F493025

General Info

Members Datasets Scaffolds Average Seq Length
1325 468 2650 82

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10597365|Ga0070676_105973652
Length 93
Sequence VPAPTRRAEPASARRSDVLRPALEHLVKGIVHNPDDVRVRMIDSRRGQRLEVRVHPDDLGTVIGRGGRTAKALRQVIGSIGGRGVRVDIMDSY

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
81 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
82 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
83 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
92 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
93 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
94 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
95 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
115 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
116 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
117 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
118 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
119 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
126 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300019179 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300019183 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300019190 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300019192 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300023559 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
144 3300023563 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
145 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
205 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
209 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
210 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
211 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
212 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
213 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
214 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
215 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
216 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
217 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
218 3300031592 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
219 3300031614 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
220 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
221 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
222 3300031686 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
223 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
224 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
225 3300031810 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
226 3300031815 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
227 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
228 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
229 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
230 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
231 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
232 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
233 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
234 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
235 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
236 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
237 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
238 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
239 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
240 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
241 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
242 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
243 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
244 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
245 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
246 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
247 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
248 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
249 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
250 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
251 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
252 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
253 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
254 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
255 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
256 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
257 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
258 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
259 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
260 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
261 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
262 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
263 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
264 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
265 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
266 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
267 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
268 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
269 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
270 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
271 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
272 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
273 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
274 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
275 3300036242 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
276 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
277 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
279 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
280 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
281 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
282 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
283 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
284 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
285 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
286 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
287 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
288 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
289 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
290 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
291 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
292 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
293 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
294 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
295 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
296 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
297 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
298 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
299 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
300 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
301 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
302 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
303 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
304 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
305 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
306 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
307 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
308 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
309 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
310 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
311 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
312 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
313 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
314 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
315 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
316 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
317 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
318 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
319 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
320 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
321 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
322 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
323 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
324 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
325 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
326 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
327 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
328 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
329 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
330 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
331 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
332 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
333 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
334 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
335 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
336 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
337 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
338 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
339 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
340 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
341 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
342 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
343 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
344 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
345 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
346 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
347 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
348 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
349 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
350 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
351 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
352 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
353 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
354 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
355 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
356 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
357 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
358 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
359 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
360 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
361 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
362 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
363 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
364 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
365 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
366 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
367 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
368 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
369 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
370 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
371 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
372 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
373 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
374 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
375 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
376 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
377 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
378 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
379 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
380 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
381 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
382 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
383 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
384 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
385 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
386 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
387 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
388 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
389 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
390 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
391 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
392 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
393 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
394 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
395 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
396 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
408 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
409 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
410 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
411 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
412 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
413 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
414 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
415 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
416 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
417 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
418 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
419 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
420 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
421 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
422 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
423 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
424 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
425 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
426 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
427 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
428 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
429 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
430 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
431 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
432 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
433 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
434 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
