 |
| 493 | Ga0207681_10178184 | 3300025923 | Bacteria | 1617 |
| 494 | Ga0207681_10697682 | 3300025923 | Bacteria | 844 |
| 495 | Ga0207694_10864232 | 3300025924 | Bacteria | 764 |
| 496 | Ga0207650_10633634 | 3300025925 | Bacteria | 900 |
| 497 | Ga0207650_11378586 | 3300025925 | Bacteria | 600 |
| 498 | Ga0207659_10004185 | 3300025926 | Bacteria | 8714 |
| 499 | Ga0207659_10293543 | 3300025926 | Bacteria | 1333 |
| 500 | Ga0207659_11864174 | 3300025926 | Bacteria | 510 |
| 501 | Ga0207687_10057947 | 3300025927 | Bacteria | 2723 |
| 502 | Ga0207700_10008761 | 3300025928 | Bacteria | 6284 |
| 503 | Ga0207700_10043804 | 3300025928 | Bacteria | 3290 |
| 504 | Ga0207700_10109682 | 3300025928 | Bacteria | 2218 |
| 505 | Ga0207700_10173207 | 3300025928 | Bacteria | 1802 |
| 506 | Ga0207700_10422868 | 3300025928 | Bacteria | 1171 |
| 507 | Ga0207700_10467342 | 3300025928 | Bacteria | 1113 |
| 508 | Ga0207700_10791159 | 3300025928 | Bacteria | 848 |
| 509 | Ga0207700_10868618 | 3300025928 | Bacteria | 807 |
| 510 | Ga0207700_11420379 | 3300025928 | Bacteria | 617 |
| 511 | Ga0207700_11521831 | 3300025928 | Bacteria | 593 |
| 512 | Ga0207664_10002028 | 3300025929 | Bacteria | 13327 |
| 513 | Ga0207664_10020733 | 3300025929 | Bacteria | 4878 |
| 514 | Ga0207664_10021120 | 3300025929 | Bacteria | 4835 |
| 515 | Ga0207664_10032443 | 3300025929 | Bacteria | 4002 |
| 516 | Ga0207664_10202640 | 3300025929 | Bacteria | 1714 |
| 517 | Ga0207664_10321487 | 3300025929 | Bacteria | 1365 |
| 518 | Ga0207664_10371665 | 3300025929 | Bacteria | 1268 |
| 519 | Ga0207664_10514508 | 3300025929 | Bacteria | 1072 |
| 520 | Ga0207664_10549317 | 3300025929 | Bacteria | 1036 |
| 521 | Ga0207664_10785581 | 3300025929 | Bacteria | 856 |
| 522 | Ga0207664_11428326 | 3300025929 | Bacteria | 613 |
| 523 | Ga0207644_11000874 | 3300025931 | Bacteria | 702 |
| 524 | Ga0207690_10067601 | 3300025932 | Bacteria | 2452 |
| 525 | Ga0207706_10367734 | 3300025933 | Bacteria | 1249 |
| 526 | Ga0207706_11064928 | 3300025933 | Bacteria | 677 |
| 527 | Ga0207669_10904033 | 3300025937 | Bacteria | 738 |
| 528 | Ga0207704_10383396 | 3300025938 | Bacteria | 1104 |
| 529 | Ga0207704_11896187 | 3300025938 | Bacteria | 513 |
| 530 | Ga0207665_10001687 | 3300025939 | Bacteria | 14854 |
| 531 | Ga0207665_10423495 | 3300025939 | Bacteria | 1017 |
| 532 | Ga0207665_10934355 | 3300025939 | Bacteria | 689 |
| 533 | Ga0207665_11047892 | 3300025939 | Bacteria | 649 |
| 534 | Ga0207691_10186014 | 3300025940 | Bacteria | 1813 |
| 535 | Ga0207691_10431019 | 3300025940 | Bacteria | 1123 |
| 536 | Ga0207711_10103798 | 3300025941 | Bacteria | 2517 |
| 537 | Ga0207711_10368503 | 3300025941 | Bacteria | 1332 |
| 538 | Ga0207711_10635389 | 3300025941 | Bacteria | 996 |
| 539 | Ga0207711_11288493 | 3300025941 | Bacteria | 673 |
| 540 | Ga0207689_10058040 | 3300025942 | Bacteria | 3183 |
| 541 | Ga0207689_10074648 | 3300025942 | Bacteria | 2786 |
| 542 | Ga0207689_10343761 | 3300025942 | Bacteria | 1240 |
| 543 | Ga0207689_10569861 | 3300025942 | Bacteria | 951 |
| 544 | Ga0207689_10835303 | 3300025942 | Bacteria | 777 |
| 545 | Ga0207661_10001620 | 3300025944 | Bacteria | 15317 |
| 546 | Ga0207661_10152677 | 3300025944 | Bacteria | 1997 |
| 547 | Ga0207661_10184007 | 3300025944 | Bacteria | 1827 |
| 548 | Ga0207661_10288319 | 3300025944 | Bacteria | 1469 |
| 549 | Ga0207661_10448037 | 3300025944 | Bacteria | 1176 |
| 550 | Ga0207661_10627931 | 3300025944 | Bacteria | 987 |
| 551 | Ga0207661_10970265 | 3300025944 | Bacteria | 783 |
| 552 | Ga0207661_11171209 | 3300025944 | Bacteria | 707 |
| 553 | Ga0207661_11231299 | 3300025944 | Bacteria | 688 |
| 554 | Ga0207661_12016946 | 3300025944 | Bacteria | 523 |
| 555 | Ga0207679_10008106 | 3300025945 | Bacteria | 6681 |
| 556 | Ga0207679_10128346 | 3300025945 | Bacteria | 2030 |
| 557 | Ga0207679_10177093 | 3300025945 | Bacteria | 1761 |
| 558 | Ga0207679_10213125 | 3300025945 | Bacteria | 1621 |
| 559 | Ga0207679_10293448 | 3300025945 | Bacteria | 1399 |
| 560 | Ga0207679_10442693 | 3300025945 | Bacteria | 1151 |
| 561 | Ga0207679_10515970 | 3300025945 | Bacteria | 1068 |
| 562 | Ga0207679_10684669 | 3300025945 | Unclassified | 929 |
| 563 | Ga0207667_10193892 | 3300025949 | Bacteria | 2084 |
| 564 | Ga0207667_12226164 | 3300025949 | Bacteria | 505 |
| 565 | Ga0207651_10983086 | 3300025960 | Bacteria | 754 |
| 566 | Ga0207651_11819403 | 3300025960 | Unclassified | 548 |
| 567 | Ga0207712_10205948 | 3300025961 | Bacteria | 1563 |
| 568 | Ga0207668_10002358 | 3300025972 | Bacteria | 11036 |
| 569 | Ga0207668_10979034 | 3300025972 | Bacteria | 755 |
| 570 | Ga0207668_11130726 | 3300025972 | Bacteria | 703 |
| 571 | Ga0207668_11483594 | 3300025972 | Bacteria | 612 |
| 572 | Ga0207640_10706683 | 3300025981 | Bacteria | 865 |
| 573 | Ga0207640_11281141 | 3300025981 | Bacteria | 654 |
| 574 | Ga0207658_10437789 | 3300025986 | Bacteria | 1155 |
| 575 | Ga0207677_11271344 | 3300026023 | Bacteria | 675 |
| 576 | Ga0207703_10000006 | 3300026035 | Bacteria | 502351 |
| 577 | Ga0207678_10122234 | 3300026067 | Bacteria | 2221 |
| 578 | Ga0207678_10130372 | 3300026067 | Bacteria | 2145 |
| 579 | Ga0207678_10187353 | 3300026067 | Bacteria | 1768 |
| 580 | Ga0207678_10219833 | 3300026067 | Bacteria | 1626 |
| 581 | Ga0207678_10221569 | 3300026067 | Bacteria | 1619 |
| 582 | Ga0207678_10338850 | 3300026067 | Bacteria | 1295 |
| 583 | Ga0207708_10094016 | 3300026075 | Bacteria | 2314 |
| 584 | Ga0207708_10322248 | 3300026075 | Bacteria | 1261 |
| 585 | Ga0207708_10365112 | 3300026075 | Bacteria | 1187 |
| 586 | Ga0207708_10396538 | 3300026075 | Bacteria | 1140 |
| 587 | Ga0207708_10651524 | 3300026075 | Bacteria | 896 |
| 588 | Ga0207702_10144165 | 3300026078 | Bacteria | 2159 |
| 589 | Ga0207702_10398334 | 3300026078 | Bacteria | 1327 |
| 590 | Ga0207702_10680302 | 3300026078 | Bacteria | 1013 |
| 591 | Ga0207702_10830201 | 3300026078 | Bacteria | 914 |
| 592 | Ga0207702_10971220 | 3300026078 | Bacteria | 842 |
| 593 | Ga0207702_11136278 | 3300026078 | Bacteria | 775 |
| 594 | Ga0207702_11444860 | 3300026078 | Bacteria | 681 |
| 595 | Ga0207702_12369271 | 3300026078 | Bacteria | 518 |
| 596 | Ga0207641_10077025 | 3300026088 | Bacteria | 2885 |
| 597 | Ga0207641_10139497 | 3300026088 | Bacteria | 2185 |
| 598 | Ga0207641_11391622 | 3300026088 | Bacteria | 702 |
| 599 | Ga0207648_10131181 | 3300026089 | Bacteria | 2206 |
| 600 | Ga0207676_10035666 | 3300026095 | Bacteria | 3778 |
| 601 | Ga0207676_10160836 | 3300026095 | Bacteria | 1945 |
| 602 | Ga0207676_10525346 | 3300026095 | Bacteria | 1127 |
| 603 | Ga0207676_10573248 | 3300026095 | Bacteria | 1081 |
| 604 | Ga0207676_10660512 | 3300026095 | Bacteria | 1010 |
| 605 | Ga0207676_10940344 | 3300026095 | Bacteria | 849 |
| 606 | Ga0207676_11625257 | 3300026095 | Bacteria | 644 |
| 607 | Ga0207674_10019875 | 3300026116 | Bacteria | 7268 |
| 608 | Ga0207674_10158216 | 3300026116 | Bacteria | 2220 |
| 609 | Ga0207674_10174824 | 3300026116 | Bacteria | 2100 |
| 610 | Ga0207674_10221562 | 3300026116 | Bacteria | 1840 |
| 611 | Ga0207674_10289063 | 3300026116 | Bacteria | 1588 |
| 612 | Ga0207674_10717995 | 3300026116 | Bacteria | 965 |
| 613 | Ga0207674_11569659 | 3300026116 | Bacteria | 627 |
| 614 | Ga0207674_11594510 | 3300026116 | Bacteria | 621 |
| 615 | Ga0207674_12109520 | 3300026116 | Bacteria | 527 |
| 616 | Ga0207675_100014030 | 3300026118 | Bacteria | 7470 |
| 617 | Ga0207675_100397758 | 3300026118 | Bacteria | 1357 |
| 618 | Ga0207675_100508119 | 3300026118 | Bacteria | 1200 |
| 619 | Ga0207675_100536457 | 3300026118 | Bacteria | 1168 |
| 620 | Ga0207675_101013001 | 3300026118 | Bacteria | 849 |
| 621 | Ga0207683_10078213 | 3300026121 | Bacteria | 2931 |
| 622 | Ga0207683_10232623 | 3300026121 | Bacteria | 1681 |
| 623 | Ga0207683_10286254 | 3300026121 | Bacteria | 1506 |
| 624 | Ga0207698_10688978 | 3300026142 | Bacteria | 1016 |
| 625 | Ga0207698_10898864 | 3300026142 | Bacteria | 893 |
| 626 | Ga0207698_11549697 | 3300026142 | Bacteria | 678 |
| 627 | Ga0207428_10080319 | 3300027907 | Bacteria | 2548 |
| 628 | Ga0268266_10207834 | 3300028379 | Bacteria | 1794 |
| 629 | Ga0268266_10688606 | 3300028379 | Bacteria | 985 |
| 630 | Ga0268266_11819046 | 3300028379 | Bacteria | 584 |
| 631 | Ga0268265_10014957 | 3300028380 | Bacteria | 5299 |
| 632 | Ga0268265_10568707 | 3300028380 | Bacteria | 1079 |
| 633 | Ga0268265_11072539 | 3300028380 | Bacteria | 799 |
| 634 | Ga0268265_11879882 | 3300028380 | Bacteria | 605 |
| 635 | Ga0268264_10139955 | 3300028381 | Bacteria | 2157 |
| 636 | Ga0268264_10404078 | 3300028381 | Bacteria | 1313 |
| 637 | Ga0265336_10042279 | 3300028666 | Bacteria | 1391 |
| 638 | Ga0307517_10115171 | 3300028786 | Bacteria | 2019 |
| 639 | Ga0307517_10503128 | 3300028786 | Bacteria | 616 |
| 640 | Ga0307515_10000045 | 3300028794 | Bacteria | 301029 |
| 641 | Ga0307515_10015993 | 3300028794 | Bacteria | 13773 |
| 642 | Ga0307515_10032705 | 3300028794 | Bacteria | 8600 |
| 643 | Ga0307515_10051803 | 3300028794 | Bacteria | 6109 |
| 644 | Ga0307515_10207412 | 3300028794 | Bacteria | 1815 |
| 645 | Ga0265338_10000680 | 3300028800 | Bacteria | 58427 |
| 646 | Ga0310981_1042067 | 3300029285 | Bacteria | 530 |
| 647 | Ga0307512_10007169 | 3300030522 | Bacteria | 11093 |
| 648 | Ga0307512_10076400 | 3300030522 | Bacteria | 2442 |
| 649 | Ga0307512_10115066 | 3300030522 | Bacteria | 1753 |
| 650 | Ga0307512_10171240 | 3300030522 | Bacteria | 1244 |
| 651 | Ga0316178_1088482 | 3300030735 | Bacteria | 1607 |
| 652 | Ga0307513_10015297 | 3300031456 | Bacteria | 9307 |
| 653 | Ga0307513_10056025 | 3300031456 | Bacteria | 4213 |
| 654 | Ga0307513_10144144 | 3300031456 | Bacteria | 2303 |
| 655 | Ga0307509_10018024 | 3300031507 | Bacteria | 8106 |
| 656 | Ga0307509_10123651 | 3300031507 | Bacteria | 2559 |
| 657 | Ga0307509_10367065 | 3300031507 | Bacteria | 1157 |
| 658 | Ga0307408_100075391 | 3300031548 | Bacteria | 2506 |
| 659 | Ga0307408_101358571 | 3300031548 | Bacteria | 668 |
| 660 | Ga0307408_102216215 | 3300031548 | Bacteria | 531 |
| 661 | Ga0310117_107422 | 3300031592 | Bacteria | 1181 |
| 662 | Ga0310103_113480 | 3300031614 | Bacteria | 1088 |
| 663 | Ga0307508_10003422 | 3300031616 | Bacteria | 16058 |
| 664 | Ga0307508_10018512 | 3300031616 | Bacteria | 6331 |
| 665 | Ga0307508_10018782 | 3300031616 | Bacteria | 6283 |
| 666 | Ga0307508_10027035 | 3300031616 | Bacteria | 5198 |
| 667 | Ga0307508_10030578 | 3300031616 | Bacteria | 4868 |
| 668 | Ga0307508_10136839 | 3300031616 | Bacteria | 2053 |
| 669 | Ga0307514_10175386 | 3300031649 | Bacteria | 1392 |
| 670 | Ga0310119_125356 | 3300031686 | Bacteria | 626 |
| 671 | Ga0307516_10006648 | 3300031730 | Bacteria | 13518 |
| 672 | Ga0307516_10014878 | 3300031730 | Bacteria | 8211 |
| 673 | Ga0307516_10018382 | 3300031730 | Bacteria | 7264 |
| 674 | Ga0307516_10297527 | 3300031730 | Bacteria | 1290 |
| 675 | Ga0307405_10005914 | 3300031731 | Bacteria | 5964 |
| 676 | Ga0307405_10087274 | 3300031731 | Bacteria | 2056 |
| 677 | Ga0307405_10547147 | 3300031731 | Bacteria | 936 |
| 678 | Ga0307405_10793985 | 3300031731 | Bacteria | 792 |
| 679 | Ga0307405_10858681 | 3300031731 | Bacteria | 765 |
| 680 | Ga0307405_11497041 | 3300031731 | Bacteria | 593 |
| 681 | Ga0316044_122642 | 3300031810 | Bacteria | 636 |
| 682 | Ga0316045_127068 | 3300031815 | Bacteria | 513 |
| 683 | Ga0307413_10168551 | 3300031824 | Bacteria | 1547 |
| 684 | Ga0307413_10436486 | 3300031824 | Bacteria | 1036 |
| 685 | Ga0307413_11080941 | 3300031824 | Bacteria | 692 |
| 686 | Ga0307413_11837754 | 3300031824 | Bacteria | 543 |
| 687 | Ga0307410_10023845 | 3300031852 | Bacteria | 3813 |
| 688 | Ga0307410_10300718 | 3300031852 | Bacteria | 1266 |
| 689 | Ga0307410_10890291 | 3300031852 | Bacteria | 762 |
| 690 | Ga0307410_11508923 | 3300031852 | Bacteria | 592 |
| 691 | Ga0307410_11934746 | 3300031852 | Bacteria | 525 |
| 692 | Ga0307406_10002273 | 3300031901 | Bacteria | 10449 |
| 693 | Ga0307406_10008054 | 3300031901 | Bacteria | 5869 |
