F493002

General Info

Members Datasets Scaffolds Average Seq Length
1323 489 1297 220

Family's Representative Sequence

Representative Sequence 3300031238|Ga0265332_10093416|Ga0265332_100934162
Length 247
Sequence MGPGSRAFALGRDDHRRMWPELGSAWMDALIQQFFNLDIMARALPLVLSGLRETLLLCLIVIPLGLAGGLLFALASLAPSRTVRWGMIVAIDFFRAVPPLVLLIFVYSGLPFSGVRLSPLAAVAVAFFLNTSSYYGEIYRAGLESVGRGQWDAARSTGLNVFHTLGFVVLPQAVRNVLPDLVSNTVEVVKLTSIASVVALPEMLYSADMARSVTFNASPIVLAAAIYLVMLWPVVRLISRLERRMAS

Samples

Sample ID Description Type Environment
1 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
2 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
3 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
4 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
5 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
6 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
7 2818991467 Bosea vestrisii 3192 Isolate Unclassified
8 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
9 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
10 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
11 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
12 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
13 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
14 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
15 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
16 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
17 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
18 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
19 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
20 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
21 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
22 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
23 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
25 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
26 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
27 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
40 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
53 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
54 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
55 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
56 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
57 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
58 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
59 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
60 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
61 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
62 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
63 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
64 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
65 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
66 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
67 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
68 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
69 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
70 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
71 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
72 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
73 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
74 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
75 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
76 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
77 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
78 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
79 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
80 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
81 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
82 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
83 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
84 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
85 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
86 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
87 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
88 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
89 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
90 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
91 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
92 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
93 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
94 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
95 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
96 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
97 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
98 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
99 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
100 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
101 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
102 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
103 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
104 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
105 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
106 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
107 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
108 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
109 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
110 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
111 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
112 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
113 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
114 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
115 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
116 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
117 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
118 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
119 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
120 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
121 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
122 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
123 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
124 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
125 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
126 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
127 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
128 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
129 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
130 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
131 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
132 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
133 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
134 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
135 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
136 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
137 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
138 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
139 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
140 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
141 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
142 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
143 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
144 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
145 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
146 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
147 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
148 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
149 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
150 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
151 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
152 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
153 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
154 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
155 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
156 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
157 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
158 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
159 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
160 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
161 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
162 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
163 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
164 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
165 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
166 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
167 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
168 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
169 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
233 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
242 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
244 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
248 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
249 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
250 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
251 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
252 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
253 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
254 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
255 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
256 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
257 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
258 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
259 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
260 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
261 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
262 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
263 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
264 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
265 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
266 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
267 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
268 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
269 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
270 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
271 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
272 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
273 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
274 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
275 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
276 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
277 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
278 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
279 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
280 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
281 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
282 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
283 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
284 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
285 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
286 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
287 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
288 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
289 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
290 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
291 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
292 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
293 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
294 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
295 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
296 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
297 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
298 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
299 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
300 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
301 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
302 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
303 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
304 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
305 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
306 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
307 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
308 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
309 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
310 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
311 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
312 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
313 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
314 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
315 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
316 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
317 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
318 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
319 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
320 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
321 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
322 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
323 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
324 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
325 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
326 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
327 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
328 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
329 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
330 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
331 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
332 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
333 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