435 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
436 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
437 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
438 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
439 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
440 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
441 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
442 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
443 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
444 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
445 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
446 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
447 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
448 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
449 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
450 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
451 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
452 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
453 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
454 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
455 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
456 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
457 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
458 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
459 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
460 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
461 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
462 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
463 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
464 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
465 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
466 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
467 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
468 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.21
Metatranscriptomes 6.19
Isolates 0.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.81
Nodule 0
Rhizoplane 4.83
Rhizosphere 87.47
Stem 0
Stem Tuber 0
Unclassified 1.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10597365 3300005328 Bacteria 795
2 JGI24735J21928_10094755 3300002067 Bacteria 856
3 JGI25406J46586_10248285 3300003203 Bacteria 523
4 rootL2_10152190 3300003322 Bacteria 1252
5 rootL2_10152199 3300003322 Bacteria 1618
6 Ga0058863_11912449 3300004799 Bacteria 827
7 Ga0058860_11883144 3300004801 Bacteria 569
8 Ga0070658_10741959 3300005327 Bacteria 853
9 Ga0070683_100271352 3300005329 Bacteria 1613
10 Ga0070683_100480301 3300005329 Bacteria 1187
11 Ga0070683_100979790 3300005329 Bacteria 811
12 Ga0070683_101566460 3300005329 Bacteria 633
13 Ga0070683_102025771 3300005329 Bacteria 553
14 Ga0070670_101393942 3300005331 Bacteria 642
15 Ga0070677_10679785 3300005333 Bacteria 578
16 Ga0068869_100002087 3300005334 Bacteria 12015
17 Ga0068869_100055256 3300005334 Bacteria 2893
18 Ga0068869_100434613 3300005334 Bacteria 1085
19 Ga0068869_100730136 3300005334 Bacteria 847
20 Ga0068869_101302088 3300005334 Bacteria 641
21 Ga0070666_11203018 3300005335 Bacteria 564
22 Ga0070680_100006507 3300005336 Bacteria 8884
23 Ga0070680_100178674 3300005336 Bacteria 1787
24 Ga0070680_100297789 3300005336 Bacteria 1368
25 Ga0070680_100392404 3300005336 Bacteria 1182
26 Ga0070682_100435295 3300005337 Bacteria 1001
27 Ga0070682_100679787 3300005337 Bacteria 823
28 Ga0070682_101206361 3300005337 Bacteria 639
29 Ga0068868_100029329 3300005338 Bacteria 4212
30 Ga0068868_100346421 3300005338 Bacteria 1272
31 Ga0068868_101676659 3300005338 Bacteria 599
32 Ga0070660_100220960 3300005339 Bacteria 1540
33 Ga0070660_100282278 3300005339 Bacteria 1359
34 Ga0070660_101045355 3300005339 Bacteria 690
35 Ga0070689_101713214 3300005340 Bacteria 572
36 Ga0070689_102221641 3300005340 Bacteria 503
37 Ga0070691_10032956 3300005341 Bacteria 2436
38 Ga0070691_10853827 3300005341 Bacteria 558
39 Ga0070687_100761532 3300005343 Bacteria 682
40 Ga0070687_101089870 3300005343 Bacteria 584
41 Ga0070661_100048109 3300005344 Bacteria 3121
42 Ga0070661_100114537 3300005344 Bacteria 2016
43 Ga0070661_100554227 3300005344 Bacteria 925
44 Ga0070661_100920142 3300005344 Bacteria 722
45 Ga0070661_101718839 3300005344 Bacteria 532
46 Ga0070692_10245196 3300005345 Bacteria 1070
47 Ga0070692_10277039 3300005345 Bacteria 1015
48 Ga0070692_11310856 3300005345 Bacteria 520
49 Ga0070668_100003831 3300005347 Bacteria 11117
50 Ga0070668_101426534 3300005347 Bacteria 632
51 Ga0070668_101870598 3300005347 Bacteria 552
52 Ga0070669_100425383 3300005353 Bacteria 1091
53 Ga0070675_100016825 3300005354 Bacteria 5806
54 Ga0070675_100623215 3300005354 Bacteria 979
55 Ga0070671_100437108 3300005355 Bacteria 1121
56 Ga0070673_100719130 3300005364 Bacteria 918
57 Ga0070688_101589281 3300005365 Bacteria 534
58 Ga0070659_100015201 3300005366 Bacteria 5760
59 Ga0070659_101460572 3300005366 Bacteria 609
60 Ga0070667_100019814 3300005367 Bacteria 5581
61 Ga0070667_100148807 3300005367 Bacteria 2055
62 Ga0070709_10198336 3300005434 Bacteria 1420
63 Ga0070709_10232602 3300005434 Bacteria 1319
64 Ga0070709_11312064 3300005434 Bacteria 584
65 Ga0070709_11572381 3300005434 Bacteria 535
66 Ga0070714_100002405 3300005435 Bacteria 13788
67 Ga0070714_100006462 3300005435 Bacteria 9055
68 Ga0070714_100132470 3300005435 Bacteria 2229
69 Ga0070714_100222719 3300005435 Bacteria 1734
70 Ga0070714_100391412 3300005435 Bacteria 1312
71 Ga0070714_100748413 3300005435 Bacteria 945
72 Ga0070714_100913869 3300005435 Unclassified 852
73 Ga0070714_100914862 3300005435 Bacteria 852
74 Ga0070714_101249829 3300005435 Bacteria 725
75 Ga0070713_100002390 3300005436 Bacteria 12241
76 Ga0070713_100018875 3300005436 Bacteria 5250
77 Ga0070713_100028043 3300005436 Bacteria 4442
78 Ga0070713_100109081 3300005436 Bacteria 2411
79 Ga0070713_100157524 3300005436 Bacteria 2025
80 Ga0070713_100358319 3300005436 Bacteria 1355
81 Ga0070713_100473658 3300005436 Bacteria 1179
82 Ga0070713_100698315 3300005436 Bacteria 968
83 Ga0070713_100946503 3300005436 Bacteria 829
84 Ga0070713_101228130 3300005436 Bacteria 726
85 Ga0070713_102420893 3300005436 Bacteria 508
86 Ga0070710_10073330 3300005437 Bacteria 1979
87 Ga0070710_10205934 3300005437 Bacteria 1244
88 Ga0070710_10317961 3300005437 Bacteria 1021
89 Ga0070710_10786716 3300005437 Bacteria 678
90 Ga0070710_10856629 3300005437 Bacteria 653
91 Ga0070710_11158324 3300005437 Bacteria 570
92 Ga0070711_100053069 3300005439 Bacteria 2792
93 Ga0070711_100082805 3300005439 Bacteria 2291
94 Ga0070711_100189420 3300005439 Bacteria 1580
95 Ga0070711_100194919 3300005439 Bacteria 1559
96 Ga0070711_100436528 3300005439 Bacteria 1070
97 Ga0070705_101162905 3300005440 Bacteria 634
98 Ga0070705_101460768 3300005440 Bacteria 572
99 Ga0070705_101700117 3300005440 Unclassified 533
100 Ga0070700_100068017 3300005441 Bacteria 2264
101 Ga0070700_100991827 3300005441 Bacteria 690
102 Ga0070694_101344423 3300005444 Bacteria 602
103 Ga0070708_100070053 3300005445 Bacteria 3155
104 Ga0070663_100132001 3300005455 Bacteria 1898
105 Ga0070663_100171938 3300005455 Bacteria 1675
106 Ga0070663_100304457 3300005455 Bacteria 1277
107 Ga0070663_100357173 3300005455 Bacteria 1184
108 Ga0070663_100379023 3300005455 Bacteria 1152
109 Ga0070663_100583286 3300005455 Bacteria 938
110 Ga0070678_100063568 3300005456 Bacteria 2732
111 Ga0070678_100739580 3300005456 Bacteria 889
112 Ga0070678_102104182 3300005456 Bacteria 535
113 Ga0070662_100344135 3300005457 Bacteria 1220
114 Ga0070662_101727280 3300005457 Bacteria 540
115 Ga0070681_10000046 3300005458 Bacteria 84043
116 Ga0070681_10122362 3300005458 Bacteria 2535
117 Ga0070681_10574122 3300005458 Bacteria 1041
118 Ga0070681_10809468 3300005458 Bacteria 854
119 Ga0070681_10962034 3300005458 Unclassified 773
120 Ga0068867_100098091 3300005459 Bacteria 2234
121 Ga0070685_10761885 3300005466 Bacteria 711
122 Ga0070706_100001132 3300005467 Bacteria 28817
123 Ga0070706_100523857 3300005467 Bacteria 1103
124 Ga0070707_100906411 3300005468 Bacteria 846
125 Ga0070707_100925546 3300005468 Bacteria 836
126 Ga0070707_101295655 3300005468 Bacteria 695
127 Ga0070698_100114679 3300005471 Bacteria 2659
128 Ga0070699_101518641 3300005518 Bacteria 614
129 Ga0070679_100001357 3300005530 Bacteria 21606
130 Ga0070679_100022895 3300005530 Bacteria 6110
131 Ga0070679_100181873 3300005530 Bacteria 2074
132 Ga0070679_100210065 3300005530 Bacteria 1910
133 Ga0070679_100419985 3300005530 Bacteria 1283
134 Ga0070679_100940056 3300005530 Bacteria 808
135 Ga0070679_101727370 3300005530 Bacteria 574
136 Ga0070679_102164542 3300005530 Bacteria 506
137 Ga0070684_100049491 3300005535 Bacteria 3647
138 Ga0070684_100131673 3300005535 Bacteria 2256
139 Ga0070684_100264811 3300005535 Bacteria 1573
140 Ga0070684_100486982 3300005535 Bacteria 1142
141 Ga0070684_100691945 3300005535 Bacteria 950
142 Ga0070684_100755196 3300005535 Bacteria 908
143 Ga0070684_102320110 3300005535 Unclassified 506
144 Ga0070697_100543948 3300005536 Bacteria 1018
145 Ga0070697_101478412 3300005536 Bacteria 607
146 Ga0068853_102079686 3300005539 Bacteria 551
147 Ga0070672_100345392 3300005543 Bacteria 1268
148 Ga0070672_100656040 3300005543 Bacteria 917
149 Ga0070686_101934728 3300005544 Bacteria 504
150 Ga0070695_100196184 3300005545 Bacteria 1440
151 Ga0070696_100052817 3300005546 Bacteria 2828
152 Ga0070693_100629895 3300005547 Bacteria 778
153 Ga0070693_100911016 3300005547 Bacteria 659
154 Ga0070665_100394988 3300005548 Bacteria 1391
155 Ga0070665_100495817 3300005548 Bacteria 1232
156 Ga0070665_100578220 3300005548 Bacteria 1136
157 Ga0070665_100632856 3300005548 Bacteria 1083
158 Ga0070665_100880729 3300005548 Bacteria 908
159 Ga0070665_101801442 3300005548 Bacteria 619
160 Ga0070704_100627673 3300005549 Bacteria 947
161 Ga0068855_100035979 3300005563 Bacteria 5896
162 Ga0070664_100003346 3300005564 Bacteria 12959
163 Ga0070664_100100342 3300005564 Bacteria 2517
164 Ga0070664_100346276 3300005564 Bacteria 1351
165 Ga0070664_100454415 3300005564 Bacteria 1176
166 Ga0070664_100592347 3300005564 Bacteria 1028
167 Ga0070664_100691719 3300005564 Bacteria 949
168 Ga0068857_100064208 3300005577 Bacteria 3264
169 Ga0068857_100064422 3300005577 Bacteria 3259
170 Ga0068857_100104273 3300005577 Bacteria 2546
171 Ga0068857_100120725 3300005577 Bacteria 2359
172 Ga0068857_100476187 3300005577 Bacteria 1170
173 Ga0068857_100656329 3300005577 Bacteria 994
174 Ga0068857_101007555 3300005577 Bacteria 802
175 Ga0068857_101738368 3300005577 Bacteria 610
176 Ga0068854_100046027 3300005578 Bacteria 3105
177 Ga0068856_100179641 3300005614 Bacteria 2129
178 Ga0068856_100420416 3300005614 Bacteria 1356
179 Ga0068856_100556725 3300005614 Bacteria 1168
180 Ga0068856_100674204 3300005614 Bacteria 1054
181 Ga0068856_101052404 3300005614 Bacteria 832
182 Ga0068852_100126393 3300005616 Bacteria 2348
183 Ga0068852_101270622 3300005616 Bacteria 758
184 Ga0068852_101815648 3300005616 Bacteria 632
185 Ga0068852_102319155 3300005616 Bacteria 558
186 Ga0068859_100471691 3300005617 Bacteria 1350
187 Ga0068859_103053840 3300005617 Bacteria 511
188 Ga0068864_100164539 3300005618 Bacteria 2019
189 Ga0068864_100505344 3300005618 Bacteria 1163
190 Ga0068864_100647361 3300005618 Bacteria 1029
191 Ga0068864_101267194 3300005618 Bacteria 737
192 Ga0068864_101267938 3300005618 Bacteria 737
193 Ga0068866_10364926 3300005718 Bacteria 922
194 Ga0068861_100152280 3300005719 Bacteria 1899
195 Ga0068861_100478272 3300005719 Bacteria 1122
196 Ga0068861_100968215 3300005719 Bacteria 810
197 Ga0068861_102279178 3300005719 Bacteria 543
198 Ga0068851_10833452 3300005834 Bacteria 575
199 Ga0068851_10919132 3300005834 Bacteria 549
200 Ga0068870_10196721 3300005840 Bacteria 1220
201 Ga0068870_11380036 3300005840 Bacteria 516
202 Ga0068863_100112032 3300005841 Bacteria 2599
203 Ga0068863_100295179 3300005841 Bacteria 1571
204 Ga0068863_100398559 3300005841 Bacteria 1346
205 Ga0068863_100438704 3300005841 Bacteria 1280
206 Ga0068863_101175857 3300005841 Bacteria 772
207 Ga0068858_100000003 3300005842 Bacteria 349151
208 Ga0068858_100400596 3300005842 Bacteria 1318
209 Ga0068860_100351412 3300005843 Bacteria 1451
210 Ga0068860_100417467 3300005843 Bacteria 1329
211 Ga0068862_100319573 3300005844 Bacteria 1432
212 Ga0068862_101461276 3300005844 Bacteria 688
213 Ga0081455_10193072 3300005937 Bacteria 1531
214 Ga0081540_1006417 3300005983 Bacteria 8562
215 Ga0081540_1008507 3300005983 Bacteria 7163
216 Ga0081540_1168961 3300005983 Bacteria 836
217 Ga0081539_10000357 3300005985 Bacteria 100714
218 Ga0081539_10000613 3300005985 Bacteria 72150
219 Ga0081539_10001106 3300005985 Bacteria 48943
220 Ga0081539_10021053 3300005985 Bacteria 4374
221 Ga0081539_10050261 3300005985 Bacteria 2360
222 Ga0081539_10210315 3300005985 Bacteria 892
223 Ga0070717_10086914 3300006028 Bacteria 2632
224 Ga0070717_10117948 3300006028 Bacteria 2270
225 Ga0070717_10155742 3300006028 Bacteria 1979
226 Ga0070717_10190102 3300006028 Bacteria 1794
227 Ga0070717_10410061 3300006028 Bacteria 1218
228 Ga0070717_10473276 3300006028 Bacteria 1131
229 Ga0070717_10535337 3300006028 Bacteria 1060
230 Ga0070717_10628381 3300006028 Bacteria 974
231 Ga0070717_10629366 3300006028 Bacteria 974
232 Ga0070717_11406333 3300006028 Bacteria 633
233 Ga0075365_10840437 3300006038 Bacteria 648
234 Ga0075368_10346759 3300006042 Bacteria 646
235 Ga0075363_101029883 3300006048 Bacteria 508
236 Ga0075364_10132326 3300006051 Bacteria 1675
237 Ga0075364_10241111 3300006051 Bacteria 1228
238 Ga0075364_10953457 3300006051 Bacteria 584
239 Ga0070715_10012535 3300006163 Bacteria 3089
240 Ga0070715_10261568 3300006163 Bacteria 909
241 Ga0070715_10337616 3300006163 Bacteria 818
242 Ga0070715_10849165 3300006163 Unclassified 558
243 Ga0070716_100017617 3300006173 Bacteria 3707
244 Ga0070716_100037270 3300006173 Bacteria 2686
245 Ga0070716_100111375 3300006173 Bacteria 1697
246 Ga0070716_100206357 3300006173 Bacteria 1310
247 Ga0070716_100263060 3300006173 Bacteria 1181
248 Ga0070716_101131958 3300006173 Bacteria 626