| 694 | Ga0307406_10033659 | 3300031901 | Bacteria | 3139 |
| 695 | Ga0307406_10367532 | 3300031901 | Bacteria | 1130 |
| 696 | Ga0307406_10384306 | 3300031901 | Bacteria | 1108 |
| 697 | Ga0307406_10537660 | 3300031901 | Bacteria | 954 |
| 698 | Ga0307406_10638900 | 3300031901 | Bacteria | 882 |
| 699 | Ga0307406_10706285 | 3300031901 | Bacteria | 842 |
| 700 | Ga0307406_10744809 | 3300031901 | Bacteria | 822 |
| 701 | Ga0307406_11004840 | 3300031901 | Bacteria | 716 |
| 702 | Ga0307407_10008322 | 3300031903 | Bacteria | 4754 |
| 703 | Ga0307407_10061396 | 3300031903 | Bacteria | 2197 |
| 704 | Ga0307407_10446597 | 3300031903 | Bacteria | 938 |
| 705 | Ga0307407_10801878 | 3300031903 | Bacteria | 716 |
| 706 | Ga0307407_11401179 | 3300031903 | Bacteria | 551 |
| 707 | Ga0307412_10082849 | 3300031911 | Bacteria | 2222 |
| 708 | Ga0307412_12319051 | 3300031911 | Bacteria | 501 |
| 709 | Ga0307409_100011902 | 3300031995 | Bacteria | 5513 |
| 710 | Ga0307409_100054640 | 3300031995 | Bacteria | 3077 |
| 711 | Ga0307409_100185269 | 3300031995 | Bacteria | 1847 |
| 712 | Ga0307409_100240682 | 3300031995 | Bacteria | 1647 |
| 713 | Ga0307409_100543258 | 3300031995 | Bacteria | 1139 |
| 714 | Ga0307409_101346036 | 3300031995 | Bacteria | 740 |
| 715 | Ga0307409_101483187 | 3300031995 | Bacteria | 705 |
| 716 | Ga0307409_102006274 | 3300031995 | Bacteria | 608 |
| 717 | Ga0307409_102236131 | 3300031995 | Bacteria | 576 |
| 718 | Ga0307409_102293295 | 3300031995 | Bacteria | 569 |
| 719 | Ga0307416_100001161 | 3300032002 | Bacteria | 14156 |
| 720 | Ga0307416_100116839 | 3300032002 | Bacteria | 2366 |
| 721 | Ga0307416_100438689 | 3300032002 | Bacteria | 1355 |
| 722 | Ga0307416_101368479 | 3300032002 | Bacteria | 813 |
| 723 | Ga0307416_101679290 | 3300032002 | Bacteria | 740 |
| 724 | Ga0307416_102214557 | 3300032002 | Bacteria | 651 |
| 725 | Ga0307416_102510581 | 3300032002 | Bacteria | 614 |
| 726 | Ga0307414_10528885 | 3300032004 | Bacteria | 1048 |
| 727 | Ga0307411_10932966 | 3300032005 | Bacteria | 773 |
| 728 | Ga0307411_11685890 | 3300032005 | Bacteria | 586 |
| 729 | Ga0307411_11927204 | 3300032005 | Bacteria | 550 |
| 730 | Ga0316053_117435 | 3300032120 | Bacteria | 545 |
| 731 | Ga0307415_100000190 | 3300032126 | Bacteria | 27293 |
| 732 | Ga0307415_100004484 | 3300032126 | Bacteria | 7252 |
| 733 | Ga0307415_100022219 | 3300032126 | Bacteria | 3911 |
| 734 | Ga0307415_100164818 | 3300032126 | Bacteria | 1722 |
| 735 | Ga0307415_100222900 | 3300032126 | Bacteria | 1513 |
| 736 | Ga0307415_100382085 | 3300032126 | Bacteria | 1196 |
| 737 | Ga0307415_100404310 | 3300032126 | Bacteria | 1167 |
| 738 | Ga0307415_100530044 | 3300032126 | Bacteria | 1035 |
| 739 | Ga0307415_100780641 | 3300032126 | Bacteria | 870 |
| 740 | Ga0307415_102355540 | 3300032126 | Bacteria | 523 |
| 741 | Ga0307507_10012122 | 3300033179 | Bacteria | 10711 |
| 742 | Ga0307507_10211728 | 3300033179 | Bacteria | 1320 |
| 743 | Ga0307507_10447943 | 3300033179 | Bacteria | 714 |
| 744 | Ga0307510_10385505 | 3300033180 | Bacteria | 846 |
| 745 | Ga0316214_1004474 | 3300033545 | Bacteria | 1804 |
| 746 | Ga0373930_0011603 | 3300034816 | Bacteria | 1593 |
| 747 | Ga0373948_0004465 | 3300034817 | Bacteria | 2215 |
| 748 | Ga0373950_0121524 | 3300034818 | Bacteria | 578 |
| 749 | Ga0373958_0026477 | 3300034819 | Bacteria | 1111 |
| 750 | Ga0373959_0131207 | 3300034820 | Bacteria | 620 |
| 751 | Ga0373926_0088989 | 3300035083 | Bacteria | 1147 |
| 752 | Ga0373926_0259422 | 3300035083 | Bacteria | 674 |
| 753 | Ga0373928_0004059 | 3300035084 | Bacteria | 2795 |
| 754 | Ga0373928_0121382 | 3300035084 | Bacteria | 701 |
| 755 | Ga0373934_0000034 | 3300035086 | Bacteria | 44625 |
| 756 | Ga0373934_0015572 | 3300035086 | Bacteria | 2886 |
| 757 | Ga0373934_0016744 | 3300035086 | Bacteria | 2789 |
| 758 | Ga0373934_0039606 | 3300035086 | Bacteria | 1858 |
| 759 | Ga0373940_0068300 | 3300035088 | Bacteria | 1030 |
| 760 | Ga0373944_0010680 | 3300035089 | Bacteria | 2506 |
| 761 | Ga0373944_0063547 | 3300035089 | Bacteria | 1189 |
| 762 | Ga0373944_0313979 | 3300035089 | Bacteria | 590 |
| 763 | Ga0373944_0430426 | 3300035089 | Bacteria | 512 |
| 764 | Ga0373949_0016313 | 3300035090 | Bacteria | 1664 |
| 765 | Ga0373951_0000004 | 3300035091 | Bacteria | 95240 |
| 766 | Ga0373951_0068872 | 3300035091 | Unclassified | 898 |
| 767 | Ga0373923_0000906 | 3300035111 | Bacteria | 7908 |
| 768 | Ga0373923_0171819 | 3300035111 | Bacteria | 993 |
| 769 | Ga0373923_0260816 | 3300035111 | Bacteria | 813 |
| 770 | Ga0373923_0263823 | 3300035111 | Bacteria | 808 |
| 771 | Ga0373932_0052367 | 3300035112 | Bacteria | 1215 |
| 772 | Ga0373936_0047619 | 3300035113 | Bacteria | 1729 |
| 773 | Ga0373936_0092749 | 3300035113 | Bacteria | 1267 |
| 774 | Ga0373939_0029292 | 3300035114 | Bacteria | 1573 |
| 775 | Ga0373941_0128570 | 3300035115 | Unclassified | 910 |
| 776 | Ga0373945_0027244 | 3300035116 | Bacteria | 1995 |
| 777 | Ga0373945_0118615 | 3300035116 | Bacteria | 1050 |
| 778 | Ga0373953_0000176 | 3300035117 | Bacteria | 16923 |
| 779 | Ga0373953_0005548 | 3300035117 | Bacteria | 4104 |
| 780 | Ga0373953_0045154 | 3300035117 | Bacteria | 1764 |
| 781 | Ga0373953_0250111 | 3300035117 | Bacteria | 770 |
| 782 | Ga0373954_0002651 | 3300035118 | Bacteria | 7533 |
| 783 | Ga0373954_0066894 | 3300035118 | Bacteria | 1702 |
| 784 | Ga0373954_0082825 | 3300035118 | Bacteria | 1534 |
| 785 | Ga0373954_0212722 | 3300035118 | Bacteria | 950 |
| 786 | Ga0373954_0392805 | 3300035118 | Bacteria | 686 |
| 787 | Ga0373956_0000479 | 3300035119 | Bacteria | 16414 |
| 788 | Ga0373956_0073581 | 3300035119 | Bacteria | 1561 |
| 789 | Ga0373956_0152272 | 3300035119 | Bacteria | 1088 |
| 790 | Ga0373956_0477923 | 3300035119 | Bacteria | 595 |
| 791 | Ga0373957_0000488 | 3300035120 | Bacteria | 9995 |
| 792 | Ga0373957_0006537 | 3300035120 | Bacteria | 3676 |
| 793 | Ga0373957_0028711 | 3300035120 | Bacteria | 2028 |
| 794 | Ga0373957_0094883 | 3300035120 | Bacteria | 1189 |
| 795 | Ga0373957_0310731 | 3300035120 | Bacteria | 669 |
| 796 | Ga0373957_0358319 | 3300035120 | Bacteria | 624 |
| 797 | Ga0373960_0265397 | 3300035121 | Bacteria | 628 |
| 798 | Ga0373943_0127602 | 3300035170 | Bacteria | 1358 |
| 799 | Ga0373943_0571597 | 3300035170 | Bacteria | 664 |
| 800 | Ga0373943_0682654 | 3300035170 | Bacteria | 608 |
| 801 | Ga0373946_0016191 | 3300035171 | Bacteria | 2838 |
| 802 | Ga0373955_0000080 | 3300035172 | Bacteria | 39754 |
| 803 | Ga0373955_0010334 | 3300035172 | Bacteria | 4404 |
| 804 | Ga0373955_0683920 | 3300035172 | Bacteria | 629 |
| 805 | Ga0373942_0060387 | 3300035207 | Bacteria | 1085 |
| 806 | Ga0373962_0000172 | 3300035242 | Bacteria | 13751 |
| 807 | Ga0373924_0000942 | 3300035410 | Bacteria | 9196 |
| 808 | Ga0373924_0008562 | 3300035410 | Bacteria | 3722 |
| 809 | Ga0373924_0023674 | 3300035410 | Bacteria | 2412 |
| 810 | Ga0373931_0130103 | 3300035691 | Bacteria | 1448 |
| 811 | Ga0373931_0441831 | 3300035691 | Bacteria | 830 |
| 812 | Ga0373935_0023454 | 3300035692 | Bacteria | 3792 |
| 813 | Ga0373935_0024335 | 3300035692 | Bacteria | 3727 |
| 814 | Ga0373935_0041109 | 3300035692 | Bacteria | 2903 |
| 815 | Ga0373935_0316326 | 3300035692 | Bacteria | 1106 |
| 816 | Ga0373935_0624336 | 3300035692 | Bacteria | 789 |
| 817 | Ga0373935_0785326 | 3300035692 | Bacteria | 703 |
| 818 | Ga0373927_0145185 | 3300035695 | Bacteria | 1553 |
| 819 | Ga0373927_0164621 | 3300035695 | Bacteria | 1453 |
| 820 | Ga0373927_0631886 | 3300035695 | Bacteria | 708 |
| 821 | Ga0373933_0000461 | 3300035724 | Bacteria | 25426 |
| 822 | Ga0373933_0003054 | 3300035724 | Bacteria | 9341 |
| 823 | Ga0373933_0004243 | 3300035724 | Bacteria | 7896 |
| 824 | Ga0373933_0007059 | 3300035724 | Bacteria | 6121 |
| 825 | Ga0373933_0009456 | 3300035724 | Bacteria | 5323 |
| 826 | Ga0373947_0044386 | 3300035725 | Bacteria | 2657 |
| 827 | Ga0373947_0081060 | 3300035725 | Bacteria | 2008 |
| 828 | Ga0373947_0332566 | 3300035725 | Bacteria | 1017 |
| 829 | Ga0373947_0473092 | 3300035725 | Bacteria | 850 |
| 830 | Ga0310104_10395 | 3300036242 | Bacteria | 756 |
| 831 | Ga0373937_0000023 | 3300036401 | Bacteria | 127414 |
| 832 | Ga0373937_0045127 | 3300036401 | Bacteria | 4026 |
| 833 | Ga0373937_0170921 | 3300036401 | Bacteria | 2039 |
| 834 | Ga0373937_0239762 | 3300036401 | Bacteria | 1708 |
| 835 | Ga0373937_0378208 | 3300036401 | Bacteria | 1343 |
| 836 | Ga0373937_0602837 | 3300036401 | Bacteria | 1042 |
| 837 | Ga0373937_1396253 | 3300036401 | Bacteria | 648 |
| 838 | Ga0373937_1610489 | 3300036401 | Bacteria | 596 |
| 839 | Ga0265778_044208 | 3300036457 | Bacteria | 599 |
| 840 | Ga0310112_047578 | 3300036458 | Bacteria | 582 |
| 841 | Ga0310109_019976 | 3300036534 | Bacteria | 904 |
| 842 | Ga0373925_0011651 | 3300037068 | Bacteria | 6359 |
| 843 | Ga0373925_0074311 | 3300037068 | Bacteria | 2574 |
| 844 | Ga0373925_0254653 | 3300037068 | Bacteria | 1409 |
| 845 | Ga0373925_0329578 | 3300037068 | Bacteria | 1236 |
| 846 | Ga0373925_0682765 | 3300037068 | Bacteria | 846 |
| 847 | Ga0373925_1304930 | 3300037068 | Bacteria | 595 |
| 848 | Ga0395899_0009471 | 3300037312 | Bacteria | 7476 |
| 849 | Ga0395900_0006872 | 3300037418 | Bacteria | 11801 |
| 850 | Ga0395900_0581918 | 3300037418 | Bacteria | 1061 |
| 851 | Ga0395900_0745628 | 3300037418 | Bacteria | 910 |
| 852 | Ga0395898_0005950 | 3300037466 | Bacteria | 13092 |
| 853 | Ga0395898_0016606 | 3300037466 | Bacteria | 7525 |
| 854 | Ga0395898_0031971 | 3300037466 | Bacteria | 5253 |
| 855 | Ga0395898_0039905 | 3300037466 | Bacteria | 4645 |
| 856 | Ga0395905_0006430 | 3300037471 | Bacteria | 11830 |
| 857 | Ga0395905_1632557 | 3300037471 | Bacteria | 550 |
| 858 | Ga0395901_0009122 | 3300038443 | Bacteria | 10045 |
| 859 | Ga0395901_0028124 | 3300038443 | Bacteria | 5783 |
| 860 | Ga0395901_0470942 | 3300038443 | Bacteria | 1282 |
| 861 | Ga0436365_0843445 | 3300039437 | Bacteria | 535 |
| 862 | Ga0436363_0176675 | 3300039450 | Bacteria | 574 |
| 863 | Ga0436363_0695637 | 3300039450 | Bacteria | 569 |
| 864 | Ga0436363_0855063 | 3300039450 | Bacteria | 570 |
| 865 | Ga0439438_145140 | 3300041405 | Bacteria | 567 |
| 866 | Ga0451789_0793300 | 3300041443 | Bacteria | 721 |
| 867 | Ga0451790_37344 | 3300041444 | Bacteria | 830 |
| 868 | Ga0451791_1219190 | 3300041451 | Bacteria | 2340 |
| 869 | Ga0451793_0029799 | 3300041452 | Bacteria | 830 |
| 870 | Ga0451793_1560447 | 3300041452 | Bacteria | 602 |
| 871 | Ga0451797_0145031 | 3300041453 | Bacteria | 669 |
| 872 | Ga0451798_0529368 | 3300041458 | Bacteria | 656 |
| 873 | Ga0451802_2162425 | 3300041460 | Bacteria | 975 |
| 874 | Ga0451804_0431050 | 3300041463 | Bacteria | 616 |
| 875 | Ga0451807_0456693 | 3300041486 | Bacteria | 538 |
| 876 | Ga0451833_0384247 | 3300041491 | Bacteria | 561 |
| 877 | Ga0451833_0883276 | 3300041491 | Bacteria | 941 |
| 878 | Ga0451833_1374928 | 3300041491 | Bacteria | 530 |
| 879 | Ga0451835_0266027 | 3300041492 | Bacteria | 599 |
| 880 | Ga0451837_0384947 | 3300041494 | Bacteria | 500 |
| 881 | Ga0451837_1660227 | 3300041494 | Bacteria | 759 |
| 882 | Ga0451839_0144053 | 3300041496 | Bacteria | 598 |
| 883 | Ga0451839_1546639 | 3300041496 | Bacteria | 573 |
| 884 | Ga0451841_0000410 | 3300041498 | Bacteria | 1142 |
| 885 | Ga0451849_0068873 | 3300041505 | Bacteria | 720 |
| 886 | Ga0451851_0087835 | 3300041507 | Bacteria | 605 |
| 887 | Ga0451843_0134207 | 3300041509 | Bacteria | 1301 |
| 888 | Ga0451843_0586583 | 3300041509 | Bacteria | 554 |
| 889 | Ga0451853_0738829 | 3300041512 | Bacteria | 725 |
| 890 | Ga0451853_0892057 | 3300041512 | Bacteria | 2232 |
| 891 | Ga0451853_1306632 | 3300041512 | Bacteria | 642 |
| 892 | Ga0439449_0023685 | 3300042007 | Bacteria | 2296 |
| 893 | Ga0450902_082829 | 3300042137 | Bacteria | 564 |
| 894 | Ga0439440_0098191 | 3300042993 | Bacteria | 794 |
| 895 | Ga0466972_0150615 | 3300044658 | Bacteria | 1094 |
| 896 | Ga0466965_0135429 | 3300044683 | Bacteria | 1279 |
| 897 | Ga0466965_0136507 | 3300044683 | Bacteria | 1275 |