334 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
335 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
336 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
337 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
338 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
339 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
340 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
341 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
342 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
343 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
344 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
345 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
346 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
347 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
348 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
349 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
350 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
351 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
352 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
353 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
354 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
355 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
356 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
357 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
358 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
359 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
360 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
361 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
362 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
363 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
364 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
365 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
366 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
367 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
368 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
369 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
370 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
371 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
372 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
373 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
374 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
375 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
376 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
377 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
378 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
379 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
380 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
381 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
382 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
383 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
384 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
385 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
386 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
387 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
388 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
389 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
390 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
391 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
392 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
393 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
394 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
395 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
396 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
397 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
398 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
399 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
400 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
401 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
402 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
403 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
404 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
405 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
406 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
407 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
408 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
409 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
410 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
411 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
412 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
413 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
414 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
415 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
416 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
417 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
418 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
419 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
420 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
421 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
422 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
423 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
424 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
425 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
426 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
427 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
428 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
429 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
430 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
431 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
432 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
433 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
434 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
435 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
436 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
437 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
438 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
439 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
440 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
441 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
442 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
443 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
444 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
445 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
446 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
447 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
448 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
449 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
450 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
451 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
452 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
453 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
454 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
455 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
456 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
457 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
458 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
459 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
460 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
461 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
462 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
463 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
464 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
465 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
466 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
467 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
468 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
469 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
470 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
471 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
472 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
473 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
474 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
475 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
476 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
477 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
478 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
479 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
480 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
481 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
482 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
483 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
484 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
485 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
486 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
487 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
488 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
489 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.03
Metatranscriptomes 0
Isolates 1.97

Biome Distribution

Category Percentage (%)
Aerial Root 0.15
Bulb 0
Endosphere 7.11
Nodule 0.53
Rhizoplane 4.31
Rhizosphere 82.46
Stem 0
Stem Tuber 0
Unclassified 5.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10025895 3300003203 Bacteria 2270
2 JGI25406J46586_10027405 3300003203 Bacteria 2185
3 JGI25406J46586_10035480 3300003203 Bacteria 1820
4 JGI25404J52841_10000578 3300003659 Bacteria 5452
5 Ga0055526_1000200 3300003771 Bacteria 51514
6 Ga0055524_1020229 3300003775 Bacteria 2250
7 JGI25405J52794_10009095 3300003911 Bacteria 1869
8 Ga0065707_10099009 3300005295 Bacteria 3039
9 Ga0065707_10307618 3300005295 Bacteria 991
10 Ga0070658_10063135 3300005327 Bacteria 3019
11 Ga0070676_10000559 3300005328 Bacteria 17996
12 Ga0070676_10093706 3300005328 Bacteria 1844
13 Ga0070676_10608658 3300005328 Bacteria 789
14 Ga0070683_100022527 3300005329 Bacteria 5631
15 Ga0070683_100109723 3300005329 Bacteria 2603
16 Ga0070683_100435421 3300005329 Bacteria 1251
17 Ga0070683_100789481 3300005329 Bacteria 910
18 Ga0070690_100011676 3300005330 Bacteria 5144
19 Ga0070690_100145401 3300005330 Bacteria 1613
20 Ga0070690_100208328 3300005330 Bacteria 1363
21 Ga0070670_100001348 3300005331 Bacteria 19649
22 Ga0070670_100368524 3300005331 Bacteria 1264
23 Ga0068869_100008769 3300005334 Bacteria 6536
24 Ga0068869_100015289 3300005334 Bacteria 5144
25 Ga0068869_100104727 3300005334 Bacteria 2145
26 Ga0068869_100395732 3300005334 Bacteria 1135
27 Ga0070680_100002153 3300005336 Bacteria 14561
28 Ga0070680_100011581 3300005336 Bacteria 6831
29 Ga0070680_100033740 3300005336 Bacteria 4127
30 Ga0070680_100050708 3300005336 Bacteria 3385
31 Ga0070680_100104795 3300005336 Bacteria 2350
32 Ga0070682_100004797 3300005337 Bacteria 7512
33 Ga0070682_100023337 3300005337 Bacteria 3671
34 Ga0068868_100006085 3300005338 Bacteria 8521
35 Ga0070660_100074612 3300005339 Bacteria 2654
36 Ga0070689_100131593 3300005340 Bacteria 2006
37 Ga0070689_100132186 3300005340 Bacteria 2002
38 Ga0070689_100219523 3300005340 Bacteria 1559
39 Ga0070691_10004567 3300005341 Bacteria 6288
40 Ga0070691_10012722 3300005341 Bacteria 3854
41 Ga0070691_10028644 3300005341 Bacteria 2603
42 Ga0070691_10049164 3300005341 Bacteria 2008
43 Ga0070661_100000426 3300005344 Bacteria 32270
44 Ga0070661_100437479 3300005344 Bacteria 1039
45 Ga0070692_10001134 3300005345 Bacteria 9340
46 Ga0070692_10008527 3300005345 Bacteria 4577
47 Ga0070692_10014012 3300005345 Bacteria 3753
48 Ga0070692_10072681 3300005345 Bacteria 1836
49 Ga0070668_100140618 3300005347 Bacteria 1945
50 Ga0070668_100491618 3300005347 Bacteria 1061
51 Ga0070669_100004771 3300005353 Bacteria 9777
52 Ga0070669_100091905 3300005353 Bacteria 2277
53 Ga0070669_100175184 3300005353 Bacteria 1675
54 Ga0070669_100431049 3300005353 Bacteria 1084
55 Ga0070675_100167056 3300005354 Bacteria 1895
56 Ga0070671_100184948 3300005355 Bacteria 1765
57 Ga0070671_100233496 3300005355 Bacteria 1561
58 Ga0070671_100481329 3300005355 Bacteria 1067
59 Ga0070674_100073491 3300005356 Bacteria 2424
60 Ga0070674_100299507 3300005356 Bacteria 1281
61 Ga0070673_100057312 3300005364 Bacteria 3078
62 Ga0070673_100112949 3300005364 Bacteria 2255
63 Ga0070673_100221808 3300005364 Bacteria 1637
64 Ga0070688_100517420 3300005365 Bacteria 902
65 Ga0070659_100000529 3300005366 Bacteria 27921
66 Ga0070667_100134910 3300005367 Bacteria 2158
67 Ga0070667_100621099 3300005367 Bacteria 996
68 Ga0070667_100697199 3300005367 Bacteria 939
69 Ga0070703_10000497 3300005406 Bacteria 15492
70 Ga0070703_10002171 3300005406 Bacteria 5706
71 Ga0070703_10036231 3300005406 Bacteria 1515
72 Ga0070703_10044504 3300005406 Bacteria 1396
73 Ga0070709_10008649 3300005434 Bacteria 5599
74 Ga0070714_100052483 3300005435 Bacteria 3477
75 Ga0070714_100084750 3300005435 Bacteria 2766
76 Ga0070714_100222632 3300005435 Bacteria 1735
77 Ga0070714_100789415 3300005435 Bacteria 919
78 Ga0070713_100040406 3300005436 Bacteria 3792
79 Ga0070713_100132883 3300005436 Bacteria 2196
80 Ga0070713_100445831 3300005436 Bacteria 1215
81 Ga0070713_101097753 3300005436 Bacteria 769
82 Ga0070710_10005794 3300005437 Bacteria 5890
83 Ga0070710_10131912 3300005437 Bacteria 1524
84 Ga0070710_10138186 3300005437 Bacteria 1491
85 Ga0070710_10247894 3300005437 Bacteria 1144
86 Ga0070701_10003786 3300005438 Bacteria 6043
87 Ga0070701_10010068 3300005438 Bacteria 4167
88 Ga0070701_10086009 3300005438 Bacteria 1713
89 Ga0070701_10113393 3300005438 Bacteria 1518
90 Ga0070705_100005181 3300005440 Bacteria 6332
91 Ga0070705_100013875 3300005440 Bacteria 4131
92 Ga0070705_100034461 3300005440 Bacteria 2831
93 Ga0070705_100062206 3300005440 Bacteria 2221
94 Ga0070705_100336997 3300005440 Bacteria 1095
95 Ga0070700_100002783 3300005441 Bacteria 8955
96 Ga0070700_100011918 3300005441 Bacteria 4829
97 Ga0070700_100040815 3300005441 Bacteria 2843