249 Ga0070712_100001139 3300006175 Bacteria 16030
250 Ga0070712_100062698 3300006175 Bacteria 2629
251 Ga0070712_100260665 3300006175 Bacteria 1389
252 Ga0070712_100970943 3300006175 Bacteria 734
253 Ga0070712_101211530 3300006175 Bacteria 657
254 Ga0070712_101580585 3300006175 Bacteria 573
255 Ga0070712_101957197 3300006175 Bacteria 513
256 Ga0075367_10247009 3300006178 Bacteria 1119
257 Ga0097621_100520562 3300006237 Bacteria 1079
258 Ga0097621_102335498 3300006237 Bacteria 512
259 Ga0068871_100730998 3300006358 Bacteria 909
260 Ga0068871_100904552 3300006358 Bacteria 818
261 Ga0068871_101836048 3300006358 Bacteria 576
262 Ga0068871_102262506 3300006358 Bacteria 518
263 Ga0075428_100131420 3300006844 Bacteria 2723
264 Ga0075428_100176977 3300006844 Bacteria 2310
265 Ga0075428_100749448 3300006844 Bacteria 1039
266 Ga0075430_100311890 3300006846 Bacteria 1301
267 Ga0075430_100811730 3300006846 Bacteria 771
268 Ga0075430_100821997 3300006846 Bacteria 766
269 Ga0075430_100825945 3300006846 Bacteria 764
270 Ga0075431_100110568 3300006847 Bacteria 2836
271 Ga0075431_100262982 3300006847 Bacteria 1750
272 Ga0075431_100602776 3300006847 Bacteria 1082
273 Ga0075431_101403375 3300006847 Bacteria 658
274 Ga0075433_10288283 3300006852 Bacteria 1454
275 Ga0075434_100639575 3300006871 Bacteria 1082
276 Ga0075434_101380961 3300006871 Bacteria 714
277 Ga0075434_102089693 3300006871 Bacteria 571
278 Ga0075429_101497486 3300006880 Bacteria 587
279 Ga0068865_100412981 3300006881 Bacteria 1108
280 Ga0097620_100471682 3300006931 Bacteria 1350
281 Ga0097620_103055042 3300006931 Bacteria 511
282 Ga0105250_10627908 3300009092 Bacteria 500
283 Ga0105240_11588746 3300009093 Bacteria 684
284 Ga0105240_11644620 3300009093 Bacteria 671
285 Ga0111539_10360375 3300009094 Bacteria 1692
286 Ga0111539_10434279 3300009094 Bacteria 1529
287 Ga0105245_10091725 3300009098 Bacteria 2796
288 Ga0105245_11264159 3300009098 Bacteria 787
289 Ga0105247_10000296 3300009101 Bacteria 44916
290 Ga0105247_10113467 3300009101 Bacteria 1747
291 Ga0105247_10534720 3300009101 Bacteria 859
292 Ga0105247_11340477 3300009101 Bacteria 576
293 Ga0114129_10000007 3300009147 Bacteria 156645
294 Ga0114129_10217549 3300009147 Bacteria 2579
295 Ga0114129_10328069 3300009147 Bacteria 2033
296 Ga0114129_10446493 3300009147 Bacteria 1697
297 Ga0114129_10861884 3300009147 Bacteria 1151
298 Ga0114129_12230636 3300009147 Bacteria 658
299 Ga0105243_10229803 3300009148 Bacteria 1645
300 Ga0105243_10578932 3300009148 Bacteria 1077
301 Ga0105241_10073255 3300009174 Bacteria 2664
302 Ga0105241_10349701 3300009174 Bacteria 1283
303 Ga0105242_13090940 3300009176 Bacteria 516
304 Ga0105248_10011254 3300009177 Bacteria 9867
305 Ga0105248_10091447 3300009177 Bacteria 3427
306 Ga0105248_10840973 3300009177 Bacteria 1036
307 Ga0105248_11241542 3300009177 Bacteria 843
308 Ga0105248_11669871 3300009177 Bacteria 722
309 Ga0105237_10579508 3300009545 Bacteria 1129
310 Ga0105237_10707778 3300009545 Bacteria 1014
311 Ga0105237_11472013 3300009545 Bacteria 687
312 Ga0105237_11977573 3300009545 Bacteria 591
313 Ga0105237_12623079 3300009545 Bacteria 515
314 Ga0105238_10658021 3300009551 Bacteria 1058
315 Ga0105238_11845463 3300009551 Bacteria 637
316 Ga0105249_11150985 3300009553 Bacteria 846
317 Ga0099796_10567381 3300010159 Bacteria 511
318 Ga0105239_10466237 3300010375 Bacteria 1434
319 Ga0105239_11445956 3300010375 Bacteria 794
320 Ga0105246_11274535 3300011119 Bacteria 680
321 Ga0105246_11389924 3300011119 Bacteria 654
322 Ga0105246_12246950 3300011119 Bacteria 532
323 Ga0157373_10534193 3300013100 Bacteria 849
324 Ga0157373_11344311 3300013100 Bacteria 542
325 Ga0157371_10390666 3300013102 Bacteria 1017
326 Ga0157370_10315645 3300013104 Bacteria 1442
327 Ga0157370_10762908 3300013104 Bacteria 881
328 Ga0157370_11754187 3300013104 Bacteria 557
329 Ga0157369_10008846 3300013105 Bacteria 11530
330 Ga0157369_10016406 3300013105 Bacteria 8330
331 Ga0157369_10158983 3300013105 Bacteria 2386
332 Ga0157369_10190000 3300013105 Bacteria 2158
333 Ga0157369_10282245 3300013105 Bacteria 1729
334 Ga0157369_10559482 3300013105 Bacteria 1182
335 Ga0157374_11395427 3300013296 Bacteria 723
336 Ga0157374_12050439 3300013296 Bacteria 599
337 Ga0157378_10533847 3300013297 Bacteria 1176
338 Ga0157378_11174705 3300013297 Bacteria 806
339 Ga0157378_13033200 3300013297 Bacteria 521
340 Ga0163162_10833368 3300013306 Bacteria 1038
341 Ga0157372_10000044 3300013307 Bacteria 152637
342 Ga0157372_10695067 3300013307 Bacteria 1184
343 Ga0157372_10726396 3300013307 Bacteria 1155
344 Ga0157372_11537878 3300013307 Bacteria 766
345 Ga0157372_11832187 3300013307 Bacteria 698
346 Ga0157372_12481291 3300013307 Bacteria 595
347 Ga0157372_12621532 3300013307 Bacteria 578
348 Ga0157375_10590344 3300013308 Bacteria 1270
349 Ga0157375_11217677 3300013308 Bacteria 883
350 Ga0157375_11285471 3300013308 Bacteria 860
351 Ga0163163_10134785 3300014325 Bacteria 2510
352 Ga0163163_10426728 3300014325 Bacteria 1385
353 Ga0163163_10933907 3300014325 Bacteria 931
354 Ga0163163_11719462 3300014325 Bacteria 688
355 Ga0163163_11830447 3300014325 Bacteria 667
356 Ga0163163_13202622 3300014325 Bacteria 510
357 Ga0157380_11461675 3300014326 Bacteria 736
358 Ga0157380_12275177 3300014326 Bacteria 606
359 Ga0182008_10804335 3300014497 Bacteria 546
360 Ga0157377_10286550 3300014745 Bacteria 1082
361 Ga0157377_10687599 3300014745 Bacteria 741
362 Ga0157377_10838470 3300014745 Bacteria 681
363 Ga0157379_10000999 3300014968 Bacteria 22965
364 Ga0157379_10346401 3300014968 Bacteria 1360
365 Ga0157379_12180640 3300014968 Bacteria 550
366 Ga0157379_12295691 3300014968 Bacteria 537
367 Ga0157376_10066563 3300014969 Bacteria 3045
368 Ga0157376_10852757 3300014969 Bacteria 926
369 Ga0163161_10742604 3300017792 Bacteria 820
370 Ga0184593_122585 3300019179 Bacteria 553
371 Ga0184601_119431 3300019183 Bacteria 511
372 Ga0184600_119799 3300019190 Bacteria 639
373 Ga0184603_112367 3300019192 Bacteria 525
374 Ga0197907_10027294 3300020069 Bacteria 1401
375 Ga0197907_10220737 3300020069 Bacteria 661
376 Ga0197907_10601364 3300020069 Bacteria 1097
377 Ga0197907_10893729 3300020069 Bacteria 980
378 Ga0206356_10997871 3300020070 Bacteria 737
379 Ga0206356_11372204 3300020070 Bacteria 1143
380 Ga0206356_11671517 3300020070 Bacteria 2525
381 Ga0206349_1553193 3300020075 Bacteria 690
382 Ga0206349_1886438 3300020075 Bacteria 531
383 Ga0206351_10291020 3300020077 Bacteria 1460
384 Ga0206351_10579729 3300020077 Bacteria 957
385 Ga0206351_10889857 3300020077 Bacteria 560
386 Ga0206352_10038242 3300020078 Bacteria 1306
387 Ga0206352_10136420 3300020078 Bacteria 1063
388 Ga0206352_10289056 3300020078 Bacteria 629
389 Ga0206352_11208457 3300020078 Bacteria 609
390 Ga0206350_10168894 3300020080 Bacteria 1041
391 Ga0206350_10655422 3300020080 Bacteria 670
392 Ga0206354_10034819 3300020081 Bacteria 1150
393 Ga0206354_10148362 3300020081 Bacteria 805
394 Ga0206354_10287205 3300020081 Bacteria 1579
395 Ga0206354_10606016 3300020081 Bacteria 1084
396 Ga0206354_10631935 3300020081 Bacteria 1308
397 Ga0206354_10751521 3300020081 Bacteria 1664
398 Ga0206354_11147654 3300020081 Bacteria 1018
399 Ga0206354_11494243 3300020081 Bacteria 2509
400 Ga0206353_10658063 3300020082 Bacteria 1132
401 Ga0206353_10693515 3300020082 Bacteria 780
402 Ga0206353_11116006 3300020082 Bacteria 1490
403 Ga0206353_11271389 3300020082 Bacteria 1192
404 Ga0206353_11430486 3300020082 Bacteria 4636
405 Ga0206353_11796673 3300020082 Bacteria 1101
406 Ga0224712_10060728 3300022467 Bacteria 1505
407 Ga0224712_10067101 3300022467 Bacteria 1446
408 Ga0224712_10073951 3300022467 Bacteria 1391
409 Ga0224712_10107264 3300022467 Bacteria 1193
410 Ga0224712_10145804 3300022467 Bacteria 1045
411 Ga0224712_10203293 3300022467 Bacteria 901
412 Ga0224712_10506274 3300022467 Bacteria 584
413 Ga0247529_114344 3300023559 Bacteria 661
414 Ga0247530_109533 3300023563 Bacteria 782
415 Ga0207682_10170805 3300025893 Bacteria 989
416 Ga0207682_10590075 3300025893 Bacteria 524
417 Ga0207692_10000366 3300025898 Bacteria 15490
418 Ga0207692_10128288 3300025898 Bacteria 1429
419 Ga0207692_10289011 3300025898 Bacteria 994
420 Ga0207692_10344722 3300025898 Bacteria 917
421 Ga0207692_10357241 3300025898 Bacteria 902
422 Ga0207692_10364691 3300025898 Bacteria 893
423 Ga0207692_10714620 3300025898 Bacteria 651
424 Ga0207692_10991139 3300025898 Bacteria 555
425 Ga0207710_10000020 3300025900 Bacteria 338425
426 Ga0207710_10411119 3300025900 Bacteria 695
427 Ga0207688_10896082 3300025901 Bacteria 562
428 Ga0207688_10899589 3300025901 Bacteria 560
429 Ga0207680_10647632 3300025903 Bacteria 756
430 Ga0207680_10889400 3300025903 Bacteria 638
431 Ga0207647_10738399 3300025904 Bacteria 534
432 Ga0207685_10166257 3300025905 Bacteria 1011
433 Ga0207685_10168595 3300025905 Bacteria 1006
434 Ga0207685_10788500 3300025905 Bacteria 523
435 Ga0207699_10003090 3300025906 Bacteria 7910
436 Ga0207699_10015215 3300025906 Bacteria 3992
437 Ga0207699_10258237 3300025906 Bacteria 1203
438 Ga0207699_10382958 3300025906 Bacteria 999
439 Ga0207699_11056717 3300025906 Bacteria 601
440 Ga0207699_11310551 3300025906 Bacteria 536
441 Ga0207645_10169744 3300025907 Bacteria 1429
442 Ga0207643_10246568 3300025908 Bacteria 1099
443 Ga0207643_10720282 3300025908 Bacteria 645
444 Ga0207705_10038088 3300025909 Bacteria 3442
445 Ga0207705_10244273 3300025909 Bacteria 1368
446 Ga0207705_10471205 3300025909 Bacteria 974
447 Ga0207705_10829913 3300025909 Bacteria 717
448 Ga0207684_10001586 3300025910 Bacteria 24214
449 Ga0207684_10021426 3300025910 Bacteria 5519
450 Ga0207684_10522748 3300025910 Bacteria 1016
451 Ga0207684_10576510 3300025910 Bacteria 962
452 Ga0207654_10109048 3300025911 Bacteria 1719
453 Ga0207707_10000418 3300025912 Bacteria 44561
454 Ga0207707_10053472 3300025912 Bacteria 3515
455 Ga0207707_10661347 3300025912 Bacteria 880
456 Ga0207707_11173233 3300025912 Bacteria 623
457 Ga0207707_11173824 3300025912 Bacteria 622
458 Ga0207695_11143221 3300025913 Bacteria 659
459 Ga0207693_10004248 3300025915 Bacteria 12147
460 Ga0207693_10086885 3300025915 Bacteria 2450
461 Ga0207693_10216939 3300025915 Bacteria 1503
462 Ga0207693_10541804 3300025915 Bacteria 908
463 Ga0207693_10920313 3300025915 Bacteria 670
464 Ga0207663_10220500 3300025916 Bacteria 1380
465 Ga0207663_10232307 3300025916 Bacteria 1348
466 Ga0207663_10409515 3300025916 Bacteria 1039
467 Ga0207663_10564624 3300025916 Bacteria 891
468 Ga0207663_10630412 3300025916 Bacteria 845
469 Ga0207663_10938692 3300025916 Bacteria 693
470 Ga0207660_10000168 3300025917 Bacteria 41428
471 Ga0207660_10156392 3300025917 Bacteria 1755
472 Ga0207660_10986639 3300025917 Bacteria 687
473 Ga0207660_11165191 3300025917 Bacteria 627
474 Ga0207662_10344881 3300025918 Bacteria 999
475 Ga0207662_10693094 3300025918 Bacteria 713
476 Ga0207657_10028132 3300025919 Bacteria 5135
477 Ga0207657_10557645 3300025919 Bacteria 896
478 Ga0207649_10021859 3300025920 Bacteria 3691
479 Ga0207649_10333869 3300025920 Bacteria 1117
480 Ga0207649_10844178 3300025920 Bacteria 716
481 Ga0207649_11072046 3300025920 Bacteria 635
482 Ga0207649_11079274 3300025920 Bacteria 633
483 Ga0207652_10000461 3300025921 Bacteria 41921
484 Ga0207652_10209906 3300025921 Bacteria 1753
485 Ga0207652_10478069 3300025921 Bacteria 1122
486 Ga0207652_10600401 3300025921 Bacteria 987
487 Ga0207652_10673217 3300025921 Unclassified 924
488 Ga0207652_11844551 3300025921 Bacteria 510
489 Ga0207646_10011604 3300025922 Bacteria 8518
490 Ga0207646_10082776 3300025922 Bacteria 2870
491 Ga0207646_11432422 3300025922 Bacteria 600
492 Ga0207646_11694505 3300025922 Bacteria 543
493 Ga0207681_10178184 3300025923 Bacteria 1617
494 Ga0207681_10697682 3300025923 Bacteria 844
495 Ga0207694_10864232 3300025924 Bacteria 764
496 Ga0207650_10633634 3300025925 Bacteria 900
497 Ga0207650_11378586 3300025925 Bacteria 600
498 Ga0207659_10004185 3300025926 Bacteria 8714
499 Ga0207659_10293543 3300025926 Bacteria 1333
500 Ga0207659_11864174 3300025926 Bacteria 510
501 Ga0207687_10057947 3300025927 Bacteria 2723
502 Ga0207700_10008761 3300025928 Bacteria 6284
503 Ga0207700_10043804 3300025928 Bacteria 3290
504 Ga0207700_10109682 3300025928 Bacteria 2218
505 Ga0207700_10173207 3300025928 Bacteria 1802
506 Ga0207700_10422868 3300025928 Bacteria 1171
507 Ga0207700_10467342 3300025928 Bacteria 1113
508 Ga0207700_10791159 3300025928 Bacteria 848
509 Ga0207700_10868618 3300025928 Bacteria 807
510 Ga0207700_11420379 3300025928 Bacteria 617
511 Ga0207700_11521831 3300025928 Bacteria 593
512 Ga0207664_10002028 3300025929 Bacteria 13327
513 Ga0207664_10020733 3300025929 Bacteria 4878
514 Ga0207664_10021120 3300025929 Bacteria 4835
515 Ga0207664_10032443 3300025929 Bacteria 4002
516 Ga0207664_10202640 3300025929 Bacteria 1714
517 Ga0207664_10321487 3300025929 Bacteria 1365
518 Ga0207664_10371665 3300025929 Bacteria 1268
519 Ga0207664_10514508 3300025929 Bacteria 1072
520 Ga0207664_10549317 3300025929 Bacteria 1036
521 Ga0207664_10785581 3300025929 Bacteria 856
522 Ga0207664_11428326 3300025929 Bacteria 613
523 Ga0207644_11000874 3300025931 Bacteria 702
524 Ga0207690_10067601 3300025932 Bacteria 2452
525 Ga0207706_10367734 3300025933 Bacteria 1249
526 Ga0207706_11064928 3300025933 Bacteria 677
527 Ga0207669_10904033 3300025937 Bacteria 738
528 Ga0207704_10383396 3300025938 Bacteria 1104
529 Ga0207704_11896187 3300025938 Bacteria 513
530 Ga0207665_10001687 3300025939 Bacteria 14854
531 Ga0207665_10423495 3300025939 Bacteria 1017
532 Ga0207665_10934355 3300025939 Bacteria 689
533 Ga0207665_11047892 3300025939 Bacteria 649
534 Ga0207691_10186014 3300025940 Bacteria 1813
535 Ga0207691_10431019 3300025940 Bacteria 1123
536 Ga0207711_10103798 3300025941 Bacteria 2517
537 Ga0207711_10368503 3300025941 Bacteria 1332
538 Ga0207711_10635389 3300025941 Bacteria 996
539 Ga0207711_11288493 3300025941 Bacteria 673
540 Ga0207689_10058040 3300025942 Bacteria 3183
541 Ga0207689_10074648 3300025942 Bacteria 2786
542 Ga0207689_10343761 3300025942 Bacteria 1240
543 Ga0207689_10569861 3300025942 Bacteria 951
544 Ga0207689_10835303 3300025942 Bacteria 777