| 898 | Ga0466966_0014016 | 3300044684 | Bacteria | 5306 |
| 899 | Ga0466961_0110007 | 3300044693 | Bacteria | 1734 |
| 900 | Ga0466963_0153592 | 3300044694 | Bacteria | 1599 |
| 901 | Ga0466963_0443705 | 3300044694 | Bacteria | 916 |
| 902 | Ga0466963_0582934 | 3300044694 | Bacteria | 790 |
| 903 | Ga0466970_0385730 | 3300044765 | Bacteria | 798 |
| 904 | Ga0466957_1136394 | 3300044842 | Bacteria | 564 |
| 905 | Ga0466960_0230832 | 3300044901 | Bacteria | 1021 |
| 906 | Ga0466960_0923893 | 3300044901 | Bacteria | 533 |
| 907 | Ga0466959_0002019 | 3300045049 | Bacteria | 12814 |
| 908 | Ga0466958_0594422 | 3300045836 | Bacteria | 720 |
| 909 | Ga0466967_0084531 | 3300045976 | Bacteria | 2871 |
| 910 | Ga0466967_0597071 | 3300045976 | Bacteria | 1089 |
| 911 | Ga0466967_0823059 | 3300045976 | Bacteria | 922 |
| 912 | Ga0466967_2537298 | 3300045976 | Bacteria | 507 |
| 913 | Ga0495592_0000523 | 3300046454 | Bacteria | 27735 |
| 914 | Ga0495592_0047127 | 3300046454 | Bacteria | 3210 |
| 915 | Ga0495592_0078356 | 3300046454 | Bacteria | 2393 |
| 916 | Ga0495592_0108893 | 3300046454 | Bacteria | 1963 |
| 917 | Ga0495592_0138027 | 3300046454 | Bacteria | 1698 |
| 918 | Ga0495629_0008073 | 3300046459 | Bacteria | 7750 |
| 919 | Ga0495629_0043738 | 3300046459 | Bacteria | 3144 |
| 920 | Ga0495629_0060229 | 3300046459 | Bacteria | 2653 |
| 921 | Ga0495629_0604591 | 3300046459 | Bacteria | 733 |
| 922 | Ga0495641_0065653 | 3300046461 | Bacteria | 1633 |
| 923 | Ga0495651_0000015 | 3300046462 | Bacteria | 127414 |
| 924 | Ga0495651_0001165 | 3300046462 | Bacteria | 20295 |
| 925 | Ga0495651_0004771 | 3300046462 | Bacteria | 10378 |
| 926 | Ga0495651_0052415 | 3300046462 | Bacteria | 3142 |
| 927 | Ga0495651_0072130 | 3300046462 | Bacteria | 2623 |
| 928 | Ga0495651_0078871 | 3300046462 | Bacteria | 2490 |
| 929 | Ga0495651_0369516 | 3300046462 | Bacteria | 943 |
| 930 | Ga0495651_0673918 | 3300046462 | Unclassified | 646 |
| 931 | Ga0495651_0888577 | 3300046462 | Bacteria | 545 |
| 932 | Ga0495653_0002364 | 3300046463 | Bacteria | 14986 |
| 933 | Ga0495653_0032581 | 3300046463 | Bacteria | 4135 |
| 934 | Ga0495653_0063119 | 3300046463 | Bacteria | 2797 |
| 935 | Ga0495653_0081544 | 3300046463 | Bacteria | 2390 |
| 936 | Ga0495653_0085195 | 3300046463 | Bacteria | 2325 |
| 937 | Ga0495653_0098480 | 3300046463 | Bacteria | 2123 |
| 938 | Ga0495653_0793210 | 3300046463 | Bacteria | 570 |
| 939 | Ga0495580_0048917 | 3300046472 | Bacteria | 2991 |
| 940 | Ga0495582_0017459 | 3300046473 | Bacteria | 3926 |
| 941 | Ga0495582_0046415 | 3300046473 | Bacteria | 2392 |
| 942 | Ga0495582_0096027 | 3300046473 | Bacteria | 1656 |
| 943 | Ga0495639_0042215 | 3300046475 | Bacteria | 2056 |
| 944 | Ga0495639_0089477 | 3300046475 | Bacteria | 1443 |
| 945 | Ga0495639_0306543 | 3300046475 | Bacteria | 792 |
| 946 | Ga0495662_0000284 | 3300046476 | Bacteria | 21837 |
| 947 | Ga0495662_0010843 | 3300046476 | Bacteria | 4457 |
| 948 | Ga0495662_0090867 | 3300046476 | Bacteria | 1488 |
| 949 | Ga0495662_0167692 | 3300046476 | Bacteria | 1082 |
| 950 | Ga0495664_0002113 | 3300046477 | Bacteria | 10630 |
| 951 | Ga0495664_0044660 | 3300046477 | Bacteria | 2626 |
| 952 | Ga0495664_0070353 | 3300046477 | Bacteria | 2089 |
| 953 | Ga0495664_0093077 | 3300046477 | Bacteria | 1813 |
| 954 | Ga0495664_0109117 | 3300046477 | Bacteria | 1670 |
| 955 | Ga0495664_0141809 | 3300046477 | Bacteria | 1457 |
| 956 | Ga0495664_0200455 | 3300046477 | Bacteria | 1209 |
| 957 | Ga0495594_0030177 | 3300046499 | Bacteria | 2932 |
| 958 | Ga0495606_0001817 | 3300046507 | Bacteria | 27123 |
| 959 | Ga0495608_0000468 | 3300046511 | Bacteria | 28005 |
| 960 | Ga0495608_0000479 | 3300046511 | Bacteria | 27769 |
| 961 | Ga0495608_0001967 | 3300046511 | Bacteria | 14726 |
| 962 | Ga0495608_0040333 | 3300046511 | Bacteria | 3128 |
| 963 | Ga0495608_0134064 | 3300046511 | Bacteria | 1583 |
| 964 | Ga0495608_0242349 | 3300046511 | Bacteria | 1126 |
| 965 | Ga0495618_0042843 | 3300046514 | Bacteria | 2855 |
| 966 | Ga0495618_0101977 | 3300046514 | Bacteria | 1837 |
| 967 | Ga0495618_0114829 | 3300046514 | Bacteria | 1724 |
| 968 | Ga0495618_0160048 | 3300046514 | Bacteria | 1435 |
| 969 | Ga0495618_0717185 | 3300046514 | Bacteria | 587 |
| 970 | Ga0495628_0000240 | 3300046516 | Bacteria | 48195 |
| 971 | Ga0495628_0099618 | 3300046516 | Bacteria | 2244 |
| 972 | Ga0495628_0108077 | 3300046516 | Bacteria | 2141 |
| 973 | Ga0495628_0281087 | 3300046516 | Bacteria | 1236 |
| 974 | Ga0495628_0442640 | 3300046516 | Bacteria | 944 |
| 975 | Ga0495628_0446630 | 3300046516 | Bacteria | 939 |
| 976 | Ga0495628_0579258 | 3300046516 | Bacteria | 803 |
| 977 | Ga0495628_1081472 | 3300046516 | Bacteria | 548 |
| 978 | Ga0495628_1210952 | 3300046516 | Bacteria | 512 |
| 979 | Ga0495630_0021401 | 3300046517 | Bacteria | 4775 |
| 980 | Ga0495630_0105860 | 3300046517 | Bacteria | 2130 |
| 981 | Ga0495630_0258767 | 3300046517 | Bacteria | 1329 |
| 982 | Ga0495630_0287670 | 3300046517 | Bacteria | 1256 |
| 983 | Ga0495630_0466692 | 3300046517 | Bacteria | 967 |
| 984 | Ga0495630_1398433 | 3300046517 | Bacteria | 526 |
| 985 | Ga0495632_0011770 | 3300046519 | Bacteria | 5091 |
| 986 | Ga0495632_0037493 | 3300046519 | Bacteria | 2459 |
| 987 | Ga0495666_0066637 | 3300046526 | Bacteria | 1716 |
| 988 | Ga0495652_0000044 | 3300046529 | Bacteria | 123607 |
| 989 | Ga0495652_0001965 | 3300046529 | Bacteria | 21870 |
| 990 | Ga0495652_0105008 | 3300046529 | Bacteria | 2283 |
| 991 | Ga0495652_0258526 | 3300046529 | Bacteria | 1286 |
| 992 | Ga0495652_0430761 | 3300046529 | Bacteria | 927 |
| 993 | Ga0495652_0468695 | 3300046529 | Bacteria | 878 |
| 994 | Ga0495652_0785543 | 3300046529 | Bacteria | 635 |
| 995 | Ga0495652_1002449 | 3300046529 | Bacteria | 546 |
| 996 | Ga0495665_0002759 | 3300046531 | Bacteria | 9484 |
| 997 | Ga0495665_0003349 | 3300046531 | Bacteria | 8690 |
| 998 | Ga0495665_0072418 | 3300046531 | Bacteria | 1814 |
| 999 | Ga0495665_0088226 | 3300046531 | Bacteria | 1630 |
| 1000 | Ga0495640_0007442 | 3300046533 | Bacteria | 8604 |
| 1001 | Ga0495640_0025022 | 3300046533 | Bacteria | 4336 |
| 1002 | Ga0495640_0075371 | 3300046533 | Bacteria | 2253 |
| 1003 | Ga0495640_0156354 | 3300046533 | Bacteria | 1463 |
| 1004 | Ga0495640_0178671 | 3300046533 | Bacteria | 1353 |
| 1005 | Ga0495640_0809730 | 3300046533 | Bacteria | 558 |
| 1006 | Ga0495586_0005641 | 3300046535 | Bacteria | 6688 |
| 1007 | Ga0495586_0119417 | 3300046535 | Bacteria | 1472 |
| 1008 | Ga0495586_0202504 | 3300046535 | Bacteria | 1125 |
| 1009 | Ga0495586_0799812 | 3300046535 | Bacteria | 544 |
| 1010 | Ga0495586_0888547 | 3300046535 | Bacteria | 513 |
| 1011 | Ga0495587_0000480 | 3300046536 | Bacteria | 27706 |
| 1012 | Ga0495587_0012542 | 3300046536 | Bacteria | 5329 |
| 1013 | Ga0495587_0013195 | 3300046536 | Bacteria | 5195 |
| 1014 | Ga0495587_0045798 | 3300046536 | Bacteria | 2598 |
| 1015 | Ga0495587_0046886 | 3300046536 | Bacteria | 2564 |
| 1016 | Ga0495587_0078793 | 3300046536 | Bacteria | 1911 |
| 1017 | Ga0495587_0402611 | 3300046536 | Bacteria | 760 |
| 1018 | Ga0495645_0001777 | 3300046543 | Bacteria | 14671 |
| 1019 | Ga0495645_0057400 | 3300046543 | Bacteria | 2825 |
| 1020 | Ga0495645_0064958 | 3300046543 | Bacteria | 2640 |
| 1021 | Ga0495645_0108633 | 3300046543 | Bacteria | 1964 |
| 1022 | Ga0495645_0134448 | 3300046543 | Bacteria | 1730 |
| 1023 | Ga0495645_0245513 | 3300046543 | Bacteria | 1192 |
| 1024 | Ga0495645_0269798 | 3300046543 | Bacteria | 1123 |
| 1025 | Ga0495645_0494553 | 3300046543 | Bacteria | 765 |
| 1026 | Ga0495645_0609908 | 3300046543 | Bacteria | 670 |
| 1027 | Ga0495622_0233600 | 3300046557 | Bacteria | 812 |
| 1028 | Ga0495622_0453209 | 3300046557 | Bacteria | 550 |
| 1029 | Ga0495667_0000404 | 3300046559 | Bacteria | 27694 |
| 1030 | Ga0495667_0004295 | 3300046559 | Bacteria | 9613 |
| 1031 | Ga0495667_0004370 | 3300046559 | Bacteria | 9544 |
| 1032 | Ga0495667_0010109 | 3300046559 | Bacteria | 6387 |
| 1033 | Ga0495667_0047816 | 3300046559 | Bacteria | 2825 |
| 1034 | Ga0495667_0077997 | 3300046559 | Bacteria | 2153 |
| 1035 | Ga0495668_0000828 | 3300046616 | Bacteria | 35228 |
| 1036 | Ga0495668_0746430 | 3300046616 | Unclassified | 542 |
| 1037 | Ga0495634_0012933 | 3300046642 | Bacteria | 6038 |
| 1038 | Ga0495634_0023988 | 3300046642 | Bacteria | 4283 |
| 1039 | Ga0495634_0038380 | 3300046642 | Bacteria | 3266 |
| 1040 | Ga0495625_0001049 | 3300046660 | Bacteria | 36242 |
| 1041 | Ga0495635_0004526 | 3300046663 | Bacteria | 9634 |
| 1042 | Ga0495635_0011486 | 3300046663 | Bacteria | 6208 |
| 1043 | Ga0495635_0070785 | 3300046663 | Bacteria | 2390 |
| 1044 | Ga0495635_0364213 | 3300046663 | Bacteria | 963 |
| 1045 | Ga0495635_0483682 | 3300046663 | Bacteria | 816 |
| 1046 | Ga0495635_0574932 | 3300046663 | Bacteria | 737 |
| 1047 | Ga0495635_0599846 | 3300046663 | Bacteria | 719 |
| 1048 | Ga0495588_0174896 | 3300046674 | Bacteria | 1135 |
| 1049 | Ga0495657_0000030 | 3300046675 | Bacteria | 127400 |
| 1050 | Ga0495657_0001488 | 3300046675 | Bacteria | 20206 |
| 1051 | Ga0495657_0003565 | 3300046675 | Bacteria | 12660 |
| 1052 | Ga0495657_0016585 | 3300046675 | Bacteria | 5366 |
| 1053 | Ga0495657_0025762 | 3300046675 | Bacteria | 4173 |
| 1054 | Ga0495657_0073978 | 3300046675 | Bacteria | 2217 |
| 1055 | Ga0495599_0000771 | 3300046678 | Bacteria | 18044 |
| 1056 | Ga0495599_0015439 | 3300046678 | Bacteria | 4739 |
| 1057 | Ga0495599_0050276 | 3300046678 | Bacteria | 2612 |
| 1058 | Ga0495599_0066328 | 3300046678 | Bacteria | 2254 |
| 1059 | Ga0495599_0150498 | 3300046678 | Bacteria | 1441 |
| 1060 | Ga0495599_0255630 | 3300046678 | Bacteria | 1065 |
| 1061 | Ga0495623_0002193 | 3300046679 | Bacteria | 13016 |
| 1062 | Ga0495623_0011410 | 3300046679 | Bacteria | 5751 |
| 1063 | Ga0495623_0048091 | 3300046679 | Bacteria | 2706 |
| 1064 | Ga0495623_0188485 | 3300046679 | Bacteria | 1193 |
| 1065 | Ga0495623_0698649 | 3300046679 | Bacteria | 520 |
| 1066 | Ga0495646_0022727 | 3300046680 | Bacteria | 3952 |
| 1067 | Ga0495646_0026728 | 3300046680 | Bacteria | 3622 |
| 1068 | Ga0495646_0035482 | 3300046680 | Bacteria | 3093 |
| 1069 | Ga0495646_0102944 | 3300046680 | Bacteria | 1634 |
| 1070 | Ga0495658_0048352 | 3300046683 | Bacteria | 2398 |
| 1071 | Ga0495613_0008225 | 3300046689 | Bacteria | 7746 |
| 1072 | Ga0495613_0076339 | 3300046689 | Bacteria | 2438 |
| 1073 | Ga0495613_0144561 | 3300046689 | Bacteria | 1698 |
| 1074 | Ga0495613_0194005 | 3300046689 | Bacteria | 1434 |
| 1075 | Ga0495613_0394121 | 3300046689 | Bacteria | 945 |
| 1076 | Ga0495613_0496700 | 3300046689 | Bacteria | 822 |
| 1077 | Ga0495624_0145712 | 3300046690 | Bacteria | 1449 |
| 1078 | Ga0495624_0314944 | 3300046690 | Bacteria | 943 |
| 1079 | Ga0495624_0338410 | 3300046690 | Bacteria | 905 |
| 1080 | Ga0495624_0351573 | 3300046690 | Bacteria | 886 |
| 1081 | Ga0495624_0365577 | 3300046690 | Bacteria | 867 |
| 1082 | Ga0495624_0487878 | 3300046690 | Bacteria | 737 |
| 1083 | Ga0495649_0361974 | 3300046694 | Bacteria | 732 |
| 1084 | Ga0495600_0004854 | 3300046809 | Bacteria | 8072 |
| 1085 | Ga0495600_0046994 | 3300046809 | Bacteria | 2815 |
| 1086 | Ga0495600_0060637 | 3300046809 | Bacteria | 2470 |
| 1087 | Ga0495600_0204615 | 3300046809 | Bacteria | 1266 |
| 1088 | Ga0495600_0208378 | 3300046809 | Bacteria | 1253 |
| 1089 | Ga0495600_0423936 | 3300046809 | Bacteria | 825 |
| 1090 | Ga0495581_0021493 | 3300047315 | Bacteria | 3739 |
| 1091 | Ga0495581_0022179 | 3300047315 | Bacteria | 3679 |
| 1092 | Ga0495581_0207983 | 3300047315 | Bacteria | 1144 |
| 1093 | Ga0495604_0000726 | 3300047317 | Bacteria | 27822 |
| 1094 | Ga0495604_0001997 | 3300047317 | Bacteria | 16455 |
| 1095 | Ga0495604_0066152 | 3300047317 | Bacteria | 2750 |
| 1096 | Ga0495604_0066167 | 3300047317 | Bacteria | 2750 |
| 1097 | Ga0495604_0069257 | 3300047317 | Bacteria | 2674 |
| 1098 | Ga0495604_0102173 | 3300047317 | Bacteria | 2104 |
| 1099 | Ga0495604_0203787 | 3300047317 | Bacteria | 1370 |
| 1100 | Ga0495636_0521784 | 3300047318 | Bacteria | 576 |