98 Ga0070700_100093420 3300005441 Bacteria 1967
99 Ga0070700_100159024 3300005441 Bacteria 1553
100 Ga0070694_100000056 3300005444 Bacteria 52311
101 Ga0070694_100003659 3300005444 Bacteria 9169
102 Ga0070694_100031929 3300005444 Bacteria 3455
103 Ga0070694_100101883 3300005444 Bacteria 2032
104 Ga0070694_100112371 3300005444 Bacteria 1943
105 Ga0070708_100176203 3300005445 Bacteria 1998
106 Ga0070663_100016249 3300005455 Bacteria 4828
107 Ga0070678_100055656 3300005456 Bacteria 2889
108 Ga0070678_100209720 3300005456 Bacteria 1613
109 Ga0070678_100685077 3300005456 Bacteria 922
110 Ga0070678_100727878 3300005456 Bacteria 896
111 Ga0070662_100027841 3300005457 Bacteria 3929
112 Ga0070662_100041551 3300005457 Bacteria 3281
113 Ga0070662_100187991 3300005457 Bacteria 1631
114 Ga0070681_10001086 3300005458 Bacteria 23200
115 Ga0070681_10013926 3300005458 Bacteria 8003
116 Ga0068867_100000546 3300005459 Bacteria 24785
117 Ga0068867_100008175 3300005459 Bacteria 7390
118 Ga0068867_100009055 3300005459 Bacteria 7024
119 Ga0068867_100168536 3300005459 Bacteria 1732
120 Ga0068867_100172681 3300005459 Bacteria 1713
121 Ga0070685_10158514 3300005466 Bacteria 1440
122 Ga0070685_10220800 3300005466 Bacteria 1241
123 Ga0070706_100504794 3300005467 Bacteria 1125
124 Ga0070706_100919450 3300005467 Bacteria 808
125 Ga0070707_100012720 3300005468 Bacteria 7857
126 Ga0070707_100213849 3300005468 Bacteria 1879
127 Ga0070707_100236424 3300005468 Bacteria 1778
128 Ga0070707_100312962 3300005468 Bacteria 1526
129 Ga0070698_100029132 3300005471 Bacteria 5730
130 Ga0070698_100120039 3300005471 Bacteria 2589
131 Ga0070698_100317315 3300005471 Bacteria 1489
132 Ga0070698_100411619 3300005471 Bacteria 1286
133 Ga0070699_100000609 3300005518 Bacteria 33774
134 Ga0070699_100114745 3300005518 Bacteria 2367
135 Ga0070699_100198445 3300005518 Bacteria 1784
136 Ga0070699_100200939 3300005518 Bacteria 1772
137 Ga0070699_100437520 3300005518 Bacteria 1185
138 Ga0070699_100679677 3300005518 Bacteria 940
139 Ga0070679_100004895 3300005530 Bacteria 12348
140 Ga0070679_100030304 3300005530 Bacteria 5342
141 Ga0070679_100061552 3300005530 Bacteria 3741
142 Ga0070679_100083819 3300005530 Bacteria 3176
143 Ga0070679_100099185 3300005530 Bacteria 2900
144 Ga0070679_100680949 3300005530 Bacteria 971
145 Ga0070684_100004958 3300005535 Bacteria 10160
146 Ga0070684_100007487 3300005535 Bacteria 8493
147 Ga0070697_100097123 3300005536 Bacteria 2444
148 Ga0070697_100169803 3300005536 Bacteria 1845
149 Ga0070697_100397572 3300005536 Bacteria 1195
150 Ga0068853_100010479 3300005539 Bacteria 7498
151 Ga0068853_100216191 3300005539 Bacteria 1749
152 Ga0068853_100544297 3300005539 Bacteria 1099
153 Ga0068853_100818973 3300005539 Bacteria 892
154 Ga0070672_100055270 3300005543 Bacteria 3110
155 Ga0070672_100162396 3300005543 Bacteria 1854
156 Ga0070672_100205843 3300005543 Bacteria 1647
157 Ga0070686_100128124 3300005544 Bacteria 1752
158 Ga0070686_100399486 3300005544 Bacteria 1045
159 Ga0070695_100000971 3300005545 Bacteria 15573
160 Ga0070695_100028466 3300005545 Bacteria 3467
161 Ga0070695_100028673 3300005545 Bacteria 3455
162 Ga0070695_100040252 3300005545 Bacteria 2958
163 Ga0070695_100045287 3300005545 Bacteria 2803
164 Ga0070695_100082325 3300005545 Bacteria 2131
165 Ga0070695_100103725 3300005545 Bacteria 1919
166 Ga0070696_100001450 3300005546 Bacteria 15525
167 Ga0070696_100001822 3300005546 Bacteria 13993
168 Ga0070696_100085690 3300005546 Bacteria 2236
169 Ga0070693_100000746 3300005547 Bacteria 14361
170 Ga0070693_100004829 3300005547 Bacteria 6426
171 Ga0070693_100380270 3300005547 Bacteria 974
172 Ga0070665_100020948 3300005548 Bacteria 6570
173 Ga0070665_100160818 3300005548 Bacteria 2248
174 Ga0070665_100315349 3300005548 Bacteria 1568
175 Ga0070704_100001063 3300005549 Bacteria 14206
176 Ga0070704_100004757 3300005549 Bacteria 7858
177 Ga0070704_100060292 3300005549 Bacteria 2710
178 Ga0070704_100218539 3300005549 Bacteria 1548
179 Ga0068855_100001718 3300005563 Bacteria 27377
180 Ga0068855_100014476 3300005563 Bacteria 9499
181 Ga0068855_100042273 3300005563 Bacteria 5400
182 Ga0068855_100129023 3300005563 Bacteria 2889
183 Ga0068855_100172440 3300005563 Bacteria 2449
184 Ga0068855_100575008 3300005563 Bacteria 1217
185 Ga0070664_100002931 3300005564 Bacteria 13807
186 Ga0070664_100029888 3300005564 Bacteria 4543
187 Ga0068857_100031133 3300005577 Bacteria 4714
188 Ga0068857_100051335 3300005577 Bacteria 3658
189 Ga0068857_100084017 3300005577 Bacteria 2845
190 Ga0068857_100103025 3300005577 Bacteria 2562
191 Ga0068857_100209266 3300005577 Bacteria 1779
192 Ga0068854_100003866 3300005578 Bacteria 9385
193 Ga0068854_100655802 3300005578 Bacteria 901
194 Ga0068856_100002142 3300005614 Bacteria 20470
195 Ga0068856_100011462 3300005614 Bacteria 8604
196 Ga0068856_100156119 3300005614 Bacteria 2292
197 Ga0070702_100000771 3300005615 Bacteria 12150
198 Ga0070702_100178919 3300005615 Bacteria 1386
199 Ga0070702_100742233 3300005615 Bacteria 753
200 Ga0068852_100038297 3300005616 Bacteria 4029
201 Ga0068852_100558397 3300005616 Bacteria 1146
202 Ga0068859_100001597 3300005617 Bacteria 23138
203 Ga0068859_100005571 3300005617 Bacteria 12828
204 Ga0068859_100055540 3300005617 Bacteria 3985
205 Ga0068859_100204859 3300005617 Bacteria 2058
206 Ga0068859_100224910 3300005617 Bacteria 1965
207 Ga0068859_100684711 3300005617 Bacteria 1116
208 Ga0068864_100028986 3300005618 Bacteria 4683
209 Ga0068864_100115669 3300005618 Bacteria 2392
210 Ga0068864_100188249 3300005618 Bacteria 1890
211 Ga0068866_10000362 3300005718 Bacteria 21390
212 Ga0068866_10164802 3300005718 Bacteria 1296
213 Ga0068861_100001160 3300005719 Bacteria 16414
214 Ga0068861_100010779 3300005719 Bacteria 6354
215 Ga0068861_100014550 3300005719 Bacteria 5523
216 Ga0068861_100017163 3300005719 Bacteria 5133
217 Ga0068851_10125978 3300005834 Bacteria 1381
218 Ga0068870_10003097 3300005840 Bacteria 7015
219 Ga0068870_10109163 3300005840 Bacteria 1577
220 Ga0068870_10126731 3300005840 Bacteria 1478
221 Ga0068863_100037848 3300005841 Bacteria 4591
222 Ga0068860_100004116 3300005843 Bacteria 14897
223 Ga0068860_100016914 3300005843 Bacteria 7108
224 Ga0068860_100058303 3300005843 Bacteria 3670
225 Ga0068860_100205916 3300005843 Bacteria 1908
226 Ga0068860_100253941 3300005843 Bacteria 1713
227 Ga0068860_100524568 3300005843 Bacteria 1184
228 Ga0068862_100001395 3300005844 Bacteria 22389
229 Ga0068862_100005139 3300005844 Bacteria 11002
230 Ga0068862_100060263 3300005844 Bacteria 3259
231 Ga0068862_100250144 3300005844 Bacteria 1615
232 Ga0068862_100300280 3300005844 Bacteria 1477
233 Ga0068862_100372021 3300005844 Bacteria 1330
234 Ga0068862_100530238 3300005844 Bacteria 1122
235 Ga0081455_10000079 3300005937 Bacteria 104277
236 Ga0081455_10002810 3300005937 Bacteria 20504
237 Ga0081455_10012998 3300005937 Bacteria 8253
238 Ga0081455_10013137 3300005937 Bacteria 8207
239 Ga0081455_10401277 3300005937 Bacteria 951
240 Ga0081455_10434248 3300005937 Bacteria 902
241 Ga0081538_10004698 3300005981 Bacteria 12504
242 Ga0081538_10015644 3300005981 Bacteria 5862
243 Ga0081540_1000008 3300005983 Bacteria 203702
244 Ga0081540_1000050 3300005983 Bacteria 126528
245 Ga0081540_1004321 3300005983 Bacteria 10890
246 Ga0081540_1034793 3300005983 Bacteria 2710
247 Ga0081539_10000539 3300005985 Bacteria 78266
248 Ga0081539_10001341 3300005985 Bacteria 42889
249 Ga0081539_10012567 3300005985 Bacteria 6504
250 Ga0081539_10014480 3300005985 Bacteria 5830
251 Ga0081539_10057916 3300005985 Bacteria 2141
252 Ga0070717_10016819 3300006028 Bacteria 5677
253 Ga0070717_10054333 3300006028 Bacteria 3303
254 Ga0070717_10213617 3300006028 Bacteria 1694
255 Ga0070717_10326036 3300006028 Bacteria 1369
256 Ga0070717_10344113 3300006028 Bacteria 1332
257 Ga0070717_10344954 3300006028 Bacteria 1330
258 Ga0070717_10743259 3300006028 Bacteria 892
259 Ga0075365_10005144 3300006038 Bacteria 7027
260 Ga0075365_10006887 3300006038 Bacteria 6307
261 Ga0075365_10039270 3300006038 Bacteria 3081
262 Ga0075365_10114416 3300006038 Bacteria 1856
263 Ga0075365_10164756 3300006038 Bacteria 1546
264 Ga0075365_10412065 3300006038 Bacteria 954
265 Ga0075368_10000566 3300006042 Bacteria 11090
266 Ga0075363_100009008 3300006048 Bacteria 4678
267 Ga0075363_100011166 3300006048 Bacteria 4292
268 Ga0075364_10017908 3300006051 Bacteria 4429
269 Ga0075364_10076667 3300006051 Bacteria 2206
270 Ga0075364_10491400 3300006051 Bacteria 839
271 Ga0075432_10060084 3300006058 Bacteria 1352
272 Ga0070715_10190711 3300006163 Bacteria 1034
273 Ga0070716_100022950 3300006173 Bacteria 3303
274 Ga0070716_100283767 3300006173 Bacteria 1144
275 Ga0070712_100022506 3300006175 Bacteria 4153
276 Ga0070712_100082381 3300006175 Bacteria 2334
277 Ga0070712_100340271 3300006175 Bacteria 1225
278 Ga0070712_100696756 3300006175 Bacteria 866
279 Ga0075362_10055905 3300006177 Bacteria 1775
280 Ga0075362_10123507 3300006177 Bacteria 1227
281 Ga0075367_10014031 3300006178 Bacteria 4327
282 Ga0075367_10344917 3300006178 Bacteria 940
283 Ga0075369_10006961 3300006186 Bacteria 4294
284 Ga0075369_10024080 3300006186 Bacteria 2520
285 Ga0075366_10006444 3300006195 Bacteria 6431
286 Ga0075366_10012372 3300006195 Bacteria 4840
287 Ga0075366_10210545 3300006195 Bacteria 1183
288 Ga0097621_100001467 3300006237 Bacteria 16135
289 Ga0097621_100237305 3300006237 Bacteria 1593
290 Ga0075370_10124997 3300006353 Bacteria 1499
291 Ga0068871_100002626 3300006358 Bacteria 12271
292 Ga0068871_100197664 3300006358 Bacteria 1735
293 Ga0068871_100227181 3300006358 Bacteria 1619
294 Ga0075428_100000594 3300006844 Bacteria 36976
295 Ga0075428_100000979 3300006844 Bacteria 30251
296 Ga0075428_100010065 3300006844 Bacteria 10507
297 Ga0075428_100013937 3300006844 Bacteria 8951
298 Ga0075428_100035781 3300006844 Bacteria 5473
299 Ga0075428_100066299 3300006844 Bacteria 3952
300 Ga0075428_100141149 3300006844 Bacteria 2619
301 Ga0075428_100200991 3300006844 Bacteria 2154
302 Ga0075428_100257408 3300006844 Bacteria 1880
303 Ga0075428_100270359 3300006844 Bacteria 1829
304 Ga0075430_100000013 3300006846 Bacteria 93627
305 Ga0075430_100012732 3300006846 Bacteria 7168
306 Ga0075430_100051633 3300006846 Bacteria 3465
307 Ga0075430_100070843 3300006846 Bacteria 2924
308 Ga0075430_100090019 3300006846 Bacteria 2567
309 Ga0075430_100125816 3300006846 Bacteria 2136
310 Ga0075431_100000202 3300006847 Bacteria 43757
311 Ga0075431_100001575 3300006847 Bacteria 21211
312 Ga0075431_100008273 3300006847 Bacteria 10401
313 Ga0075431_100036230 3300006847 Bacteria 5081
314 Ga0075431_100046113 3300006847 Bacteria 4494
315 Ga0075431_100053192 3300006847 Bacteria 4175
316 Ga0075431_100102517 3300006847 Bacteria 2953
317 Ga0075431_100134895 3300006847 Bacteria 2545
318 Ga0075431_100159940 3300006847 Bacteria 2316
319 Ga0075431_100199545 3300006847 Bacteria 2047
320 Ga0075431_100297908 3300006847 Bacteria 1630
321 Ga0075431_100341011 3300006847 Unclassified 1508
322 Ga0075431_100450967 3300006847 Bacteria 1282
323 Ga0075433_10000148 3300006852 Bacteria 37322
324 Ga0075433_10014227 3300006852 Bacteria 6497
325 Ga0075433_10014866 3300006852 Bacteria 6371
326 Ga0075433_10016316 3300006852 Bacteria 6116
327 Ga0075433_10028759 3300006852 Bacteria 4728
328 Ga0075433_10029345 3300006852 Bacteria 4685
329 Ga0075433_10039272 3300006852 Bacteria 4091
330 Ga0075433_10058619 3300006852 Bacteria 3368
331 Ga0075433_10070633 3300006852 Bacteria 3069
332 Ga0075433_10252811 3300006852 Bacteria 1563
333 Ga0075433_10330437 3300006852 Bacteria 1348
334 Ga0075433_10430365 3300006852 Bacteria 1164
335 Ga0075433_10459699 3300006852 Bacteria 1122
336 Ga0075433_10514684 3300006852 Bacteria 1053
337 Ga0075433_10782873 3300006852 Bacteria 834
338 Ga0075434_100000484 3300006871 Bacteria 29868
339 Ga0075434_100006228 3300006871 Bacteria 10931
340 Ga0075434_100016507 3300006871 Bacteria 7098
341 Ga0075434_100029302 3300006871 Bacteria 5414
342 Ga0075434_100044530 3300006871 Bacteria 4402
343 Ga0075434_100049485 3300006871 Bacteria 4173
344 Ga0075434_100059874 3300006871 Bacteria 3787
345 Ga0075434_100089713 3300006871 Bacteria 3075
346 Ga0075434_100092842 3300006871 Bacteria 3021
347 Ga0075434_100107975 3300006871 Bacteria 2794
348 Ga0075434_100170174 3300006871 Bacteria 2198
349 Ga0075434_100353039 3300006871 Bacteria 1491
350 Ga0075429_100000234 3300006880 Bacteria 38034
351 Ga0075429_100002284 3300006880 Bacteria 16086
352 Ga0075429_100008027 3300006880 Bacteria 9171
353 Ga0075429_100011751 3300006880 Bacteria 7595
354 Ga0075429_100052004 3300006880 Bacteria 3563
355 Ga0075429_100075151 3300006880 Bacteria 2943
356 Ga0075429_100562991 3300006880 Bacteria 999
357 Ga0075429_100968039 3300006880 Bacteria 744
358 Ga0068865_100009339 3300006881 Bacteria 6076
359 Ga0068865_100018548 3300006881 Bacteria 4491
360 Ga0068865_100428839 3300006881 Bacteria 1089
361 Ga0075436_100042237 3300006914 Bacteria 3145
362 Ga0075436_100081809 3300006914 Bacteria 2239
363 Ga0075436_100542626 3300006914 Bacteria 853
364 Ga0097620_100001597 3300006931 Bacteria 23138
365 Ga0097620_100005571 3300006931 Bacteria 12828
366 Ga0097620_100055541 3300006931 Bacteria 3985
367 Ga0097620_100204844 3300006931 Bacteria 2058
368 Ga0097620_100224920 3300006931 Bacteria 1965
369 Ga0097620_100684683 3300006931 Bacteria 1116
370 Ga0079104_1000029 3300006946 Bacteria 207648
371 Ga0075435_100011662 3300007076 Bacteria 6478
372 Ga0075435_100017645 3300007076 Bacteria 5408
373 Ga0075435_100044379 3300007076 Bacteria 3561
374 Ga0075435_100052289 3300007076 Bacteria 3292
375 Ga0075435_100177251 3300007076 Bacteria 1800
376 Ga0075435_100180101 3300007076 Bacteria 1786
377 Ga0075435_100191341 3300007076 Bacteria 1732
378 Ga0075435_100318633 3300007076 Bacteria 1331
379 Ga0075435_100494745 3300007076 Bacteria 1057
380 Ga0075435_100593652 3300007076 Bacteria 960
381 Ga0075435_100626184 3300007076 Bacteria 933
382 Ga0099794_10027620 3300007265 Bacteria 2632