545 Ga0207661_10001620 3300025944 Bacteria 15317
546 Ga0207661_10152677 3300025944 Bacteria 1997
547 Ga0207661_10184007 3300025944 Bacteria 1827
548 Ga0207661_10288319 3300025944 Bacteria 1469
549 Ga0207661_10448037 3300025944 Bacteria 1176
550 Ga0207661_10627931 3300025944 Bacteria 987
551 Ga0207661_10970265 3300025944 Bacteria 783
552 Ga0207661_11171209 3300025944 Bacteria 707
553 Ga0207661_11231299 3300025944 Bacteria 688
554 Ga0207661_12016946 3300025944 Bacteria 523
555 Ga0207679_10008106 3300025945 Bacteria 6681
556 Ga0207679_10128346 3300025945 Bacteria 2030
557 Ga0207679_10177093 3300025945 Bacteria 1761
558 Ga0207679_10213125 3300025945 Bacteria 1621
559 Ga0207679_10293448 3300025945 Bacteria 1399
560 Ga0207679_10442693 3300025945 Bacteria 1151
561 Ga0207679_10515970 3300025945 Bacteria 1068
562 Ga0207679_10684669 3300025945 Unclassified 929
563 Ga0207667_10193892 3300025949 Bacteria 2084
564 Ga0207667_12226164 3300025949 Bacteria 505
565 Ga0207651_10983086 3300025960 Bacteria 754
566 Ga0207651_11819403 3300025960 Unclassified 548
567 Ga0207712_10205948 3300025961 Bacteria 1563
568 Ga0207668_10002358 3300025972 Bacteria 11036
569 Ga0207668_10979034 3300025972 Bacteria 755
570 Ga0207668_11130726 3300025972 Bacteria 703
571 Ga0207668_11483594 3300025972 Bacteria 612
572 Ga0207640_10706683 3300025981 Bacteria 865
573 Ga0207640_11281141 3300025981 Bacteria 654
574 Ga0207658_10437789 3300025986 Bacteria 1155
575 Ga0207677_11271344 3300026023 Bacteria 675
576 Ga0207703_10000006 3300026035 Bacteria 502351
577 Ga0207678_10122234 3300026067 Bacteria 2221
578 Ga0207678_10130372 3300026067 Bacteria 2145
579 Ga0207678_10187353 3300026067 Bacteria 1768
580 Ga0207678_10219833 3300026067 Bacteria 1626
581 Ga0207678_10221569 3300026067 Bacteria 1619
582 Ga0207678_10338850 3300026067 Bacteria 1295
583 Ga0207708_10094016 3300026075 Bacteria 2314
584 Ga0207708_10322248 3300026075 Bacteria 1261
585 Ga0207708_10365112 3300026075 Bacteria 1187
586 Ga0207708_10396538 3300026075 Bacteria 1140
587 Ga0207708_10651524 3300026075 Bacteria 896
588 Ga0207702_10144165 3300026078 Bacteria 2159
589 Ga0207702_10398334 3300026078 Bacteria 1327
590 Ga0207702_10680302 3300026078 Bacteria 1013
591 Ga0207702_10830201 3300026078 Bacteria 914
592 Ga0207702_10971220 3300026078 Bacteria 842
593 Ga0207702_11136278 3300026078 Bacteria 775
594 Ga0207702_11444860 3300026078 Bacteria 681
595 Ga0207702_12369271 3300026078 Bacteria 518
596 Ga0207641_10077025 3300026088 Bacteria 2885
597 Ga0207641_10139497 3300026088 Bacteria 2185
598 Ga0207641_11391622 3300026088 Bacteria 702
599 Ga0207648_10131181 3300026089 Bacteria 2206
600 Ga0207676_10035666 3300026095 Bacteria 3778
601 Ga0207676_10160836 3300026095 Bacteria 1945
602 Ga0207676_10525346 3300026095 Bacteria 1127
603 Ga0207676_10573248 3300026095 Bacteria 1081
604 Ga0207676_10660512 3300026095 Bacteria 1010
605 Ga0207676_10940344 3300026095 Bacteria 849
606 Ga0207676_11625257 3300026095 Bacteria 644
607 Ga0207674_10019875 3300026116 Bacteria 7268
608 Ga0207674_10158216 3300026116 Bacteria 2220
609 Ga0207674_10174824 3300026116 Bacteria 2100
610 Ga0207674_10221562 3300026116 Bacteria 1840
611 Ga0207674_10289063 3300026116 Bacteria 1588
612 Ga0207674_10717995 3300026116 Bacteria 965
613 Ga0207674_11569659 3300026116 Bacteria 627
614 Ga0207674_11594510 3300026116 Bacteria 621
615 Ga0207674_12109520 3300026116 Bacteria 527
616 Ga0207675_100014030 3300026118 Bacteria 7470
617 Ga0207675_100397758 3300026118 Bacteria 1357
618 Ga0207675_100508119 3300026118 Bacteria 1200
619 Ga0207675_100536457 3300026118 Bacteria 1168
620 Ga0207675_101013001 3300026118 Bacteria 849
621 Ga0207683_10078213 3300026121 Bacteria 2931
622 Ga0207683_10232623 3300026121 Bacteria 1681
623 Ga0207683_10286254 3300026121 Bacteria 1506
624 Ga0207698_10688978 3300026142 Bacteria 1016
625 Ga0207698_10898864 3300026142 Bacteria 893
626 Ga0207698_11549697 3300026142 Bacteria 678
627 Ga0207428_10080319 3300027907 Bacteria 2548
628 Ga0268266_10207834 3300028379 Bacteria 1794
629 Ga0268266_10688606 3300028379 Bacteria 985
630 Ga0268266_11819046 3300028379 Bacteria 584
631 Ga0268265_10014957 3300028380 Bacteria 5299
632 Ga0268265_10568707 3300028380 Bacteria 1079
633 Ga0268265_11072539 3300028380 Bacteria 799
634 Ga0268265_11879882 3300028380 Bacteria 605
635 Ga0268264_10139955 3300028381 Bacteria 2157
636 Ga0268264_10404078 3300028381 Bacteria 1313
637 Ga0265336_10042279 3300028666 Bacteria 1391
638 Ga0307517_10115171 3300028786 Bacteria 2019
639 Ga0307517_10503128 3300028786 Bacteria 616
640 Ga0307515_10000045 3300028794 Bacteria 301029
641 Ga0307515_10015993 3300028794 Bacteria 13773
642 Ga0307515_10032705 3300028794 Bacteria 8600
643 Ga0307515_10051803 3300028794 Bacteria 6109
644 Ga0307515_10207412 3300028794 Bacteria 1815
645 Ga0265338_10000680 3300028800 Bacteria 58427
646 Ga0310981_1042067 3300029285 Bacteria 530
647 Ga0307512_10007169 3300030522 Bacteria 11093
648 Ga0307512_10076400 3300030522 Bacteria 2442
649 Ga0307512_10115066 3300030522 Bacteria 1753
650 Ga0307512_10171240 3300030522 Bacteria 1244
651 Ga0316178_1088482 3300030735 Bacteria 1607
652 Ga0307513_10015297 3300031456 Bacteria 9307
653 Ga0307513_10056025 3300031456 Bacteria 4213
654 Ga0307513_10144144 3300031456 Bacteria 2303
655 Ga0307509_10018024 3300031507 Bacteria 8106
656 Ga0307509_10123651 3300031507 Bacteria 2559
657 Ga0307509_10367065 3300031507 Bacteria 1157
658 Ga0307408_100075391 3300031548 Bacteria 2506
659 Ga0307408_101358571 3300031548 Bacteria 668
660 Ga0307408_102216215 3300031548 Bacteria 531
661 Ga0310117_107422 3300031592 Bacteria 1181
662 Ga0310103_113480 3300031614 Bacteria 1088
663 Ga0307508_10003422 3300031616 Bacteria 16058
664 Ga0307508_10018512 3300031616 Bacteria 6331
665 Ga0307508_10018782 3300031616 Bacteria 6283
666 Ga0307508_10027035 3300031616 Bacteria 5198
667 Ga0307508_10030578 3300031616 Bacteria 4868
668 Ga0307508_10136839 3300031616 Bacteria 2053
669 Ga0307514_10175386 3300031649 Bacteria 1392
670 Ga0310119_125356 3300031686 Bacteria 626
671 Ga0307516_10006648 3300031730 Bacteria 13518
672 Ga0307516_10014878 3300031730 Bacteria 8211
673 Ga0307516_10018382 3300031730 Bacteria 7264
674 Ga0307516_10297527 3300031730 Bacteria 1290
675 Ga0307405_10005914 3300031731 Bacteria 5964
676 Ga0307405_10087274 3300031731 Bacteria 2056
677 Ga0307405_10547147 3300031731 Bacteria 936
678 Ga0307405_10793985 3300031731 Bacteria 792
679 Ga0307405_10858681 3300031731 Bacteria 765
680 Ga0307405_11497041 3300031731 Bacteria 593
681 Ga0316044_122642 3300031810 Bacteria 636
682 Ga0316045_127068 3300031815 Bacteria 513
683 Ga0307413_10168551 3300031824 Bacteria 1547
684 Ga0307413_10436486 3300031824 Bacteria 1036
685 Ga0307413_11080941 3300031824 Bacteria 692
686 Ga0307413_11837754 3300031824 Bacteria 543
687 Ga0307410_10023845 3300031852 Bacteria 3813
688 Ga0307410_10300718 3300031852 Bacteria 1266
689 Ga0307410_10890291 3300031852 Bacteria 762
690 Ga0307410_11508923 3300031852 Bacteria 592
691 Ga0307410_11934746 3300031852 Bacteria 525
692 Ga0307406_10002273 3300031901 Bacteria 10449
693 Ga0307406_10008054 3300031901 Bacteria 5869
694 Ga0307406_10033659 3300031901 Bacteria 3139
695 Ga0307406_10367532 3300031901 Bacteria 1130
696 Ga0307406_10384306 3300031901 Bacteria 1108
697 Ga0307406_10537660 3300031901 Bacteria 954
698 Ga0307406_10638900 3300031901 Bacteria 882
699 Ga0307406_10706285 3300031901 Bacteria 842
700 Ga0307406_10744809 3300031901 Bacteria 822
701 Ga0307406_11004840 3300031901 Bacteria 716
702 Ga0307407_10008322 3300031903 Bacteria 4754
703 Ga0307407_10061396 3300031903 Bacteria 2197
704 Ga0307407_10446597 3300031903 Bacteria 938
705 Ga0307407_10801878 3300031903 Bacteria 716
706 Ga0307407_11401179 3300031903 Bacteria 551
707 Ga0307412_10082849 3300031911 Bacteria 2222
708 Ga0307412_12319051 3300031911 Bacteria 501
709 Ga0307409_100011902 3300031995 Bacteria 5513
710 Ga0307409_100054640 3300031995 Bacteria 3077
711 Ga0307409_100185269 3300031995 Bacteria 1847
712 Ga0307409_100240682 3300031995 Bacteria 1647
713 Ga0307409_100543258 3300031995 Bacteria 1139
714 Ga0307409_101346036 3300031995 Bacteria 740
715 Ga0307409_101483187 3300031995 Bacteria 705
716 Ga0307409_102006274 3300031995 Bacteria 608
717 Ga0307409_102236131 3300031995 Bacteria 576
718 Ga0307409_102293295 3300031995 Bacteria 569
719 Ga0307416_100001161 3300032002 Bacteria 14156
720 Ga0307416_100116839 3300032002 Bacteria 2366
721 Ga0307416_100438689 3300032002 Bacteria 1355
722 Ga0307416_101368479 3300032002 Bacteria 813
723 Ga0307416_101679290 3300032002 Bacteria 740
724 Ga0307416_102214557 3300032002 Bacteria 651
725 Ga0307416_102510581 3300032002 Bacteria 614
726 Ga0307414_10528885 3300032004 Bacteria 1048
727 Ga0307411_10932966 3300032005 Bacteria 773
728 Ga0307411_11685890 3300032005 Bacteria 586
729 Ga0307411_11927204 3300032005 Bacteria 550
730 Ga0316053_117435 3300032120 Bacteria 545
731 Ga0307415_100000190 3300032126 Bacteria 27293
732 Ga0307415_100004484 3300032126 Bacteria 7252
733 Ga0307415_100022219 3300032126 Bacteria 3911
734 Ga0307415_100164818 3300032126 Bacteria 1722
735 Ga0307415_100222900 3300032126 Bacteria 1513
736 Ga0307415_100382085 3300032126 Bacteria 1196
737 Ga0307415_100404310 3300032126 Bacteria 1167
738 Ga0307415_100530044 3300032126 Bacteria 1035
739 Ga0307415_100780641 3300032126 Bacteria 870
740 Ga0307415_102355540 3300032126 Bacteria 523
741 Ga0307507_10012122 3300033179 Bacteria 10711
742 Ga0307507_10211728 3300033179 Bacteria 1320
743 Ga0307507_10447943 3300033179 Bacteria 714
744 Ga0307510_10385505 3300033180 Bacteria 846
745 Ga0316214_1004474 3300033545 Bacteria 1804
746 Ga0373930_0011603 3300034816 Bacteria 1593
747 Ga0373948_0004465 3300034817 Bacteria 2215
748 Ga0373950_0121524 3300034818 Bacteria 578
749 Ga0373958_0026477 3300034819 Bacteria 1111
750 Ga0373959_0131207 3300034820 Bacteria 620
751 Ga0373926_0088989 3300035083 Bacteria 1147
752 Ga0373926_0259422 3300035083 Bacteria 674
753 Ga0373928_0004059 3300035084 Bacteria 2795
754 Ga0373928_0121382 3300035084 Bacteria 701
755 Ga0373934_0000034 3300035086 Bacteria 44625
756 Ga0373934_0015572 3300035086 Bacteria 2886
757 Ga0373934_0016744 3300035086 Bacteria 2789
758 Ga0373934_0039606 3300035086 Bacteria 1858
759 Ga0373940_0068300 3300035088 Bacteria 1030
760 Ga0373944_0010680 3300035089 Bacteria 2506
761 Ga0373944_0063547 3300035089 Bacteria 1189
762 Ga0373944_0313979 3300035089 Bacteria 590
763 Ga0373944_0430426 3300035089 Bacteria 512
764 Ga0373949_0016313 3300035090 Bacteria 1664
765 Ga0373951_0000004 3300035091 Bacteria 95240
766 Ga0373951_0068872 3300035091 Unclassified 898
767 Ga0373923_0000906 3300035111 Bacteria 7908
768 Ga0373923_0171819 3300035111 Bacteria 993
769 Ga0373923_0260816 3300035111 Bacteria 813
770 Ga0373923_0263823 3300035111 Bacteria 808
771 Ga0373932_0052367 3300035112 Bacteria 1215
772 Ga0373936_0047619 3300035113 Bacteria 1729
773 Ga0373936_0092749 3300035113 Bacteria 1267
774 Ga0373939_0029292 3300035114 Bacteria 1573
775 Ga0373941_0128570 3300035115 Unclassified 910
776 Ga0373945_0027244 3300035116 Bacteria 1995
777 Ga0373945_0118615 3300035116 Bacteria 1050
778 Ga0373953_0000176 3300035117 Bacteria 16923
779 Ga0373953_0005548 3300035117 Bacteria 4104
780 Ga0373953_0045154 3300035117 Bacteria 1764
781 Ga0373953_0250111 3300035117 Bacteria 770
782 Ga0373954_0002651 3300035118 Bacteria 7533
783 Ga0373954_0066894 3300035118 Bacteria 1702
784 Ga0373954_0082825 3300035118 Bacteria 1534
785 Ga0373954_0212722 3300035118 Bacteria 950
786 Ga0373954_0392805 3300035118 Bacteria 686
787 Ga0373956_0000479 3300035119 Bacteria 16414
788 Ga0373956_0073581 3300035119 Bacteria 1561
789 Ga0373956_0152272 3300035119 Bacteria 1088
790 Ga0373956_0477923 3300035119 Bacteria 595
791 Ga0373957_0000488 3300035120 Bacteria 9995
792 Ga0373957_0006537 3300035120 Bacteria 3676
793 Ga0373957_0028711 3300035120 Bacteria 2028
794 Ga0373957_0094883 3300035120 Bacteria 1189
795 Ga0373957_0310731 3300035120 Bacteria 669
796 Ga0373957_0358319 3300035120 Bacteria 624
797 Ga0373960_0265397 3300035121 Bacteria 628
798 Ga0373943_0127602 3300035170 Bacteria 1358
799 Ga0373943_0571597 3300035170 Bacteria 664
800 Ga0373943_0682654 3300035170 Bacteria 608
801 Ga0373946_0016191 3300035171 Bacteria 2838
802 Ga0373955_0000080 3300035172 Bacteria 39754
803 Ga0373955_0010334 3300035172 Bacteria 4404
804 Ga0373955_0683920 3300035172 Bacteria 629
805 Ga0373942_0060387 3300035207 Bacteria 1085
806 Ga0373962_0000172 3300035242 Bacteria 13751
807 Ga0373924_0000942 3300035410 Bacteria 9196
808 Ga0373924_0008562 3300035410 Bacteria 3722
809 Ga0373924_0023674 3300035410 Bacteria 2412
810 Ga0373931_0130103 3300035691 Bacteria 1448
811 Ga0373931_0441831 3300035691 Bacteria 830
812 Ga0373935_0023454 3300035692 Bacteria 3792
813 Ga0373935_0024335 3300035692 Bacteria 3727
814 Ga0373935_0041109 3300035692 Bacteria 2903
815 Ga0373935_0316326 3300035692 Bacteria 1106
816 Ga0373935_0624336 3300035692 Bacteria 789
817 Ga0373935_0785326 3300035692 Bacteria 703
818 Ga0373927_0145185 3300035695 Bacteria 1553
819 Ga0373927_0164621 3300035695 Bacteria 1453
820 Ga0373927_0631886 3300035695 Bacteria 708
821 Ga0373933_0000461 3300035724 Bacteria 25426
822 Ga0373933_0003054 3300035724 Bacteria 9341
823 Ga0373933_0004243 3300035724 Bacteria 7896
824 Ga0373933_0007059 3300035724 Bacteria 6121
825 Ga0373933_0009456 3300035724 Bacteria 5323
826 Ga0373947_0044386 3300035725 Bacteria 2657
827 Ga0373947_0081060 3300035725 Bacteria 2008
828 Ga0373947_0332566 3300035725 Bacteria 1017
829 Ga0373947_0473092 3300035725 Bacteria 850
830 Ga0310104_10395 3300036242 Bacteria 756
831 Ga0373937_0000023 3300036401 Bacteria 127414
832 Ga0373937_0045127 3300036401 Bacteria 4026
833 Ga0373937_0170921 3300036401 Bacteria 2039
834 Ga0373937_0239762 3300036401 Bacteria 1708
835 Ga0373937_0378208 3300036401 Bacteria 1343
836 Ga0373937_0602837 3300036401 Bacteria 1042
837 Ga0373937_1396253 3300036401 Bacteria 648
838 Ga0373937_1610489 3300036401 Bacteria 596
839 Ga0265778_044208 3300036457 Bacteria 599
840 Ga0310112_047578 3300036458 Bacteria 582
841 Ga0310109_019976 3300036534 Bacteria 904