| 1101 | Ga0495674_0005608 | 3300047319 | Bacteria | 12035 |
| 1102 | Ga0495674_0018411 | 3300047319 | Bacteria | 6502 |
| 1103 | Ga0495674_0046272 | 3300047319 | Bacteria | 3862 |
| 1104 | Ga0495674_0131381 | 3300047319 | Bacteria | 2109 |
| 1105 | Ga0495674_0141183 | 3300047319 | Bacteria | 2024 |
| 1106 | Ga0495674_0143889 | 3300047319 | Bacteria | 2002 |
| 1107 | Ga0495674_0173144 | 3300047319 | Bacteria | 1800 |
| 1108 | Ga0495674_0810656 | 3300047319 | Bacteria | 727 |
| 1109 | Ga0495676_0089100 | 3300047321 | Bacteria | 2312 |
| 1110 | Ga0495676_0181027 | 3300047321 | Bacteria | 1477 |
| 1111 | Ga0495676_0222378 | 3300047321 | Bacteria | 1300 |
| 1112 | Ga0495676_0904004 | 3300047321 | Bacteria | 565 |
| 1113 | Ga0495680_0002167 | 3300047322 | Bacteria | 20326 |
| 1114 | Ga0495680_0047604 | 3300047322 | Bacteria | 3371 |
| 1115 | Ga0495680_0085959 | 3300047322 | Bacteria | 2367 |
| 1116 | Ga0495680_0114753 | 3300047322 | Bacteria | 1993 |
| 1117 | Ga0495680_0116312 | 3300047322 | Bacteria | 1977 |
| 1118 | Ga0495680_0165720 | 3300047322 | Bacteria | 1602 |
| 1119 | Ga0495683_0073066 | 3300047323 | Bacteria | 1682 |
| 1120 | Ga0495687_158722 | 3300047443 | Bacteria | 764 |
| 1121 | Ga0495675_0002225 | 3300047444 | Bacteria | 11577 |
| 1122 | Ga0495675_0002248 | 3300047444 | Bacteria | 11535 |
| 1123 | Ga0495675_0008897 | 3300047444 | Bacteria | 6238 |
| 1124 | Ga0495675_0009653 | 3300047444 | Bacteria | 6011 |
| 1125 | Ga0495675_0034922 | 3300047444 | Bacteria | 3211 |
| 1126 | Ga0495675_0322250 | 3300047444 | Bacteria | 914 |
| 1127 | Ga0495675_0656626 | 3300047444 | Bacteria | 590 |
| 1128 | Ga0495684_0046859 | 3300047471 | Bacteria | 3307 |
| 1129 | Ga0495684_0052322 | 3300047471 | Bacteria | 3116 |
| 1130 | Ga0495684_0058663 | 3300047471 | Bacteria | 2931 |
| 1131 | Ga0495684_0160591 | 3300047471 | Bacteria | 1676 |
| 1132 | Ga0495684_0306343 | 3300047471 | Bacteria | 1139 |
| 1133 | Ga0495684_0409190 | 3300047471 | Bacteria | 950 |
| 1134 | Ga0495684_0533944 | 3300047471 | Bacteria | 801 |
| 1135 | Ga0495593_0051176 | 3300047673 | Bacteria | 2186 |
| 1136 | Ga0495593_0146375 | 3300047673 | Bacteria | 1195 |
| 1137 | Ga0495593_0273158 | 3300047673 | Bacteria | 846 |
| 1138 | Ga0495593_0312539 | 3300047673 | Bacteria | 785 |
| 1139 | Ga0495602_0000973 | 3300048088 | Bacteria | 27723 |
| 1140 | Ga0495602_0033691 | 3300048088 | Bacteria | 4801 |
| 1141 | Ga0495602_0067865 | 3300048088 | Bacteria | 3066 |
| 1142 | Ga0495602_0136874 | 3300048088 | Bacteria | 1944 |
| 1143 | Ga0495602_0156864 | 3300048088 | Bacteria | 1781 |
| 1144 | Ga0495602_0256585 | 3300048088 | Bacteria | 1299 |
| 1145 | Ga0495602_1057778 | 3300048088 | Bacteria | 533 |
| 1146 | Ga0495614_0012354 | 3300048089 | Bacteria | 3748 |
| 1147 | Ga0495614_0052674 | 3300048089 | Bacteria | 1744 |
| 1148 | Ga0495626_0000129 | 3300048091 | Bacteria | 95400 |
| 1149 | Ga0496100_0144972 | 3300048903 | Bacteria | 1687 |
| 1150 | Ga0496101_0085492 | 3300048904 | Bacteria | 2337 |
| 1151 | Ga0496102_0055998 | 3300048905 | Bacteria | 3596 |
| 1152 | Ga0496102_0074600 | 3300048905 | Bacteria | 3118 |
| 1153 | Ga0496102_0082888 | 3300048905 | Bacteria | 2958 |
| 1154 | Ga0496102_1622732 | 3300048905 | Bacteria | 565 |
| 1155 | Ga0496103_0065291 | 3300048906 | Bacteria | 2270 |
| 1156 | Ga0496103_0408747 | 3300048906 | Bacteria | 872 |
| 1157 | Ga0496103_0596065 | 3300048906 | Bacteria | 704 |
| 1158 | Ga0496104_0000414 | 3300048907 | Bacteria | 37438 |
| 1159 | Ga0496104_0082301 | 3300048907 | Bacteria | 3069 |
| 1160 | Ga0496104_0144963 | 3300048907 | Bacteria | 2280 |
| 1161 | Ga0496105_0007787 | 3300048908 | Bacteria | 8315 |
| 1162 | Ga0496105_0104627 | 3300048908 | Bacteria | 2337 |
| 1163 | Ga0496105_0518731 | 3300048908 | Bacteria | 933 |
| 1164 | Ga0496106_0918867 | 3300048909 | Bacteria | 690 |
| 1165 | Ga0496106_1104034 | 3300048909 | Bacteria | 621 |
| 1166 | Ga0496106_1332056 | 3300048909 | Bacteria | 556 |
| 1167 | Ga0496107_0235987 | 3300048910 | Bacteria | 1361 |
| 1168 | Ga0496107_0273011 | 3300048910 | Bacteria | 1258 |
| 1169 | Ga0496107_0727532 | 3300048910 | Bacteria | 729 |
| 1170 | Ga0496108_0000048 | 3300048911 | Bacteria | 133539 |
| 1171 | Ga0496108_0045957 | 3300048911 | Bacteria | 3647 |
| 1172 | Ga0496108_0198795 | 3300048911 | Bacteria | 1739 |
| 1173 | Ga0496109_0110811 | 3300048912 | Bacteria | 2552 |
| 1174 | Ga0496109_0207911 | 3300048912 | Bacteria | 1840 |
| 1175 | Ga0496109_0286849 | 3300048912 | Bacteria | 1552 |
| 1176 | Ga0496109_1347613 | 3300048912 | Bacteria | 649 |
| 1177 | Ga0496109_1810241 | 3300048912 | Bacteria | 544 |
| 1178 | Ga0496110_0117451 | 3300048913 | Bacteria | 2395 |
| 1179 | Ga0496110_0433756 | 3300048913 | Bacteria | 1198 |
| 1180 | Ga0496110_1475921 | 3300048913 | Bacteria | 590 |
| 1181 | Ga0496111_0842161 | 3300048914 | Bacteria | 662 |
| 1182 | Ga0496111_0857772 | 3300048914 | Bacteria | 655 |
| 1183 | Ga0496111_0938096 | 3300048914 | Bacteria | 622 |
| 1184 | Ga0496112_0000596 | 3300048915 | Bacteria | 24874 |
| 1185 | Ga0496112_0084551 | 3300048915 | Bacteria | 3138 |
| 1186 | Ga0496112_0189572 | 3300048915 | Bacteria | 2018 |
| 1187 | Ga0496112_0224263 | 3300048915 | Bacteria | 1835 |
| 1188 | Ga0496112_0368641 | 3300048915 | Bacteria | 1378 |
| 1189 | Ga0496112_0766103 | 3300048915 | Bacteria | 891 |
| 1190 | Ga0496112_1174697 | 3300048915 | Bacteria | 684 |
| 1191 | Ga0496113_0002740 | 3300048916 | Bacteria | 10357 |
| 1192 | Ga0496113_0111148 | 3300048916 | Bacteria | 2133 |
| 1193 | Ga0496113_0174879 | 3300048916 | Bacteria | 1701 |
| 1194 | Ga0496113_0362740 | 3300048916 | Bacteria | 1162 |
| 1195 | Ga0496113_0555702 | 3300048916 | Bacteria | 921 |
| 1196 | Ga0496114_0221247 | 3300048917 | Bacteria | 1662 |
| 1197 | Ga0496114_0742514 | 3300048917 | Bacteria | 858 |
| 1198 | Ga0496115_0018404 | 3300048918 | Bacteria | 5363 |
| 1199 | Ga0496115_0131057 | 3300048918 | Bacteria | 2067 |
| 1200 | Ga0496115_0608248 | 3300048918 | Bacteria | 868 |
| 1201 | Ga0496115_0613648 | 3300048918 | Bacteria | 863 |
| 1202 | Ga0496115_0772859 | 3300048918 | Bacteria | 749 |
| 1203 | Ga0496119_0118301 | 3300048922 | Bacteria | 1460 |
| 1204 | Ga0496120_0349067 | 3300048923 | Bacteria | 665 |
| 1205 | Ga0496121_0029885 | 3300048924 | Bacteria | 5020 |
| 1206 | Ga0496121_0146270 | 3300048924 | Bacteria | 1746 |
| 1207 | Ga0496125_0523936 | 3300048928 | Bacteria | 662 |
| 1208 | Ga0496126_0000006 | 3300048929 | Bacteria | 798804 |
| 1209 | Ga0496126_0062845 | 3300048929 | Bacteria | 3330 |
| 1210 | Ga0496126_0091910 | 3300048929 | Bacteria | 2667 |
| 1211 | Ga0496126_0157059 | 3300048929 | Bacteria | 1946 |
| 1212 | Ga0496126_0799361 | 3300048929 | Bacteria | 724 |
| 1213 | Ga0496126_1288642 | 3300048929 | Bacteria | 533 |
| 1214 | Ga0501306_011107 | 3300049127 | Bacteria | 1144 |
| 1215 | Ga0501306_029189 | 3300049127 | Bacteria | 812 |
| 1216 | Ga0501308_080298 | 3300049128 | Bacteria | 518 |
| 1217 | Ga0501309_018349 | 3300049129 | Bacteria | 966 |
| 1218 | Ga0501305_031356 | 3300049161 | Bacteria | 830 |
| 1219 | Ga0501307_021961 | 3300049162 | Bacteria | 836 |
| 1220 | Ga0501307_077563 | 3300049162 | Bacteria | 538 |
| 1221 | Ga0501311_006389 | 3300049527 | Bacteria | 1326 |
| 1222 | Ga0501311_047856 | 3300049527 | Bacteria | 664 |
| 1223 | Ga0501316_006060 | 3300049532 | Bacteria | 1276 |
| 1224 | Ga0501316_012254 | 3300049532 | Bacteria | 1000 |
| 1225 | Ga0501317_002825 | 3300049533 | Bacteria | 1679 |
| 1226 | Ga0501317_036426 | 3300049533 | Bacteria | 735 |
| 1227 | Ga0501318_001814 | 3300049534 | Bacteria | 1754 |
| 1228 | Ga0501318_008287 | 3300049534 | Bacteria | 1107 |
| 1229 | Ga0501320_006475 | 3300049536 | Bacteria | 1099 |
| 1230 | Ga0501320_030349 | 3300049536 | Bacteria | 670 |
| 1231 | Ga0501321_071856 | 3300049537 | Bacteria | 539 |
| 1232 | Ga0501322_010990 | 3300049538 | Bacteria | 704 |
| 1233 | Ga0501323_002812 | 3300049539 | Bacteria | 1724 |
| 1234 | Ga0501323_029569 | 3300049539 | Bacteria | 764 |
| 1235 | Ga0501325_003904 | 3300049541 | Bacteria | 1113 |
| 1236 | Ga0501031_0141683 | 3300049568 | Bacteria | 1571 |
| 1237 | Ga0501032_0166115 | 3300049569 | Bacteria | 1448 |
| 1238 | Ga0501033_0124328 | 3300049570 | Bacteria | 1871 |
| 1239 | Ga0501034_0239029 | 3300049571 | Bacteria | 1763 |
| 1240 | Ga0501036_0306563 | 3300049572 | Bacteria | 1328 |
| 1241 | Ga0501037_0015433 | 3300049573 | Bacteria | 5621 |
| 1242 | Ga0501038_0044915 | 3300049574 | Bacteria | 3836 |
| 1243 | Ga0501039_0014058 | 3300049575 | Bacteria | 6127 |
| 1244 | Ga0501039_1133581 | 3300049575 | Bacteria | 606 |
| 1245 | Ga0501043_0117362 | 3300049579 | Bacteria | 2088 |
| 1246 | Ga0501046_0019700 | 3300049580 | Bacteria | 5592 |
| 1247 | Ga0501047_0017930 | 3300049581 | Bacteria | 6786 |
| 1248 | Ga0501047_1360530 | 3300049581 | Bacteria | 525 |
| 1249 | Ga0501048_0315443 | 3300049582 | Bacteria | 1113 |
| 1250 | Ga0501069_0267779 | 3300049585 | Bacteria | 998 |
| 1251 | Ga0501072_0722698 | 3300049588 | Bacteria | 782 |
| 1252 | Ga0501074_0143211 | 3300049590 | Bacteria | 1709 |
| 1253 | Ga0501080_0542373 | 3300049742 | Bacteria | 1036 |
| 1254 | Ga0501270_134122 | 3300049767 | Bacteria | 551 |
| 1255 | Ga0501035_0131656 | 3300049822 | Bacteria | 2180 |
| 1256 | Ga0501044_0194913 | 3300049823 | Bacteria | 1986 |
| 1257 | Ga0501044_0414246 | 3300049823 | Bacteria | 1258 |
| 1258 | nmdc:mga03n38_96710_c1 | 3300050490 | Bacteria | 1416 |
| 1259 | nmdc:mga00v17_203983_c1 | 3300050491 | Bacteria | 1278 |
| 1260 | nmdc:mga00v17_227557_c1 | 3300050491 | Bacteria | 1208 |
| 1261 | nmdc:mga05p37_1883746_c1 | 3300050507 | Bacteria | 572 |
| 1262 | nmdc:mga05p37_193252_c1 | 3300050507 | Bacteria | 2469 |
| 1263 | nmdc:mga05p37_3761_c1 | 3300050507 | Bacteria | 17766 |
| 1264 | nmdc:mga09592_1270461_c1 | 3300050508 | Bacteria | 606 |
| 1265 | nmdc:mga0qj67_181757_c1 | 3300050509 | Bacteria | 1708 |
| 1266 | nmdc:mga0qj67_532056_c1 | 3300050509 | Bacteria | 943 |
| 1267 | nmdc:mga0qj67_574260_c1 | 3300050509 | Bacteria | 903 |
| 1268 | nmdc:mga0qj67_669700_c1 | 3300050509 | Bacteria | 827 |
| 1269 | nmdc:mga0qj67_756218_c1 | 3300050509 | Bacteria | 771 |
| 1270 | nmdc:mga06r32_1042206_c1 | 3300050510 | Bacteria | 769 |
| 1271 | nmdc:mga06r32_358355_c1 | 3300050510 | Bacteria | 1443 |
| 1272 | nmdc:mga06r32_673191_c1 | 3300050510 | Bacteria | 1002 |
| 1273 | nmdc:mga08y16_16801_c1 | 3300050511 | Bacteria | 7703 |
| 1274 | nmdc:mga08y16_2184587_c1 | 3300050511 | Bacteria | 500 |
| 1275 | nmdc:mga0n895_1553132_c1 | 3300050512 | Unclassified | 627 |
| 1276 | nmdc:mga0n895_15902_c1 | 3300050512 | Bacteria | 6883 |
| 1277 | nmdc:mga0rr50_12258_c1 | 3300050513 | Bacteria | 5530 |
| 1278 | nmdc:mga08x19_292776_c1 | 3300050514 | Bacteria | 1130 |
| 1279 | nmdc:mga08x19_951733_c1 | 3300050514 | Bacteria | 610 |
| 1280 | nmdc:mga0a205_19224_c1 | 3300050515 | Bacteria | 6438 |
| 1281 | nmdc:mga0a205_530497_c1 | 3300050515 | Bacteria | 1033 |
| 1282 | nmdc:mga0sz30_92942_c1 | 3300050516 | Bacteria | 1313 |
| 1283 | Ga0495601_0043789 | 3300053077 | Bacteria | 2811 |
| 1284 | Ga0495601_0121933 | 3300053077 | Bacteria | 1693 |
| 1285 | Ga0495601_0222997 | 3300053077 | Bacteria | 1231 |
| 1286 | Ga0495601_0398758 | 3300053077 | Bacteria | 892 |
| 1287 | Ga0495601_0647050 | 3300053077 | Bacteria | 676 |
| 1288 | Ga0495612_0004276 | 3300053078 | Bacteria | 5933 |
| 1289 | Ga0495612_0013342 | 3300053078 | Bacteria | 3310 |
| 1290 | Ga0495612_0446661 | 3300053078 | Bacteria | 590 |
| 1291 | Ga0495655_0148629 | 3300053083 | Unclassified | 735 |
| 1292 | Ga0495595_0000864 | 3300053084 | Bacteria | 11649 |
| 1293 | Ga0495595_0012168 | 3300053084 | Bacteria | 3612 |
| 1294 | Ga0495595_0022322 | 3300053084 | Bacteria | 2777 |
| 1295 | Ga0495595_0057337 | 3300053084 | Bacteria | 1817 |
| 1296 | Ga0495595_0728299 | 3300053084 | Bacteria | 509 |
| 1297 | Ga0495619_0020221 | 3300053085 | Bacteria | 4238 |
| 1298 | Ga0495619_0061608 | 3300053085 | Bacteria | 2496 |
| 1299 | Ga0495619_0127116 | 3300053085 | Bacteria | 1750 |