383 Ga0099794_10034120 3300007265 Bacteria 2395
384 Ga0099794_10053394 3300007265 Bacteria 1949
385 Ga0099795_10007995 3300007788 Bacteria 2988
386 Ga0105250_10071343 3300009092 Bacteria 1403
387 Ga0105240_10001546 3300009093 Bacteria 39059
388 Ga0105240_10089377 3300009093 Bacteria 3767
389 Ga0105240_10152105 3300009093 Bacteria 2755
390 Ga0105240_11366747 3300009093 Bacteria 745
391 Ga0111539_10000369 3300009094 Bacteria 55645
392 Ga0111539_10000618 3300009094 Bacteria 46089
393 Ga0111539_10000708 3300009094 Bacteria 43220
394 Ga0111539_10010911 3300009094 Bacteria 11435
395 Ga0111539_10161316 3300009094 Bacteria 2622
396 Ga0111539_10447030 3300009094 Bacteria 1505
397 Ga0111539_10625048 3300009094 Bacteria 1254
398 Ga0111539_10906443 3300009094 Bacteria 1025
399 Ga0111539_11297329 3300009094 Bacteria 845
400 Ga0105245_10010838 3300009098 Bacteria 7933
401 Ga0105245_10102050 3300009098 Bacteria 2656
402 Ga0105245_10384068 3300009098 Bacteria 1399
403 Ga0105245_10669958 3300009098 Bacteria 1069
404 Ga0105245_10686995 3300009098 Bacteria 1056
405 Ga0105247_10143054 3300009101 Bacteria 1569
406 Ga0114129_10000329 3300009147 Bacteria 55412
407 Ga0114129_10002660 3300009147 Bacteria 24854
408 Ga0114129_10022171 3300009147 Bacteria 9016
409 Ga0114129_10057223 3300009147 Bacteria 5458
410 Ga0114129_10102283 3300009147 Bacteria 3963
411 Ga0114129_10116199 3300009147 Bacteria 3687
412 Ga0114129_10162752 3300009147 Bacteria 3047
413 Ga0114129_10181800 3300009147 Bacteria 2860
414 Ga0114129_10186767 3300009147 Bacteria 2816
415 Ga0114129_10222673 3300009147 Bacteria 2545
416 Ga0114129_10575640 3300009147 Bacteria 1462
417 Ga0114129_11461295 3300009147 Bacteria 841
418 Ga0105243_10007704 3300009148 Bacteria 8278
419 Ga0105243_10010240 3300009148 Bacteria 7126
420 Ga0105243_10013484 3300009148 Bacteria 6181
421 Ga0105243_10066097 3300009148 Bacteria 2907
422 Ga0105243_11415390 3300009148 Bacteria 716
423 Ga0105241_10000650 3300009174 Bacteria 26087
424 Ga0105241_10032807 3300009174 Bacteria 3897
425 Ga0105241_10054961 3300009174 Bacteria 3049
426 Ga0105241_10234205 3300009174 Bacteria 1549
427 Ga0105241_10413696 3300009174 Bacteria 1185
428 Ga0105242_10006783 3300009176 Bacteria 8827
429 Ga0105242_10021028 3300009176 Bacteria 5119
430 Ga0105242_10153506 3300009176 Bacteria 2010
431 Ga0105242_10423201 3300009176 Bacteria 1248
432 Ga0105248_10255360 3300009177 Bacteria 1973
433 Ga0105248_10329846 3300009177 Bacteria 1719
434 Ga0105248_11730123 3300009177 Bacteria 709
435 Ga0105237_10666232 3300009545 Bacteria 1047
436 Ga0105238_10259967 3300009551 Bacteria 1715
437 Ga0105238_11078645 3300009551 Bacteria 825
438 Ga0105249_10013784 3300009553 Bacteria 7142
439 Ga0105249_10020999 3300009553 Bacteria 5843
440 Ga0105249_10071214 3300009553 Bacteria 3211
441 Ga0105249_10669422 3300009553 Bacteria 1096
442 Ga0099796_10002974 3300010159 Bacteria 3841
443 Ga0099796_10066010 3300010159 Bacteria 1295
444 Ga0105239_10103625 3300010375 Bacteria 3149
445 Ga0105239_10435888 3300010375 Bacteria 1485
446 Ga0105239_10949687 3300010375 Bacteria 987
447 Ga0105239_11080591 3300010375 Unclassified 923
448 Ga0105246_10122543 3300011119 Bacteria 1929
449 Ga0105246_10474005 3300011119 Bacteria 1057
450 Ga0157373_10005062 3300013100 Bacteria 9904
451 Ga0157373_10167085 3300013100 Bacteria 1548
452 Ga0157373_10260566 3300013100 Bacteria 1227
453 Ga0157373_10364009 3300013100 Bacteria 1033
454 Ga0157371_10003256 3300013102 Bacteria 14890
455 Ga0157371_10021200 3300013102 Bacteria 4773
456 Ga0157369_10015753 3300013105 Bacteria 8518
457 Ga0157369_10096375 3300013105 Bacteria 3156
458 Ga0157369_10216403 3300013105 Bacteria 2006
459 Ga0157369_10326879 3300013105 Bacteria 1593
460 Ga0157369_10509830 3300013105 Bacteria 1244
461 Ga0157378_10003376 3300013297 Bacteria 14197
462 Ga0157378_10018011 3300013297 Bacteria 6201
463 Ga0157378_10080417 3300013297 Bacteria 2944
464 Ga0157378_10423874 3300013297 Bacteria 1316
465 Ga0163162_10107534 3300013306 Bacteria 2885
466 Ga0157372_10000746 3300013307 Bacteria 35404
467 Ga0157375_10090194 3300013308 Bacteria 3123
468 Ga0157375_10150256 3300013308 Bacteria 2464
469 Ga0163163_10002136 3300014325 Bacteria 16698
470 Ga0163163_10078397 3300014325 Bacteria 3300
471 Ga0163163_10154967 3300014325 Bacteria 2335
472 Ga0163163_10793784 3300014325 Bacteria 1010
473 Ga0163163_11076815 3300014325 Bacteria 867
474 Ga0157380_10018569 3300014326 Bacteria 5163
475 Ga0157380_10025645 3300014326 Bacteria 4471
476 Ga0157380_10168602 3300014326 Bacteria 1910
477 Ga0157380_10212947 3300014326 Bacteria 1723
478 Ga0157380_10490032 3300014326 Bacteria 1191
479 Ga0157380_11166404 3300014326 Bacteria 812
480 Ga0182008_10144325 3300014497 Bacteria 1192
481 Ga0157377_10086971 3300014745 Bacteria 1838
482 Ga0157377_10218316 3300014745 Bacteria 1219
483 Ga0157377_10236029 3300014745 Bacteria 1178
484 Ga0157377_10297617 3300014745 Bacteria 1064
485 Ga0157379_10107425 3300014968 Bacteria 2505
486 Ga0157379_10199932 3300014968 Bacteria 1807
487 Ga0157376_10003105 3300014969 Bacteria 11411
488 Ga0157376_10019126 3300014969 Bacteria 5271
489 Ga0157376_11235141 3300014969 Bacteria 776
490 Ga0163161_10016668 3300017792 Bacteria 5133
491 Ga0163161_10304459 3300017792 Bacteria 1256
492 Ga0163161_10527199 3300017792 Bacteria 965
493 Ga0213874_10087740 3300021377 Bacteria 1017
494 Ga0213876_10005637 3300021384 Bacteria 6874
495 Ga0213876_10026057 3300021384 Bacteria 3084
496 Ga0213876_10152283 3300021384 Bacteria 1230
497 Ga0213876_10183412 3300021384 Bacteria 1113
498 Ga0213875_10021851 3300021388 Bacteria 3062
499 Ga0213875_10029465 3300021388 Bacteria 2604
500 Ga0224572_1008475 3300024225 Bacteria 1901
501 Ga0209564_1000043 3300025295 Bacteria 388153
502 Ga0209758_1007690 3300025297 Bacteria 7243
503 Ga0209256_1000545 3300025299 Bacteria 54076
504 Ga0207697_10081000 3300025315 Bacteria 1368
505 Ga0207656_10044224 3300025321 Bacteria 1901
506 Ga0207653_10008773 3300025885 Bacteria 3151
507 Ga0207653_10034067 3300025885 Bacteria 1653
508 Ga0207653_10117875 3300025885 Bacteria 953
509 Ga0207682_10037193 3300025893 Bacteria 1971
510 Ga0207692_10001508 3300025898 Bacteria 8753
511 Ga0207692_10226036 3300025898 Bacteria 1112
512 Ga0207692_10330136 3300025898 Bacteria 935
513 Ga0207642_10007999 3300025899 Bacteria 3602
514 Ga0207710_10015448 3300025900 Bacteria 3226
515 Ga0207688_10017744 3300025901 Bacteria 3872
516 Ga0207688_10042746 3300025901 Bacteria 2523
517 Ga0207647_10171457 3300025904 Bacteria 1263
518 Ga0207685_10035129 3300025905 Bacteria 1827
519 Ga0207645_10000213 3300025907 Bacteria 48054
520 Ga0207645_10072742 3300025907 Bacteria 2201
521 Ga0207645_10186218 3300025907 Bacteria 1363
522 Ga0207645_10217713 3300025907 Bacteria 1258
523 Ga0207645_10406537 3300025907 Bacteria 916
524 Ga0207643_10000590 3300025908 Bacteria 23060
525 Ga0207643_10051270 3300025908 Bacteria 2342
526 Ga0207643_10093273 3300025908 Bacteria 1758
527 Ga0207705_10111855 3300025909 Bacteria 2018
528 Ga0207684_10004444 3300025910 Bacteria 13218
529 Ga0207684_10092676 3300025910 Bacteria 2575
530 Ga0207684_10901755 3300025910 Bacteria 743
531 Ga0207654_10032445 3300025911 Bacteria 2886
532 Ga0207654_10136129 3300025911 Bacteria 1561
533 Ga0207654_10145300 3300025911 Bacteria 1517
534 Ga0207654_10251154 3300025911 Bacteria 1185
535 Ga0207707_10001151 3300025912 Bacteria 25082
536 Ga0207707_10115966 3300025912 Bacteria 2340
537 Ga0207695_10048203 3300025913 Bacteria 4501
538 Ga0207695_10281923 3300025913 Bacteria 1555
539 Ga0207695_10516225 3300025913 Bacteria 1076
540 Ga0207693_10025358 3300025915 Bacteria 4701
541 Ga0207693_10031529 3300025915 Bacteria 4188
542 Ga0207693_10133729 3300025915 Bacteria 1949
543 Ga0207693_10277980 3300025915 Bacteria 1312
544 Ga0207693_10668429 3300025915 Bacteria 806
545 Ga0207663_10223042 3300025916 Bacteria 1373
546 Ga0207663_10467601 3300025916 Bacteria 975
547 Ga0207663_10605170 3300025916 Bacteria 861
548 Ga0207660_10001357 3300025917 Bacteria 16423
549 Ga0207660_10006875 3300025917 Bacteria 7367
550 Ga0207660_10020025 3300025917 Bacteria 4483
551 Ga0207660_10155678 3300025917 Bacteria 1759
552 Ga0207662_10000065 3300025918 Bacteria 46256
553 Ga0207662_10024979 3300025918 Bacteria 3439
554 Ga0207662_10159902 3300025918 Bacteria 1438
555 Ga0207657_10000300 3300025919 Bacteria 52449
556 Ga0207649_10112049 3300025920 Bacteria 1825
557 Ga0207652_10003563 3300025921 Bacteria 12843
558 Ga0207652_10008730 3300025921 Bacteria 8155
559 Ga0207652_10077220 3300025921 Bacteria 2906
560 Ga0207652_10124613 3300025921 Bacteria 2294
561 Ga0207652_10273087 3300025921 Bacteria 1525
562 Ga0207646_10048348 3300025922 Bacteria 3813
563 Ga0207646_10152643 3300025922 Bacteria 2083
564 Ga0207681_10006788 3300025923 Bacteria 7018
565 Ga0207681_10135091 3300025923 Bacteria 1829
566 Ga0207681_10305383 3300025923 Bacteria 1260
567 Ga0207694_10531429 3300025924 Bacteria 986
568 Ga0207650_10004857 3300025925 Bacteria 9180
569 Ga0207659_10101321 3300025926 Bacteria 2171
570 Ga0207659_10102227 3300025926 Bacteria 2163
571 Ga0207687_10007409 3300025927 Bacteria 7225
572 Ga0207687_10065280 3300025927 Bacteria 2584
573 Ga0207687_10158464 3300025927 Bacteria 1734
574 Ga0207687_10218754 3300025927 Bacteria 1498
575 Ga0207687_10288188 3300025927 Bacteria 1319
576 Ga0207700_10016207 3300025928 Bacteria 4945
577 Ga0207700_10053142 3300025928 Bacteria 3033
578 Ga0207700_10388172 3300025928 Bacteria 1222
579 Ga0207700_10535353 3300025928 Bacteria 1038
580 Ga0207664_10040367 3300025929 Bacteria 3628
581 Ga0207664_10089861 3300025929 Bacteria 2516
582 Ga0207664_10099514 3300025929 Bacteria 2400
583 Ga0207664_10370197 3300025929 Bacteria 1271
584 Ga0207664_10523443 3300025929 Bacteria 1063
585 Ga0207644_10108556 3300025931 Bacteria 2095
586 Ga0207644_10312934 3300025931 Bacteria 1268
587 Ga0207644_10663544 3300025931 Bacteria 868
588 Ga0207690_10002782 3300025932 Bacteria 10563
589 Ga0207690_10180760 3300025932 Bacteria 1588
590 Ga0207690_10495624 3300025932 Bacteria 987
591 Ga0207706_10025916 3300025933 Bacteria 5250
592 Ga0207706_10046485 3300025933 Bacteria 3842
593 Ga0207706_10064455 3300025933 Bacteria 3226
594 Ga0207706_10099603 3300025933 Bacteria 2557
595 Ga0207706_10173754 3300025933 Bacteria 1893
596 Ga0207706_10215971 3300025933 Bacteria 1680
597 Ga0207706_10669012 3300025933 Bacteria 888
598 Ga0207686_10012265 3300025934 Bacteria 4709
599 Ga0207709_10008586 3300025935 Bacteria 5643
600 Ga0207709_10011883 3300025935 Bacteria 4803
601 Ga0207670_10109074 3300025936 Bacteria 1991
602 Ga0207670_10129912 3300025936 Bacteria 1844
603 Ga0207670_10174772 3300025936 Bacteria 1613
604 Ga0207670_10433911 3300025936 Bacteria 1056
605 Ga0207670_10668920 3300025936 Bacteria 857
606 Ga0207670_10796380 3300025936 Bacteria 787
607 Ga0207669_10012946 3300025937 Bacteria 4123
608 Ga0207669_10022230 3300025937 Bacteria 3365
609 Ga0207669_10112591 3300025937 Bacteria 1827
610 Ga0207669_10350158 3300025937 Bacteria 1141
611 Ga0207704_10009642 3300025938 Bacteria 4669
612 Ga0207704_10023649 3300025938 Bacteria 3315
613 Ga0207704_10066243 3300025938 Bacteria 2266
614 Ga0207704_10190072 3300025938 Bacteria 1493
615 Ga0207665_10014564 3300025939 Bacteria 5178
616 Ga0207665_10048759 3300025939 Bacteria 2844
617 Ga0207665_10088398 3300025939 Bacteria 2143
618 Ga0207665_10127531 3300025939 Bacteria 1803
619 Ga0207665_10273598 3300025939 Bacteria 1255
620 Ga0207691_10042527 3300025940 Bacteria 4188
621 Ga0207691_10076264 3300025940 Bacteria 3021
622 Ga0207689_10000257 3300025942 Bacteria 47544
623 Ga0207689_10000438 3300025942 Bacteria 39053
624 Ga0207689_10017442 3300025942 Bacteria 6076
625 Ga0207689_10053222 3300025942 Bacteria 3335
626 Ga0207689_10206082 3300025942 Bacteria 1624
627 Ga0207689_10303975 3300025942 Bacteria 1322
628 Ga0207661_10017221 3300025944 Bacteria 5344
629 Ga0207661_10129668 3300025944 Bacteria 2158
630 Ga0207661_10384137 3300025944 Bacteria 1271
631 Ga0207661_10721792 3300025944 Bacteria 917
632 Ga0207679_10008189 3300025945 Bacteria 6653
633 Ga0207679_10069292 3300025945 Bacteria 2654
634 Ga0207679_10116041 3300025945 Bacteria 2122
635 Ga0207667_10003068 3300025949 Bacteria 20705
636 Ga0207667_10162023 3300025949 Bacteria 2300
637 Ga0207651_10087304 3300025960 Bacteria 2270
638 Ga0207651_10171331 3300025960 Bacteria 1712
639 Ga0207712_10092184 3300025961 Bacteria 2233
640 Ga0207712_10739497 3300025961 Bacteria 861
641 Ga0207712_10792230 3300025961 Bacteria 833
642 Ga0207668_10003050 3300025972 Bacteria 9818
643 Ga0207668_10049211 3300025972 Bacteria 2896
644 Ga0207640_10001086 3300025981 Bacteria 15053
645 Ga0207640_10561431 3300025981 Bacteria 961
646 Ga0207658_10111097 3300025986 Bacteria 2167
647 Ga0207677_10010414 3300026023 Bacteria 5260
648 Ga0207677_10217798 3300026023 Bacteria 1529
649 Ga0207677_10862584 3300026023 Unclassified 814
650 Ga0207639_10005888 3300026041 Bacteria 8307
651 Ga0207678_10071215 3300026067 Bacteria 2981
652 Ga0207678_10164500 3300026067 Bacteria 1894
653 Ga0207678_10218201 3300026067 Bacteria 1632
654 Ga0207678_10497040 3300026067 Bacteria 1063
655 Ga0207708_10000961 3300026075 Bacteria 21578
656 Ga0207708_10002431 3300026075 Bacteria 13681
657 Ga0207708_10010496 3300026075 Bacteria 6876
658 Ga0207708_10018935 3300026075 Bacteria 5184
659 Ga0207708_10168264 3300026075 Bacteria 1734
660 Ga0207702_10002765 3300026078 Bacteria 16425
661 Ga0207702_10126077 3300026078 Bacteria 2299
662 Ga0207702_10222911 3300026078 Bacteria 1758
663 Ga0207641_10094706 3300026088 Bacteria 2619
664 Ga0207641_10181299 3300026088 Bacteria 1929
665 Ga0207641_10757817 3300026088 Bacteria 959
666 Ga0207648_10000210 3300026089 Bacteria 62827
667 Ga0207648_10000854 3300026089 Bacteria 34339
668 Ga0207648_10002687 3300026089 Bacteria 18922
669 Ga0207648_10121925 3300026089 Bacteria 2292
670 Ga0207648_10213670 3300026089 Bacteria 1713
671 Ga0207648_10227268 3300026089 Bacteria 1659
672 Ga0207676_10057909 3300026095 Bacteria 3054