842 Ga0373925_0011651 3300037068 Bacteria 6359
843 Ga0373925_0074311 3300037068 Bacteria 2574
844 Ga0373925_0254653 3300037068 Bacteria 1409
845 Ga0373925_0329578 3300037068 Bacteria 1236
846 Ga0373925_0682765 3300037068 Bacteria 846
847 Ga0373925_1304930 3300037068 Bacteria 595
848 Ga0395899_0009471 3300037312 Bacteria 7476
849 Ga0395900_0006872 3300037418 Bacteria 11801
850 Ga0395900_0581918 3300037418 Bacteria 1061
851 Ga0395900_0745628 3300037418 Bacteria 910
852 Ga0395898_0005950 3300037466 Bacteria 13092
853 Ga0395898_0016606 3300037466 Bacteria 7525
854 Ga0395898_0031971 3300037466 Bacteria 5253
855 Ga0395898_0039905 3300037466 Bacteria 4645
856 Ga0395905_0006430 3300037471 Bacteria 11830
857 Ga0395905_1632557 3300037471 Bacteria 550
858 Ga0395901_0009122 3300038443 Bacteria 10045
859 Ga0395901_0028124 3300038443 Bacteria 5783
860 Ga0395901_0470942 3300038443 Bacteria 1282
861 Ga0436365_0843445 3300039437 Bacteria 535
862 Ga0436363_0176675 3300039450 Bacteria 574
863 Ga0436363_0695637 3300039450 Bacteria 569
864 Ga0436363_0855063 3300039450 Bacteria 570
865 Ga0439438_145140 3300041405 Bacteria 567
866 Ga0451789_0793300 3300041443 Bacteria 721
867 Ga0451790_37344 3300041444 Bacteria 830
868 Ga0451791_1219190 3300041451 Bacteria 2340
869 Ga0451793_0029799 3300041452 Bacteria 830
870 Ga0451793_1560447 3300041452 Bacteria 602
871 Ga0451797_0145031 3300041453 Bacteria 669
872 Ga0451798_0529368 3300041458 Bacteria 656
873 Ga0451802_2162425 3300041460 Bacteria 975
874 Ga0451804_0431050 3300041463 Bacteria 616
875 Ga0451807_0456693 3300041486 Bacteria 538
876 Ga0451833_0384247 3300041491 Bacteria 561
877 Ga0451833_0883276 3300041491 Bacteria 941
878 Ga0451833_1374928 3300041491 Bacteria 530
879 Ga0451835_0266027 3300041492 Bacteria 599
880 Ga0451837_0384947 3300041494 Bacteria 500
881 Ga0451837_1660227 3300041494 Bacteria 759
882 Ga0451839_0144053 3300041496 Bacteria 598
883 Ga0451839_1546639 3300041496 Bacteria 573
884 Ga0451841_0000410 3300041498 Bacteria 1142
885 Ga0451849_0068873 3300041505 Bacteria 720
886 Ga0451851_0087835 3300041507 Bacteria 605
887 Ga0451843_0134207 3300041509 Bacteria 1301
888 Ga0451843_0586583 3300041509 Bacteria 554
889 Ga0451853_0738829 3300041512 Bacteria 725
890 Ga0451853_0892057 3300041512 Bacteria 2232
891 Ga0451853_1306632 3300041512 Bacteria 642
892 Ga0439449_0023685 3300042007 Bacteria 2296
893 Ga0450902_082829 3300042137 Bacteria 564
894 Ga0439440_0098191 3300042993 Bacteria 794
895 Ga0466972_0150615 3300044658 Bacteria 1094
896 Ga0466965_0135429 3300044683 Bacteria 1279
897 Ga0466965_0136507 3300044683 Bacteria 1275
898 Ga0466966_0014016 3300044684 Bacteria 5306
899 Ga0466961_0110007 3300044693 Bacteria 1734
900 Ga0466963_0153592 3300044694 Bacteria 1599
901 Ga0466963_0443705 3300044694 Bacteria 916
902 Ga0466963_0582934 3300044694 Bacteria 790
903 Ga0466970_0385730 3300044765 Bacteria 798
904 Ga0466957_1136394 3300044842 Bacteria 564
905 Ga0466960_0230832 3300044901 Bacteria 1021
906 Ga0466960_0923893 3300044901 Bacteria 533
907 Ga0466959_0002019 3300045049 Bacteria 12814
908 Ga0466958_0594422 3300045836 Bacteria 720
909 Ga0466967_0084531 3300045976 Bacteria 2871
910 Ga0466967_0597071 3300045976 Bacteria 1089
911 Ga0466967_0823059 3300045976 Bacteria 922
912 Ga0466967_2537298 3300045976 Bacteria 507
913 Ga0495592_0000523 3300046454 Bacteria 27735
914 Ga0495592_0047127 3300046454 Bacteria 3210
915 Ga0495592_0078356 3300046454 Bacteria 2393
916 Ga0495592_0108893 3300046454 Bacteria 1963
917 Ga0495592_0138027 3300046454 Bacteria 1698
918 Ga0495629_0008073 3300046459 Bacteria 7750
919 Ga0495629_0043738 3300046459 Bacteria 3144
920 Ga0495629_0060229 3300046459 Bacteria 2653
921 Ga0495629_0604591 3300046459 Bacteria 733
922 Ga0495641_0065653 3300046461 Bacteria 1633
923 Ga0495651_0000015 3300046462 Bacteria 127414
924 Ga0495651_0001165 3300046462 Bacteria 20295
925 Ga0495651_0004771 3300046462 Bacteria 10378
926 Ga0495651_0052415 3300046462 Bacteria 3142
927 Ga0495651_0072130 3300046462 Bacteria 2623
928 Ga0495651_0078871 3300046462 Bacteria 2490
929 Ga0495651_0369516 3300046462 Bacteria 943
930 Ga0495651_0673918 3300046462 Unclassified 646
931 Ga0495651_0888577 3300046462 Bacteria 545
932 Ga0495653_0002364 3300046463 Bacteria 14986
933 Ga0495653_0032581 3300046463 Bacteria 4135
934 Ga0495653_0063119 3300046463 Bacteria 2797
935 Ga0495653_0081544 3300046463 Bacteria 2390
936 Ga0495653_0085195 3300046463 Bacteria 2325
937 Ga0495653_0098480 3300046463 Bacteria 2123
938 Ga0495653_0793210 3300046463 Bacteria 570
939 Ga0495580_0048917 3300046472 Bacteria 2991
940 Ga0495582_0017459 3300046473 Bacteria 3926
941 Ga0495582_0046415 3300046473 Bacteria 2392
942 Ga0495582_0096027 3300046473 Bacteria 1656
943 Ga0495639_0042215 3300046475 Bacteria 2056
944 Ga0495639_0089477 3300046475 Bacteria 1443
945 Ga0495639_0306543 3300046475 Bacteria 792
946 Ga0495662_0000284 3300046476 Bacteria 21837
947 Ga0495662_0010843 3300046476 Bacteria 4457
948 Ga0495662_0090867 3300046476 Bacteria 1488
949 Ga0495662_0167692 3300046476 Bacteria 1082
950 Ga0495664_0002113 3300046477 Bacteria 10630
951 Ga0495664_0044660 3300046477 Bacteria 2626
952 Ga0495664_0070353 3300046477 Bacteria 2089
953 Ga0495664_0093077 3300046477 Bacteria 1813
954 Ga0495664_0109117 3300046477 Bacteria 1670
955 Ga0495664_0141809 3300046477 Bacteria 1457
956 Ga0495664_0200455 3300046477 Bacteria 1209
957 Ga0495594_0030177 3300046499 Bacteria 2932
958 Ga0495606_0001817 3300046507 Bacteria 27123
959 Ga0495608_0000468 3300046511 Bacteria 28005
960 Ga0495608_0000479 3300046511 Bacteria 27769
961 Ga0495608_0001967 3300046511 Bacteria 14726
962 Ga0495608_0040333 3300046511 Bacteria 3128
963 Ga0495608_0134064 3300046511 Bacteria 1583
964 Ga0495608_0242349 3300046511 Bacteria 1126
965 Ga0495618_0042843 3300046514 Bacteria 2855
966 Ga0495618_0101977 3300046514 Bacteria 1837
967 Ga0495618_0114829 3300046514 Bacteria 1724
968 Ga0495618_0160048 3300046514 Bacteria 1435
969 Ga0495618_0717185 3300046514 Bacteria 587
970 Ga0495628_0000240 3300046516 Bacteria 48195
971 Ga0495628_0099618 3300046516 Bacteria 2244
972 Ga0495628_0108077 3300046516 Bacteria 2141
973 Ga0495628_0281087 3300046516 Bacteria 1236
974 Ga0495628_0442640 3300046516 Bacteria 944
975 Ga0495628_0446630 3300046516 Bacteria 939
976 Ga0495628_0579258 3300046516 Bacteria 803
977 Ga0495628_1081472 3300046516 Bacteria 548
978 Ga0495628_1210952 3300046516 Bacteria 512
979 Ga0495630_0021401 3300046517 Bacteria 4775
980 Ga0495630_0105860 3300046517 Bacteria 2130
981 Ga0495630_0258767 3300046517 Bacteria 1329
982 Ga0495630_0287670 3300046517 Bacteria 1256
983 Ga0495630_0466692 3300046517 Bacteria 967
984 Ga0495630_1398433 3300046517 Bacteria 526
985 Ga0495632_0011770 3300046519 Bacteria 5091
986 Ga0495632_0037493 3300046519 Bacteria 2459
987 Ga0495666_0066637 3300046526 Bacteria 1716
988 Ga0495652_0000044 3300046529 Bacteria 123607
989 Ga0495652_0001965 3300046529 Bacteria 21870
990 Ga0495652_0105008 3300046529 Bacteria 2283
991 Ga0495652_0258526 3300046529 Bacteria 1286
992 Ga0495652_0430761 3300046529 Bacteria 927
993 Ga0495652_0468695 3300046529 Bacteria 878
994 Ga0495652_0785543 3300046529 Bacteria 635
995 Ga0495652_1002449 3300046529 Bacteria 546
996 Ga0495665_0002759 3300046531 Bacteria 9484
997 Ga0495665_0003349 3300046531 Bacteria 8690
998 Ga0495665_0072418 3300046531 Bacteria 1814
999 Ga0495665_0088226 3300046531 Bacteria 1630
1000 Ga0495640_0007442 3300046533 Bacteria 8604
1001 Ga0495640_0025022 3300046533 Bacteria 4336
1002 Ga0495640_0075371 3300046533 Bacteria 2253
1003 Ga0495640_0156354 3300046533 Bacteria 1463
1004 Ga0495640_0178671 3300046533 Bacteria 1353
1005 Ga0495640_0809730 3300046533 Bacteria 558
1006 Ga0495586_0005641 3300046535 Bacteria 6688
1007 Ga0495586_0119417 3300046535 Bacteria 1472
1008 Ga0495586_0202504 3300046535 Bacteria 1125
1009 Ga0495586_0799812 3300046535 Bacteria 544
1010 Ga0495586_0888547 3300046535 Bacteria 513
1011 Ga0495587_0000480 3300046536 Bacteria 27706
1012 Ga0495587_0012542 3300046536 Bacteria 5329
1013 Ga0495587_0013195 3300046536 Bacteria 5195
1014 Ga0495587_0045798 3300046536 Bacteria 2598
1015 Ga0495587_0046886 3300046536 Bacteria 2564
1016 Ga0495587_0078793 3300046536 Bacteria 1911
1017 Ga0495587_0402611 3300046536 Bacteria 760
1018 Ga0495645_0001777 3300046543 Bacteria 14671
1019 Ga0495645_0057400 3300046543 Bacteria 2825
1020 Ga0495645_0064958 3300046543 Bacteria 2640
1021 Ga0495645_0108633 3300046543 Bacteria 1964
1022 Ga0495645_0134448 3300046543 Bacteria 1730
1023 Ga0495645_0245513 3300046543 Bacteria 1192
1024 Ga0495645_0269798 3300046543 Bacteria 1123
1025 Ga0495645_0494553 3300046543 Bacteria 765
1026 Ga0495645_0609908 3300046543 Bacteria 670
1027 Ga0495622_0233600 3300046557 Bacteria 812
1028 Ga0495622_0453209 3300046557 Bacteria 550
1029 Ga0495667_0000404 3300046559 Bacteria 27694
1030 Ga0495667_0004295 3300046559 Bacteria 9613
1031 Ga0495667_0004370 3300046559 Bacteria 9544
1032 Ga0495667_0010109 3300046559 Bacteria 6387
1033 Ga0495667_0047816 3300046559 Bacteria 2825
1034 Ga0495667_0077997 3300046559 Bacteria 2153
1035 Ga0495668_0000828 3300046616 Bacteria 35228
1036 Ga0495668_0746430 3300046616 Unclassified 542
1037 Ga0495634_0012933 3300046642 Bacteria 6038
1038 Ga0495634_0023988 3300046642 Bacteria 4283
1039 Ga0495634_0038380 3300046642 Bacteria 3266
1040 Ga0495625_0001049 3300046660 Bacteria 36242
1041 Ga0495635_0004526 3300046663 Bacteria 9634
1042 Ga0495635_0011486 3300046663 Bacteria 6208
1043 Ga0495635_0070785 3300046663 Bacteria 2390
1044 Ga0495635_0364213 3300046663 Bacteria 963
1045 Ga0495635_0483682 3300046663 Bacteria 816
1046 Ga0495635_0574932 3300046663 Bacteria 737
1047 Ga0495635_0599846 3300046663 Bacteria 719
1048 Ga0495588_0174896 3300046674 Bacteria 1135
1049 Ga0495657_0000030 3300046675 Bacteria 127400
1050 Ga0495657_0001488 3300046675 Bacteria 20206
1051 Ga0495657_0003565 3300046675 Bacteria 12660
1052 Ga0495657_0016585 3300046675 Bacteria 5366
1053 Ga0495657_0025762 3300046675 Bacteria 4173
1054 Ga0495657_0073978 3300046675 Bacteria 2217
1055 Ga0495599_0000771 3300046678 Bacteria 18044
1056 Ga0495599_0015439 3300046678 Bacteria 4739
1057 Ga0495599_0050276 3300046678 Bacteria 2612
1058 Ga0495599_0066328 3300046678 Bacteria 2254
1059 Ga0495599_0150498 3300046678 Bacteria 1441
1060 Ga0495599_0255630 3300046678 Bacteria 1065
1061 Ga0495623_0002193 3300046679 Bacteria 13016
1062 Ga0495623_0011410 3300046679 Bacteria 5751
1063 Ga0495623_0048091 3300046679 Bacteria 2706
1064 Ga0495623_0188485 3300046679 Bacteria 1193
1065 Ga0495623_0698649 3300046679 Bacteria 520
1066 Ga0495646_0022727 3300046680 Bacteria 3952
1067 Ga0495646_0026728 3300046680 Bacteria 3622
1068 Ga0495646_0035482 3300046680 Bacteria 3093
1069 Ga0495646_0102944 3300046680 Bacteria 1634
1070 Ga0495658_0048352 3300046683 Bacteria 2398
1071 Ga0495613_0008225 3300046689 Bacteria 7746
1072 Ga0495613_0076339 3300046689 Bacteria 2438
1073 Ga0495613_0144561 3300046689 Bacteria 1698
1074 Ga0495613_0194005 3300046689 Bacteria 1434
1075 Ga0495613_0394121 3300046689 Bacteria 945
1076 Ga0495613_0496700 3300046689 Bacteria 822
1077 Ga0495624_0145712 3300046690 Bacteria 1449
1078 Ga0495624_0314944 3300046690 Bacteria 943
1079 Ga0495624_0338410 3300046690 Bacteria 905
1080 Ga0495624_0351573 3300046690 Bacteria 886
1081 Ga0495624_0365577 3300046690 Bacteria 867
1082 Ga0495624_0487878 3300046690 Bacteria 737
1083 Ga0495649_0361974 3300046694 Bacteria 732
1084 Ga0495600_0004854 3300046809 Bacteria 8072
1085 Ga0495600_0046994 3300046809 Bacteria 2815
1086 Ga0495600_0060637 3300046809 Bacteria 2470
1087 Ga0495600_0204615 3300046809 Bacteria 1266
1088 Ga0495600_0208378 3300046809 Bacteria 1253
1089 Ga0495600_0423936 3300046809 Bacteria 825
1090 Ga0495581_0021493 3300047315 Bacteria 3739
1091 Ga0495581_0022179 3300047315 Bacteria 3679
1092 Ga0495581_0207983 3300047315 Bacteria 1144
1093 Ga0495604_0000726 3300047317 Bacteria 27822
1094 Ga0495604_0001997 3300047317 Bacteria 16455
1095 Ga0495604_0066152 3300047317 Bacteria 2750
1096 Ga0495604_0066167 3300047317 Bacteria 2750
1097 Ga0495604_0069257 3300047317 Bacteria 2674
1098 Ga0495604_0102173 3300047317 Bacteria 2104
1099 Ga0495604_0203787 3300047317 Bacteria 1370
1100 Ga0495636_0521784 3300047318 Bacteria 576
1101 Ga0495674_0005608 3300047319 Bacteria 12035
1102 Ga0495674_0018411 3300047319 Bacteria 6502
1103 Ga0495674_0046272 3300047319 Bacteria 3862
1104 Ga0495674_0131381 3300047319 Bacteria 2109
1105 Ga0495674_0141183 3300047319 Bacteria 2024
1106 Ga0495674_0143889 3300047319 Bacteria 2002
1107 Ga0495674_0173144 3300047319 Bacteria 1800
1108 Ga0495674_0810656 3300047319 Bacteria 727
1109 Ga0495676_0089100 3300047321 Bacteria 2312
1110 Ga0495676_0181027 3300047321 Bacteria 1477
1111 Ga0495676_0222378 3300047321 Bacteria 1300
1112 Ga0495676_0904004 3300047321 Bacteria 565
1113 Ga0495680_0002167 3300047322 Bacteria 20326
1114 Ga0495680_0047604 3300047322 Bacteria 3371
1115 Ga0495680_0085959 3300047322 Bacteria 2367
1116 Ga0495680_0114753 3300047322 Bacteria 1993
1117 Ga0495680_0116312 3300047322 Bacteria 1977
1118 Ga0495680_0165720 3300047322 Bacteria 1602
1119 Ga0495683_0073066 3300047323 Bacteria 1682
1120 Ga0495687_158722 3300047443 Bacteria 764
1121 Ga0495675_0002225 3300047444 Bacteria 11577
1122 Ga0495675_0002248 3300047444 Bacteria 11535
1123 Ga0495675_0008897 3300047444 Bacteria 6238
1124 Ga0495675_0009653 3300047444 Bacteria 6011
1125 Ga0495675_0034922 3300047444 Bacteria 3211
1126 Ga0495675_0322250 3300047444 Bacteria 914
1127 Ga0495675_0656626 3300047444 Bacteria 590
1128 Ga0495684_0046859 3300047471 Bacteria 3307
1129 Ga0495684_0052322 3300047471 Bacteria 3116
1130 Ga0495684_0058663 3300047471 Bacteria 2931
1131 Ga0495684_0160591 3300047471 Bacteria 1676
1132 Ga0495684_0306343 3300047471 Bacteria 1139
1133 Ga0495684_0409190 3300047471 Bacteria 950
1134 Ga0495684_0533944 3300047471 Bacteria 801
1135 Ga0495593_0051176 3300047673 Bacteria 2186
1136 Ga0495593_0146375 3300047673 Bacteria 1195
1137 Ga0495593_0273158 3300047673 Bacteria 846
1138 Ga0495593_0312539 3300047673 Bacteria 785
1139 Ga0495602_0000973 3300048088 Bacteria 27723