| 1300 | Ga0495619_1205216 | 3300053085 | Bacteria | 501 |
| 1301 | Ga0500643_010499 | 3300053087 | Bacteria | 3442 |
| 1302 | Ga0500651_0068220 | 3300053093 | Bacteria | 2215 |
| 1303 | Ga0500650_0020934 | 3300053098 | Bacteria | 2876 |
| 1304 | Ga0500650_0175108 | 3300053098 | Bacteria | 985 |
| 1305 | Ga0500562_065470 | 3300053108 | Bacteria | 979 |
| 1306 | Ga0500594_0215454 | 3300053118 | Bacteria | 634 |
| 1307 | Ga0500594_0322973 | 3300053118 | Bacteria | 518 |
| 1308 | Ga0500621_099084 | 3300053126 | Bacteria | 1152 |
| 1309 | Ga0500573_0182803 | 3300053140 | Bacteria | 1126 |
| 1310 | Ga0500577_0426392 | 3300053142 | Bacteria | 580 |
| 1311 | Ga0500579_094498 | 3300053143 | Bacteria | 1594 |
| 1312 | Ga0500600_0162036 | 3300053149 | Bacteria | 1098 |
| 1313 | Ga0500630_115641 | 3300053159 | Bacteria | 1197 |
| 1314 | Ga0501084_0810902 | 3300054114 | Bacteria | 788 |
| 1315 | Ga0590075_070474 | 3300059424 | Bacteria | 903 |
| 1316 | Ga0587067_111827 | 3300059640 | Bacteria | 645 |
| 1317 | Ga0530510_0249379 | 3300061734 | Bacteria | 1323 |
| 1318 | 2515496029 | 2515154088 | Bacteria | 5526283 |
| 1319 | 2515719800 | 2515154129 | Bacteria | 5584369 |
| 1320 | 2515757867 | 2515154137 | Bacteria | 5711575 |
| 1321 | 2516090293 | 2515154203 | Bacteria | 5458536 |
| 1322 | 2753264716 | 2751185782 | Bacteria | 11227053 |
| 1323 | 2861520641 | 2861520306 | Bacteria | 8348283 |
| 1324 | 2887482830 | 2887478801 | Bacteria | 8972725 |
| 1325 | 8001781895 | 8001781756 | Bacteria | 9586736 |
| 1326 | Ga0070676_10597365 | |||
| 1327 | JGI24735J21928_10094755 | |||
| 1328 | JGI25406J46586_10248285 | |||
| 1329 | rootL2_10152190 | |||
| 1330 | rootL2_10152199 | |||
| 1331 | Ga0058863_11912449 | |||
| 1332 | Ga0058860_11883144 | |||
| 1333 | Ga0070658_10741959 | |||
| 1334 | Ga0070683_100271352 | |||
| 1335 | Ga0070683_100480301 | |||
| 1336 | Ga0070683_100979790 | |||
| 1337 | Ga0070683_101566460 | |||
| 1338 | Ga0070683_102025771 | |||
| 1339 | Ga0070670_101393942 | |||
| 1340 | Ga0070677_10679785 | |||
| 1341 | Ga0068869_100002087 | |||
| 1342 | Ga0068869_100055256 | |||
| 1343 | Ga0068869_100434613 | |||
| 1344 | Ga0068869_100730136 | |||
| 1345 | Ga0068869_101302088 | |||
| 1346 | Ga0070666_11203018 | |||
| 1347 | Ga0070680_100006507 | |||
| 1348 | Ga0070680_100178674 | |||
| 1349 | Ga0070680_100297789 | |||
| 1350 | Ga0070680_100392404 | |||
| 1351 | Ga0070682_100435295 | |||
| 1352 | Ga0070682_100679787 | |||
| 1353 | Ga0070682_101206361 | |||
| 1354 | Ga0068868_100029329 | |||
| 1355 | Ga0068868_100346421 | |||
| 1356 | Ga0068868_101676659 | |||
| 1357 | Ga0070660_100220960 | |||
| 1358 | Ga0070660_100282278 | |||
| 1359 | Ga0070660_101045355 | |||
| 1360 | Ga0070689_101713214 | |||
| 1361 | Ga0070689_102221641 | |||
| 1362 | Ga0070691_10032956 | |||
| 1363 | Ga0070691_10853827 | |||
| 1364 | Ga0070687_100761532 | |||
| 1365 | Ga0070687_101089870 | |||
| 1366 | Ga0070661_100048109 | |||
| 1367 | Ga0070661_100114537 | |||
| 1368 | Ga0070661_100554227 | |||
| 1369 | Ga0070661_100920142 | |||
| 1370 | Ga0070661_101718839 | |||
| 1371 | Ga0070692_10245196 | |||
| 1372 | Ga0070692_10277039 | |||
| 1373 | Ga0070692_11310856 | |||
| 1374 | Ga0070668_100003831 | |||
| 1375 | Ga0070668_101426534 | |||
| 1376 | Ga0070668_101870598 | |||
| 1377 | Ga0070669_100425383 | |||
| 1378 | Ga0070675_100016825 | |||
| 1379 | Ga0070675_100623215 | |||
| 1380 | Ga0070671_100437108 | |||
| 1381 | Ga0070673_100719130 | |||
| 1382 | Ga0070688_101589281 | |||
| 1383 | Ga0070659_100015201 | |||
| 1384 | Ga0070659_101460572 | |||
| 1385 | Ga0070667_100019814 | |||
| 1386 | Ga0070667_100148807 | |||
| 1387 | Ga0070709_10198336 | |||
| 1388 | Ga0070709_10232602 | |||
| 1389 | Ga0070709_11312064 | |||
| 1390 | Ga0070709_11572381 | |||
| 1391 | Ga0070714_100002405 | |||
| 1392 | Ga0070714_100006462 | |||
| 1393 | Ga0070714_100132470 | |||
| 1394 | Ga0070714_100222719 | |||
| 1395 | Ga0070714_100391412 | |||
| 1396 | Ga0070714_100748413 | |||
| 1397 | Ga0070714_100913869 | |||
| 1398 | Ga0070714_100914862 | |||
| 1399 | Ga0070714_101249829 | |||
| 1400 | Ga0070713_100002390 | |||
| 1401 | Ga0070713_100018875 | |||
| 1402 | Ga0070713_100028043 | |||
| 1403 | Ga0070713_100109081 | |||
| 1404 | Ga0070713_100157524 | |||
| 1405 | Ga0070713_100358319 | |||
| 1406 | Ga0070713_100473658 | |||
| 1407 | Ga0070713_100698315 | |||
| 1408 | Ga0070713_100946503 | |||
| 1409 | Ga0070713_101228130 | |||
| 1410 | Ga0070713_102420893 | |||
| 1411 | Ga0070710_10073330 | |||
| 1412 | Ga0070710_10205934 | |||
| 1413 | Ga0070710_10317961 | |||
| 1414 | Ga0070710_10786716 | |||
| 1415 | Ga0070710_10856629 | |||
| 1416 | Ga0070710_11158324 | |||
| 1417 | Ga0070711_100053069 | |||
| 1418 | Ga0070711_100082805 | |||
| 1419 | Ga0070711_100189420 | |||
| 1420 | Ga0070711_100194919 | |||
| 1421 | Ga0070711_100436528 | |||
| 1422 | Ga0070705_101162905 | |||
| 1423 | Ga0070705_101460768 | |||
| 1424 | Ga0070705_101700117 | |||
| 1425 | Ga0070700_100068017 | |||
| 1426 | Ga0070700_100991827 | |||
| 1427 | Ga0070694_101344423 | |||
| 1428 | Ga0070708_100070053 | |||
| 1429 | Ga0070663_100132001 | |||
| 1430 | Ga0070663_100171938 | |||
| 1431 | Ga0070663_100304457 | |||
| 1432 | Ga0070663_100357173 | |||
| 1433 | Ga0070663_100379023 | |||
| 1434 | Ga0070663_100583286 | |||
| 1435 | Ga0070678_100063568 | |||
| 1436 | Ga0070678_100739580 | |||
| 1437 | Ga0070678_102104182 | |||
| 1438 | Ga0070662_100344135 | |||
| 1439 | Ga0070662_101727280 | |||
| 1440 | Ga0070681_10000046 | |||
| 1441 | Ga0070681_10122362 | |||
| 1442 | Ga0070681_10574122 | |||
| 1443 | Ga0070681_10809468 | |||
| 1444 | Ga0070681_10962034 | |||
| 1445 | Ga0068867_100098091 | |||
| 1446 | Ga0070685_10761885 | |||
| 1447 | Ga0070706_100001132 | |||
| 1448 | Ga0070706_100523857 | |||
| 1449 | Ga0070707_100906411 | |||
| 1450 | Ga0070707_100925546 | |||
| 1451 | Ga0070707_101295655 | |||
| 1452 | Ga0070698_100114679 | |||
| 1453 | Ga0070699_101518641 | |||
| 1454 | Ga0070679_100001357 | |||
| 1455 | Ga0070679_100022895 | |||
| 1456 | Ga0070679_100181873 | |||
| 1457 | Ga0070679_100210065 | |||
| 1458 | Ga0070679_100419985 | |||
| 1459 | Ga0070679_100940056 | |||
| 1460 | Ga0070679_101727370 | |||
| 1461 | Ga0070679_102164542 | |||
| 1462 | Ga0070684_100049491 | |||
| 1463 | Ga0070684_100131673 | |||
| 1464 | Ga0070684_100264811 | |||
| 1465 | Ga0070684_100486982 | |||
| 1466 | Ga0070684_100691945 | |||
| 1467 | Ga0070684_100755196 | |||
| 1468 | Ga0070684_102320110 | |||
| 1469 | Ga0070697_100543948 | |||
| 1470 | Ga0070697_101478412 | |||
| 1471 | Ga0068853_102079686 | |||
| 1472 | Ga0070672_100345392 | |||
| 1473 | Ga0070672_100656040 | |||
| 1474 | Ga0070686_101934728 | |||
| 1475 | Ga0070695_100196184 | |||
| 1476 | Ga0070696_100052817 | |||
| 1477 | Ga0070693_100629895 | |||
| 1478 | Ga0070693_100911016 | |||
| 1479 | Ga0070665_100394988 | |||
| 1480 | Ga0070665_100495817 | |||
| 1481 | Ga0070665_100578220 | |||
| 1482 | Ga0070665_100632856 | |||
| 1483 | Ga0070665_100880729 | |||
| 1484 | Ga0070665_101801442 | |||
| 1485 | Ga0070704_100627673 | |||
| 1486 | Ga0068855_100035979 | |||
| 1487 | Ga0070664_100003346 | |||
| 1488 | Ga0070664_100100342 | |||
| 1489 | Ga0070664_100346276 | |||
| 1490 | Ga0070664_100454415 | |||
| 1491 | Ga0070664_100592347 | |||
| 1492 | Ga0070664_100691719 | |||
| 1493 | Ga0068857_100064208 | |||
| 1494 | Ga0068857_100064422 | |||
| 1495 | Ga0068857_100104273 | |||
| 1496 | Ga0068857_100120725 | |||
| 1497 | Ga0068857_100476187 | |||
| 1498 | Ga0068857_100656329 | |||
| 1499 | Ga0068857_101007555 | |||
| 1500 | Ga0068857_101738368 | |||
| 1501 | Ga0068854_100046027 | |||
| 1502 | Ga0068856_100179641 | |||
| 1503 | Ga0068856_100420416 | |||
| 1504 | Ga0068856_100556725 | |||
| 1505 | Ga0068856_100674204 | |||
| 1506 | Ga0068856_101052404 | |||
| 1507 | Ga0068852_100126393 | |||
| 1508 | Ga0068852_101270622 | |||
| 1509 | Ga0068852_101815648 | |||
| 1510 | Ga0068852_102319155 | |||
| 1511 | Ga0068859_100471691 | |||
| 1512 | Ga0068859_103053840 | |||
| 1513 | Ga0068864_100164539 | |||
| 1514 | Ga0068864_100505344 | |||
| 1515 | Ga0068864_100647361 | |||
| 1516 | Ga0068864_101267194 | |||
| 1517 | Ga0068864_101267938 | |||
| 1518 | Ga0068866_10364926 | |||
| 1519 | Ga0068861_100152280 | |||
| 1520 | Ga0068861_100478272 | |||
| 1521 | Ga0068861_100968215 | |||
| 1522 | Ga0068861_102279178 | |||
| 1523 | Ga0068851_10833452 | |||
| 1524 | Ga0068851_10919132 | |||
| 1525 | Ga0068870_10196721 | |||
| 1526 | Ga0068870_11380036 | |||
| 1527 | Ga0068863_100112032 | |||
| 1528 | Ga0068863_100295179 | |||
| 1529 | Ga0068863_100398559 | |||
| 1530 | Ga0068863_100438704 | |||
| 1531 | Ga0068863_101175857 | |||
| 1532 | Ga0068858_100000003 | |||
| 1533 | Ga0068858_100400596 | |||
| 1534 | Ga0068860_100351412 | |||
| 1535 | Ga0068860_100417467 | |||
| 1536 | Ga0068862_100319573 | |||
| 1537 | Ga0068862_101461276 | |||
| 1538 | Ga0081455_10193072 | |||
| 1539 | Ga0081540_1006417 | |||
| 1540 | Ga0081540_1008507 | |||
| 1541 | Ga0081540_1168961 | |||
| 1542 | Ga0081539_10000357 | |||
| 1543 | Ga0081539_10000613 | |||
| 1544 | Ga0081539_10001106 | |||
| 1545 | Ga0081539_10021053 | |||
| 1546 | Ga0081539_10050261 | |||
| 1547 | Ga0081539_10210315 | |||
| 1548 | Ga0070717_10086914 | |||
| 1549 | Ga0070717_10117948 | |||
| 1550 | Ga0070717_10155742 | |||
| 1551 | Ga0070717_10190102 | |||
| 1552 | Ga0070717_10410061 | |||
| 1553 | Ga0070717_10473276 | |||
| 1554 | Ga0070717_10535337 | |||
| 1555 | Ga0070717_10628381 | |||
| 1556 | Ga0070717_10629366 | |||
| 1557 | Ga0070717_11406333 | |||
| 1558 | Ga0075365_10840437 | |||
| 1559 | Ga0075368_10346759 | |||
| 1560 | Ga0075363_101029883 | |||
| 1561 | Ga0075364_10132326 | |||
| 1562 | Ga0075364_10241111 | |||
| 1563 | Ga0075364_10953457 | |||
| 1564 | Ga0070715_10012535 | |||
| 1565 | Ga0070715_10261568 | |||
| 1566 | Ga0070715_10337616 | |||
| 1567 | Ga0070715_10849165 | |||
| 1568 | Ga0070716_100017617 | |||
| 1569 | Ga0070716_100037270 | |||
| 1570 | Ga0070716_100111375 | |||
| 1571 | Ga0070716_100206357 | |||
| 1572 | Ga0070716_100263060 | |||
| 1573 | Ga0070716_101131958 | |||
| 1574 | Ga0070712_100001139 | |||
| 1575 | Ga0070712_100062698 | |||
| 1576 | Ga0070712_100260665 | |||
| 1577 | Ga0070712_100970943 | |||
| 1578 | Ga0070712_101211530 | |||
| 1579 | Ga0070712_101580585 | |||
| 1580 | Ga0070712_101957197 | |||
| 1581 | Ga0075367_10247009 | |||
| 1582 | Ga0097621_100520562 | |||
| 1583 | Ga0097621_102335498 | |||
| 1584 | Ga0068871_100730998 | |||
| 1585 | Ga0068871_100904552 | |||
| 1586 | Ga0068871_101836048 | |||
| 1587 | Ga0068871_102262506 | |||
| 1588 | Ga0075428_100131420 | |||
| 1589 | Ga0075428_100176977 | |||
| 1590 | Ga0075428_100749448 | |||
| 1591 | Ga0075430_100311890 | |||
| 1592 | Ga0075430_100811730 | |||
| 1593 | Ga0075430_100821997 | |||
| 1594 | Ga0075430_100825945 | |||
| 1595 | Ga0075431_100110568 | |||
| 1596 | Ga0075431_100262982 | |||
| 1597 | Ga0075431_100602776 | |||
| 1598 | Ga0075431_101403375 | |||
| 1599 | Ga0075433_10288283 | |||
| 1600 | Ga0075434_100639575 | |||
| 1601 | Ga0075434_101380961 | |||
| 1602 | Ga0075434_102089693 | |||
| 1603 | Ga0075429_101497486 | |||
| 1604 | Ga0068865_100412981 | |||
| 1605 | Ga0097620_100471682 | |||
| 1606 | Ga0097620_103055042 | |||
| 1607 | Ga0105250_10627908 | |||
| 1608 | Ga0105240_11588746 | |||
| 1609 | Ga0105240_11644620 | |||
| 1610 | Ga0111539_10360375 | |||
| 1611 | Ga0111539_10434279 | |||
| 1612 | Ga0105245_10091725 | |||
| 1613 | Ga0105245_11264159 | |||
| 1614 | Ga0105247_10000296 | |||
| 1615 | Ga0105247_10113467 | |||
| 1616 | Ga0105247_10534720 | |||
| 1617 | Ga0105247_11340477 | |||
| 1618 | Ga0114129_10000007 | |||
| 1619 | Ga0114129_10217549 | |||
| 1620 | Ga0114129_10328069 | |||
| 1621 | Ga0114129_10446493 | |||
| 1622 | Ga0114129_10861884 | |||
| 1623 | Ga0114129_12230636 | |||
| 1624 | Ga0105243_10229803 | |||
| 1625 | Ga0105243_10578932 | |||
| 1626 | Ga0105241_10073255 | |||
| 1627 | Ga0105241_10349701 | |||
| 1628 | Ga0105242_13090940 | |||