673 Ga0207676_10386272 3300026095 Bacteria 1304
674 Ga0207674_10004234 3300026116 Bacteria 17311
675 Ga0207674_10041274 3300026116 Bacteria 4773
676 Ga0207675_100000473 3300026118 Bacteria 39053
677 Ga0207675_100006447 3300026118 Bacteria 11111
678 Ga0207675_100092764 3300026118 Bacteria 2840
679 Ga0207675_100103181 3300026118 Bacteria 2687
680 Ga0207675_100277917 3300026118 Bacteria 1626
681 Ga0207683_10002061 3300026121 Bacteria 17777
682 Ga0207683_10125234 3300026121 Bacteria 2309
683 Ga0207683_10138240 3300026121 Bacteria 2194
684 Ga0207683_10594669 3300026121 Bacteria 1024
685 Ga0207698_10102855 3300026142 Bacteria 2372
686 Ga0207698_10214236 3300026142 Bacteria 1735
687 Ga0209281_1000118 3300027111 Bacteria 208448
688 Ga0209981_1021656 3300027378 Bacteria 920
689 Ga0210000_1002064 3300027462 Bacteria 2841
690 Ga0210000_1005546 3300027462 Bacteria 1831
691 Ga0209995_1010877 3300027471 Bacteria 1478
692 Ga0209995_1016441 3300027471 Bacteria 1215
693 Ga0209968_1017095 3300027526 Bacteria 1156
694 Ga0209999_1000258 3300027543 Bacteria 7699
695 Ga0209588_1025122 3300027671 Bacteria 1883
696 Ga0209588_1036890 3300027671 Bacteria 1573
697 Ga0209971_1026348 3300027682 Bacteria 1390
698 Ga0209966_1000058 3300027695 Bacteria 48823
699 Ga0209813_10037422 3300027866 Bacteria 1462
700 Ga0209974_10025440 3300027876 Bacteria 1959
701 Ga0207428_10000118 3300027907 Bacteria 107695
702 Ga0207428_10000519 3300027907 Bacteria 46036
703 Ga0207428_10006083 3300027907 Bacteria 11163
704 Ga0207428_10022374 3300027907 Bacteria 5336
705 Ga0207428_10024940 3300027907 Bacteria 5014
706 Ga0207428_10034027 3300027907 Bacteria 4178
707 Ga0207428_10232506 3300027907 Bacteria 1379
708 Ga0268266_10147662 3300028379 Bacteria 2116
709 Ga0268266_10274083 3300028379 Bacteria 1567
710 Ga0268266_10508984 3300028379 Bacteria 1150
711 Ga0268265_10004690 3300028380 Bacteria 9438
712 Ga0268265_10004813 3300028380 Bacteria 9307
713 Ga0268265_10012057 3300028380 Bacteria 5852
714 Ga0268265_10039138 3300028380 Bacteria 3492
715 Ga0268265_11061606 3300028380 Bacteria 803
716 Ga0268264_10059356 3300028381 Bacteria 3205
717 Ga0268264_10243880 3300028381 Bacteria 1666
718 Ga0268264_10282914 3300028381 Bacteria 1554
719 Ga0268264_10669895 3300028381 Bacteria 1028
720 Ga0268264_11175131 3300028381 Bacteria 776
721 Ga0265338_10288969 3300028800 Bacteria 1195
722 Ga0307511_10000964 3300030521 Bacteria 30506
723 Ga0265332_10093416 3300031238 Bacteria 1271
724 Ga0265325_10018690 3300031241 Bacteria 3843
725 Ga0265325_10052246 3300031241 Bacteria 2099
726 Ga0265329_10024025 3300031242 Bacteria 2025
727 Ga0265340_10033586 3300031247 Bacteria 2553
728 Ga0265340_10060264 3300031247 Bacteria 1818
729 Ga0265340_10159291 3300031247 Bacteria 1026
730 Ga0265339_10046918 3300031249 Bacteria 2373
731 Ga0265339_10158103 3300031249 Bacteria 1142
732 Ga0265331_10132943 3300031250 Bacteria 1134
733 Ga0265327_10059193 3300031251 Bacteria 1963
734 Ga0265316_10015448 3300031344 Bacteria 6676
735 Ga0265316_10173583 3300031344 Bacteria 1607
736 Ga0265316_10175146 3300031344 Bacteria 1599
737 Ga0265313_10057900 3300031595 Bacteria 1827
738 Ga0265342_10059052 3300031712 Bacteria 2266
739 Ga0265342_10069012 3300031712 Bacteria 2065
740 Ga0265342_10076058 3300031712 Bacteria 1947
741 Ga0307412_10494182 3300031911 Bacteria 1017
742 Ga0307416_100536624 3300032002 Bacteria 1241
743 Ga0307411_10328622 3300032005 Bacteria 1238
744 Ga0373950_0040159 3300034818 Bacteria 893
745 Ga0373958_0020166 3300034819 Bacteria 1225
746 Ga0373959_0015312 3300034820 Bacteria 1407
747 Ga0373959_0019892 3300034820 Bacteria 1276
748 Ga0373926_0000195 3300035083 Bacteria 13918
749 Ga0373952_0008015 3300035092 Bacteria 1995
750 Ga0373952_0089523 3300035092 Bacteria 797
751 Ga0373932_0005232 3300035112 Bacteria 3050
752 Ga0373932_0017858 3300035112 Bacteria 1827
753 Ga0373936_0000690 3300035113 Bacteria 11780
754 Ga0373939_0003205 3300035114 Bacteria 3835
755 Ga0373939_0020267 3300035114 Bacteria 1804
756 Ga0373939_0020797 3300035114 Bacteria 1788
757 Ga0373939_0030256 3300035114 Bacteria 1556
758 Ga0373939_0030780 3300035114 Bacteria 1546
759 Ga0373941_0009155 3300035115 Bacteria 2486
760 Ga0373941_0028074 3300035115 Bacteria 1649
761 Ga0373941_0057439 3300035115 Bacteria 1256
762 Ga0373945_0031260 3300035116 Bacteria 1881
763 Ga0373945_0128217 3300035116 Bacteria 1014
764 Ga0373960_0002402 3300035121 Bacteria 4206
765 Ga0373960_0056340 3300035121 Unclassified 1180
766 Ga0373943_0001726 3300035170 Bacteria 9908
767 Ga0373943_0014469 3300035170 Bacteria 3573
768 Ga0373943_0123991 3300035170 Unclassified 1376
769 Ga0373946_0002235 3300035171 Bacteria 6832
770 Ga0373946_0116727 3300035171 Bacteria 1214
771 Ga0373961_0014093 3300035241 Bacteria 2026
772 Ga0373961_0038044 3300035241 Bacteria 1377
773 Ga0373962_0008778 3300035242 Bacteria 2495
774 Ga0373962_0038862 3300035242 Bacteria 1334
775 Ga0373931_0003181 3300035691 Bacteria 7326
776 Ga0373931_0008868 3300035691 Bacteria 4788
777 Ga0373931_0009669 3300035691 Bacteria 4617
778 Ga0373931_0029645 3300035691 Bacteria 2811
779 Ga0373931_0061586 3300035691 Bacteria 2024
780 Ga0373931_0160061 3300035691 Bacteria 1319
781 Ga0373935_0005776 3300035692 Bacteria 7317
782 Ga0373935_0011481 3300035692 Bacteria 5317
783 Ga0373935_0054403 3300035692 Bacteria 2548
784 Ga0373935_0103669 3300035692 Bacteria 1879
785 Ga0373935_0252399 3300035692 Bacteria 1235
786 Ga0373935_0335321 3300035692 Bacteria 1076
787 Ga0373927_0004235 3300035695 Bacteria 10074
788 Ga0373927_0103608 3300035695 Bacteria 1852
789 Ga0373927_0165826 3300035695 Bacteria 1448
790 Ga0373933_0386934 3300035724 Bacteria 911
791 Ga0373947_0003323 3300035725 Bacteria 9531
792 Ga0373947_0004079 3300035725 Bacteria 8598
793 Ga0373947_0009876 3300035725 Bacteria 5480
794 Ga0373947_0036819 3300035725 Bacteria 2902
795 Ga0373947_0104588 3300035725 Bacteria 1783
796 Ga0373947_0436590 3300035725 Bacteria 886
797 Ga0373947_0605505 3300035725 Bacteria 747
798 Ga0373937_0054737 3300036401 Bacteria 3662
799 Ga0373937_0288338 3300036401 Bacteria 1551
800 Ga0373937_0518324 3300036401 Bacteria 1133
801 Ga0316584_0096222 3300036712 Bacteria 2216
802 Ga0373925_0003648 3300037068 Bacteria 11860
803 Ga0373925_0008634 3300037068 Bacteria 7422
804 Ga0373925_0062614 3300037068 Bacteria 2798
805 Ga0373925_0080820 3300037068 Bacteria 2471
806 Ga0373925_0769336 3300037068 Bacteria 794
807 Ga0395899_0013907 3300037312 Bacteria 6146
808 Ga0395899_0066534 3300037312 Bacteria 2646
809 Ga0395899_0144741 3300037312 Bacteria 1688
810 Ga0395900_0177284 3300037418 Bacteria 2167
811 Ga0395900_0285319 3300037418 Bacteria 1641
812 Ga0395900_0314098 3300037418 Bacteria 1549
813 Ga0395900_0338071 3300037418 Bacteria 1482
814 Ga0395898_0028788 3300037466 Bacteria 5568
815 Ga0395898_0053657 3300037466 Bacteria 3937
816 Ga0395898_0110566 3300037466 Bacteria 2634
817 Ga0395905_0189564 3300037471 Bacteria 1929
818 Ga0395905_0776267 3300037471 Bacteria 861
819 Ga0436364_0024334 3300037853 Bacteria 2869
820 Ga0436364_0036231 3300037853 Bacteria 1987
821 Ga0436364_0102492 3300037853 Bacteria 17015
822 Ga0436364_0604575 3300037853 Bacteria 2837
823 Ga0436364_1011929 3300037853 Bacteria 4091
824 Ga0436364_1368626 3300037853 Bacteria 2925
825 Ga0395901_0004531 3300038443 Bacteria 14013
826 Ga0395901_0024595 3300038443 Bacteria 6184
827 Ga0395901_0066966 3300038443 Bacteria 3740
828 Ga0395901_0373912 3300038443 Bacteria 1467
829 Ga0436365_0079845 3300039437 Bacteria 4018
830 Ga0436365_0116924 3300039437 Bacteria 1279
831 Ga0436365_0129764 3300039437 Bacteria 1748
832 Ga0436365_0356319 3300039437 Bacteria 21022
833 Ga0436365_0449923 3300039437 Unclassified 894
834 Ga0436365_0653192 3300039437 Bacteria 2205
835 Ga0436365_0763573 3300039437 Bacteria 1821
836 Ga0436365_1191589 3300039437 Bacteria 754
837 Ga0436365_1712439 3300039437 Bacteria 1071
838 Ga0436365_1731595 3300039437 Bacteria 1714
839 Ga0436360_0485582 3300039438 Bacteria 1626
840 Ga0436360_0638353 3300039438 Bacteria 2264
841 Ga0436360_0878352 3300039438 Bacteria 1579
842 Ga0436360_1051847 3300039438 Bacteria 1257
843 Ga0436360_1282173 3300039438 Bacteria 1363
844 Ga0436361_0602437 3300039447 Bacteria 1592
845 Ga0436363_0619359 3300039450 Bacteria 5836
846 Ga0436363_0815889 3300039450 Bacteria 881
847 Ga0436363_0858438 3300039450 Bacteria 947
848 Ga0439453_0005684 3300041408 Bacteria 1908
849 Ga0439465_0077408 3300041413 Bacteria 1123
850 Ga0451807_2679455 3300041486 Bacteria 2972
851 Ga0451853_2031171 3300041512 Bacteria 1099
852 Ga0439441_009658 3300042001 Bacteria 1603
853 Ga0439441_013424 3300042001 Bacteria 1421
854 Ga0439441_025781 3300042001 Bacteria 1112
855 Ga0439443_000435 3300042003 Bacteria 3627
856 Ga0439448_0000722 3300042005 Bacteria 7963
857 Ga0439463_012567 3300042016 Bacteria 2083
858 Ga0450923_041328 3300042125 Bacteria 970
859 Ga0439458_0001256 3300042157 Bacteria 6398
860 Ga0439435_0007496 3300042436 Bacteria 2497
861 Ga0439460_0010765 3300042461 Bacteria 2348
862 Ga0451577_0002781 3300042876 Bacteria 20227
863 Ga0451577_0009822 3300042876 Bacteria 9170
864 Ga0451577_0102161 3300042876 Bacteria 2562
865 Ga0451577_0155692 3300042876 Bacteria 2057
866 Ga0451577_0756551 3300042876 Bacteria 879
867 Ga0453684_0027486 3300044712 Bacteria 8157
868 Ga0453684_0194743 3300044712 Bacteria 2368
869 Ga0466968_0142555 3300044735 Bacteria 1097
870 Ga0466959_0132286 3300045049 Bacteria 1768
871 Ga0451576_0000675 3300045051 Bacteria 69506
872 Ga0451576_0001560 3300045051 Bacteria 38618
873 Ga0451576_0016703 3300045051 Bacteria 8095
874 Ga0451576_0020927 3300045051 Bacteria 7119
875 Ga0451576_0039924 3300045051 Bacteria 4968
876 Ga0451576_0210373 3300045051 Bacteria 2031
877 Ga0495603_0032349 3300046455 Bacteria 3147
878 Ga0495603_0042369 3300046455 Bacteria 2721
879 Ga0495591_022367 3300046458 Bacteria 2045
880 Ga0495638_0012261 3300046460 Bacteria 5882
881 Ga0495638_0100790 3300046460 Bacteria 1727
882 Ga0495638_0106886 3300046460 Bacteria 1667
883 Ga0495638_0127966 3300046460 Bacteria 1495
884 Ga0495638_0133139 3300046460 Bacteria 1458
885 Ga0495580_0001101 3300046472 Bacteria 23723
886 Ga0495580_0002735 3300046472 Bacteria 15211
887 Ga0495580_0214433 3300046472 Bacteria 1324
888 Ga0495582_0032106 3300046473 Bacteria 2889
889 Ga0495605_0017300 3300046474 Bacteria 3886
890 Ga0495662_0053818 3300046476 Bacteria 1944
891 Ga0495584_0021909 3300046491 Bacteria 3244
892 Ga0495584_0172803 3300046491 Bacteria 1098
893 Ga0495585_0005753 3300046492 Bacteria 7777
894 Ga0495596_0005581 3300046500 Bacteria 5914
895 Ga0495607_0051144 3300046501 Bacteria 2401
896 Ga0495607_0154453 3300046501 Bacteria 1172
897 Ga0495606_0035406 3300046507 Bacteria 3412
898 Ga0495610_0025112 3300046512 Bacteria 3205
899 Ga0495616_0012462 3300046513 Bacteria 4827
900 Ga0495616_0057445 3300046513 Bacteria 1918
901 Ga0495620_0103105 3300046515 Bacteria 1136
902 Ga0495630_0264030 3300046517 Bacteria 1315
903 Ga0495631_0041424 3300046518 Bacteria 2038
904 Ga0495632_0135841 3300046519 Bacteria 1143
905 Ga0495637_0032492 3300046520 Bacteria 2298
906 Ga0495643_0030338 3300046522 Bacteria 3020
907 Ga0495644_0001773 3300046523 Bacteria 8705
908 Ga0495648_0028648 3300046524 Bacteria 3706
909 Ga0495648_0202072 3300046524 Bacteria 994
910 Ga0495663_0001218 3300046525 Bacteria 8268
911 Ga0495663_0039050 3300046525 Bacteria 1437
912 Ga0495666_0001865 3300046526 Bacteria 10400
913 Ga0495642_0045202 3300046528 Bacteria 1800
914 Ga0495642_0049393 3300046528 Bacteria 1728
915 Ga0495654_0001080 3300046530 Bacteria 19872
916 Ga0495654_0033331 3300046530 Bacteria 2607
917 Ga0495654_0045976 3300046530 Bacteria 2152
918 Ga0495640_0161037 3300046533 Bacteria 1438
919 Ga0495640_0238574 3300046533 Bacteria 1142
920 Ga0495586_0007994 3300046535 Bacteria 5642
921 Ga0495598_0000982 3300046537 Bacteria 5491
922 Ga0495598_0045429 3300046537 Bacteria 1301
923 Ga0495609_0011376 3300046538 Bacteria 4240
924 Ga0495597_0178523 3300046542 Unclassified 859
925 Ga0495645_0606382 3300046543 Bacteria 673
926 Ga0495622_0037855 3300046557 Bacteria 2246
927 Ga0495633_0031180 3300046558 Bacteria 2587
928 Ga0495656_0007268 3300046615 Bacteria 3907
929 Ga0495668_0019509 3300046616 Bacteria 3907
930 Ga0495611_0005578 3300046648 Bacteria 5369
931 Ga0495659_0009620 3300046664 Bacteria 3090
932 Ga0495659_0087804 3300046664 Bacteria 1190
933 Ga0495661_0019091 3300046665 Bacteria 4497
934 Ga0495661_0035705 3300046665 Bacteria 3117
935 Ga0495588_0014772 3300046674 Bacteria 3745
936 Ga0495588_0016816 3300046674 Bacteria 3540
937 Ga0495657_0182727 3300046675 Bacteria 1286
938 Ga0495647_0000948 3300046681 Bacteria 8744
939 Ga0495658_0010802 3300046683 Bacteria 4573
940 Ga0495658_0067177 3300046683 Bacteria 2073
941 Ga0495658_0293597 3300046683 Bacteria 1027
942 Ga0495669_0007268 3300046684 Bacteria 4639
943 Ga0495669_0021483 3300046684 Bacteria 2802
944 Ga0495669_0091938 3300046684 Bacteria 1401
945 Ga0495624_0140034 3300046690 Bacteria 1482
946 Ga0495670_0021776 3300046691 Bacteria 3163
947 Ga0495670_0036040 3300046691 Bacteria 2464
948 Ga0495671_0006022 3300046692 Bacteria 7048
949 Ga0495671_0023073 3300046692 Bacteria 3254
950 Ga0495649_0026038 3300046694 Bacteria 3256
951 Ga0495660_0065974 3300046810 Bacteria 1931
952 Ga0495636_0058461 3300047318 Bacteria 1626
953 Ga0495674_0218795 3300047319 Unclassified 1575
954 Ga0495672_0087001 3300047320 Bacteria 1727
955 Ga0495676_0007035 3300047321 Bacteria 10328
956 Ga0495676_0019040 3300047321 Bacteria 6045
957 Ga0495676_0025891 3300047321 Bacteria 5056
958 Ga0495687_000388 3300047443 Bacteria 54492
959 Ga0495677_0008087 3300047445 Bacteria 3905
960 Ga0495679_043979 3300047446 Bacteria 1370
961 Ga0495685_024288 3300047447 Bacteria 2086
962 Ga0495684_0143697 3300047471 Bacteria 1788
963 Ga0495686_0009809 3300047472 Bacteria 6871
964 Ga0495615_0001640 3300048090 Bacteria 3374
965 Ga0495626_0025409 3300048091 Bacteria 2898
966 Ga0495626_0109708 3300048091 Bacteria 1196