1140 Ga0495602_0033691 3300048088 Bacteria 4801
1141 Ga0495602_0067865 3300048088 Bacteria 3066
1142 Ga0495602_0136874 3300048088 Bacteria 1944
1143 Ga0495602_0156864 3300048088 Bacteria 1781
1144 Ga0495602_0256585 3300048088 Bacteria 1299
1145 Ga0495602_1057778 3300048088 Bacteria 533
1146 Ga0495614_0012354 3300048089 Bacteria 3748
1147 Ga0495614_0052674 3300048089 Bacteria 1744
1148 Ga0495626_0000129 3300048091 Bacteria 95400
1149 Ga0496100_0144972 3300048903 Bacteria 1687
1150 Ga0496101_0085492 3300048904 Bacteria 2337
1151 Ga0496102_0055998 3300048905 Bacteria 3596
1152 Ga0496102_0074600 3300048905 Bacteria 3118
1153 Ga0496102_0082888 3300048905 Bacteria 2958
1154 Ga0496102_1622732 3300048905 Bacteria 565
1155 Ga0496103_0065291 3300048906 Bacteria 2270
1156 Ga0496103_0408747 3300048906 Bacteria 872
1157 Ga0496103_0596065 3300048906 Bacteria 704
1158 Ga0496104_0000414 3300048907 Bacteria 37438
1159 Ga0496104_0082301 3300048907 Bacteria 3069
1160 Ga0496104_0144963 3300048907 Bacteria 2280
1161 Ga0496105_0007787 3300048908 Bacteria 8315
1162 Ga0496105_0104627 3300048908 Bacteria 2337
1163 Ga0496105_0518731 3300048908 Bacteria 933
1164 Ga0496106_0918867 3300048909 Bacteria 690
1165 Ga0496106_1104034 3300048909 Bacteria 621
1166 Ga0496106_1332056 3300048909 Bacteria 556
1167 Ga0496107_0235987 3300048910 Bacteria 1361
1168 Ga0496107_0273011 3300048910 Bacteria 1258
1169 Ga0496107_0727532 3300048910 Bacteria 729
1170 Ga0496108_0000048 3300048911 Bacteria 133539
1171 Ga0496108_0045957 3300048911 Bacteria 3647
1172 Ga0496108_0198795 3300048911 Bacteria 1739
1173 Ga0496109_0110811 3300048912 Bacteria 2552
1174 Ga0496109_0207911 3300048912 Bacteria 1840
1175 Ga0496109_0286849 3300048912 Bacteria 1552
1176 Ga0496109_1347613 3300048912 Bacteria 649
1177 Ga0496109_1810241 3300048912 Bacteria 544
1178 Ga0496110_0117451 3300048913 Bacteria 2395
1179 Ga0496110_0433756 3300048913 Bacteria 1198
1180 Ga0496110_1475921 3300048913 Bacteria 590
1181 Ga0496111_0842161 3300048914 Bacteria 662
1182 Ga0496111_0857772 3300048914 Bacteria 655
1183 Ga0496111_0938096 3300048914 Bacteria 622
1184 Ga0496112_0000596 3300048915 Bacteria 24874
1185 Ga0496112_0084551 3300048915 Bacteria 3138
1186 Ga0496112_0189572 3300048915 Bacteria 2018
1187 Ga0496112_0224263 3300048915 Bacteria 1835
1188 Ga0496112_0368641 3300048915 Bacteria 1378
1189 Ga0496112_0766103 3300048915 Bacteria 891
1190 Ga0496112_1174697 3300048915 Bacteria 684
1191 Ga0496113_0002740 3300048916 Bacteria 10357
1192 Ga0496113_0111148 3300048916 Bacteria 2133
1193 Ga0496113_0174879 3300048916 Bacteria 1701
1194 Ga0496113_0362740 3300048916 Bacteria 1162
1195 Ga0496113_0555702 3300048916 Bacteria 921
1196 Ga0496114_0221247 3300048917 Bacteria 1662
1197 Ga0496114_0742514 3300048917 Bacteria 858
1198 Ga0496115_0018404 3300048918 Bacteria 5363
1199 Ga0496115_0131057 3300048918 Bacteria 2067
1200 Ga0496115_0608248 3300048918 Bacteria 868
1201 Ga0496115_0613648 3300048918 Bacteria 863
1202 Ga0496115_0772859 3300048918 Bacteria 749
1203 Ga0496119_0118301 3300048922 Bacteria 1460
1204 Ga0496120_0349067 3300048923 Bacteria 665
1205 Ga0496121_0029885 3300048924 Bacteria 5020
1206 Ga0496121_0146270 3300048924 Bacteria 1746
1207 Ga0496125_0523936 3300048928 Bacteria 662
1208 Ga0496126_0000006 3300048929 Bacteria 798804
1209 Ga0496126_0062845 3300048929 Bacteria 3330
1210 Ga0496126_0091910 3300048929 Bacteria 2667
1211 Ga0496126_0157059 3300048929 Bacteria 1946
1212 Ga0496126_0799361 3300048929 Bacteria 724
1213 Ga0496126_1288642 3300048929 Bacteria 533
1214 Ga0501306_011107 3300049127 Bacteria 1144
1215 Ga0501306_029189 3300049127 Bacteria 812
1216 Ga0501308_080298 3300049128 Bacteria 518
1217 Ga0501309_018349 3300049129 Bacteria 966
1218 Ga0501305_031356 3300049161 Bacteria 830
1219 Ga0501307_021961 3300049162 Bacteria 836
1220 Ga0501307_077563 3300049162 Bacteria 538
1221 Ga0501311_006389 3300049527 Bacteria 1326
1222 Ga0501311_047856 3300049527 Bacteria 664
1223 Ga0501316_006060 3300049532 Bacteria 1276
1224 Ga0501316_012254 3300049532 Bacteria 1000
1225 Ga0501317_002825 3300049533 Bacteria 1679
1226 Ga0501317_036426 3300049533 Bacteria 735
1227 Ga0501318_001814 3300049534 Bacteria 1754
1228 Ga0501318_008287 3300049534 Bacteria 1107
1229 Ga0501320_006475 3300049536 Bacteria 1099
1230 Ga0501320_030349 3300049536 Bacteria 670
1231 Ga0501321_071856 3300049537 Bacteria 539
1232 Ga0501322_010990 3300049538 Bacteria 704
1233 Ga0501323_002812 3300049539 Bacteria 1724
1234 Ga0501323_029569 3300049539 Bacteria 764
1235 Ga0501325_003904 3300049541 Bacteria 1113
1236 Ga0501031_0141683 3300049568 Bacteria 1571
1237 Ga0501032_0166115 3300049569 Bacteria 1448
1238 Ga0501033_0124328 3300049570 Bacteria 1871
1239 Ga0501034_0239029 3300049571 Bacteria 1763
1240 Ga0501036_0306563 3300049572 Bacteria 1328
1241 Ga0501037_0015433 3300049573 Bacteria 5621
1242 Ga0501038_0044915 3300049574 Bacteria 3836
1243 Ga0501039_0014058 3300049575 Bacteria 6127
1244 Ga0501039_1133581 3300049575 Bacteria 606
1245 Ga0501043_0117362 3300049579 Bacteria 2088
1246 Ga0501046_0019700 3300049580 Bacteria 5592
1247 Ga0501047_0017930 3300049581 Bacteria 6786
1248 Ga0501047_1360530 3300049581 Bacteria 525
1249 Ga0501048_0315443 3300049582 Bacteria 1113
1250 Ga0501069_0267779 3300049585 Bacteria 998
1251 Ga0501072_0722698 3300049588 Bacteria 782
1252 Ga0501074_0143211 3300049590 Bacteria 1709
1253 Ga0501080_0542373 3300049742 Bacteria 1036
1254 Ga0501270_134122 3300049767 Bacteria 551
1255 Ga0501035_0131656 3300049822 Bacteria 2180
1256 Ga0501044_0194913 3300049823 Bacteria 1986
1257 Ga0501044_0414246 3300049823 Bacteria 1258
1258 nmdc:mga03n38_96710_c1 3300050490 Bacteria 1416
1259 nmdc:mga00v17_203983_c1 3300050491 Bacteria 1278
1260 nmdc:mga00v17_227557_c1 3300050491 Bacteria 1208
1261 nmdc:mga05p37_1883746_c1 3300050507 Bacteria 572
1262 nmdc:mga05p37_193252_c1 3300050507 Bacteria 2469
1263 nmdc:mga05p37_3761_c1 3300050507 Bacteria 17766
1264 nmdc:mga09592_1270461_c1 3300050508 Bacteria 606
1265 nmdc:mga0qj67_181757_c1 3300050509 Bacteria 1708
1266 nmdc:mga0qj67_532056_c1 3300050509 Bacteria 943
1267 nmdc:mga0qj67_574260_c1 3300050509 Bacteria 903
1268 nmdc:mga0qj67_669700_c1 3300050509 Bacteria 827
1269 nmdc:mga0qj67_756218_c1 3300050509 Bacteria 771
1270 nmdc:mga06r32_1042206_c1 3300050510 Bacteria 769
1271 nmdc:mga06r32_358355_c1 3300050510 Bacteria 1443
1272 nmdc:mga06r32_673191_c1 3300050510 Bacteria 1002
1273 nmdc:mga08y16_16801_c1 3300050511 Bacteria 7703
1274 nmdc:mga08y16_2184587_c1 3300050511 Bacteria 500
1275 nmdc:mga0n895_1553132_c1 3300050512 Unclassified 627
1276 nmdc:mga0n895_15902_c1 3300050512 Bacteria 6883
1277 nmdc:mga0rr50_12258_c1 3300050513 Bacteria 5530
1278 nmdc:mga08x19_292776_c1 3300050514 Bacteria 1130
1279 nmdc:mga08x19_951733_c1 3300050514 Bacteria 610
1280 nmdc:mga0a205_19224_c1 3300050515 Bacteria 6438
1281 nmdc:mga0a205_530497_c1 3300050515 Bacteria 1033
1282 nmdc:mga0sz30_92942_c1 3300050516 Bacteria 1313
1283 Ga0495601_0043789 3300053077 Bacteria 2811
1284 Ga0495601_0121933 3300053077 Bacteria 1693
1285 Ga0495601_0222997 3300053077 Bacteria 1231
1286 Ga0495601_0398758 3300053077 Bacteria 892
1287 Ga0495601_0647050 3300053077 Bacteria 676
1288 Ga0495612_0004276 3300053078 Bacteria 5933
1289 Ga0495612_0013342 3300053078 Bacteria 3310
1290 Ga0495612_0446661 3300053078 Bacteria 590
1291 Ga0495655_0148629 3300053083 Unclassified 735
1292 Ga0495595_0000864 3300053084 Bacteria 11649
1293 Ga0495595_0012168 3300053084 Bacteria 3612
1294 Ga0495595_0022322 3300053084 Bacteria 2777
1295 Ga0495595_0057337 3300053084 Bacteria 1817
1296 Ga0495595_0728299 3300053084 Bacteria 509
1297 Ga0495619_0020221 3300053085 Bacteria 4238
1298 Ga0495619_0061608 3300053085 Bacteria 2496
1299 Ga0495619_0127116 3300053085 Bacteria 1750
1300 Ga0495619_1205216 3300053085 Bacteria 501
1301 Ga0500643_010499 3300053087 Bacteria 3442
1302 Ga0500651_0068220 3300053093 Bacteria 2215
1303 Ga0500650_0020934 3300053098 Bacteria 2876
1304 Ga0500650_0175108 3300053098 Bacteria 985
1305 Ga0500562_065470 3300053108 Bacteria 979
1306 Ga0500594_0215454 3300053118 Bacteria 634
1307 Ga0500594_0322973 3300053118 Bacteria 518
1308 Ga0500621_099084 3300053126 Bacteria 1152
1309 Ga0500573_0182803 3300053140 Bacteria 1126
1310 Ga0500577_0426392 3300053142 Bacteria 580
1311 Ga0500579_094498 3300053143 Bacteria 1594
1312 Ga0500600_0162036 3300053149 Bacteria 1098
1313 Ga0500630_115641 3300053159 Bacteria 1197
1314 Ga0501084_0810902 3300054114 Bacteria 788
1315 Ga0590075_070474 3300059424 Bacteria 903
1316 Ga0587067_111827 3300059640 Bacteria 645
1317 Ga0530510_0249379 3300061734 Bacteria 1323
1318 2515496029 2515154088 Bacteria 5526283
1319 2515719800 2515154129 Bacteria 5584369
1320 2515757867 2515154137 Bacteria 5711575
1321 2516090293 2515154203 Bacteria 5458536
1322 2753264716 2751185782 Bacteria 11227053
1323 2861520641 2861520306 Bacteria 8348283
1324 2887482830 2887478801 Bacteria 8972725
1325 8001781895 8001781756 Bacteria 9586736
1326 Ga0070676_10597365
1327 JGI24735J21928_10094755
1328 JGI25406J46586_10248285
1329 rootL2_10152190
1330 rootL2_10152199
1331 Ga0058863_11912449
1332 Ga0058860_11883144
1333 Ga0070658_10741959
1334 Ga0070683_100271352
1335 Ga0070683_100480301
1336 Ga0070683_100979790
1337 Ga0070683_101566460
1338 Ga0070683_102025771
1339 Ga0070670_101393942
1340 Ga0070677_10679785
1341 Ga0068869_100002087
1342 Ga0068869_100055256
1343 Ga0068869_100434613
1344 Ga0068869_100730136
1345 Ga0068869_101302088
1346 Ga0070666_11203018
1347 Ga0070680_100006507
1348 Ga0070680_100178674
1349 Ga0070680_100297789
1350 Ga0070680_100392404
1351 Ga0070682_100435295
1352 Ga0070682_100679787
1353 Ga0070682_101206361
1354 Ga0068868_100029329
1355 Ga0068868_100346421
1356 Ga0068868_101676659
1357 Ga0070660_100220960
1358 Ga0070660_100282278
1359 Ga0070660_101045355
1360 Ga0070689_101713214
1361 Ga0070689_102221641
1362 Ga0070691_10032956
1363 Ga0070691_10853827
1364 Ga0070687_100761532
1365 Ga0070687_101089870
1366 Ga0070661_100048109
1367 Ga0070661_100114537
1368 Ga0070661_100554227
1369 Ga0070661_100920142
1370 Ga0070661_101718839
1371 Ga0070692_10245196
1372 Ga0070692_10277039
1373 Ga0070692_11310856
1374 Ga0070668_100003831
1375 Ga0070668_101426534
1376 Ga0070668_101870598
1377 Ga0070669_100425383
1378 Ga0070675_100016825
1379 Ga0070675_100623215
1380 Ga0070671_100437108
1381 Ga0070673_100719130
1382 Ga0070688_101589281
1383 Ga0070659_100015201
1384 Ga0070659_101460572
1385 Ga0070667_100019814
1386 Ga0070667_100148807
1387 Ga0070709_10198336
1388 Ga0070709_10232602
1389 Ga0070709_11312064
1390 Ga0070709_11572381
1391 Ga0070714_100002405
1392 Ga0070714_100006462
1393 Ga0070714_100132470
1394 Ga0070714_100222719
1395 Ga0070714_100391412
1396 Ga0070714_100748413
1397 Ga0070714_100913869
1398 Ga0070714_100914862
1399 Ga0070714_101249829
1400 Ga0070713_100002390
1401 Ga0070713_100018875
1402 Ga0070713_100028043
1403 Ga0070713_100109081
1404 Ga0070713_100157524
1405 Ga0070713_100358319
1406 Ga0070713_100473658
1407 Ga0070713_100698315
1408 Ga0070713_100946503
1409 Ga0070713_101228130
1410 Ga0070713_102420893
1411 Ga0070710_10073330
1412 Ga0070710_10205934
1413 Ga0070710_10317961
1414 Ga0070710_10786716
1415 Ga0070710_10856629
1416 Ga0070710_11158324
1417 Ga0070711_100053069
1418 Ga0070711_100082805
1419 Ga0070711_100189420
1420 Ga0070711_100194919
1421 Ga0070711_100436528
1422 Ga0070705_101162905
1423 Ga0070705_101460768
1424 Ga0070705_101700117
1425 Ga0070700_100068017
1426 Ga0070700_100991827
1427 Ga0070694_101344423
1428 Ga0070708_100070053
1429 Ga0070663_100132001
1430 Ga0070663_100171938
1431 Ga0070663_100304457
1432 Ga0070663_100357173
1433 Ga0070663_100379023
1434 Ga0070663_100583286
1435 Ga0070678_100063568
1436 Ga0070678_100739580
1437 Ga0070678_102104182
1438 Ga0070662_100344135
1439 Ga0070662_101727280
1440 Ga0070681_10000046
1441 Ga0070681_10122362
1442 Ga0070681_10574122
1443 Ga0070681_10809468
1444 Ga0070681_10962034
1445 Ga0068867_100098091
1446 Ga0070685_10761885
1447 Ga0070706_100001132
1448 Ga0070706_100523857
1449 Ga0070707_100906411
1450 Ga0070707_100925546
1451 Ga0070707_101295655
1452 Ga0070698_100114679
1453 Ga0070699_101518641
1454 Ga0070679_100001357
1455 Ga0070679_100022895
1456 Ga0070679_100181873
1457 Ga0070679_100210065
1458 Ga0070679_100419985
1459 Ga0070679_100940056
1460 Ga0070679_101727370
1461 Ga0070679_102164542
1462 Ga0070684_100049491
1463 Ga0070684_100131673
1464 Ga0070684_100264811
1465 Ga0070684_100486982
1466 Ga0070684_100691945
1467 Ga0070684_100755196
1468 Ga0070684_102320110
1469 Ga0070697_100543948
1470 Ga0070697_101478412
1471 Ga0068853_102079686
1472 Ga0070672_100345392
1473 Ga0070672_100656040
1474 Ga0070686_101934728
1475 Ga0070695_100196184
1476 Ga0070696_100052817
1477 Ga0070693_100629895
1478 Ga0070693_100911016
1479 Ga0070665_100394988
1480 Ga0070665_100495817
1481 Ga0070665_100578220
1482 Ga0070665_100632856
1483 Ga0070665_100880729
1484 Ga0070665_101801442
1485 Ga0070704_100627673
1486 Ga0068855_100035979
1487 Ga0070664_100003346
1488 Ga0070664_100100342
1489 Ga0070664_100346276
1490 Ga0070664_100454415
1491 Ga0070664_100592347
1492 Ga0070664_100691719
1493 Ga0068857_100064208
1494 Ga0068857_100064422
1495 Ga0068857_100104273
1496 Ga0068857_100120725
1497 Ga0068857_100476187
1498 Ga0068857_100656329
1499 Ga0068857_101007555
1500 Ga0068857_101738368
1501 Ga0068854_100046027
1502 Ga0068856_100179641
1503 Ga0068856_100420416
1504 Ga0068856_100556725
1505 Ga0068856_100674204
1506 Ga0068856_101052404
1507 Ga0068852_100126393
1508 Ga0068852_101270622
1509 Ga0068852_101815648
1510 Ga0068852_102319155
1511 Ga0068859_100471691
1512 Ga0068859_103053840
1513 Ga0068864_100164539
1514 Ga0068864_100505344
1515 Ga0068864_100647361
1516 Ga0068864_101267194
1517 Ga0068864_101267938
1518 Ga0068866_10364926
1519 Ga0068861_100152280
1520 Ga0068861_100478272
1521 Ga0068861_100968215
1522 Ga0068861_102279178
1523 Ga0068851_10833452
1524 Ga0068851_10919132
1525 Ga0068870_10196721
1526 Ga0068870_11380036
1527 Ga0068863_100112032
1528 Ga0068863_100295179
1529 Ga0068863_100398559
1530 Ga0068863_100438704