| 1629 | Ga0105248_10011254 | |||
| 1630 | Ga0105248_10091447 | |||
| 1631 | Ga0105248_10840973 | |||
| 1632 | Ga0105248_11241542 | |||
| 1633 | Ga0105248_11669871 | |||
| 1634 | Ga0105237_10579508 | |||
| 1635 | Ga0105237_10707778 | |||
| 1636 | Ga0105237_11472013 | |||
| 1637 | Ga0105237_11977573 | |||
| 1638 | Ga0105237_12623079 | |||
| 1639 | Ga0105238_10658021 | |||
| 1640 | Ga0105238_11845463 | |||
| 1641 | Ga0105249_11150985 | |||
| 1642 | Ga0099796_10567381 | |||
| 1643 | Ga0105239_10466237 | |||
| 1644 | Ga0105239_11445956 | |||
| 1645 | Ga0105246_11274535 | |||
| 1646 | Ga0105246_11389924 | |||
| 1647 | Ga0105246_12246950 | |||
| 1648 | Ga0157373_10534193 | |||
| 1649 | Ga0157373_11344311 | |||
| 1650 | Ga0157371_10390666 | |||
| 1651 | Ga0157370_10315645 | |||
| 1652 | Ga0157370_10762908 | |||
| 1653 | Ga0157370_11754187 | |||
| 1654 | Ga0157369_10008846 | |||
| 1655 | Ga0157369_10016406 | |||
| 1656 | Ga0157369_10158983 | |||
| 1657 | Ga0157369_10190000 | |||
| 1658 | Ga0157369_10282245 | |||
| 1659 | Ga0157369_10559482 | |||
| 1660 | Ga0157374_11395427 | |||
| 1661 | Ga0157374_12050439 | |||
| 1662 | Ga0157378_10533847 | |||
| 1663 | Ga0157378_11174705 | |||
| 1664 | Ga0157378_13033200 | |||
| 1665 | Ga0163162_10833368 | |||
| 1666 | Ga0157372_10000044 | |||
| 1667 | Ga0157372_10695067 | |||
| 1668 | Ga0157372_10726396 | |||
| 1669 | Ga0157372_11537878 | |||
| 1670 | Ga0157372_11832187 | |||
| 1671 | Ga0157372_12481291 | |||
| 1672 | Ga0157372_12621532 | |||
| 1673 | Ga0157375_10590344 | |||
| 1674 | Ga0157375_11217677 | |||
| 1675 | Ga0157375_11285471 | |||
| 1676 | Ga0163163_10134785 | |||
| 1677 | Ga0163163_10426728 | |||
| 1678 | Ga0163163_10933907 | |||
| 1679 | Ga0163163_11719462 | |||
| 1680 | Ga0163163_11830447 | |||
| 1681 | Ga0163163_13202622 | |||
| 1682 | Ga0157380_11461675 | |||
| 1683 | Ga0157380_12275177 | |||
| 1684 | Ga0182008_10804335 | |||
| 1685 | Ga0157377_10286550 | |||
| 1686 | Ga0157377_10687599 | |||
| 1687 | Ga0157377_10838470 | |||
| 1688 | Ga0157379_10000999 | |||
| 1689 | Ga0157379_10346401 | |||
| 1690 | Ga0157379_12180640 | |||
| 1691 | Ga0157379_12295691 | |||
| 1692 | Ga0157376_10066563 | |||
| 1693 | Ga0157376_10852757 | |||
| 1694 | Ga0163161_10742604 | |||
| 1695 | Ga0184593_122585 | |||
| 1696 | Ga0184601_119431 | |||
| 1697 | Ga0184600_119799 | |||
| 1698 | Ga0184603_112367 | |||
| 1699 | Ga0197907_10027294 | |||
| 1700 | Ga0197907_10220737 | |||
| 1701 | Ga0197907_10601364 | |||
| 1702 | Ga0197907_10893729 | |||
| 1703 | Ga0206356_10997871 | |||
| 1704 | Ga0206356_11372204 | |||
| 1705 | Ga0206356_11671517 | |||
| 1706 | Ga0206349_1553193 | |||
| 1707 | Ga0206349_1886438 | |||
| 1708 | Ga0206351_10291020 | |||
| 1709 | Ga0206351_10579729 | |||
| 1710 | Ga0206351_10889857 | |||
| 1711 | Ga0206352_10038242 | |||
| 1712 | Ga0206352_10136420 | |||
| 1713 | Ga0206352_10289056 | |||
| 1714 | Ga0206352_11208457 | |||
| 1715 | Ga0206350_10168894 | |||
| 1716 | Ga0206350_10655422 | |||
| 1717 | Ga0206354_10034819 | |||
| 1718 | Ga0206354_10148362 | |||
| 1719 | Ga0206354_10287205 | |||
| 1720 | Ga0206354_10606016 | |||
| 1721 | Ga0206354_10631935 | |||
| 1722 | Ga0206354_10751521 | |||
| 1723 | Ga0206354_11147654 | |||
| 1724 | Ga0206354_11494243 | |||
| 1725 | Ga0206353_10658063 | |||
| 1726 | Ga0206353_10693515 | |||
| 1727 | Ga0206353_11116006 | |||
| 1728 | Ga0206353_11271389 | |||
| 1729 | Ga0206353_11430486 | |||
| 1730 | Ga0206353_11796673 | |||
| 1731 | Ga0224712_10060728 | |||
| 1732 | Ga0224712_10067101 | |||
| 1733 | Ga0224712_10073951 | |||
| 1734 | Ga0224712_10107264 | |||
| 1735 | Ga0224712_10145804 | |||
| 1736 | Ga0224712_10203293 | |||
| 1737 | Ga0224712_10506274 | |||
| 1738 | Ga0247529_114344 | |||
| 1739 | Ga0247530_109533 | |||
| 1740 | Ga0207682_10170805 | |||
| 1741 | Ga0207682_10590075 | |||
| 1742 | Ga0207692_10000366 | |||
| 1743 | Ga0207692_10128288 | |||
| 1744 | Ga0207692_10289011 | |||
| 1745 | Ga0207692_10344722 | |||
| 1746 | Ga0207692_10357241 | |||
| 1747 | Ga0207692_10364691 | |||
| 1748 | Ga0207692_10714620 | |||
| 1749 | Ga0207692_10991139 | |||
| 1750 | Ga0207710_10000020 | |||
| 1751 | Ga0207710_10411119 | |||
| 1752 | Ga0207688_10896082 | |||
| 1753 | Ga0207688_10899589 | |||
| 1754 | Ga0207680_10647632 | |||
| 1755 | Ga0207680_10889400 | |||
| 1756 | Ga0207647_10738399 | |||
| 1757 | Ga0207685_10166257 | |||
| 1758 | Ga0207685_10168595 | |||
| 1759 | Ga0207685_10788500 | |||
| 1760 | Ga0207699_10003090 | |||
| 1761 | Ga0207699_10015215 | |||
| 1762 | Ga0207699_10258237 | |||
| 1763 | Ga0207699_10382958 | |||
| 1764 | Ga0207699_11056717 | |||
| 1765 | Ga0207699_11310551 | |||
| 1766 | Ga0207645_10169744 | |||
| 1767 | Ga0207643_10246568 | |||
| 1768 | Ga0207643_10720282 | |||
| 1769 | Ga0207705_10038088 | |||
| 1770 | Ga0207705_10244273 | |||
| 1771 | Ga0207705_10471205 | |||
| 1772 | Ga0207705_10829913 | |||
| 1773 | Ga0207684_10001586 | |||
| 1774 | Ga0207684_10021426 | |||
| 1775 | Ga0207684_10522748 | |||
| 1776 | Ga0207684_10576510 | |||
| 1777 | Ga0207654_10109048 | |||
| 1778 | Ga0207707_10000418 | |||
| 1779 | Ga0207707_10053472 | |||
| 1780 | Ga0207707_10661347 | |||
| 1781 | Ga0207707_11173233 | |||
| 1782 | Ga0207707_11173824 | |||
| 1783 | Ga0207695_11143221 | |||
| 1784 | Ga0207693_10004248 | |||
| 1785 | Ga0207693_10086885 | |||
| 1786 | Ga0207693_10216939 | |||
| 1787 | Ga0207693_10541804 | |||
| 1788 | Ga0207693_10920313 | |||
| 1789 | Ga0207663_10220500 | |||
| 1790 | Ga0207663_10232307 | |||
| 1791 | Ga0207663_10409515 | |||
| 1792 | Ga0207663_10564624 | |||
| 1793 | Ga0207663_10630412 | |||
| 1794 | Ga0207663_10938692 | |||
| 1795 | Ga0207660_10000168 | |||
| 1796 | Ga0207660_10156392 | |||
| 1797 | Ga0207660_10986639 | |||
| 1798 | Ga0207660_11165191 | |||
| 1799 | Ga0207662_10344881 | |||
| 1800 | Ga0207662_10693094 | |||
| 1801 | Ga0207657_10028132 | |||
| 1802 | Ga0207657_10557645 | |||
| 1803 | Ga0207649_10021859 | |||
| 1804 | Ga0207649_10333869 | |||
| 1805 | Ga0207649_10844178 | |||
| 1806 | Ga0207649_11072046 | |||
| 1807 | Ga0207649_11079274 | |||
| 1808 | Ga0207652_10000461 | |||
| 1809 | Ga0207652_10209906 | |||
| 1810 | Ga0207652_10478069 | |||
| 1811 | Ga0207652_10600401 | |||
| 1812 | Ga0207652_10673217 | |||
| 1813 | Ga0207652_11844551 | |||
| 1814 | Ga0207646_10011604 | |||
| 1815 | Ga0207646_10082776 | |||
| 1816 | Ga0207646_11432422 | |||
| 1817 | Ga0207646_11694505 | |||
| 1818 | Ga0207681_10178184 | |||
| 1819 | Ga0207681_10697682 | |||
| 1820 | Ga0207694_10864232 | |||
| 1821 | Ga0207650_10633634 | |||
| 1822 | Ga0207650_11378586 | |||
| 1823 | Ga0207659_10004185 | |||
| 1824 | Ga0207659_10293543 | |||
| 1825 | Ga0207659_11864174 | |||
| 1826 | Ga0207687_10057947 | |||
| 1827 | Ga0207700_10008761 | |||
| 1828 | Ga0207700_10043804 | |||
| 1829 | Ga0207700_10109682 | |||
| 1830 | Ga0207700_10173207 | |||
| 1831 | Ga0207700_10422868 | |||
| 1832 | Ga0207700_10467342 | |||
| 1833 | Ga0207700_10791159 | |||
| 1834 | Ga0207700_10868618 | |||
| 1835 | Ga0207700_11420379 | |||
| 1836 | Ga0207700_11521831 | |||
| 1837 | Ga0207664_10002028 | |||
| 1838 | Ga0207664_10020733 | |||
| 1839 | Ga0207664_10021120 | |||
| 1840 | Ga0207664_10032443 | |||
| 1841 | Ga0207664_10202640 | |||
| 1842 | Ga0207664_10321487 | |||
| 1843 | Ga0207664_10371665 | |||
| 1844 | Ga0207664_10514508 | |||
| 1845 | Ga0207664_10549317 | |||
| 1846 | Ga0207664_10785581 | |||
| 1847 | Ga0207664_11428326 | |||
| 1848 | Ga0207644_11000874 | |||
| 1849 | Ga0207690_10067601 | |||
| 1850 | Ga0207706_10367734 | |||
| 1851 | Ga0207706_11064928 | |||
| 1852 | Ga0207669_10904033 | |||
| 1853 | Ga0207704_10383396 | |||
| 1854 | Ga0207704_11896187 | |||
| 1855 | Ga0207665_10001687 | |||
| 1856 | Ga0207665_10423495 | |||
| 1857 | Ga0207665_10934355 | |||
| 1858 | Ga0207665_11047892 | |||
| 1859 | Ga0207691_10186014 | |||
| 1860 | Ga0207691_10431019 | |||
| 1861 | Ga0207711_10103798 | |||
| 1862 | Ga0207711_10368503 | |||
| 1863 | Ga0207711_10635389 | |||
| 1864 | Ga0207711_11288493 | |||
| 1865 | Ga0207689_10058040 | |||
| 1866 | Ga0207689_10074648 | |||
| 1867 | Ga0207689_10343761 | |||
| 1868 | Ga0207689_10569861 | |||
| 1869 | Ga0207689_10835303 | |||
| 1870 | Ga0207661_10001620 | |||
| 1871 | Ga0207661_10152677 | |||
| 1872 | Ga0207661_10184007 | |||
| 1873 | Ga0207661_10288319 | |||
| 1874 | Ga0207661_10448037 | |||
| 1875 | Ga0207661_10627931 | |||
| 1876 | Ga0207661_10970265 | |||
| 1877 | Ga0207661_11171209 | |||
| 1878 | Ga0207661_11231299 | |||
| 1879 | Ga0207661_12016946 | |||
| 1880 | Ga0207679_10008106 | |||
| 1881 | Ga0207679_10128346 | |||
| 1882 | Ga0207679_10177093 | |||
| 1883 | Ga0207679_10213125 | |||
| 1884 | Ga0207679_10293448 | |||
| 1885 | Ga0207679_10442693 | |||
| 1886 | Ga0207679_10515970 | |||
| 1887 | Ga0207679_10684669 | |||
| 1888 | Ga0207667_10193892 | |||
| 1889 | Ga0207667_12226164 | |||
| 1890 | Ga0207651_10983086 | |||
| 1891 | Ga0207651_11819403 | |||
| 1892 | Ga0207712_10205948 | |||
| 1893 | Ga0207668_10002358 | |||
| 1894 | Ga0207668_10979034 | |||
| 1895 | Ga0207668_11130726 | |||
| 1896 | Ga0207668_11483594 | |||
| 1897 | Ga0207640_10706683 | |||
| 1898 | Ga0207640_11281141 | |||
| 1899 | Ga0207658_10437789 | |||
| 1900 | Ga0207677_11271344 | |||
| 1901 | Ga0207703_10000006 | |||
| 1902 | Ga0207678_10122234 | |||
| 1903 | Ga0207678_10130372 | |||
| 1904 | Ga0207678_10187353 | |||
| 1905 | Ga0207678_10219833 | |||
| 1906 | Ga0207678_10221569 | |||
| 1907 | Ga0207678_10338850 | |||
| 1908 | Ga0207708_10094016 | |||
| 1909 | Ga0207708_10322248 | |||
| 1910 | Ga0207708_10365112 | |||
| 1911 | Ga0207708_10396538 | |||
| 1912 | Ga0207708_10651524 | |||
| 1913 | Ga0207702_10144165 | |||
| 1914 | Ga0207702_10398334 | |||
| 1915 | Ga0207702_10680302 | |||
| 1916 | Ga0207702_10830201 | |||
| 1917 | Ga0207702_10971220 | |||
| 1918 | Ga0207702_11136278 | |||
| 1919 | Ga0207702_11444860 | |||
| 1920 | Ga0207702_12369271 | |||
| 1921 | Ga0207641_10077025 | |||
| 1922 | Ga0207641_10139497 | |||
| 1923 | Ga0207641_11391622 | |||
| 1924 | Ga0207648_10131181 | |||
| 1925 | Ga0207676_10035666 | |||
| 1926 | Ga0207676_10160836 | |||
| 1927 | Ga0207676_10525346 | |||
| 1928 | Ga0207676_10573248 | |||
| 1929 | Ga0207676_10660512 | |||
| 1930 | Ga0207676_10940344 | |||
| 1931 | Ga0207676_11625257 | |||
| 1932 | Ga0207674_10019875 | |||
| 1933 | Ga0207674_10158216 | |||
| 1934 | Ga0207674_10174824 | |||
| 1935 | Ga0207674_10221562 | |||
| 1936 | Ga0207674_10289063 | |||
| 1937 | Ga0207674_10717995 | |||
| 1938 | Ga0207674_11569659 | |||
| 1939 | Ga0207674_11594510 | |||
| 1940 | Ga0207674_12109520 | |||
| 1941 | Ga0207675_100014030 | |||
| 1942 | Ga0207675_100397758 | |||
| 1943 | Ga0207675_100508119 | |||
| 1944 | Ga0207675_100536457 | |||
| 1945 | Ga0207675_101013001 | |||
| 1946 | Ga0207683_10078213 | |||
| 1947 | Ga0207683_10232623 | |||
| 1948 | Ga0207683_10286254 | |||
| 1949 | Ga0207698_10688978 | |||
| 1950 | Ga0207698_10898864 | |||
| 1951 | Ga0207698_11549697 | |||
| 1952 | Ga0207428_10080319 | |||
| 1953 | Ga0268266_10207834 | |||
| 1954 | Ga0268266_10688606 | |||
| 1955 | Ga0268266_11819046 | |||
| 1956 | Ga0268265_10014957 | |||
| 1957 | Ga0268265_10568707 | |||
| 1958 | Ga0268265_11072539 | |||
| 1959 | Ga0268265_11879882 | |||
| 1960 | Ga0268264_10139955 | |||
| 1961 | Ga0268264_10404078 | |||
| 1962 | Ga0265336_10042279 | |||
| 1963 | Ga0307517_10115171 | |||
| 1964 | Ga0307517_10503128 | |||
| 1965 | Ga0307515_10000045 | |||
| 1966 | Ga0307515_10015993 | |||
| 1967 | Ga0307515_10032705 | |||
| 1968 | Ga0307515_10051803 | |||
| 1969 | Ga0307515_10207412 | |||
| 1970 | Ga0265338_10000680 | |||
| 1971 | Ga0310981_1042067 | |||
| 1972 | Ga0307512_10007169 | |||
| 1973 | Ga0307512_10076400 | |||
| 1974 | Ga0307512_10115066 | |||
| 1975 | Ga0307512_10171240 | |||
| 1976 | Ga0316178_1088482 | |||
| 1977 | Ga0307513_10015297 | |||
| 1978 | Ga0307513_10056025 | |||
| 1979 | Ga0307513_10144144 | |||
| 1980 | Ga0307509_10018024 | |||
| 1981 | Ga0307509_10123651 | |||
| 1982 | Ga0307509_10367065 | |||