967 Ga0496100_0017604 3300048903 Bacteria 4222
968 Ga0496100_0097712 3300048903 Bacteria 2017
969 Ga0496100_0124854 3300048903 Bacteria 1805
970 Ga0496100_0472800 3300048903 Unclassified 963
971 Ga0496101_0030581 3300048904 Bacteria 3777
972 Ga0496101_0076772 3300048904 Bacteria 2461
973 Ga0496101_0094815 3300048904 Bacteria 2225
974 Ga0496102_0022924 3300048905 Bacteria 5537
975 Ga0496102_0235500 3300048905 Bacteria 1726
976 Ga0496102_0316762 3300048905 Bacteria 1470
977 Ga0496103_0038473 3300048906 Bacteria 2935
978 Ga0496104_0001994 3300048907 Bacteria 17714
979 Ga0496104_0010317 3300048907 Bacteria 8340
980 Ga0496104_0013248 3300048907 Bacteria 7432
981 Ga0496104_0061181 3300048907 Bacteria 3569
982 Ga0496105_0026267 3300048908 Bacteria 4749
983 Ga0496105_0041867 3300048908 Bacteria 3775
984 Ga0496105_0214395 3300048908 Bacteria 1569
985 Ga0496106_0006348 3300048909 Bacteria 8757
986 Ga0496106_0037466 3300048909 Bacteria 3628
987 Ga0496107_0043856 3300048910 Bacteria 3214
988 Ga0496107_0108783 3300048910 Bacteria 2036
989 Ga0496107_0173346 3300048910 Unclassified 1601
990 Ga0496107_0836229 3300048910 Bacteria 673
991 Ga0496108_0007201 3300048911 Bacteria 9016
992 Ga0496108_0155646 3300048911 Bacteria 1974
993 Ga0496109_0002300 3300048912 Bacteria 15893
994 Ga0496109_0168093 3300048912 Bacteria 2057
995 Ga0496109_0863253 3300048912 Bacteria 843
996 Ga0496110_0008186 3300048913 Bacteria 8403
997 Ga0496110_0011792 3300048913 Bacteria 7175
998 Ga0496110_0026348 3300048913 Bacteria 4973
999 Ga0496110_0226986 3300048913 Bacteria 1698
1000 Ga0496110_0715883 3300048913 Bacteria 903
1001 Ga0496111_0001890 3300048914 Bacteria 12398
1002 Ga0496111_0119894 3300048914 Bacteria 1943
1003 Ga0496112_0001865 3300048915 Bacteria 16603
1004 Ga0496112_0156578 3300048915 Bacteria 2245
1005 Ga0496112_0181169 3300048915 Bacteria 2071
1006 Ga0496112_0563503 3300048915 Bacteria 1073
1007 Ga0496113_0000167 3300048916 Bacteria 29216
1008 Ga0496113_0132216 3300048916 Bacteria 1959
1009 Ga0496113_0175855 3300048916 Bacteria 1696
1010 Ga0496113_0289307 3300048916 Bacteria 1311
1011 Ga0496113_0388762 3300048916 Bacteria 1120
1012 Ga0496114_0051129 3300048917 Bacteria 3440
1013 Ga0496114_0073163 3300048917 Bacteria 2884
1014 Ga0496114_0176244 3300048917 Bacteria 1866
1015 Ga0496114_0187205 3300048917 Bacteria 1810
1016 Ga0496115_0018777 3300048918 Bacteria 5315
1017 Ga0496115_0030258 3300048918 Bacteria 4258
1018 Ga0496115_0038959 3300048918 Bacteria 3774
1019 Ga0496115_0259112 3300048918 Bacteria 1430
1020 Ga0496116_0000026 3300048919 Bacteria 450803
1021 Ga0496116_0013539 3300048919 Bacteria 6565
1022 Ga0496117_0004597 3300048920 Bacteria 15077
1023 Ga0496117_0044695 3300048920 Bacteria 3206
1024 Ga0496117_0092935 3300048920 Bacteria 1936
1025 Ga0496118_0029029 3300048921 Bacteria 4646
1026 Ga0496118_0045851 3300048921 Bacteria 3406
1027 Ga0496118_0086133 3300048921 Bacteria 2184
1028 Ga0496118_0189001 3300048921 Bacteria 1234
1029 Ga0496119_0062440 3300048922 Bacteria 2220
1030 Ga0496119_0203484 3300048922 Bacteria 1023
1031 Ga0496120_0123119 3300048923 Bacteria 1338
1032 Ga0496120_0129526 3300048923 Bacteria 1294
1033 Ga0496121_0001905 3300048924 Bacteria 33397
1034 Ga0496121_0007839 3300048924 Bacteria 12769
1035 Ga0496121_0029508 3300048924 Bacteria 5070
1036 Ga0496121_0276991 3300048924 Bacteria 1150
1037 Ga0496122_0236254 3300048925 Bacteria 1034
1038 Ga0496123_0005272 3300048926 Bacteria 13107
1039 Ga0496123_0052936 3300048926 Bacteria 2687
1040 Ga0496124_0035931 3300048927 Bacteria 4329
1041 Ga0496124_0048988 3300048927 Bacteria 3606
1042 Ga0496124_0061982 3300048927 Bacteria 3132
1043 Ga0496124_0183136 3300048927 Bacteria 1610
1044 Ga0496125_0001573 3300048928 Bacteria 32538
1045 Ga0496125_0085042 3300048928 Bacteria 2398
1046 Ga0496126_0000069 3300048929 Bacteria 246935
1047 Ga0496126_0007545 3300048929 Bacteria 11901
1048 Ga0496126_0048869 3300048929 Bacteria 3863
1049 Ga0501032_0182089 3300049569 Bacteria 1375
1050 Ga0501033_0000666 3300049570 Bacteria 31758
1051 Ga0501033_0055354 3300049570 Bacteria 2933
1052 Ga0501033_0215358 3300049570 Bacteria 1369
1053 Ga0501034_0005553 3300049571 Bacteria 13753
1054 Ga0501034_0077714 3300049571 Bacteria 3324
1055 Ga0501034_0085624 3300049571 Bacteria 3153
1056 Ga0501034_0140789 3300049571 Bacteria 2392
1057 Ga0501036_0001754 3300049572 Bacteria 16852
1058 Ga0501037_0063546 3300049573 Bacteria 2691
1059 Ga0501037_0258359 3300049573 Bacteria 1217
1060 Ga0501037_0485143 3300049573 Bacteria 840
1061 Ga0501037_0578928 3300049573 Bacteria 755
1062 Ga0501038_0002084 3300049574 Bacteria 18539
1063 Ga0501038_0295632 3300049574 Bacteria 1272
1064 Ga0501038_0384572 3300049574 Bacteria 1088
1065 Ga0501039_0011020 3300049575 Bacteria 6887
1066 Ga0501039_0138193 3300049575 Bacteria 1914
1067 Ga0501039_0193256 3300049575 Bacteria 1600
1068 Ga0501039_0458357 3300049575 Bacteria 1001
1069 Ga0501040_0000304 3300049576 Bacteria 28753
1070 Ga0501040_0049568 3300049576 Bacteria 2871
1071 Ga0501040_0121838 3300049576 Bacteria 1830
1072 Ga0501041_0000266 3300049577 Bacteria 24787
1073 Ga0501041_0027096 3300049577 Bacteria 3452
1074 Ga0501041_0093683 3300049577 Bacteria 1855
1075 Ga0501041_0154012 3300049577 Bacteria 1436
1076 Ga0501042_0003926 3300049578 Bacteria 9409
1077 Ga0501042_0027014 3300049578 Bacteria 4035
1078 Ga0501042_0044922 3300049578 Bacteria 3148
1079 Ga0501042_0048605 3300049578 Bacteria 3025
1080 Ga0501043_0013517 3300049579 Bacteria 6388
1081 Ga0501046_0000413 3300049580 Bacteria 42578
1082 Ga0501046_0073066 3300049580 Bacteria 2662
1083 Ga0501048_0007453 3300049582 Bacteria 8293
1084 Ga0501048_0022525 3300049582 Bacteria 4607
1085 Ga0501048_0227559 3300049582 Bacteria 1323
1086 Ga0501048_0410020 3300049582 Bacteria 969
1087 Ga0501067_0019042 3300049583 Bacteria 3799
1088 Ga0501068_0046421 3300049584 Bacteria 2620
1089 Ga0501068_0222188 3300049584 Bacteria 1201
1090 Ga0501068_0578227 3300049584 Bacteria 731
1091 Ga0501070_0045012 3300049586 Bacteria 3671
1092 Ga0501070_0495277 3300049586 Bacteria 982
1093 Ga0501071_0001916 3300049587 Bacteria 12386
1094 Ga0501071_0007364 3300049587 Bacteria 7217
1095 Ga0501072_0003133 3300049588 Bacteria 12440
1096 Ga0501072_0008557 3300049588 Bacteria 7759
1097 Ga0501072_0009222 3300049588 Bacteria 7498
1098 Ga0501072_0010196 3300049588 Bacteria 7160
1099 Ga0501072_0104921 3300049588 Bacteria 2247
1100 Ga0501072_0754948 3300049588 Bacteria 763
1101 Ga0501074_0002421 3300049590 Bacteria 12998
1102 Ga0501074_0299769 3300049590 Bacteria 1142
1103 Ga0501075_0003585 3300049591 Bacteria 10398
1104 Ga0501075_0136695 3300049591 Bacteria 1867
1105 Ga0501076_0001446 3300049592 Bacteria 15968
1106 Ga0501076_0001483 3300049592 Bacteria 15718
1107 Ga0501076_0022711 3300049592 Bacteria 4824
1108 Ga0501076_0022723 3300049592 Bacteria 4823
1109 Ga0501076_0062208 3300049592 Bacteria 2972
1110 Ga0501076_0120017 3300049592 Bacteria 2129
1111 Ga0501076_0479249 3300049592 Bacteria 1025
1112 Ga0501076_0575887 3300049592 Bacteria 929
1113 Ga0501077_0003912 3300049593 Bacteria 8972
1114 Ga0501077_0113475 3300049593 Bacteria 1718
1115 Ga0501077_0393678 3300049593 Bacteria 885
1116 Ga0501238_019607 3300049671 Bacteria 951
1117 Ga0501079_0016515 3300049741 Bacteria 5638
1118 Ga0501079_0017526 3300049741 Bacteria 5469
1119 Ga0501079_0503698 3300049741 Bacteria 952
1120 Ga0501080_0005621 3300049742 Bacteria 11204
1121 Ga0501080_0035001 3300049742 Bacteria 4689
1122 Ga0501081_0039325 3300049743 Bacteria 3235
1123 Ga0501081_0141341 3300049743 Bacteria 1725
1124 Ga0501081_0389709 3300049743 Bacteria 1030
1125 Ga0501083_0096736 3300049744 Bacteria 1948
1126 Ga0501083_0178895 3300049744 Bacteria 1385
1127 Ga0501035_0033015 3300049822 Bacteria 4707
1128 Ga0501035_0351323 3300049822 Bacteria 1233
1129 Ga0501044_0029827 3300049823 Bacteria 5750
1130 Ga0501044_0103882 3300049823 Bacteria 2856
1131 Ga0501044_0194444 3300049823 Bacteria 1989
1132 Ga0501045_0000295 3300049824 Bacteria 29176
1133 Ga0501045_0007168 3300049824 Bacteria 7734
1134 Ga0501045_0072370 3300049824 Bacteria 2538
1135 Ga0501045_0177065 3300049824 Bacteria 1589
1136 nmdc:mga03683_11477_c1 3300050489 Bacteria 1464
1137 nmdc:mga03683_20338_c1 3300050489 Bacteria 2546
1138 nmdc:mga03683_2429_c1 3300050489 Bacteria 5785
1139 nmdc:mga03683_271126_c1 3300050489 Bacteria 791
1140 nmdc:mga03n38_124545_c1 3300050490 Bacteria 1270
1141 nmdc:mga03n38_136051_c1 3300050490 Bacteria 1223
1142 nmdc:mga03n38_17332_c1 3300050490 Bacteria 2819
1143 nmdc:mga00v17_145119_c1 3300050491 Bacteria 1523
1144 nmdc:mga00v17_207742_c1 3300050491 Bacteria 1267
1145 nmdc:mga00v17_240704_c1 3300050491 Bacteria 1173
1146 nmdc:mga00v17_82603_c1 3300050491 Bacteria 2008
1147 nmdc:mga0yw44_1059_c1 3300050492 Bacteria 10549
1148 nmdc:mga0yw44_1573_c1 3300050492 Bacteria 9152
1149 nmdc:mga0yw44_18590_c1 3300050492 Bacteria 3811
1150 nmdc:mga0yw44_230281_c1 3300050492 Bacteria 1230
1151 nmdc:mga0yw44_435161_c1 3300050492 Bacteria 889
1152 nmdc:mga0yw44_8582_c1 3300050492 Bacteria 2820
1153 nmdc:mga0k408_148172_c1 3300050493 Bacteria 1397
1154 nmdc:mga0k408_22647_c1 3300050493 Bacteria 3539
1155 nmdc:mga0k408_75725_c1 3300050493 Bacteria 1967
1156 nmdc:mga06z11_10515_c1 3300050494 Bacteria 3950
1157 nmdc:mga04h51_44764_c1 3300050495 Bacteria 1461
1158 nmdc:mga07m45_176188_c1 3300050496 Bacteria 1243
1159 nmdc:mga05p37_1030425_c1 3300050507 Bacteria 870
1160 nmdc:mga05p37_13349_c1 3300050507 Bacteria 9840
1161 nmdc:mga05p37_18147_c1 3300050507 Bacteria 8500
1162 nmdc:mga05p37_245292_c1 3300050507 Bacteria 2151
1163 nmdc:mga05p37_284177_c1 3300050507 Bacteria 1972
1164 nmdc:mga05p37_350268_c1 3300050507 Bacteria 1739
1165 nmdc:mga05p37_375_c1 3300050507 Bacteria 48034
1166 nmdc:mga05p37_8272_c1 3300050507 Bacteria 12300
1167 nmdc:mga05p37_8460_c1 3300050507 Bacteria 12167
1168 nmdc:mga09592_122_c1 3300050508 Bacteria 49514
1169 nmdc:mga09592_150915_c1 3300050508 Bacteria 2005
1170 nmdc:mga09592_27000_c1 3300050508 Bacteria 4761
1171 nmdc:mga09592_50873_c1 3300050508 Bacteria 3494
1172 nmdc:mga09592_64067_c1 3300050508 Bacteria 3112
1173 nmdc:mga09592_9811_c1 3300050508 Bacteria 7784
1174 nmdc:mga0qj67_12117_c1 3300050509 Bacteria 6486
1175 nmdc:mga0qj67_15530_c1 3300050509 Bacteria 5766
1176 nmdc:mga0qj67_183400_c1 3300050509 Bacteria 1700
1177 nmdc:mga0qj67_3256_c1 3300050509 Bacteria 11696
1178 nmdc:mga0qj67_45584_c1 3300050509 Bacteria 3460
1179 nmdc:mga0qj67_61926_c1 3300050509 Bacteria 2972
1180 nmdc:mga06r32_1168_c1 3300050510 Bacteria 23647
1181 nmdc:mga06r32_152492_c1 3300050510 Bacteria 2290
1182 nmdc:mga06r32_17315_c1 3300050510 Bacteria 6579
1183 nmdc:mga06r32_24989_c1 3300050510 Bacteria 5550
1184 nmdc:mga06r32_30461_c1 3300050510 Bacteria 5062
1185 nmdc:mga06r32_3605_c1 3300050510 Bacteria 13817
1186 nmdc:mga06r32_49808_c1 3300050510 Bacteria 4007
1187 nmdc:mga06r32_4_c1 3300050510 Bacteria 144637
1188 nmdc:mga06r32_54967_c1 3300050510 Bacteria 3818
1189 nmdc:mga06r32_551046_c1 3300050510 Bacteria 1127
1190 nmdc:mga06r32_595302_c1 3300050510 Bacteria 1077
1191 nmdc:mga06r32_96336_c1 3300050510 Bacteria 2897
1192 nmdc:mga08y16_16961_c1 3300050511 Bacteria 7669
1193 nmdc:mga08y16_197018_c1 3300050511 Bacteria 2088
1194 nmdc:mga08y16_247461_c1 3300050511 Bacteria 1842
1195 nmdc:mga08y16_348_c1 3300050511 Bacteria 41612
1196 nmdc:mga08y16_4215_c1 3300050511 Bacteria 15001
1197 nmdc:mga08y16_562411_c1 3300050511 Bacteria 1153
1198 nmdc:mga08y16_756619_c1 3300050511 Bacteria 967
1199 nmdc:mga08y16_8294_c1 3300050511 Bacteria 10872
1200 nmdc:mga08y16_9100_c1 3300050511 Bacteria 10428
1201 nmdc:mga0n895_1039876_c1 3300050512 Bacteria 798
1202 nmdc:mga0n895_162047_c1 3300050512 Bacteria 2268
1203 nmdc:mga0n895_20484_c1 3300050512 Bacteria 6169
1204 nmdc:mga0n895_254848_c1 3300050512 Bacteria 1781
1205 nmdc:mga0n895_33720_c1 3300050512 Bacteria 4921
1206 nmdc:mga0n895_35879_c1 3300050512 Bacteria 4785
1207 nmdc:mga0n895_365520_c1 3300050512 Bacteria 1461
1208 nmdc:mga0n895_367_c1 3300050512 Bacteria 30485
1209 nmdc:mga0n895_392704_c1 3300050512 Bacteria 1403
1210 nmdc:mga0n895_3979_c1 3300050512 Bacteria 12016
1211 nmdc:mga0n895_53331_c1 3300050512 Bacteria 3974
1212 nmdc:mga0n895_95333_c1 3300050512 Bacteria 2980
1213 nmdc:mga0rr50_107633_c1 3300050513 Bacteria 2201
1214 nmdc:mga0rr50_115538_c1 3300050513 Bacteria 2130
1215 nmdc:mga0rr50_12254_c1 3300050513 Bacteria 5530
1216 nmdc:mga0rr50_147498_c2 3300050513 Bacteria 1277
1217 nmdc:mga0rr50_182397_c1 3300050513 Bacteria 1717
1218 nmdc:mga0rr50_2408_c1 3300050513 Bacteria 10528
1219 nmdc:mga0rr50_392515_c1 3300050513 Bacteria 1171
1220 nmdc:mga0rr50_404287_c1 3300050513 Bacteria 1154
1221 nmdc:mga0rr50_895456_c1 3300050513 Bacteria 757
1222 nmdc:mga08x19_194011_c1 3300050514 Bacteria 1390
1223 nmdc:mga08x19_6538_c1 3300050514 Bacteria 3635
1224 nmdc:mga08x19_73342_c1 3300050514 Bacteria 2234
1225 nmdc:mga08x19_86296_c1 3300050514 Bacteria 2066
1226 nmdc:mga0a205_123347_c1 3300050515 Bacteria 2490
1227 nmdc:mga0a205_136101_c1 3300050515 Bacteria 2357
1228 nmdc:mga0a205_159518_c1 3300050515 Bacteria 2153
1229 nmdc:mga0a205_19958_c1 3300050515 Bacteria 6324
1230 nmdc:mga0a205_2122_c1 3300050515 Bacteria 17397
1231 nmdc:mga0a205_32425_c1 3300050515 Bacteria 5009
1232 nmdc:mga0a205_4461_c2 3300050515 Bacteria 8877
1233 nmdc:mga0a205_475509_c1 3300050515 Bacteria 1108
1234 nmdc:mga0a205_545545_c1 3300050515 Bacteria 1015
1235 nmdc:mga0a205_5700_c1 3300050515 Bacteria 11220
1236 nmdc:mga0a205_6561_c1 3300050515 Bacteria 10523
1237 nmdc:mga0a205_66_c1 3300050515 Bacteria 56771
1238 nmdc:mga0sz30_54786_c1 3300050516 Bacteria 1696
1239 nmdc:mga0sz30_73067_c1 3300050516 Bacteria 1478
1240 nmdc:mga0sz30_98511_c1 3300050516 Bacteria 1276
1241 Ga0495601_0167447 3300053077 Bacteria 1436
1242 Ga0495612_0031633 3300053078 Bacteria 2134
1243 Ga0500610_0179717 3300053079 Bacteria 1037
1244 Ga0495655_0000541 3300053083 Bacteria 6202
1245 Ga0495595_0105175 3300053084 Bacteria 1365