1531 Ga0068863_101175857
1532 Ga0068858_100000003
1533 Ga0068858_100400596
1534 Ga0068860_100351412
1535 Ga0068860_100417467
1536 Ga0068862_100319573
1537 Ga0068862_101461276
1538 Ga0081455_10193072
1539 Ga0081540_1006417
1540 Ga0081540_1008507
1541 Ga0081540_1168961
1542 Ga0081539_10000357
1543 Ga0081539_10000613
1544 Ga0081539_10001106
1545 Ga0081539_10021053
1546 Ga0081539_10050261
1547 Ga0081539_10210315
1548 Ga0070717_10086914
1549 Ga0070717_10117948
1550 Ga0070717_10155742
1551 Ga0070717_10190102
1552 Ga0070717_10410061
1553 Ga0070717_10473276
1554 Ga0070717_10535337
1555 Ga0070717_10628381
1556 Ga0070717_10629366
1557 Ga0070717_11406333
1558 Ga0075365_10840437
1559 Ga0075368_10346759
1560 Ga0075363_101029883
1561 Ga0075364_10132326
1562 Ga0075364_10241111
1563 Ga0075364_10953457
1564 Ga0070715_10012535
1565 Ga0070715_10261568
1566 Ga0070715_10337616
1567 Ga0070715_10849165
1568 Ga0070716_100017617
1569 Ga0070716_100037270
1570 Ga0070716_100111375
1571 Ga0070716_100206357
1572 Ga0070716_100263060
1573 Ga0070716_101131958
1574 Ga0070712_100001139
1575 Ga0070712_100062698
1576 Ga0070712_100260665
1577 Ga0070712_100970943
1578 Ga0070712_101211530
1579 Ga0070712_101580585
1580 Ga0070712_101957197
1581 Ga0075367_10247009
1582 Ga0097621_100520562
1583 Ga0097621_102335498
1584 Ga0068871_100730998
1585 Ga0068871_100904552
1586 Ga0068871_101836048
1587 Ga0068871_102262506
1588 Ga0075428_100131420
1589 Ga0075428_100176977
1590 Ga0075428_100749448
1591 Ga0075430_100311890
1592 Ga0075430_100811730
1593 Ga0075430_100821997
1594 Ga0075430_100825945
1595 Ga0075431_100110568
1596 Ga0075431_100262982
1597 Ga0075431_100602776
1598 Ga0075431_101403375
1599 Ga0075433_10288283
1600 Ga0075434_100639575
1601 Ga0075434_101380961
1602 Ga0075434_102089693
1603 Ga0075429_101497486
1604 Ga0068865_100412981
1605 Ga0097620_100471682
1606 Ga0097620_103055042
1607 Ga0105250_10627908
1608 Ga0105240_11588746
1609 Ga0105240_11644620
1610 Ga0111539_10360375
1611 Ga0111539_10434279
1612 Ga0105245_10091725
1613 Ga0105245_11264159
1614 Ga0105247_10000296
1615 Ga0105247_10113467
1616 Ga0105247_10534720
1617 Ga0105247_11340477
1618 Ga0114129_10000007
1619 Ga0114129_10217549
1620 Ga0114129_10328069
1621 Ga0114129_10446493
1622 Ga0114129_10861884
1623 Ga0114129_12230636
1624 Ga0105243_10229803
1625 Ga0105243_10578932
1626 Ga0105241_10073255
1627 Ga0105241_10349701
1628 Ga0105242_13090940
1629 Ga0105248_10011254
1630 Ga0105248_10091447
1631 Ga0105248_10840973
1632 Ga0105248_11241542
1633 Ga0105248_11669871
1634 Ga0105237_10579508
1635 Ga0105237_10707778
1636 Ga0105237_11472013
1637 Ga0105237_11977573
1638 Ga0105237_12623079
1639 Ga0105238_10658021
1640 Ga0105238_11845463
1641 Ga0105249_11150985
1642 Ga0099796_10567381
1643 Ga0105239_10466237
1644 Ga0105239_11445956
1645 Ga0105246_11274535
1646 Ga0105246_11389924
1647 Ga0105246_12246950
1648 Ga0157373_10534193
1649 Ga0157373_11344311
1650 Ga0157371_10390666
1651 Ga0157370_10315645
1652 Ga0157370_10762908
1653 Ga0157370_11754187
1654 Ga0157369_10008846
1655 Ga0157369_10016406
1656 Ga0157369_10158983
1657 Ga0157369_10190000
1658 Ga0157369_10282245
1659 Ga0157369_10559482
1660 Ga0157374_11395427
1661 Ga0157374_12050439
1662 Ga0157378_10533847
1663 Ga0157378_11174705
1664 Ga0157378_13033200
1665 Ga0163162_10833368
1666 Ga0157372_10000044
1667 Ga0157372_10695067
1668 Ga0157372_10726396
1669 Ga0157372_11537878
1670 Ga0157372_11832187
1671 Ga0157372_12481291
1672 Ga0157372_12621532
1673 Ga0157375_10590344
1674 Ga0157375_11217677
1675 Ga0157375_11285471
1676 Ga0163163_10134785
1677 Ga0163163_10426728
1678 Ga0163163_10933907
1679 Ga0163163_11719462
1680 Ga0163163_11830447
1681 Ga0163163_13202622
1682 Ga0157380_11461675
1683 Ga0157380_12275177
1684 Ga0182008_10804335
1685 Ga0157377_10286550
1686 Ga0157377_10687599
1687 Ga0157377_10838470
1688 Ga0157379_10000999
1689 Ga0157379_10346401
1690 Ga0157379_12180640
1691 Ga0157379_12295691
1692 Ga0157376_10066563
1693 Ga0157376_10852757
1694 Ga0163161_10742604
1695 Ga0184593_122585
1696 Ga0184601_119431
1697 Ga0184600_119799
1698 Ga0184603_112367
1699 Ga0197907_10027294
1700 Ga0197907_10220737
1701 Ga0197907_10601364
1702 Ga0197907_10893729
1703 Ga0206356_10997871
1704 Ga0206356_11372204
1705 Ga0206356_11671517
1706 Ga0206349_1553193
1707 Ga0206349_1886438
1708 Ga0206351_10291020
1709 Ga0206351_10579729
1710 Ga0206351_10889857
1711 Ga0206352_10038242
1712 Ga0206352_10136420
1713 Ga0206352_10289056
1714 Ga0206352_11208457
1715 Ga0206350_10168894
1716 Ga0206350_10655422
1717 Ga0206354_10034819
1718 Ga0206354_10148362
1719 Ga0206354_10287205
1720 Ga0206354_10606016
1721 Ga0206354_10631935
1722 Ga0206354_10751521
1723 Ga0206354_11147654
1724 Ga0206354_11494243
1725 Ga0206353_10658063
1726 Ga0206353_10693515
1727 Ga0206353_11116006
1728 Ga0206353_11271389
1729 Ga0206353_11430486
1730 Ga0206353_11796673
1731 Ga0224712_10060728
1732 Ga0224712_10067101
1733 Ga0224712_10073951
1734 Ga0224712_10107264
1735 Ga0224712_10145804
1736 Ga0224712_10203293
1737 Ga0224712_10506274
1738 Ga0247529_114344
1739 Ga0247530_109533
1740 Ga0207682_10170805
1741 Ga0207682_10590075
1742 Ga0207692_10000366
1743 Ga0207692_10128288
1744 Ga0207692_10289011
1745 Ga0207692_10344722
1746 Ga0207692_10357241
1747 Ga0207692_10364691
1748 Ga0207692_10714620
1749 Ga0207692_10991139
1750 Ga0207710_10000020
1751 Ga0207710_10411119
1752 Ga0207688_10896082
1753 Ga0207688_10899589
1754 Ga0207680_10647632
1755 Ga0207680_10889400
1756 Ga0207647_10738399
1757 Ga0207685_10166257
1758 Ga0207685_10168595
1759 Ga0207685_10788500
1760 Ga0207699_10003090
1761 Ga0207699_10015215
1762 Ga0207699_10258237
1763 Ga0207699_10382958
1764 Ga0207699_11056717
1765 Ga0207699_11310551
1766 Ga0207645_10169744
1767 Ga0207643_10246568
1768 Ga0207643_10720282
1769 Ga0207705_10038088
1770 Ga0207705_10244273
1771 Ga0207705_10471205
1772 Ga0207705_10829913
1773 Ga0207684_10001586
1774 Ga0207684_10021426
1775 Ga0207684_10522748
1776 Ga0207684_10576510
1777 Ga0207654_10109048
1778 Ga0207707_10000418
1779 Ga0207707_10053472
1780 Ga0207707_10661347
1781 Ga0207707_11173233
1782 Ga0207707_11173824
1783 Ga0207695_11143221
1784 Ga0207693_10004248
1785 Ga0207693_10086885
1786 Ga0207693_10216939
1787 Ga0207693_10541804
1788 Ga0207693_10920313
1789 Ga0207663_10220500
1790 Ga0207663_10232307
1791 Ga0207663_10409515
1792 Ga0207663_10564624
1793 Ga0207663_10630412
1794 Ga0207663_10938692
1795 Ga0207660_10000168
1796 Ga0207660_10156392
1797 Ga0207660_10986639
1798 Ga0207660_11165191
1799 Ga0207662_10344881
1800 Ga0207662_10693094
1801 Ga0207657_10028132
1802 Ga0207657_10557645
1803 Ga0207649_10021859
1804 Ga0207649_10333869
1805 Ga0207649_10844178
1806 Ga0207649_11072046
1807 Ga0207649_11079274
1808 Ga0207652_10000461
1809 Ga0207652_10209906
1810 Ga0207652_10478069
1811 Ga0207652_10600401
1812 Ga0207652_10673217
1813 Ga0207652_11844551
1814 Ga0207646_10011604
1815 Ga0207646_10082776
1816 Ga0207646_11432422
1817 Ga0207646_11694505
1818 Ga0207681_10178184
1819 Ga0207681_10697682
1820 Ga0207694_10864232
1821 Ga0207650_10633634
1822 Ga0207650_11378586
1823 Ga0207659_10004185
1824 Ga0207659_10293543
1825 Ga0207659_11864174
1826 Ga0207687_10057947
1827 Ga0207700_10008761
1828 Ga0207700_10043804
1829 Ga0207700_10109682
1830 Ga0207700_10173207
1831 Ga0207700_10422868
1832 Ga0207700_10467342
1833 Ga0207700_10791159
1834 Ga0207700_10868618
1835 Ga0207700_11420379
1836 Ga0207700_11521831
1837 Ga0207664_10002028
1838 Ga0207664_10020733
1839 Ga0207664_10021120
1840 Ga0207664_10032443
1841 Ga0207664_10202640
1842 Ga0207664_10321487
1843 Ga0207664_10371665
1844 Ga0207664_10514508
1845 Ga0207664_10549317
1846 Ga0207664_10785581
1847 Ga0207664_11428326
1848 Ga0207644_11000874
1849 Ga0207690_10067601
1850 Ga0207706_10367734
1851 Ga0207706_11064928
1852 Ga0207669_10904033
1853 Ga0207704_10383396
1854 Ga0207704_11896187
1855 Ga0207665_10001687
1856 Ga0207665_10423495
1857 Ga0207665_10934355
1858 Ga0207665_11047892
1859 Ga0207691_10186014
1860 Ga0207691_10431019
1861 Ga0207711_10103798
1862 Ga0207711_10368503
1863 Ga0207711_10635389
1864 Ga0207711_11288493
1865 Ga0207689_10058040
1866 Ga0207689_10074648
1867 Ga0207689_10343761
1868 Ga0207689_10569861
1869 Ga0207689_10835303
1870 Ga0207661_10001620
1871 Ga0207661_10152677
1872 Ga0207661_10184007
1873 Ga0207661_10288319
1874 Ga0207661_10448037
1875 Ga0207661_10627931
1876 Ga0207661_10970265
1877 Ga0207661_11171209
1878 Ga0207661_11231299
1879 Ga0207661_12016946
1880 Ga0207679_10008106
1881 Ga0207679_10128346
1882 Ga0207679_10177093
1883 Ga0207679_10213125
1884 Ga0207679_10293448
1885 Ga0207679_10442693
1886 Ga0207679_10515970
1887 Ga0207679_10684669
1888 Ga0207667_10193892
1889 Ga0207667_12226164
1890 Ga0207651_10983086
1891 Ga0207651_11819403
1892 Ga0207712_10205948
1893 Ga0207668_10002358
1894 Ga0207668_10979034
1895 Ga0207668_11130726
1896 Ga0207668_11483594
1897 Ga0207640_10706683
1898 Ga0207640_11281141
1899 Ga0207658_10437789
1900 Ga0207677_11271344
1901 Ga0207703_10000006
1902 Ga0207678_10122234
1903 Ga0207678_10130372
1904 Ga0207678_10187353
1905 Ga0207678_10219833
1906 Ga0207678_10221569
1907 Ga0207678_10338850
1908 Ga0207708_10094016
1909 Ga0207708_10322248
1910 Ga0207708_10365112
1911 Ga0207708_10396538
1912 Ga0207708_10651524
1913 Ga0207702_10144165
1914 Ga0207702_10398334
1915 Ga0207702_10680302
1916 Ga0207702_10830201
1917 Ga0207702_10971220
1918 Ga0207702_11136278
1919 Ga0207702_11444860
1920 Ga0207702_12369271
1921 Ga0207641_10077025
1922 Ga0207641_10139497
1923 Ga0207641_11391622
1924 Ga0207648_10131181
1925 Ga0207676_10035666
1926 Ga0207676_10160836
1927 Ga0207676_10525346
1928 Ga0207676_10573248
1929 Ga0207676_10660512
1930 Ga0207676_10940344
1931 Ga0207676_11625257
1932 Ga0207674_10019875
1933 Ga0207674_10158216
1934 Ga0207674_10174824
1935 Ga0207674_10221562
1936 Ga0207674_10289063
1937 Ga0207674_10717995
1938 Ga0207674_11569659
1939 Ga0207674_11594510
1940 Ga0207674_12109520
1941 Ga0207675_100014030
1942 Ga0207675_100397758
1943 Ga0207675_100508119
1944 Ga0207675_100536457
1945 Ga0207675_101013001
1946 Ga0207683_10078213
1947 Ga0207683_10232623
1948 Ga0207683_10286254
1949 Ga0207698_10688978
1950 Ga0207698_10898864
1951 Ga0207698_11549697
1952 Ga0207428_10080319
1953 Ga0268266_10207834
1954 Ga0268266_10688606
1955 Ga0268266_11819046
1956 Ga0268265_10014957
1957 Ga0268265_10568707
1958 Ga0268265_11072539
1959 Ga0268265_11879882
1960 Ga0268264_10139955
1961 Ga0268264_10404078
1962 Ga0265336_10042279
1963 Ga0307517_10115171
1964 Ga0307517_10503128
1965 Ga0307515_10000045
1966 Ga0307515_10015993
1967 Ga0307515_10032705
1968 Ga0307515_10051803
1969 Ga0307515_10207412
1970 Ga0265338_10000680
1971 Ga0310981_1042067
1972 Ga0307512_10007169
1973 Ga0307512_10076400
1974 Ga0307512_10115066
1975 Ga0307512_10171240
1976 Ga0316178_1088482
1977 Ga0307513_10015297
1978 Ga0307513_10056025
1979 Ga0307513_10144144
1980 Ga0307509_10018024
1981 Ga0307509_10123651
1982 Ga0307509_10367065
1983 Ga0307408_100075391
1984 Ga0307408_101358571
1985 Ga0307408_102216215
1986 Ga0310117_107422
1987 Ga0310103_113480
1988 Ga0307508_10003422
1989 Ga0307508_10018512
1990 Ga0307508_10018782
1991 Ga0307508_10027035
1992 Ga0307508_10030578
1993 Ga0307508_10136839
1994 Ga0307514_10175386
1995 Ga0310119_125356
1996 Ga0307516_10006648
1997 Ga0307516_10014878
1998 Ga0307516_10018382
1999 Ga0307516_10297527
2000 Ga0307405_10005914
2001 Ga0307405_10087274
2002 Ga0307405_10547147
2003 Ga0307405_10793985
2004 Ga0307405_10858681
2005 Ga0307405_11497041
2006 Ga0316044_122642
2007 Ga0316045_127068
2008 Ga0307413_10168551
2009 Ga0307413_10436486
2010 Ga0307413_11080941
2011 Ga0307413_11837754
2012 Ga0307410_10023845
2013 Ga0307410_10300718
2014 Ga0307410_10890291
2015 Ga0307410_11508923
2016 Ga0307410_11934746
2017 Ga0307406_10002273
2018 Ga0307406_10008054
2019 Ga0307406_10033659
2020 Ga0307406_10367532
2021 Ga0307406_10384306
2022 Ga0307406_10537660
2023 Ga0307406_10638900
2024 Ga0307406_10706285
2025 Ga0307406_10744809
2026 Ga0307406_11004840
2027 Ga0307407_10008322
2028 Ga0307407_10061396
2029 Ga0307407_10446597
2030 Ga0307407_10801878
2031 Ga0307407_11401179
2032 Ga0307412_10082849
2033 Ga0307412_12319051
2034 Ga0307409_100011902
2035 Ga0307409_100054640
2036 Ga0307409_100185269
2037 Ga0307409_100240682
2038 Ga0307409_100543258
2039 Ga0307409_101346036
2040 Ga0307409_101483187
2041 Ga0307409_102006274
2042 Ga0307409_102236131
2043 Ga0307409_102293295
2044 Ga0307416_100001161
2045 Ga0307416_100116839
2046 Ga0307416_100438689
2047 Ga0307416_101368479
2048 Ga0307416_101679290
2049 Ga0307416_102214557
2050 Ga0307416_102510581
2051 Ga0307414_10528885
2052 Ga0307411_10932966
2053 Ga0307411_11685890
2054 Ga0307411_11927204
2055 Ga0316053_117435
2056 Ga0307415_100000190
2057 Ga0307415_100004484
2058 Ga0307415_100022219
2059 Ga0307415_100164818
2060 Ga0307415_100222900
2061 Ga0307415_100382085
2062 Ga0307415_100404310
2063 Ga0307415_100530044
2064 Ga0307415_100780641
2065 Ga0307415_102355540
2066 Ga0307507_10012122
2067 Ga0307507_10211728
2068 Ga0307507_10447943
2069 Ga0307510_10385505
2070 Ga0316214_1004474
2071 Ga0373930_0011603
2072 Ga0373948_0004465
2073 Ga0373950_0121524
2074 Ga0373958_0026477
2075 Ga0373959_0131207
2076 Ga0373926_0088989
2077 Ga0373926_0259422
2078 Ga0373928_0004059
2079 Ga0373928_0121382
2080 Ga0373934_0000034
2081 Ga0373934_0015572
2082 Ga0373934_0016744
2083 Ga0373934_0039606
2084 Ga0373940_0068300
2085 Ga0373944_0010680
2086 Ga0373944_0063547
2087 Ga0373944_0313979
2088 Ga0373944_0430426
2089 Ga0373949_0016313
2090 Ga0373951_0000004
2091 Ga0373951_0068872
2092 Ga0373923_0000906
2093 Ga0373923_0171819
2094 Ga0373923_0260816
2095 Ga0373923_0263823
2096 Ga0373932_0052367
2097 Ga0373936_0047619
2098 Ga0373936_0092749
2099 Ga0373939_0029292
2100 Ga0373941_0128570
2101 Ga0373945_0027244
2102 Ga0373945_0118615
2103 Ga0373953_0000176
2104 Ga0373953_0005548
2105 Ga0373953_0045154
2106 Ga0373953_0250111
2107 Ga0373954_0002651
2108 Ga0373954_0066894
2109 Ga0373954_0082825
2110 Ga0373954_0212722
2111 Ga0373954_0392805
2112 Ga0373956_0000479
2113 Ga0373956_0073581
2114 Ga0373956_0152272
2115 Ga0373956_0477923
2116 Ga0373957_0000488
2117 Ga0373957_0006537