| 1983 | Ga0307408_100075391 | |||
| 1984 | Ga0307408_101358571 | |||
| 1985 | Ga0307408_102216215 | |||
| 1986 | Ga0310117_107422 | |||
| 1987 | Ga0310103_113480 | |||
| 1988 | Ga0307508_10003422 | |||
| 1989 | Ga0307508_10018512 | |||
| 1990 | Ga0307508_10018782 | |||
| 1991 | Ga0307508_10027035 | |||
| 1992 | Ga0307508_10030578 | |||
| 1993 | Ga0307508_10136839 | |||
| 1994 | Ga0307514_10175386 | |||
| 1995 | Ga0310119_125356 | |||
| 1996 | Ga0307516_10006648 | |||
| 1997 | Ga0307516_10014878 | |||
| 1998 | Ga0307516_10018382 | |||
| 1999 | Ga0307516_10297527 | |||
| 2000 | Ga0307405_10005914 | |||
| 2001 | Ga0307405_10087274 | |||
| 2002 | Ga0307405_10547147 | |||
| 2003 | Ga0307405_10793985 | |||
| 2004 | Ga0307405_10858681 | |||
| 2005 | Ga0307405_11497041 | |||
| 2006 | Ga0316044_122642 | |||
| 2007 | Ga0316045_127068 | |||
| 2008 | Ga0307413_10168551 | |||
| 2009 | Ga0307413_10436486 | |||
| 2010 | Ga0307413_11080941 | |||
| 2011 | Ga0307413_11837754 | |||
| 2012 | Ga0307410_10023845 | |||
| 2013 | Ga0307410_10300718 | |||
| 2014 | Ga0307410_10890291 | |||
| 2015 | Ga0307410_11508923 | |||
| 2016 | Ga0307410_11934746 | |||
| 2017 | Ga0307406_10002273 | |||
| 2018 | Ga0307406_10008054 | |||
| 2019 | Ga0307406_10033659 | |||
| 2020 | Ga0307406_10367532 | |||
| 2021 | Ga0307406_10384306 | |||
| 2022 | Ga0307406_10537660 | |||
| 2023 | Ga0307406_10638900 | |||
| 2024 | Ga0307406_10706285 | |||
| 2025 | Ga0307406_10744809 | |||
| 2026 | Ga0307406_11004840 | |||
| 2027 | Ga0307407_10008322 | |||
| 2028 | Ga0307407_10061396 | |||
| 2029 | Ga0307407_10446597 | |||
| 2030 | Ga0307407_10801878 | |||
| 2031 | Ga0307407_11401179 | |||
| 2032 | Ga0307412_10082849 | |||
| 2033 | Ga0307412_12319051 | |||
| 2034 | Ga0307409_100011902 | |||
| 2035 | Ga0307409_100054640 | |||
| 2036 | Ga0307409_100185269 | |||
| 2037 | Ga0307409_100240682 | |||
| 2038 | Ga0307409_100543258 | |||
| 2039 | Ga0307409_101346036 | |||
| 2040 | Ga0307409_101483187 | |||
| 2041 | Ga0307409_102006274 | |||
| 2042 | Ga0307409_102236131 | |||
| 2043 | Ga0307409_102293295 | |||
| 2044 | Ga0307416_100001161 | |||
| 2045 | Ga0307416_100116839 | |||
| 2046 | Ga0307416_100438689 | |||
| 2047 | Ga0307416_101368479 | |||
| 2048 | Ga0307416_101679290 | |||
| 2049 | Ga0307416_102214557 | |||
| 2050 | Ga0307416_102510581 | |||
| 2051 | Ga0307414_10528885 | |||
| 2052 | Ga0307411_10932966 | |||
| 2053 | Ga0307411_11685890 | |||
| 2054 | Ga0307411_11927204 | |||
| 2055 | Ga0316053_117435 | |||
| 2056 | Ga0307415_100000190 | |||
| 2057 | Ga0307415_100004484 | |||
| 2058 | Ga0307415_100022219 | |||
| 2059 | Ga0307415_100164818 | |||
| 2060 | Ga0307415_100222900 | |||
| 2061 | Ga0307415_100382085 | |||
| 2062 | Ga0307415_100404310 | |||
| 2063 | Ga0307415_100530044 | |||
| 2064 | Ga0307415_100780641 | |||
| 2065 | Ga0307415_102355540 | |||
| 2066 | Ga0307507_10012122 | |||
| 2067 | Ga0307507_10211728 | |||
| 2068 | Ga0307507_10447943 | |||
| 2069 | Ga0307510_10385505 | |||
| 2070 | Ga0316214_1004474 | |||
| 2071 | Ga0373930_0011603 | |||
| 2072 | Ga0373948_0004465 | |||
| 2073 | Ga0373950_0121524 | |||
| 2074 | Ga0373958_0026477 | |||
| 2075 | Ga0373959_0131207 | |||
| 2076 | Ga0373926_0088989 | |||
| 2077 | Ga0373926_0259422 | |||
| 2078 | Ga0373928_0004059 | |||
| 2079 | Ga0373928_0121382 | |||
| 2080 | Ga0373934_0000034 | |||
| 2081 | Ga0373934_0015572 | |||
| 2082 | Ga0373934_0016744 | |||
| 2083 | Ga0373934_0039606 | |||
| 2084 | Ga0373940_0068300 | |||
| 2085 | Ga0373944_0010680 | |||
| 2086 | Ga0373944_0063547 | |||
| 2087 | Ga0373944_0313979 | |||
| 2088 | Ga0373944_0430426 | |||
| 2089 | Ga0373949_0016313 | |||
| 2090 | Ga0373951_0000004 | |||
| 2091 | Ga0373951_0068872 | |||
| 2092 | Ga0373923_0000906 | |||
| 2093 | Ga0373923_0171819 | |||
| 2094 | Ga0373923_0260816 | |||
| 2095 | Ga0373923_0263823 | |||
| 2096 | Ga0373932_0052367 | |||
| 2097 | Ga0373936_0047619 | |||
| 2098 | Ga0373936_0092749 | |||
| 2099 | Ga0373939_0029292 | |||
| 2100 | Ga0373941_0128570 | |||
| 2101 | Ga0373945_0027244 | |||
| 2102 | Ga0373945_0118615 | |||
| 2103 | Ga0373953_0000176 | |||
| 2104 | Ga0373953_0005548 | |||
| 2105 | Ga0373953_0045154 | |||
| 2106 | Ga0373953_0250111 | |||
| 2107 | Ga0373954_0002651 | |||
| 2108 | Ga0373954_0066894 | |||
| 2109 | Ga0373954_0082825 | |||
| 2110 | Ga0373954_0212722 | |||
| 2111 | Ga0373954_0392805 | |||
| 2112 | Ga0373956_0000479 | |||
| 2113 | Ga0373956_0073581 | |||
| 2114 | Ga0373956_0152272 | |||
| 2115 | Ga0373956_0477923 | |||
| 2116 | Ga0373957_0000488 | |||
| 2117 | Ga0373957_0006537 | |||
| 2118 | Ga0373957_0028711 | |||
| 2119 | Ga0373957_0094883 | |||
| 2120 | Ga0373957_0310731 | |||
| 2121 | Ga0373957_0358319 | |||
| 2122 | Ga0373960_0265397 | |||
| 2123 | Ga0373943_0127602 | |||
| 2124 | Ga0373943_0571597 | |||
| 2125 | Ga0373943_0682654 | |||
| 2126 | Ga0373946_0016191 | |||
| 2127 | Ga0373955_0000080 | |||
| 2128 | Ga0373955_0010334 | |||
| 2129 | Ga0373955_0683920 | |||
| 2130 | Ga0373942_0060387 | |||
| 2131 | Ga0373962_0000172 | |||
| 2132 | Ga0373924_0000942 | |||
| 2133 | Ga0373924_0008562 | |||
| 2134 | Ga0373924_0023674 | |||
| 2135 | Ga0373931_0130103 | |||
| 2136 | Ga0373931_0441831 | |||
| 2137 | Ga0373935_0023454 | |||
| 2138 | Ga0373935_0024335 | |||
| 2139 | Ga0373935_0041109 | |||
| 2140 | Ga0373935_0316326 | |||
| 2141 | Ga0373935_0624336 | |||
| 2142 | Ga0373935_0785326 | |||
| 2143 | Ga0373927_0145185 | |||
| 2144 | Ga0373927_0164621 | |||
| 2145 | Ga0373927_0631886 | |||
| 2146 | Ga0373933_0000461 | |||
| 2147 | Ga0373933_0003054 | |||
| 2148 | Ga0373933_0004243 | |||
| 2149 | Ga0373933_0007059 | |||
| 2150 | Ga0373933_0009456 | |||
| 2151 | Ga0373947_0044386 | |||
| 2152 | Ga0373947_0081060 | |||
| 2153 | Ga0373947_0332566 | |||
| 2154 | Ga0373947_0473092 | |||
| 2155 | Ga0310104_10395 | |||
| 2156 | Ga0373937_0000023 | |||
| 2157 | Ga0373937_0045127 | |||
| 2158 | Ga0373937_0170921 | |||
| 2159 | Ga0373937_0239762 | |||
| 2160 | Ga0373937_0378208 | |||
| 2161 | Ga0373937_0602837 | |||
| 2162 | Ga0373937_1396253 | |||
| 2163 | Ga0373937_1610489 | |||
| 2164 | Ga0265778_044208 | |||
| 2165 | Ga0310112_047578 | |||
| 2166 | Ga0310109_019976 | |||
| 2167 | Ga0373925_0011651 | |||
| 2168 | Ga0373925_0074311 | |||
| 2169 | Ga0373925_0254653 | |||
| 2170 | Ga0373925_0329578 | |||
| 2171 | Ga0373925_0682765 | |||
| 2172 | Ga0373925_1304930 | |||
| 2173 | Ga0395899_0009471 | |||
| 2174 | Ga0395900_0006872 | |||
| 2175 | Ga0395900_0581918 | |||
| 2176 | Ga0395900_0745628 | |||
| 2177 | Ga0395898_0005950 | |||
| 2178 | Ga0395898_0016606 | |||
| 2179 | Ga0395898_0031971 | |||
| 2180 | Ga0395898_0039905 | |||
| 2181 | Ga0395905_0006430 | |||
| 2182 | Ga0395905_1632557 | |||
| 2183 | Ga0395901_0009122 | |||
| 2184 | Ga0395901_0028124 | |||
| 2185 | Ga0395901_0470942 | |||
| 2186 | Ga0436365_0843445 | |||
| 2187 | Ga0436363_0176675 | |||
| 2188 | Ga0436363_0695637 | |||
| 2189 | Ga0436363_0855063 | |||
| 2190 | Ga0439438_145140 | |||
| 2191 | Ga0451789_0793300 | |||
| 2192 | Ga0451790_37344 | |||
| 2193 | Ga0451791_1219190 | |||
| 2194 | Ga0451793_0029799 | |||
| 2195 | Ga0451793_1560447 | |||
| 2196 | Ga0451797_0145031 | |||
| 2197 | Ga0451798_0529368 | |||
| 2198 | Ga0451802_2162425 | |||
| 2199 | Ga0451804_0431050 | |||
| 2200 | Ga0451807_0456693 | |||
| 2201 | Ga0451833_0384247 | |||
| 2202 | Ga0451833_0883276 | |||
| 2203 | Ga0451833_1374928 | |||
| 2204 | Ga0451835_0266027 | |||
| 2205 | Ga0451837_0384947 | |||
| 2206 | Ga0451837_1660227 | |||
| 2207 | Ga0451839_0144053 | |||
| 2208 | Ga0451839_1546639 | |||
| 2209 | Ga0451841_0000410 | |||
| 2210 | Ga0451849_0068873 | |||
| 2211 | Ga0451851_0087835 | |||
| 2212 | Ga0451843_0134207 | |||
| 2213 | Ga0451843_0586583 | |||
| 2214 | Ga0451853_0738829 | |||
| 2215 | Ga0451853_0892057 | |||
| 2216 | Ga0451853_1306632 | |||
| 2217 | Ga0439449_0023685 | |||
| 2218 | Ga0450902_082829 | |||
| 2219 | Ga0439440_0098191 | |||
| 2220 | Ga0466972_0150615 | |||
| 2221 | Ga0466965_0135429 | |||
| 2222 | Ga0466965_0136507 | |||
| 2223 | Ga0466966_0014016 | |||
| 2224 | Ga0466961_0110007 | |||
| 2225 | Ga0466963_0153592 | |||
| 2226 | Ga0466963_0443705 | |||
| 2227 | Ga0466963_0582934 | |||
| 2228 | Ga0466970_0385730 | |||
| 2229 | Ga0466957_1136394 | |||
| 2230 | Ga0466960_0230832 | |||
| 2231 | Ga0466960_0923893 | |||
| 2232 | Ga0466959_0002019 | |||
| 2233 | Ga0466958_0594422 | |||
| 2234 | Ga0466967_0084531 | |||
| 2235 | Ga0466967_0597071 | |||
| 2236 | Ga0466967_0823059 | |||
| 2237 | Ga0466967_2537298 | |||
| 2238 | Ga0495592_0000523 | |||
| 2239 | Ga0495592_0047127 | |||
| 2240 | Ga0495592_0078356 | |||
| 2241 | Ga0495592_0108893 | |||
| 2242 | Ga0495592_0138027 | |||
| 2243 | Ga0495629_0008073 | |||
| 2244 | Ga0495629_0043738 | |||
| 2245 | Ga0495629_0060229 | |||
| 2246 | Ga0495629_0604591 | |||
| 2247 | Ga0495641_0065653 | |||
| 2248 | Ga0495651_0000015 | |||
| 2249 | Ga0495651_0001165 | |||
| 2250 | Ga0495651_0004771 | |||
| 2251 | Ga0495651_0052415 | |||
| 2252 | Ga0495651_0072130 | |||
| 2253 | Ga0495651_0078871 | |||
| 2254 | Ga0495651_0369516 | |||
| 2255 | Ga0495651_0673918 | |||
| 2256 | Ga0495651_0888577 | |||
| 2257 | Ga0495653_0002364 | |||
| 2258 | Ga0495653_0032581 | |||
| 2259 | Ga0495653_0063119 | |||
| 2260 | Ga0495653_0081544 | |||
| 2261 | Ga0495653_0085195 | |||
| 2262 | Ga0495653_0098480 | |||
| 2263 | Ga0495653_0793210 | |||
| 2264 | Ga0495580_0048917 | |||
| 2265 | Ga0495582_0017459 | |||
| 2266 | Ga0495582_0046415 | |||
| 2267 | Ga0495582_0096027 | |||
| 2268 | Ga0495639_0042215 | |||
| 2269 | Ga0495639_0089477 | |||
| 2270 | Ga0495639_0306543 | |||
| 2271 | Ga0495662_0000284 | |||
| 2272 | Ga0495662_0010843 | |||
| 2273 | Ga0495662_0090867 | |||
| 2274 | Ga0495662_0167692 | |||
| 2275 | Ga0495664_0002113 | |||
| 2276 | Ga0495664_0044660 | |||
| 2277 | Ga0495664_0070353 | |||
| 2278 | Ga0495664_0093077 | |||
| 2279 | Ga0495664_0109117 | |||
| 2280 | Ga0495664_0141809 | |||
| 2281 | Ga0495664_0200455 | |||
| 2282 | Ga0495594_0030177 | |||
| 2283 | Ga0495606_0001817 | |||
| 2284 | Ga0495608_0000468 | |||
| 2285 | Ga0495608_0000479 | |||
| 2286 | Ga0495608_0001967 | |||
| 2287 | Ga0495608_0040333 | |||
| 2288 | Ga0495608_0134064 | |||
| 2289 | Ga0495608_0242349 | |||
| 2290 | Ga0495618_0042843 | |||
| 2291 | Ga0495618_0101977 | |||
| 2292 | Ga0495618_0114829 | |||
| 2293 | Ga0495618_0160048 | |||
| 2294 | Ga0495618_0717185 | |||
| 2295 | Ga0495628_0000240 | |||
| 2296 | Ga0495628_0099618 | |||
| 2297 | Ga0495628_0108077 | |||
| 2298 | Ga0495628_0281087 | |||
| 2299 | Ga0495628_0442640 | |||
| 2300 | Ga0495628_0446630 | |||
| 2301 | Ga0495628_0579258 | |||
| 2302 | Ga0495628_1081472 | |||
| 2303 | Ga0495628_1210952 | |||
| 2304 | Ga0495630_0021401 | |||
| 2305 | Ga0495630_0105860 | |||
| 2306 | Ga0495630_0258767 | |||
| 2307 | Ga0495630_0287670 | |||
| 2308 | Ga0495630_0466692 | |||
| 2309 | Ga0495630_1398433 | |||
| 2310 | Ga0495632_0011770 | |||
| 2311 | Ga0495632_0037493 | |||
| 2312 | Ga0495666_0066637 | |||
| 2313 | Ga0495652_0000044 | |||
| 2314 | Ga0495652_0001965 | |||
| 2315 | Ga0495652_0105008 | |||
| 2316 | Ga0495652_0258526 | |||
| 2317 | Ga0495652_0430761 | |||
| 2318 | Ga0495652_0468695 | |||
| 2319 | Ga0495652_0785543 | |||
| 2320 | Ga0495652_1002449 | |||
| 2321 | Ga0495665_0002759 | |||
| 2322 | Ga0495665_0003349 | |||
| 2323 | Ga0495665_0072418 | |||
| 2324 | Ga0495665_0088226 | |||
| 2325 | Ga0495640_0007442 | |||
| 2326 | Ga0495640_0025022 | |||
| 2327 | Ga0495640_0075371 | |||
| 2328 | Ga0495640_0156354 | |||
| 2329 | Ga0495640_0178671 | |||
| 2330 | Ga0495640_0809730 | |||
| 2331 | Ga0495586_0005641 | |||
| 2332 | Ga0495586_0119417 | |||
| 2333 | Ga0495586_0202504 | |||
| 2334 | Ga0495586_0799812 | |||
| 2335 | Ga0495586_0888547 | |||
| 2336 | Ga0495587_0000480 | |||
| 2337 | Ga0495587_0012542 | |||
| 2338 | Ga0495587_0013195 | |||
| 2339 | Ga0495587_0045798 | |||
| 2340 | Ga0495587_0046886 | |||
| 2341 | Ga0495587_0078793 | |||
| 2342 | Ga0495587_0402611 | |||
| 2343 | Ga0495645_0001777 | |||
| 2344 | Ga0495645_0057400 | |||