1246 Ga0495619_0070046 3300053085 Bacteria 2345
1247 Ga0495619_0486244 3300053085 Bacteria 849
1248 Ga0500578_0063399 3300053086 Bacteria 2358
1249 Ga0500643_031603 3300053087 Bacteria 1612
1250 Ga0500646_0251360 3300053090 Bacteria 622
1251 Ga0500651_0038106 3300053093 Bacteria 3029
1252 Ga0500566_0000118 3300053094 Bacteria 40914
1253 Ga0500641_0002266 3300053096 Bacteria 6820
1254 Ga0500641_0004939 3300053096 Bacteria 4726
1255 Ga0500650_0090972 3300053098 Bacteria 1428
1256 Ga0500555_001804 3300053103 Bacteria 6390
1257 Ga0500556_0000003 3300053104 Bacteria 679379
1258 Ga0500562_035725 3300053108 Bacteria 1316
1259 Ga0500569_006211 3300053109 Bacteria 2612
1260 Ga0500593_002147 3300053117 Bacteria 7173
1261 Ga0500608_000841 3300053122 Bacteria 11113
1262 Ga0500608_084513 3300053122 Bacteria 1492
1263 Ga0500618_000843 3300053125 Bacteria 16595
1264 Ga0500618_036333 3300053125 Bacteria 1142
1265 Ga0500642_0000006 3300053130 Bacteria 350064
1266 Ga0500642_0002570 3300053130 Bacteria 5354
1267 Ga0500652_098908 3300053131 Bacteria 1219
1268 Ga0500655_001113 3300053133 Bacteria 5133
1269 Ga0500658_0074878 3300053134 Bacteria 1436
1270 Ga0500658_0153682 3300053134 Bacteria 1038
1271 Ga0500559_0000284 3300053136 Bacteria 39133
1272 Ga0500568_0006823 3300053139 Bacteria 5686
1273 Ga0500568_0010309 3300053139 Bacteria 4383
1274 Ga0500573_0172471 3300053140 Bacteria 1168
1275 Ga0500574_000110 3300053141 Bacteria 8867
1276 Ga0500577_0010379 3300053142 Bacteria 2740
1277 Ga0500588_0090836 3300053146 Bacteria 1038
1278 Ga0500604_0003713 3300053151 Bacteria 4083
1279 Ga0500604_0006665 3300053151 Bacteria 3054
1280 Ga0500616_0000033 3300053153 Bacteria 398830
1281 Ga0500622_0001548 3300053156 Bacteria 18205
1282 Ga0500627_0074921 3300053158 Bacteria 1503
1283 Ga0500627_0085903 3300053158 Bacteria 1405
1284 Ga0500636_0006124 3300053177 Bacteria 6906
1285 Ga0500645_018432 3300053730 Bacteria 2180
1286 Ga0500552_001175 3300053733 Bacteria 2480
1287 Ga0501084_0010451 3300054114 Bacteria 7673
1288 Ga0501084_0101727 3300054114 Bacteria 2413
1289 Ga0501084_0217747 3300054114 Bacteria 1611
1290 Ga0501084_0523183 3300054114 Bacteria 1003
1291 Ga0501082_0000438 3300060353 Bacteria 36890
1292 Ga0501082_0046888 3300060353 Bacteria 3724
1293 Ga0501082_0082168 3300060353 Bacteria 2780
1294 Ga0530510_0001413 3300061734 Bacteria 16087
1295 Ga0530510_0297194 3300061734 Bacteria 1208
1296 Ga0530510_0297786 3300061734 Unclassified 1207
1297 Ga0530510_0660428 3300061734 Bacteria 796

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053090 Ga0500646_0251360 Ga0500646_0251360_13_603 187
2 3300049571 Ga0501034_0140789 Ga0501034_0140789_937_1602 194
3 3300006880 Ga0075429_100008027 Ga0075429_1000080273 195
4 3300009094 Ga0111539_11297329 Ga0111539_112973292 195
5 3300053096 Ga0500641_0004939 Ga0500641_0004939_3956_4621 195
6 3300006195 Ga0075366_10210545 Ga0075366_102105452 198
7 3300050493 nmdc:mga0k408_148172_c1 nmdc:mga0k408_148172_c1_204_878 198
8 3300005441 Ga0070700_100159024 Ga0070700_1001590242 199
9 3300005844 Ga0068862_100300280 Ga0068862_1003002802 199
10 3300048910 Ga0496107_0836229 Ga0496107_0836229_10_609 199
11 3300005615 Ga0070702_100742233 Ga0070702_1007422331 201
12 3300006852 Ga0075433_10058619 Ga0075433_100586193 201
13 3300013297 Ga0157378_10080417 Ga0157378_100804174 201
14 3300025938 Ga0207704_10190072 Ga0207704_101900722 201
15 3300037312 Ga0395899_0013907 Ga0395899_0013907_1658_2332 201
16 3300038443 Ga0395901_0004531 Ga0395901_0004531_7044_7718 201
17 3300046528 Ga0495642_0045202 Ga0495642_0045202_845_1507 201
18 3300046684 Ga0495669_0021483 Ga0495669_0021483_1414_2076 201
19 3300050512 nmdc:mga0n895_254848_c1 nmdc:mga0n895_254848_c1_430_1092 201
20 3300050515 nmdc:mga0a205_136101_c1 nmdc:mga0a205_136101_c1_817_1479 201
21 3300021384 Ga0213876_10005637 Ga0213876_100056377 202
22 3300039437 Ga0436365_0356319 Ga0436365_0356319_3580_4254 202
23 3300049570 Ga0501033_0055354 Ga0501033_0055354_136_810 202
24 3300005340 Ga0070689_100219523 Ga0070689_1002195232 203
25 3300006846 Ga0075430_100070843 Ga0075430_1000708433 203
26 3300006852 Ga0075433_10016316 Ga0075433_100163165 203
27 3300006871 Ga0075434_100029302 Ga0075434_1000293026 203
28 3300007076 Ga0075435_100011662 Ga0075435_1000116624 203
29 3300009147 Ga0114129_10116199 Ga0114129_101161993 203
30 3300035114 Ga0373939_0030780 Ga0373939_0030780_623_1285 203
31 3300035242 Ga0373962_0038862 Ga0373962_0038862_640_1302 203
32 3300046472 Ga0495580_0002735 Ga0495580_0002735_1260_1922 203
33 3300050508 nmdc:mga09592_64067_c1 nmdc:mga09592_64067_c1_1700_2362 203
34 3300050509 nmdc:mga0qj67_61926_c1 nmdc:mga0qj67_61926_c1_240_902 203
35 3300050514 nmdc:mga08x19_73342_c1 nmdc:mga08x19_73342_c1_417_1079 203
36 3300049671 Ga0501238_019607 Ga0501238_019607_327_941 204
37 3300049822 Ga0501035_0351323 Ga0501035_0351323_289_924 204
38 3300021377 Ga0213874_10087740 Ga0213874_100877402 206
39 3300039450 Ga0436363_0619359 Ga0436363_0619359_4922_5596 206
40 3300046519 Ga0495632_0135841 Ga0495632_0135841_10_630 206
41 3300048922 Ga0496119_0203484 Ga0496119_0203484_13_633 206
42 3300006038 Ga0075365_10114416 Ga0075365_101144162 207
43 3300006186 Ga0075369_10024080 Ga0075369_100240803 207
44 3300006353 Ga0075370_10124997 Ga0075370_101249972 207
45 3300046557 Ga0495622_0037855 Ga0495622_0037855_1093_1752 207
46 3300048919 Ga0496116_0013539 Ga0496116_0013539_1015_1674 207
47 3300048920 Ga0496117_0004597 Ga0496117_0004597_4424_5083 207
48 3300048921 Ga0496118_0086133 Ga0496118_0086133_690_1349 207
49 3300048927 Ga0496124_0061982 Ga0496124_0061982_923_1582 207
50 3300048928 Ga0496125_0085042 Ga0496125_0085042_1392_2051 207
51 3300050490 nmdc:mga03n38_124545_c1 nmdc:mga03n38_124545_c1_264_923 207
52 3300050492 nmdc:mga0yw44_8582_c1 nmdc:mga0yw44_8582_c1_1156_1815 207
53 3300053094 Ga0500566_0000118 Ga0500566_0000118_956_1615 207
54 3300053122 Ga0500608_084513 Ga0500608_084513_785_1444 207
55 3300053136 Ga0500559_0000284 Ga0500559_0000284_35538_36197 207
56 3300005331 Ga0070670_100368524 Ga0070670_1003685242 208
57 3300005518 Ga0070699_100198445 Ga0070699_1001984452 208
58 3300005985 Ga0081539_10012567 Ga0081539_100125674 208
59 3300005985 Ga0081539_10014480 Ga0081539_100144809 208
60 3300010159 Ga0099796_10066010 Ga0099796_100660101 208
61 3300035725 Ga0373947_0104588 Ga0373947_0104588_918_1583 208
62 3300037068 Ga0373925_0080820 Ga0373925_0080820_1833_2459 208
63 3300039450 Ga0436363_0858438 Ga0436363_0858438_180_845 208
64 3300041413 Ga0439465_0077408 Ga0439465_0077408_195_860 208
65 3300046543 Ga0495645_0606382 Ga0495645_0606382_24_650 208
66 3300046665 Ga0495661_0035705 Ga0495661_0035705_13_639 208
67 3300046691 Ga0495670_0021776 Ga0495670_0021776_2524_3150 208
68 3300049588 Ga0501072_0754948 Ga0501072_0754948_121_747 208
69 3300053134 Ga0500658_0074878 Ga0500658_0074878_785_1420 208
70 3300005436 Ga0070713_100132883 Ga0070713_1001328833 210
71 3300005437 Ga0070710_10247894 Ga0070710_102478942 210
72 3300006175 Ga0070712_100340271 Ga0070712_1003402712 210
73 3300006852 Ga0075433_10330437 Ga0075433_103304372 210
74 3300006871 Ga0075434_100089713 Ga0075434_1000897134 210
75 3300007076 Ga0075435_100052289 Ga0075435_1000522894 210
76 3300025928 Ga0207700_10053142 Ga0207700_100531422 210
77 3300049571 Ga0501034_0005553 Ga0501034_0005553_12109_12786 210
78 3300050512 nmdc:mga0n895_3979_c1 nmdc:mga0n895_3979_c1_10586_11248 210
79 3300050515 nmdc:mga0a205_159518_c1 nmdc:mga0a205_159518_c1_924_1586 210
80 3300005844 Ga0068862_100250144 Ga0068862_1002501442 211
81 3300006844 Ga0075428_100257408 Ga0075428_1002574082 211
82 3300006852 Ga0075433_10014866 Ga0075433_100148667 211
83 3300006871 Ga0075434_100092842 Ga0075434_1000928424 211
84 3300006871 Ga0075434_100107975 Ga0075434_1001079752 211
85 3300007076 Ga0075435_100044379 Ga0075435_1000443793 211
86 3300009094 Ga0111539_10000708 Ga0111539_1000070828 211
87 3300025933 Ga0207706_10099603 Ga0207706_100996033 211
88 3300027682 Ga0209971_1026348 Ga0209971_10263482 211
89 3300027907 Ga0207428_10000519 Ga0207428_1000051917 211
90 3300028380 Ga0268265_10039138 Ga0268265_100391384 211
91 3300035112 Ga0373932_0017858 Ga0373932_0017858_66_740 211
92 3300035114 Ga0373939_0030256 Ga0373939_0030256_432_1106 211
93 3300035691 Ga0373931_0009669 Ga0373931_0009669_1736_2410 211
94 3300035695 Ga0373927_0103608 Ga0373927_0103608_908_1582 211
95 3300035725 Ga0373947_0436590 Ga0373947_0436590_61_735 211
96 3300036401 Ga0373937_0518324 Ga0373937_0518324_100_774 211
97 3300039437 Ga0436365_0449923 Ga0436365_0449923_196_876 211
98 3300042876 Ga0451577_0002781 Ga0451577_0002781_5892_6554 211
99 3300044712 Ga0453684_0027486 Ga0453684_0027486_1480_2142 211
100 3300045051 Ga0451576_0016703 Ga0451576_0016703_5116_5778 211
101 3300046683 Ga0495658_0293597 Ga0495658_0293597_148_786 211
102 3300050511 nmdc:mga08y16_9100_c1 nmdc:mga08y16_9100_c1_5689_6351 211
103 3300050512 nmdc:mga0n895_365520_c1 nmdc:mga0n895_365520_c1_439_1140 211
104 3300050512 nmdc:mga0n895_95333_c1 nmdc:mga0n895_95333_c1_252_914 211
105 3300050513 nmdc:mga0rr50_895456_c1 nmdc:mga0rr50_895456_c1_33_734 211
106 3300050515 nmdc:mga0a205_4461_c2 nmdc:mga0a205_4461_c2_7975_8637 211
107 3300005328 Ga0070676_10093706 Ga0070676_100937062 212
108 3300005539 Ga0068853_100544297 Ga0068853_1005442971 212
109 3300005544 Ga0070686_100128124 Ga0070686_1001281242 212
110 3300006038 Ga0075365_10164756 Ga0075365_101647563 212
111 3300013308 Ga0157375_10150256 Ga0157375_101502562 212
112 3300017792 Ga0163161_10304459 Ga0163161_103044592 212
113 3300025907 Ga0207645_10186218 Ga0207645_101862182 212
114 3300025931 Ga0207644_10108556 Ga0207644_101085563 212
115 3300025937 Ga0207669_10350158 Ga0207669_103501582 212
116 3300026121 Ga0207683_10594669 Ga0207683_105946692 212
117 3300035692 Ga0373935_0335321 Ga0373935_0335321_263_940 212
118 3300005440 Ga0070705_100062206 Ga0070705_1000622063 213
119 3300005577 Ga0068857_100051335 Ga0068857_1000513353 213
120 3300005937 Ga0081455_10012998 Ga0081455_100129988 213
121 3300006051 Ga0075364_10491400 Ga0075364_104914002 213
122 3300006852 Ga0075433_10514684 Ga0075433_105146841 213
123 3300009098 Ga0105245_10669958 Ga0105245_106699582 213
124 3300013100 Ga0157373_10364009 Ga0157373_103640092 213
125 3300025915 Ga0207693_10277980 Ga0207693_102779802 213
126 3300027671 Ga0209588_1036890 Ga0209588_10368901 213
127 3300037312 Ga0395899_0066534 Ga0395899_0066534_1844_2518 213
128 3300037418 Ga0395900_0177284 Ga0395900_0177284_420_1094 213
129 3300037466 Ga0395898_0053657 Ga0395898_0053657_2378_3052 213
130 3300038443 Ga0395901_0024595 Ga0395901_0024595_992_1666 213
131 3300050516 nmdc:mga0sz30_54786_c1 nmdc:mga0sz30_54786_c1_576_1241 213
132 3300009098 Ga0105245_10686995 Ga0105245_106869951 214
133 3300014325 Ga0163163_11076815 Ga0163163_110768152 214
134 3300049741 Ga0501079_0503698 Ga0501079_0503698_162_833 214
135 3300005548 Ga0070665_100020948 Ga0070665_1000209486 215
136 3300005843 Ga0068860_100253941 Ga0068860_1002539412 215
137 3300006042 Ga0075368_10000566 Ga0075368_100005663 215
138 3300006048 Ga0075363_100011166 Ga0075363_1000111663 215
139 3300006177 Ga0075362_10055905 Ga0075362_100559052 215
140 3300006178 Ga0075367_10014031 Ga0075367_100140315 215
141 3300006186 Ga0075369_10006961 Ga0075369_100069612 215
142 3300006195 Ga0075366_10006444 Ga0075366_100064442 215
143 3300026067 Ga0207678_10164500 Ga0207678_101645003 215
144 3300027866 Ga0209813_10037422 Ga0209813_100374221 215
145 3300035691 Ga0373931_0160061 Ga0373931_0160061_154_807 215
146 3300050489 nmdc:mga03683_20338_c1 nmdc:mga03683_20338_c1_1121_1792 215
147 3300050490 nmdc:mga03n38_136051_c1 nmdc:mga03n38_136051_c1_352_1023 215
148 3300050491 nmdc:mga00v17_207742_c1 nmdc:mga00v17_207742_c1_75_746 215
149 3300050492 nmdc:mga0yw44_435161_c1 nmdc:mga0yw44_435161_c1_92_763 215
150 3300050493 nmdc:mga0k408_75725_c1 nmdc:mga0k408_75725_c1_1182_1853 215
151 3300050494 nmdc:mga06z11_10515_c1 nmdc:mga06z11_10515_c1_1202_1873 215
152 3300050495 nmdc:mga04h51_44764_c1 nmdc:mga04h51_44764_c1_46_717 215
153 iso_pu_bacteria 2602042107 2603860263 215
154 iso_pu_bacteria 2857524615 2857525274 215
155 iso_pu_bacteria 2893066018 2893066609 215
156 iso_pu_bacteria 2919073203 2919075063 215
157 iso_pu_bacteria 2941499720 2941502067 215
158 iso_pu_bacteria 2978969890 2978970057 215
159 iso_pu_bacteria 2984587000 2984587077 215
160 3300005329 Ga0070683_100022527 Ga0070683_1000225276 216
161 3300005456 Ga0070678_100727878 Ga0070678_1007278782 216
162 3300005535 Ga0070684_100004958 Ga0070684_10000495812 216
163 3300005539 Ga0068853_100216191 Ga0068853_1002161911 216
164 3300005563 Ga0068855_100172440 Ga0068855_1001724402 216
165 3300005563 Ga0068855_100575008 Ga0068855_1005750082 216
166 3300005564 Ga0070664_100029888 Ga0070664_1000298884 216
167 3300005577 Ga0068857_100103025 Ga0068857_1001030252 216
168 3300005614 Ga0068856_100011462 Ga0068856_1000114626 216
169 3300005843 Ga0068860_100524568 Ga0068860_1005245682 216
170 3300006058 Ga0075432_10060084 Ga0075432_100600842 216
171 3300009093 Ga0105240_10089377 Ga0105240_100893773 216
172 3300009174 Ga0105241_10413696 Ga0105241_104136962 216
173 3300009545 Ga0105237_10666232 Ga0105237_106662322 216
174 3300010375 Ga0105239_10435888 Ga0105239_104358882 216
175 3300013102 Ga0157371_10021200 Ga0157371_100212004 216
176 3300013105 Ga0157369_10015753 Ga0157369_100157534 216
177 3300021388 Ga0213875_10021851 Ga0213875_100218512 216
178 3300025321 Ga0207656_10044224 Ga0207656_100442242 216
179 3300025911 Ga0207654_10251154 Ga0207654_102511542 216
180 3300025913 Ga0207695_10281923 Ga0207695_102819233 216
181 3300025921 Ga0207652_10273087 Ga0207652_102730872 216
182 3300025933 Ga0207706_10173754 Ga0207706_101737543 216
183 3300025936 Ga0207670_10174772 Ga0207670_101747721 216
184 3300025944 Ga0207661_10017221 Ga0207661_100172212 216
185 3300025945 Ga0207679_10069292 Ga0207679_100692922 216
186 3300026078 Ga0207702_10222911 Ga0207702_102229112 216