2118 Ga0373957_0028711
2119 Ga0373957_0094883
2120 Ga0373957_0310731
2121 Ga0373957_0358319
2122 Ga0373960_0265397
2123 Ga0373943_0127602
2124 Ga0373943_0571597
2125 Ga0373943_0682654
2126 Ga0373946_0016191
2127 Ga0373955_0000080
2128 Ga0373955_0010334
2129 Ga0373955_0683920
2130 Ga0373942_0060387
2131 Ga0373962_0000172
2132 Ga0373924_0000942
2133 Ga0373924_0008562
2134 Ga0373924_0023674
2135 Ga0373931_0130103
2136 Ga0373931_0441831
2137 Ga0373935_0023454
2138 Ga0373935_0024335
2139 Ga0373935_0041109
2140 Ga0373935_0316326
2141 Ga0373935_0624336
2142 Ga0373935_0785326
2143 Ga0373927_0145185
2144 Ga0373927_0164621
2145 Ga0373927_0631886
2146 Ga0373933_0000461
2147 Ga0373933_0003054
2148 Ga0373933_0004243
2149 Ga0373933_0007059
2150 Ga0373933_0009456
2151 Ga0373947_0044386
2152 Ga0373947_0081060
2153 Ga0373947_0332566
2154 Ga0373947_0473092
2155 Ga0310104_10395
2156 Ga0373937_0000023
2157 Ga0373937_0045127
2158 Ga0373937_0170921
2159 Ga0373937_0239762
2160 Ga0373937_0378208
2161 Ga0373937_0602837
2162 Ga0373937_1396253
2163 Ga0373937_1610489
2164 Ga0265778_044208
2165 Ga0310112_047578
2166 Ga0310109_019976
2167 Ga0373925_0011651
2168 Ga0373925_0074311
2169 Ga0373925_0254653
2170 Ga0373925_0329578
2171 Ga0373925_0682765
2172 Ga0373925_1304930
2173 Ga0395899_0009471
2174 Ga0395900_0006872
2175 Ga0395900_0581918
2176 Ga0395900_0745628
2177 Ga0395898_0005950
2178 Ga0395898_0016606
2179 Ga0395898_0031971
2180 Ga0395898_0039905
2181 Ga0395905_0006430
2182 Ga0395905_1632557
2183 Ga0395901_0009122
2184 Ga0395901_0028124
2185 Ga0395901_0470942
2186 Ga0436365_0843445
2187 Ga0436363_0176675
2188 Ga0436363_0695637
2189 Ga0436363_0855063
2190 Ga0439438_145140
2191 Ga0451789_0793300
2192 Ga0451790_37344
2193 Ga0451791_1219190
2194 Ga0451793_0029799
2195 Ga0451793_1560447
2196 Ga0451797_0145031
2197 Ga0451798_0529368
2198 Ga0451802_2162425
2199 Ga0451804_0431050
2200 Ga0451807_0456693
2201 Ga0451833_0384247
2202 Ga0451833_0883276
2203 Ga0451833_1374928
2204 Ga0451835_0266027
2205 Ga0451837_0384947
2206 Ga0451837_1660227
2207 Ga0451839_0144053
2208 Ga0451839_1546639
2209 Ga0451841_0000410
2210 Ga0451849_0068873
2211 Ga0451851_0087835
2212 Ga0451843_0134207
2213 Ga0451843_0586583
2214 Ga0451853_0738829
2215 Ga0451853_0892057
2216 Ga0451853_1306632
2217 Ga0439449_0023685
2218 Ga0450902_082829
2219 Ga0439440_0098191
2220 Ga0466972_0150615
2221 Ga0466965_0135429
2222 Ga0466965_0136507
2223 Ga0466966_0014016
2224 Ga0466961_0110007
2225 Ga0466963_0153592
2226 Ga0466963_0443705
2227 Ga0466963_0582934
2228 Ga0466970_0385730
2229 Ga0466957_1136394
2230 Ga0466960_0230832
2231 Ga0466960_0923893
2232 Ga0466959_0002019
2233 Ga0466958_0594422
2234 Ga0466967_0084531
2235 Ga0466967_0597071
2236 Ga0466967_0823059
2237 Ga0466967_2537298
2238 Ga0495592_0000523
2239 Ga0495592_0047127
2240 Ga0495592_0078356
2241 Ga0495592_0108893
2242 Ga0495592_0138027
2243 Ga0495629_0008073
2244 Ga0495629_0043738
2245 Ga0495629_0060229
2246 Ga0495629_0604591
2247 Ga0495641_0065653
2248 Ga0495651_0000015
2249 Ga0495651_0001165
2250 Ga0495651_0004771
2251 Ga0495651_0052415
2252 Ga0495651_0072130
2253 Ga0495651_0078871
2254 Ga0495651_0369516
2255 Ga0495651_0673918
2256 Ga0495651_0888577
2257 Ga0495653_0002364
2258 Ga0495653_0032581
2259 Ga0495653_0063119
2260 Ga0495653_0081544
2261 Ga0495653_0085195
2262 Ga0495653_0098480
2263 Ga0495653_0793210
2264 Ga0495580_0048917
2265 Ga0495582_0017459
2266 Ga0495582_0046415
2267 Ga0495582_0096027
2268 Ga0495639_0042215
2269 Ga0495639_0089477
2270 Ga0495639_0306543
2271 Ga0495662_0000284
2272 Ga0495662_0010843
2273 Ga0495662_0090867
2274 Ga0495662_0167692
2275 Ga0495664_0002113
2276 Ga0495664_0044660
2277 Ga0495664_0070353
2278 Ga0495664_0093077
2279 Ga0495664_0109117
2280 Ga0495664_0141809
2281 Ga0495664_0200455
2282 Ga0495594_0030177
2283 Ga0495606_0001817
2284 Ga0495608_0000468
2285 Ga0495608_0000479
2286 Ga0495608_0001967
2287 Ga0495608_0040333
2288 Ga0495608_0134064
2289 Ga0495608_0242349
2290 Ga0495618_0042843
2291 Ga0495618_0101977
2292 Ga0495618_0114829
2293 Ga0495618_0160048
2294 Ga0495618_0717185
2295 Ga0495628_0000240
2296 Ga0495628_0099618
2297 Ga0495628_0108077
2298 Ga0495628_0281087
2299 Ga0495628_0442640
2300 Ga0495628_0446630
2301 Ga0495628_0579258
2302 Ga0495628_1081472
2303 Ga0495628_1210952
2304 Ga0495630_0021401
2305 Ga0495630_0105860
2306 Ga0495630_0258767
2307 Ga0495630_0287670
2308 Ga0495630_0466692
2309 Ga0495630_1398433
2310 Ga0495632_0011770
2311 Ga0495632_0037493
2312 Ga0495666_0066637
2313 Ga0495652_0000044
2314 Ga0495652_0001965
2315 Ga0495652_0105008
2316 Ga0495652_0258526
2317 Ga0495652_0430761
2318 Ga0495652_0468695
2319 Ga0495652_0785543
2320 Ga0495652_1002449
2321 Ga0495665_0002759
2322 Ga0495665_0003349
2323 Ga0495665_0072418
2324 Ga0495665_0088226
2325 Ga0495640_0007442
2326 Ga0495640_0025022
2327 Ga0495640_0075371
2328 Ga0495640_0156354
2329 Ga0495640_0178671
2330 Ga0495640_0809730
2331 Ga0495586_0005641
2332 Ga0495586_0119417
2333 Ga0495586_0202504
2334 Ga0495586_0799812
2335 Ga0495586_0888547
2336 Ga0495587_0000480
2337 Ga0495587_0012542
2338 Ga0495587_0013195
2339 Ga0495587_0045798
2340 Ga0495587_0046886
2341 Ga0495587_0078793
2342 Ga0495587_0402611
2343 Ga0495645_0001777
2344 Ga0495645_0057400
2345 Ga0495645_0064958
2346 Ga0495645_0108633
2347 Ga0495645_0134448
2348 Ga0495645_0245513
2349 Ga0495645_0269798
2350 Ga0495645_0494553
2351 Ga0495645_0609908
2352 Ga0495622_0233600
2353 Ga0495622_0453209
2354 Ga0495667_0000404
2355 Ga0495667_0004295
2356 Ga0495667_0004370
2357 Ga0495667_0010109
2358 Ga0495667_0047816
2359 Ga0495667_0077997
2360 Ga0495668_0000828
2361 Ga0495668_0746430
2362 Ga0495634_0012933
2363 Ga0495634_0023988
2364 Ga0495634_0038380
2365 Ga0495625_0001049
2366 Ga0495635_0004526
2367 Ga0495635_0011486
2368 Ga0495635_0070785
2369 Ga0495635_0364213
2370 Ga0495635_0483682
2371 Ga0495635_0574932
2372 Ga0495635_0599846
2373 Ga0495588_0174896
2374 Ga0495657_0000030
2375 Ga0495657_0001488
2376 Ga0495657_0003565
2377 Ga0495657_0016585
2378 Ga0495657_0025762
2379 Ga0495657_0073978
2380 Ga0495599_0000771
2381 Ga0495599_0015439
2382 Ga0495599_0050276
2383 Ga0495599_0066328
2384 Ga0495599_0150498
2385 Ga0495599_0255630
2386 Ga0495623_0002193
2387 Ga0495623_0011410
2388 Ga0495623_0048091
2389 Ga0495623_0188485
2390 Ga0495623_0698649
2391 Ga0495646_0022727
2392 Ga0495646_0026728
2393 Ga0495646_0035482
2394 Ga0495646_0102944
2395 Ga0495658_0048352
2396 Ga0495613_0008225
2397 Ga0495613_0076339
2398 Ga0495613_0144561
2399 Ga0495613_0194005
2400 Ga0495613_0394121
2401 Ga0495613_0496700
2402 Ga0495624_0145712
2403 Ga0495624_0314944
2404 Ga0495624_0338410
2405 Ga0495624_0351573
2406 Ga0495624_0365577
2407 Ga0495624_0487878
2408 Ga0495649_0361974
2409 Ga0495600_0004854
2410 Ga0495600_0046994
2411 Ga0495600_0060637
2412 Ga0495600_0204615
2413 Ga0495600_0208378
2414 Ga0495600_0423936
2415 Ga0495581_0021493
2416 Ga0495581_0022179
2417 Ga0495581_0207983
2418 Ga0495604_0000726
2419 Ga0495604_0001997
2420 Ga0495604_0066152
2421 Ga0495604_0066167
2422 Ga0495604_0069257
2423 Ga0495604_0102173
2424 Ga0495604_0203787
2425 Ga0495636_0521784
2426 Ga0495674_0005608
2427 Ga0495674_0018411
2428 Ga0495674_0046272
2429 Ga0495674_0131381
2430 Ga0495674_0141183
2431 Ga0495674_0143889
2432 Ga0495674_0173144
2433 Ga0495674_0810656
2434 Ga0495676_0089100
2435 Ga0495676_0181027
2436 Ga0495676_0222378
2437 Ga0495676_0904004
2438 Ga0495680_0002167
2439 Ga0495680_0047604
2440 Ga0495680_0085959
2441 Ga0495680_0114753
2442 Ga0495680_0116312
2443 Ga0495680_0165720
2444 Ga0495683_0073066
2445 Ga0495687_158722
2446 Ga0495675_0002225
2447 Ga0495675_0002248
2448 Ga0495675_0008897
2449 Ga0495675_0009653
2450 Ga0495675_0034922
2451 Ga0495675_0322250
2452 Ga0495675_0656626
2453 Ga0495684_0046859
2454 Ga0495684_0052322
2455 Ga0495684_0058663
2456 Ga0495684_0160591
2457 Ga0495684_0306343
2458 Ga0495684_0409190
2459 Ga0495684_0533944
2460 Ga0495593_0051176
2461 Ga0495593_0146375
2462 Ga0495593_0273158
2463 Ga0495593_0312539
2464 Ga0495602_0000973
2465 Ga0495602_0033691
2466 Ga0495602_0067865
2467 Ga0495602_0136874
2468 Ga0495602_0156864
2469 Ga0495602_0256585
2470 Ga0495602_1057778
2471 Ga0495614_0012354
2472 Ga0495614_0052674
2473 Ga0495626_0000129
2474 Ga0496100_0144972
2475 Ga0496101_0085492
2476 Ga0496102_0055998
2477 Ga0496102_0074600
2478 Ga0496102_0082888
2479 Ga0496102_1622732
2480 Ga0496103_0065291
2481 Ga0496103_0408747
2482 Ga0496103_0596065
2483 Ga0496104_0000414
2484 Ga0496104_0082301
2485 Ga0496104_0144963
2486 Ga0496105_0007787
2487 Ga0496105_0104627
2488 Ga0496105_0518731
2489 Ga0496106_0918867
2490 Ga0496106_1104034
2491 Ga0496106_1332056
2492 Ga0496107_0235987
2493 Ga0496107_0273011
2494 Ga0496107_0727532
2495 Ga0496108_0000048
2496 Ga0496108_0045957
2497 Ga0496108_0198795
2498 Ga0496109_0110811
2499 Ga0496109_0207911
2500 Ga0496109_0286849
2501 Ga0496109_1347613
2502 Ga0496109_1810241
2503 Ga0496110_0117451
2504 Ga0496110_0433756
2505 Ga0496110_1475921
2506 Ga0496111_0842161
2507 Ga0496111_0857772
2508 Ga0496111_0938096
2509 Ga0496112_0000596
2510 Ga0496112_0084551
2511 Ga0496112_0189572
2512 Ga0496112_0224263
2513 Ga0496112_0368641
2514 Ga0496112_0766103
2515 Ga0496112_1174697
2516 Ga0496113_0002740
2517 Ga0496113_0111148
2518 Ga0496113_0174879
2519 Ga0496113_0362740
2520 Ga0496113_0555702
2521 Ga0496114_0221247
2522 Ga0496114_0742514
2523 Ga0496115_0018404
2524 Ga0496115_0131057
2525 Ga0496115_0608248
2526 Ga0496115_0613648
2527 Ga0496115_0772859
2528 Ga0496119_0118301
2529 Ga0496120_0349067
2530 Ga0496121_0029885
2531 Ga0496121_0146270
2532 Ga0496125_0523936
2533 Ga0496126_0000006
2534 Ga0496126_0062845
2535 Ga0496126_0091910
2536 Ga0496126_0157059
2537 Ga0496126_0799361
2538 Ga0496126_1288642
2539 Ga0501306_011107
2540 Ga0501306_029189
2541 Ga0501308_080298
2542 Ga0501309_018349
2543 Ga0501305_031356
2544 Ga0501307_021961
2545 Ga0501307_077563
2546 Ga0501311_006389
2547 Ga0501311_047856
2548 Ga0501316_006060
2549 Ga0501316_012254
2550 Ga0501317_002825
2551 Ga0501317_036426
2552 Ga0501318_001814
2553 Ga0501318_008287
2554 Ga0501320_006475
2555 Ga0501320_030349
2556 Ga0501321_071856
2557 Ga0501322_010990
2558 Ga0501323_002812
2559 Ga0501323_029569
2560 Ga0501325_003904
2561 Ga0501031_0141683
2562 Ga0501032_0166115
2563 Ga0501033_0124328
2564 Ga0501034_0239029
2565 Ga0501036_0306563
2566 Ga0501037_0015433
2567 Ga0501038_0044915
2568 Ga0501039_0014058
2569 Ga0501039_1133581
2570 Ga0501043_0117362
2571 Ga0501046_0019700
2572 Ga0501047_0017930
2573 Ga0501047_1360530
2574 Ga0501048_0315443
2575 Ga0501069_0267779
2576 Ga0501072_0722698
2577 Ga0501074_0143211
2578 Ga0501080_0542373
2579 Ga0501270_134122
2580 Ga0501035_0131656
2581 Ga0501044_0194913
2582 Ga0501044_0414246
2583 nmdc:mga03n38_96710_c1
2584 nmdc:mga00v17_203983_c1
2585 nmdc:mga00v17_227557_c1
2586 nmdc:mga05p37_1883746_c1
2587 nmdc:mga05p37_193252_c1
2588 nmdc:mga05p37_3761_c1
2589 nmdc:mga09592_1270461_c1
2590 nmdc:mga0qj67_181757_c1
2591 nmdc:mga0qj67_532056_c1
2592 nmdc:mga0qj67_574260_c1
2593 nmdc:mga0qj67_669700_c1
2594 nmdc:mga0qj67_756218_c1
2595 nmdc:mga06r32_1042206_c1
2596 nmdc:mga06r32_358355_c1
2597 nmdc:mga06r32_673191_c1
2598 nmdc:mga08y16_16801_c1
2599 nmdc:mga08y16_2184587_c1
2600 nmdc:mga0n895_1553132_c1
2601 nmdc:mga0n895_15902_c1
2602 nmdc:mga0rr50_12258_c1
2603 nmdc:mga08x19_292776_c1
2604 nmdc:mga08x19_951733_c1
2605 nmdc:mga0a205_19224_c1
2606 nmdc:mga0a205_530497_c1
2607 nmdc:mga0sz30_92942_c1
2608 Ga0495601_0043789
2609 Ga0495601_0121933
2610 Ga0495601_0222997
2611 Ga0495601_0398758
2612 Ga0495601_0647050
2613 Ga0495612_0004276
2614 Ga0495612_0013342
2615 Ga0495612_0446661
2616 Ga0495655_0148629
2617 Ga0495595_0000864
2618 Ga0495595_0012168
2619 Ga0495595_0022322
2620 Ga0495595_0057337
2621 Ga0495595_0728299
2622 Ga0495619_0020221
2623 Ga0495619_0061608
2624 Ga0495619_0127116
2625 Ga0495619_1205216
2626 Ga0500643_010499
2627 Ga0500651_0068220
2628 Ga0500650_0020934
2629 Ga0500650_0175108
2630 Ga0500562_065470
2631 Ga0500594_0215454
2632 Ga0500594_0322973
2633 Ga0500621_099084
2634 Ga0500573_0182803
2635 Ga0500577_0426392
2636 Ga0500579_094498
2637 Ga0500600_0162036
2638 Ga0500630_115641
2639 Ga0501084_0810902
2640 Ga0590075_070474
2641 Ga0587067_111827
2642 Ga0530510_0249379
2643 2515496029
2644 2515719800
2645 2515757867
2646 2516090293
2647 2753264716
2648 2861520641
2649 2887482830
2650 8001781895

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13083

KhpA-B_KH

KhpA/KhpB, KH domain

20

89

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
8crx-assembly1.cif.gz_G cutibacterium acnes 70s ribosome with mrna, p-site trna and sarecycline bound 0.8129 2 74
5iqr-assembly1.cif.gz_h error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8081 2 74
7n1p-assembly1.cif.gz_SC elongating 70s ribosome complex in a classical pre-translocation (pre-c) conformation 0.7925 2 74
7zag-assembly1.cif.gz_Z cryo-em structure of a pyrococcus abyssi 30s bound to met-initiator trna,mrna, aif1a and the c-terminal domain of aif5b. 0.7899 2 74
6zj3-assembly1.cif.gz_SC cryo-em structure of the highly atypical cytoplasmic ribosome of euglena gracilis 0.7799 2 74
ID Description Score Start End Superfamily
af_P9WFM7_9_77_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9826 7 74 3.30.300.20
af_P9WFM7_9_77_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.955 7 74 3.30.300.20
af_P0AFF6_278_343_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.781 1 77 3.30.300.20
2cy1A02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.7781 1 73 3.30.300.20
5xxuD01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.7748 2 74 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A6N7GEQ5-F1-model_v4 RNA-binding protein KhpA (KH-domain protein A) 0.9947 2 74 GO:0003723
GO:0005737
AF-A0A7X6NU24-F1-model_v4 RNA-binding protein 0.9727 1 60 GO:0003723
AF-A0A523RLL8-F1-model_v4 KH domain-containing protein 0.9615 1 74 GO:0003723
AF-A0A3A4U8U8-F1-model_v4 RNA-binding protein KhpA (KH-domain protein A) 0.9612 1 74 GO:0003723
GO:0005737
GO:0008360
GO:0009252
GO:0071555
AF-A0A562VAG7-F1-model_v4 RNA-binding protein KhpA (KH-domain protein A) 0.9578 1 74 GO:0003723
GO:0005737

Map