| 2345 | Ga0495645_0064958 | |||
| 2346 | Ga0495645_0108633 | |||
| 2347 | Ga0495645_0134448 | |||
| 2348 | Ga0495645_0245513 | |||
| 2349 | Ga0495645_0269798 | |||
| 2350 | Ga0495645_0494553 | |||
| 2351 | Ga0495645_0609908 | |||
| 2352 | Ga0495622_0233600 | |||
| 2353 | Ga0495622_0453209 | |||
| 2354 | Ga0495667_0000404 | |||
| 2355 | Ga0495667_0004295 | |||
| 2356 | Ga0495667_0004370 | |||
| 2357 | Ga0495667_0010109 | |||
| 2358 | Ga0495667_0047816 | |||
| 2359 | Ga0495667_0077997 | |||
| 2360 | Ga0495668_0000828 | |||
| 2361 | Ga0495668_0746430 | |||
| 2362 | Ga0495634_0012933 | |||
| 2363 | Ga0495634_0023988 | |||
| 2364 | Ga0495634_0038380 | |||
| 2365 | Ga0495625_0001049 | |||
| 2366 | Ga0495635_0004526 | |||
| 2367 | Ga0495635_0011486 | |||
| 2368 | Ga0495635_0070785 | |||
| 2369 | Ga0495635_0364213 | |||
| 2370 | Ga0495635_0483682 | |||
| 2371 | Ga0495635_0574932 | |||
| 2372 | Ga0495635_0599846 | |||
| 2373 | Ga0495588_0174896 | |||
| 2374 | Ga0495657_0000030 | |||
| 2375 | Ga0495657_0001488 | |||
| 2376 | Ga0495657_0003565 | |||
| 2377 | Ga0495657_0016585 | |||
| 2378 | Ga0495657_0025762 | |||
| 2379 | Ga0495657_0073978 | |||
| 2380 | Ga0495599_0000771 | |||
| 2381 | Ga0495599_0015439 | |||
| 2382 | Ga0495599_0050276 | |||
| 2383 | Ga0495599_0066328 | |||
| 2384 | Ga0495599_0150498 | |||
| 2385 | Ga0495599_0255630 | |||
| 2386 | Ga0495623_0002193 | |||
| 2387 | Ga0495623_0011410 | |||
| 2388 | Ga0495623_0048091 | |||
| 2389 | Ga0495623_0188485 | |||
| 2390 | Ga0495623_0698649 | |||
| 2391 | Ga0495646_0022727 | |||
| 2392 | Ga0495646_0026728 | |||
| 2393 | Ga0495646_0035482 | |||
| 2394 | Ga0495646_0102944 | |||
| 2395 | Ga0495658_0048352 | |||
| 2396 | Ga0495613_0008225 | |||
| 2397 | Ga0495613_0076339 | |||
| 2398 | Ga0495613_0144561 | |||
| 2399 | Ga0495613_0194005 | |||
| 2400 | Ga0495613_0394121 | |||
| 2401 | Ga0495613_0496700 | |||
| 2402 | Ga0495624_0145712 | |||
| 2403 | Ga0495624_0314944 | |||
| 2404 | Ga0495624_0338410 | |||
| 2405 | Ga0495624_0351573 | |||
| 2406 | Ga0495624_0365577 | |||
| 2407 | Ga0495624_0487878 | |||
| 2408 | Ga0495649_0361974 | |||
| 2409 | Ga0495600_0004854 | |||
| 2410 | Ga0495600_0046994 | |||
| 2411 | Ga0495600_0060637 | |||
| 2412 | Ga0495600_0204615 | |||
| 2413 | Ga0495600_0208378 | |||
| 2414 | Ga0495600_0423936 | |||
| 2415 | Ga0495581_0021493 | |||
| 2416 | Ga0495581_0022179 | |||
| 2417 | Ga0495581_0207983 | |||
| 2418 | Ga0495604_0000726 | |||
| 2419 | Ga0495604_0001997 | |||
| 2420 | Ga0495604_0066152 | |||
| 2421 | Ga0495604_0066167 | |||
| 2422 | Ga0495604_0069257 | |||
| 2423 | Ga0495604_0102173 | |||
| 2424 | Ga0495604_0203787 | |||
| 2425 | Ga0495636_0521784 | |||
| 2426 | Ga0495674_0005608 | |||
| 2427 | Ga0495674_0018411 | |||
| 2428 | Ga0495674_0046272 | |||
| 2429 | Ga0495674_0131381 | |||
| 2430 | Ga0495674_0141183 | |||
| 2431 | Ga0495674_0143889 | |||
| 2432 | Ga0495674_0173144 | |||
| 2433 | Ga0495674_0810656 | |||
| 2434 | Ga0495676_0089100 | |||
| 2435 | Ga0495676_0181027 | |||
| 2436 | Ga0495676_0222378 | |||
| 2437 | Ga0495676_0904004 | |||
| 2438 | Ga0495680_0002167 | |||
| 2439 | Ga0495680_0047604 | |||
| 2440 | Ga0495680_0085959 | |||
| 2441 | Ga0495680_0114753 | |||
| 2442 | Ga0495680_0116312 | |||
| 2443 | Ga0495680_0165720 | |||
| 2444 | Ga0495683_0073066 | |||
| 2445 | Ga0495687_158722 | |||
| 2446 | Ga0495675_0002225 | |||
| 2447 | Ga0495675_0002248 | |||
| 2448 | Ga0495675_0008897 | |||
| 2449 | Ga0495675_0009653 | |||
| 2450 | Ga0495675_0034922 | |||
| 2451 | Ga0495675_0322250 | |||
| 2452 | Ga0495675_0656626 | |||
| 2453 | Ga0495684_0046859 | |||
| 2454 | Ga0495684_0052322 | |||
| 2455 | Ga0495684_0058663 | |||
| 2456 | Ga0495684_0160591 | |||
| 2457 | Ga0495684_0306343 | |||
| 2458 | Ga0495684_0409190 | |||
| 2459 | Ga0495684_0533944 | |||
| 2460 | Ga0495593_0051176 | |||
| 2461 | Ga0495593_0146375 | |||
| 2462 | Ga0495593_0273158 | |||
| 2463 | Ga0495593_0312539 | |||
| 2464 | Ga0495602_0000973 | |||
| 2465 | Ga0495602_0033691 | |||
| 2466 | Ga0495602_0067865 | |||
| 2467 | Ga0495602_0136874 | |||
| 2468 | Ga0495602_0156864 | |||
| 2469 | Ga0495602_0256585 | |||
| 2470 | Ga0495602_1057778 | |||
| 2471 | Ga0495614_0012354 | |||
| 2472 | Ga0495614_0052674 | |||
| 2473 | Ga0495626_0000129 | |||
| 2474 | Ga0496100_0144972 | |||
| 2475 | Ga0496101_0085492 | |||
| 2476 | Ga0496102_0055998 | |||
| 2477 | Ga0496102_0074600 | |||
| 2478 | Ga0496102_0082888 | |||
| 2479 | Ga0496102_1622732 | |||
| 2480 | Ga0496103_0065291 | |||
| 2481 | Ga0496103_0408747 | |||
| 2482 | Ga0496103_0596065 | |||
| 2483 | Ga0496104_0000414 | |||
| 2484 | Ga0496104_0082301 | |||
| 2485 | Ga0496104_0144963 | |||
| 2486 | Ga0496105_0007787 | |||
| 2487 | Ga0496105_0104627 | |||
| 2488 | Ga0496105_0518731 | |||
| 2489 | Ga0496106_0918867 | |||
| 2490 | Ga0496106_1104034 | |||
| 2491 | Ga0496106_1332056 | |||
| 2492 | Ga0496107_0235987 | |||
| 2493 | Ga0496107_0273011 | |||
| 2494 | Ga0496107_0727532 | |||
| 2495 | Ga0496108_0000048 | |||
| 2496 | Ga0496108_0045957 | |||
| 2497 | Ga0496108_0198795 | |||
| 2498 | Ga0496109_0110811 | |||
| 2499 | Ga0496109_0207911 | |||
| 2500 | Ga0496109_0286849 | |||
| 2501 | Ga0496109_1347613 | |||
| 2502 | Ga0496109_1810241 | |||
| 2503 | Ga0496110_0117451 | |||
| 2504 | Ga0496110_0433756 | |||
| 2505 | Ga0496110_1475921 | |||
| 2506 | Ga0496111_0842161 | |||
| 2507 | Ga0496111_0857772 | |||
| 2508 | Ga0496111_0938096 | |||
| 2509 | Ga0496112_0000596 | |||
| 2510 | Ga0496112_0084551 | |||
| 2511 | Ga0496112_0189572 | |||
| 2512 | Ga0496112_0224263 | |||
| 2513 | Ga0496112_0368641 | |||
| 2514 | Ga0496112_0766103 | |||
| 2515 | Ga0496112_1174697 | |||
| 2516 | Ga0496113_0002740 | |||
| 2517 | Ga0496113_0111148 | |||
| 2518 | Ga0496113_0174879 | |||
| 2519 | Ga0496113_0362740 | |||
| 2520 | Ga0496113_0555702 | |||
| 2521 | Ga0496114_0221247 | |||
| 2522 | Ga0496114_0742514 | |||
| 2523 | Ga0496115_0018404 | |||
| 2524 | Ga0496115_0131057 | |||
| 2525 | Ga0496115_0608248 | |||
| 2526 | Ga0496115_0613648 | |||
| 2527 | Ga0496115_0772859 | |||
| 2528 | Ga0496119_0118301 | |||
| 2529 | Ga0496120_0349067 | |||
| 2530 | Ga0496121_0029885 | |||
| 2531 | Ga0496121_0146270 | |||
| 2532 | Ga0496125_0523936 | |||
| 2533 | Ga0496126_0000006 | |||
| 2534 | Ga0496126_0062845 | |||
| 2535 | Ga0496126_0091910 | |||
| 2536 | Ga0496126_0157059 | |||
| 2537 | Ga0496126_0799361 | |||
| 2538 | Ga0496126_1288642 | |||
| 2539 | Ga0501306_011107 | |||
| 2540 | Ga0501306_029189 | |||
| 2541 | Ga0501308_080298 | |||
| 2542 | Ga0501309_018349 | |||
| 2543 | Ga0501305_031356 | |||
| 2544 | Ga0501307_021961 | |||
| 2545 | Ga0501307_077563 | |||
| 2546 | Ga0501311_006389 | |||
| 2547 | Ga0501311_047856 | |||
| 2548 | Ga0501316_006060 | |||
| 2549 | Ga0501316_012254 | |||
| 2550 | Ga0501317_002825 | |||
| 2551 | Ga0501317_036426 | |||
| 2552 | Ga0501318_001814 | |||
| 2553 | Ga0501318_008287 | |||
| 2554 | Ga0501320_006475 | |||
| 2555 | Ga0501320_030349 | |||
| 2556 | Ga0501321_071856 | |||
| 2557 | Ga0501322_010990 | |||
| 2558 | Ga0501323_002812 | |||
| 2559 | Ga0501323_029569 | |||
| 2560 | Ga0501325_003904 | |||
| 2561 | Ga0501031_0141683 | |||
| 2562 | Ga0501032_0166115 | |||
| 2563 | Ga0501033_0124328 | |||
| 2564 | Ga0501034_0239029 | |||
| 2565 | Ga0501036_0306563 | |||
| 2566 | Ga0501037_0015433 | |||
| 2567 | Ga0501038_0044915 | |||
| 2568 | Ga0501039_0014058 | |||
| 2569 | Ga0501039_1133581 | |||
| 2570 | Ga0501043_0117362 | |||
| 2571 | Ga0501046_0019700 | |||
| 2572 | Ga0501047_0017930 | |||
| 2573 | Ga0501047_1360530 | |||
| 2574 | Ga0501048_0315443 | |||
| 2575 | Ga0501069_0267779 | |||
| 2576 | Ga0501072_0722698 | |||
| 2577 | Ga0501074_0143211 | |||
| 2578 | Ga0501080_0542373 | |||
| 2579 | Ga0501270_134122 | |||
| 2580 | Ga0501035_0131656 | |||
| 2581 | Ga0501044_0194913 | |||
| 2582 | Ga0501044_0414246 | |||
| 2583 | nmdc:mga03n38_96710_c1 | |||
| 2584 | nmdc:mga00v17_203983_c1 | |||
| 2585 | nmdc:mga00v17_227557_c1 | |||
| 2586 | nmdc:mga05p37_1883746_c1 | |||
| 2587 | nmdc:mga05p37_193252_c1 | |||
| 2588 | nmdc:mga05p37_3761_c1 | |||
| 2589 | nmdc:mga09592_1270461_c1 | |||
| 2590 | nmdc:mga0qj67_181757_c1 | |||
| 2591 | nmdc:mga0qj67_532056_c1 | |||
| 2592 | nmdc:mga0qj67_574260_c1 | |||
| 2593 | nmdc:mga0qj67_669700_c1 | |||
| 2594 | nmdc:mga0qj67_756218_c1 | |||
| 2595 | nmdc:mga06r32_1042206_c1 | |||
| 2596 | nmdc:mga06r32_358355_c1 | |||
| 2597 | nmdc:mga06r32_673191_c1 | |||
| 2598 | nmdc:mga08y16_16801_c1 | |||
| 2599 | nmdc:mga08y16_2184587_c1 | |||
| 2600 | nmdc:mga0n895_1553132_c1 | |||
| 2601 | nmdc:mga0n895_15902_c1 | |||
| 2602 | nmdc:mga0rr50_12258_c1 | |||
| 2603 | nmdc:mga08x19_292776_c1 | |||
| 2604 | nmdc:mga08x19_951733_c1 | |||
| 2605 | nmdc:mga0a205_19224_c1 | |||
| 2606 | nmdc:mga0a205_530497_c1 | |||
| 2607 | nmdc:mga0sz30_92942_c1 | |||
| 2608 | Ga0495601_0043789 | |||
| 2609 | Ga0495601_0121933 | |||
| 2610 | Ga0495601_0222997 | |||
| 2611 | Ga0495601_0398758 | |||
| 2612 | Ga0495601_0647050 | |||
| 2613 | Ga0495612_0004276 | |||
| 2614 | Ga0495612_0013342 | |||
| 2615 | Ga0495612_0446661 | |||
| 2616 | Ga0495655_0148629 | |||
| 2617 | Ga0495595_0000864 | |||
| 2618 | Ga0495595_0012168 | |||
| 2619 | Ga0495595_0022322 | |||
| 2620 | Ga0495595_0057337 | |||
| 2621 | Ga0495595_0728299 | |||
| 2622 | Ga0495619_0020221 | |||
| 2623 | Ga0495619_0061608 | |||
| 2624 | Ga0495619_0127116 | |||
| 2625 | Ga0495619_1205216 | |||
| 2626 | Ga0500643_010499 | |||
| 2627 | Ga0500651_0068220 | |||
| 2628 | Ga0500650_0020934 | |||
| 2629 | Ga0500650_0175108 | |||
| 2630 | Ga0500562_065470 | |||
| 2631 | Ga0500594_0215454 | |||
| 2632 | Ga0500594_0322973 | |||
| 2633 | Ga0500621_099084 | |||
| 2634 | Ga0500573_0182803 | |||
| 2635 | Ga0500577_0426392 | |||
| 2636 | Ga0500579_094498 | |||
| 2637 | Ga0500600_0162036 | |||
| 2638 | Ga0500630_115641 | |||
| 2639 | Ga0501084_0810902 | |||
| 2640 | Ga0590075_070474 | |||
| 2641 | Ga0587067_111827 | |||
| 2642 | Ga0530510_0249379 | |||
| 2643 | 2515496029 | |||
| 2644 | 2515719800 | |||
| 2645 | 2515757867 | |||
| 2646 | 2516090293 | |||
| 2647 | 2753264716 | |||
| 2648 | 2861520641 | |||
| 2649 | 2887482830 | |||
| 2650 | 8001781895 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8crx-assembly1.cif.gz_G | cutibacterium acnes 70s ribosome with mrna, p-site trna and sarecycline bound | 0.8129 | 2 | 74 |
| 5iqr-assembly1.cif.gz_h | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.8081 | 2 | 74 |
| 7n1p-assembly1.cif.gz_SC | elongating 70s ribosome complex in a classical pre-translocation (pre-c) conformation | 0.7925 | 2 | 74 |
| 7zag-assembly1.cif.gz_Z | cryo-em structure of a pyrococcus abyssi 30s bound to met-initiator trna,mrna, aif1a and the c-terminal domain of aif5b. | 0.7899 | 2 | 74 |
| 6zj3-assembly1.cif.gz_SC | cryo-em structure of the highly atypical cytoplasmic ribosome of euglena gracilis | 0.7799 | 2 | 74 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WFM7_9_77_3.30.300.20 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9826 | 7 | 74 | 3.30.300.20 |
| af_P9WFM7_9_77_3.30.300.20 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.955 | 7 | 74 | 3.30.300.20 |
| af_P0AFF6_278_343_3.30.300.20 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.781 | 1 | 77 | 3.30.300.20 |
| 2cy1A02 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.7781 | 1 | 73 | 3.30.300.20 |
| 5xxuD01 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.7748 | 2 | 74 | 3.30.300.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6N7GEQ5-F1-model_v4 | RNA-binding protein KhpA (KH-domain protein A) | 0.9947 | 2 | 74 |
GO:0003723
GO:0005737 |
| AF-A0A7X6NU24-F1-model_v4 | RNA-binding protein | 0.9727 | 1 | 60 |
GO:0003723
|
| AF-A0A523RLL8-F1-model_v4 | KH domain-containing protein | 0.9615 | 1 | 74 |
GO:0003723
|
| AF-A0A3A4U8U8-F1-model_v4 | RNA-binding protein KhpA (KH-domain protein A) | 0.9612 | 1 | 74 |
GO:0003723
GO:0005737 GO:0008360 GO:0009252 GO:0071555 |
| AF-A0A562VAG7-F1-model_v4 | RNA-binding protein KhpA (KH-domain protein A) | 0.9578 | 1 | 74 |
GO:0003723
GO:0005737 |