187 3300026088 Ga0207641_10757817 Ga0207641_107578172 216
188 3300028379 Ga0268266_10147662 Ga0268266_101476622 216
189 3300028380 Ga0268265_11061606 Ga0268265_110616061 216
190 3300037312 Ga0395899_0144741 Ga0395899_0144741_600_1277 216
191 3300037418 Ga0395900_0285319 Ga0395900_0285319_683_1360 216
192 3300037418 Ga0395900_0314098 Ga0395900_0314098_134_811 216
193 3300037466 Ga0395898_0028788 Ga0395898_0028788_3637_4314 216
194 3300037853 Ga0436364_1011929 Ga0436364_1011929_1112_1792 216
195 3300038443 Ga0395901_0373912 Ga0395901_0373912_496_1173 216
196 3300050489 nmdc:mga03683_271126_c1 nmdc:mga03683_271126_c1_40_714 216
197 3300053085 Ga0495619_0070046 Ga0495619_0070046_1172_1837 216
198 3300005295 Ga0065707_10099009 Ga0065707_100990093 217
199 3300005345 Ga0070692_10072681 Ga0070692_100726813 217
200 3300005347 Ga0070668_100140618 Ga0070668_1001406183 217
201 3300005353 Ga0070669_100004771 Ga0070669_10000477110 217
202 3300005356 Ga0070674_100073491 Ga0070674_1000734912 217
203 3300005406 Ga0070703_10036231 Ga0070703_100362312 217
204 3300005438 Ga0070701_10086009 Ga0070701_100860092 217
205 3300005441 Ga0070700_100002783 Ga0070700_1000027832 217
206 3300005444 Ga0070694_100112371 Ga0070694_1001123711 217
207 3300005459 Ga0068867_100008175 Ga0068867_1000081756 217
208 3300005543 Ga0070672_100205843 Ga0070672_1002058432 217
209 3300005718 Ga0068866_10164802 Ga0068866_101648022 217
210 3300005719 Ga0068861_100014550 Ga0068861_1000145503 217
211 3300005840 Ga0068870_10126731 Ga0068870_101267312 217
212 3300005844 Ga0068862_100060263 Ga0068862_1000602633 217
213 3300006881 Ga0068865_100018548 Ga0068865_1000185485 217
214 3300009094 Ga0111539_10447030 Ga0111539_104470302 217
215 3300009148 Ga0105243_10010240 Ga0105243_100102403 217
216 3300009553 Ga0105249_10020999 Ga0105249_100209994 217
217 3300014326 Ga0157380_10025645 Ga0157380_100256452 217
218 3300025899 Ga0207642_10007999 Ga0207642_100079993 217
219 3300025907 Ga0207645_10072742 Ga0207645_100727422 217
220 3300025908 Ga0207643_10051270 Ga0207643_100512702 217
221 3300025917 Ga0207660_10020025 Ga0207660_100200253 217
222 3300025917 Ga0207660_10155678 Ga0207660_101556782 217
223 3300025923 Ga0207681_10006788 Ga0207681_100067885 217
224 3300025935 Ga0207709_10008586 Ga0207709_100085863 217
225 3300025937 Ga0207669_10022230 Ga0207669_100222302 217
226 3300025938 Ga0207704_10009642 Ga0207704_100096423 217
227 3300025940 Ga0207691_10042527 Ga0207691_100425274 217
228 3300025961 Ga0207712_10792230 Ga0207712_107922302 217
229 3300025972 Ga0207668_10003050 Ga0207668_100030507 217
230 3300026075 Ga0207708_10002431 Ga0207708_1000243114 217
231 3300026089 Ga0207648_10002687 Ga0207648_100026879 217
232 3300026118 Ga0207675_100006447 Ga0207675_1000064478 217
233 3300027907 Ga0207428_10034027 Ga0207428_100340275 217
234 3300028380 Ga0268265_10012057 Ga0268265_100120573 217
235 3300032002 Ga0307416_100536624 Ga0307416_1005366242 217
236 3300042125 Ga0450923_041328 Ga0450923_041328_133_795 217
237 iso_pu_bacteria 2513237087 2513591621 217
238 iso_pu_bacteria 2599185236 2599724036 217
239 iso_pu_bacteria 2600254933 2600376205 217
240 iso_pu_bacteria 2687453129 2687577944 217
241 iso_pu_bacteria 2738541317 2738946963 217
242 iso_pu_bacteria 2818991467 2819717375 217
243 iso_pu_bacteria 2821123053 2821126883 217
244 iso_pu_bacteria 2838736955 2838740490 217
245 iso_pu_bacteria 2841840854 2841843386 217
246 iso_pu_bacteria 2842140634 2842143107 217
247 iso_pu_bacteria 2854681122 2854684671 217
248 iso_pu_bacteria 2857531043 2857535333 217
249 iso_pu_bacteria 2913308742 2913312212 217
250 iso_pu_bacteria 2935959822 2935960937 217
251 iso_pu_bacteria 2978969890 2978970051 217
252 iso_pu_bacteria 2984587000 2984587070 217
253 iso_pu_bacteria 2995392953 2995396721 217
254 iso_pu_bacteria 8054460903 8054464198 217
255 iso_pu_bacteria 8054563764 8054565578 217
256 3300005295 Ga0065707_10307618 Ga0065707_103076181 218
257 3300005327 Ga0070658_10063135 Ga0070658_100631352 218
258 3300005328 Ga0070676_10000559 Ga0070676_1000055914 218
259 3300005328 Ga0070676_10608658 Ga0070676_106086581 218
260 3300005329 Ga0070683_100435421 Ga0070683_1004354212 218
261 3300005330 Ga0070690_100145401 Ga0070690_1001454012 218
262 3300005330 Ga0070690_100208328 Ga0070690_1002083281 218
263 3300005331 Ga0070670_100001348 Ga0070670_1000013489 218
264 3300005334 Ga0068869_100008769 Ga0068869_1000087697 218
265 3300005334 Ga0068869_100104727 Ga0068869_1001047273 218
266 3300005336 Ga0070680_100002153 Ga0070680_10000215315 218
267 3300005336 Ga0070680_100011581 Ga0070680_1000115815 218
268 3300005336 Ga0070680_100050708 Ga0070680_1000507082 218
269 3300005336 Ga0070680_100104795 Ga0070680_1001047952 218
270 3300005337 Ga0070682_100023337 Ga0070682_1000233376 218
271 3300005339 Ga0070660_100074612 Ga0070660_1000746122 218
272 3300005340 Ga0070689_100132186 Ga0070689_1001321863 218
273 3300005341 Ga0070691_10004567 Ga0070691_100045673 218
274 3300005341 Ga0070691_10012722 Ga0070691_100127222 218
275 3300005341 Ga0070691_10028644 Ga0070691_100286444 218
276 3300005344 Ga0070661_100000426 Ga0070661_1000004265 218
277 3300005345 Ga0070692_10001134 Ga0070692_100011342 218
278 3300005345 Ga0070692_10014012 Ga0070692_100140126 218
279 3300005353 Ga0070669_100091905 Ga0070669_1000919052 218
280 3300005354 Ga0070675_100167056 Ga0070675_1001670563 218
281 3300005364 Ga0070673_100057312 Ga0070673_1000573123 218
282 3300005366 Ga0070659_100000529 Ga0070659_1000005298 218
283 3300005367 Ga0070667_100134910 Ga0070667_1001349103 218
284 3300005406 Ga0070703_10000497 Ga0070703_100004979 218
285 3300005436 Ga0070713_100445831 Ga0070713_1004458312 218
286 3300005438 Ga0070701_10010068 Ga0070701_100100684 218
287 3300005438 Ga0070701_10113393 Ga0070701_101133932 218
288 3300005440 Ga0070705_100013875 Ga0070705_1000138753 218
289 3300005440 Ga0070705_100336997 Ga0070705_1003369971 218
290 3300005441 Ga0070700_100040815 Ga0070700_1000408152 218
291 3300005441 Ga0070700_100093420 Ga0070700_1000934203 218
292 3300005444 Ga0070694_100000056 Ga0070694_1000000561 218
293 3300005444 Ga0070694_100031929 Ga0070694_1000319292 218
294 3300005455 Ga0070663_100016249 Ga0070663_1000162491 218
295 3300005457 Ga0070662_100041551 Ga0070662_1000415515 218
296 3300005458 Ga0070681_10013926 Ga0070681_100139264 218
297 3300005459 Ga0068867_100009055 Ga0068867_1000090558 218
298 3300005459 Ga0068867_100172681 Ga0068867_1001726812 218
299 3300005468 Ga0070707_100012720 Ga0070707_1000127202 218
300 3300005468 Ga0070707_100213849 Ga0070707_1002138492 218
301 3300005471 Ga0070698_100029132 Ga0070698_1000291329 218
302 3300005471 Ga0070698_100120039 Ga0070698_1001200395 218
303 3300005518 Ga0070699_100114745 Ga0070699_1001147452 218
304 3300005518 Ga0070699_100437520 Ga0070699_1004375202 218
305 3300005530 Ga0070679_100004895 Ga0070679_10000489510 218
306 3300005530 Ga0070679_100030304 Ga0070679_1000303047 218
307 3300005530 Ga0070679_100099185 Ga0070679_1000991853 218
308 3300005535 Ga0070684_100007487 Ga0070684_1000074875 218
309 3300005536 Ga0070697_100097123 Ga0070697_1000971232 218
310 3300005536 Ga0070697_100169803 Ga0070697_1001698032 218
311 3300005539 Ga0068853_100010479 Ga0068853_1000104797 218
312 3300005543 Ga0070672_100055270 Ga0070672_1000552702 218
313 3300005545 Ga0070695_100028466 Ga0070695_1000284665 218
314 3300005545 Ga0070695_100028673 Ga0070695_1000286732 218
315 3300005545 Ga0070695_100040252 Ga0070695_1000402522 218
316 3300005545 Ga0070695_100082325 Ga0070695_1000823252 218
317 3300005546 Ga0070696_100001822 Ga0070696_10000182215 218
318 3300005546 Ga0070696_100085690 Ga0070696_1000856902 218
319 3300005547 Ga0070693_100000746 Ga0070693_10000074616 218
320 3300005547 Ga0070693_100380270 Ga0070693_1003802701 218
321 3300005549 Ga0070704_100004757 Ga0070704_1000047578 218
322 3300005549 Ga0070704_100060292 Ga0070704_1000602923 218
323 3300005563 Ga0068855_100014476 Ga0068855_1000144765 218
324 3300005563 Ga0068855_100042273 Ga0068855_1000422737 218
325 3300005563 Ga0068855_100129023 Ga0068855_1001290233 218
326 3300005564 Ga0070664_100002931 Ga0070664_10000293114 218
327 3300005577 Ga0068857_100031133 Ga0068857_1000311336 218
328 3300005577 Ga0068857_100209266 Ga0068857_1002092662 218
329 3300005578 Ga0068854_100003866 Ga0068854_1000038661 218
330 3300005614 Ga0068856_100002142 Ga0068856_10000214216 218
331 3300005614 Ga0068856_100156119 Ga0068856_1001561192 218
332 3300005616 Ga0068852_100038297 Ga0068852_1000382976 218
333 3300005617 Ga0068859_100001597 Ga0068859_10000159721 218
334 3300005617 Ga0068859_100204859 Ga0068859_1002048592 218
335 3300005617 Ga0068859_100684711 Ga0068859_1006847112 218
336 3300005618 Ga0068864_100028986 Ga0068864_1000289866 218
337 3300005618 Ga0068864_100115669 Ga0068864_1001156692 218
338 3300005719 Ga0068861_100017163 Ga0068861_1000171635 218
339 3300005834 Ga0068851_10125978 Ga0068851_101259782 218
340 3300005840 Ga0068870_10003097 Ga0068870_100030974 218
341 3300005841 Ga0068863_100037848 Ga0068863_1000378485 218
342 3300005843 Ga0068860_100004116 Ga0068860_10000411610 218
343 3300005843 Ga0068860_100058303 Ga0068860_1000583032 218
344 3300005843 Ga0068860_100205916 Ga0068860_1002059163 218
345 3300005844 Ga0068862_100001395 Ga0068862_10000139512 218
346 3300005981 Ga0081538_10004698 Ga0081538_100046986 218
347 3300006237 Ga0097621_100237305 Ga0097621_1002373052 218
348 3300006358 Ga0068871_100197664 Ga0068871_1001976644 218
349 3300006844 Ga0075428_100000979 Ga0075428_10000097921 218
350 3300006844 Ga0075428_100010065 Ga0075428_1000100656 218
351 3300006844 Ga0075428_100066299 Ga0075428_1000662994 218
352 3300006846 Ga0075430_100000013 Ga0075430_10000001385 218
353 3300006847 Ga0075431_100001575 Ga0075431_1000015759 218
354 3300006847 Ga0075431_100008273 Ga0075431_1000082738 218
355 3300006847 Ga0075431_100046113 Ga0075431_1000461132 218
356 3300006847 Ga0075431_100053192 Ga0075431_1000531924 218
357 3300006847 Ga0075431_100297908 Ga0075431_1002979082 218
358 3300006852 Ga0075433_10000148 Ga0075433_1000014825 218
359 3300006852 Ga0075433_10014227 Ga0075433_100142273 218
360 3300006852 Ga0075433_10028759 Ga0075433_100287593 218
361 3300006852 Ga0075433_10029345 Ga0075433_100293455 218
362 3300006852 Ga0075433_10039272 Ga0075433_100392722 218
363 3300006852 Ga0075433_10782873 Ga0075433_107828732 218
364 3300006871 Ga0075434_100000484 Ga0075434_10000048415 218
365 3300006871 Ga0075434_100016507 Ga0075434_1000165074 218
366 3300006871 Ga0075434_100044530 Ga0075434_1000445306 218
367 3300006871 Ga0075434_100049485 Ga0075434_1000494855 218
368 3300006880 Ga0075429_100000234 Ga0075429_10000023418 218
369 3300006880 Ga0075429_100002284 Ga0075429_10000228412 218
370 3300006880 Ga0075429_100052004 Ga0075429_1000520041 218
371 3300006914 Ga0075436_100042237 Ga0075436_1000422374 218
372 3300006914 Ga0075436_100081809 Ga0075436_1000818093 218
373 3300006914 Ga0075436_100542626 Ga0075436_1005426261 218
374 3300006931 Ga0097620_100001597 Ga0097620_10000159721 218
375 3300006931 Ga0097620_100204844 Ga0097620_1002048442 218
376 3300006931 Ga0097620_100684683 Ga0097620_1006846832 218
377 3300007076 Ga0075435_100017645 Ga0075435_1000176454 218
378 3300007076 Ga0075435_100177251 Ga0075435_1001772512 218
379 3300007076 Ga0075435_100191341 Ga0075435_1001913413 218
380 3300007076 Ga0075435_100494745 Ga0075435_1004947452 218
381 3300007076 Ga0075435_100593652 Ga0075435_1005936521 218
382 3300007076 Ga0075435_100626184 Ga0075435_1006261841 218
383 3300007265 Ga0099794_10053394 Ga0099794_100533942 218
384 3300009093 Ga0105240_10001546 Ga0105240_100015462 218
385 3300009093 Ga0105240_11366747 Ga0105240_113667471 218
386 3300009094 Ga0111539_10000618 Ga0111539_1000061812 218
387 3300009094 Ga0111539_10161316 Ga0111539_101613163 218
388 3300009094 Ga0111539_10625048 Ga0111539_106250482 218
389 3300009147 Ga0114129_10002660 Ga0114129_1000266017 218
390 3300009147 Ga0114129_10022171 Ga0114129_100221719 218
391 3300009147 Ga0114129_10057223 Ga0114129_100572235 218
392 3300009147 Ga0114129_10102283 Ga0114129_101022834 218
393 3300009147 Ga0114129_10181800 Ga0114129_101818004 218
394 3300009147 Ga0114129_10222673 Ga0114129_102226732 218
395 3300009148 Ga0105243_10066097 Ga0105243_100660972 218
396 3300009174 Ga0105241_10000650 Ga0105241_100006502 218
397 3300009174 Ga0105241_10234205 Ga0105241_102342052 218
398 3300009176 Ga0105242_10021028 Ga0105242_100210285 218
399 3300010375 Ga0105239_10949687 Ga0105239_109496872 218
400 3300011119 Ga0105246_10122543 Ga0105246_101225431 218
401 3300013100 Ga0157373_10005062 Ga0157373_100050621 218
402 3300013105 Ga0157369_10096375 Ga0157369_100963754 218
403 3300013307 Ga0157372_10000746 Ga0157372_1000074627 218
404 3300013308 Ga0157375_10090194 Ga0157375_100901944 218
405 3300014325 Ga0163163_10793784 Ga0163163_107937841 218
406 3300014326 Ga0157380_11166404 Ga0157380_111664041 218
407 3300014497 Ga0182008_10144325 Ga0182008_101443253 218
408 3300014745 Ga0157377_10086971 Ga0157377_100869711 218
409 3300014745 Ga0157377_10218316 Ga0157377_102183162 218
410 3300014745 Ga0157377_10236029 Ga0157377_102360292 218
411 3300014745 Ga0157377_10297617 Ga0157377_102976172 218
412 3300025885 Ga0207653_10034067 Ga0207653_100340672 218
413 3300025901 Ga0207688_10017744 Ga0207688_100177443 218
414 3300025907 Ga0207645_10000213 Ga0207645_1000021347 218
415 3300025907 Ga0207645_10406537 Ga0207645_104065371 218
416 3300025908 Ga0207643_10000590 Ga0207643_1000059012 218
417 3300025908 Ga0207643_10093273 Ga0207643_100932732 218
418 3300025909 Ga0207705_10111855 Ga0207705_101118552 218
419 3300025911 Ga0207654_10136129 Ga0207654_101361292 218
420 3300025911 Ga0207654_10145300 Ga0207654_101453004 218
421 3300025912 Ga0207707_10001151 Ga0207707_1000115114 218
422 3300025912 Ga0207707_10115966 Ga0207707_101159663 218
423 3300025913 Ga0207695_10048203 Ga0207695_100482033 218
424 3300025917 Ga0207660_10001357 Ga0207660_100013579 218
425 3300025919 Ga0207657_10000300 Ga0207657_100003002 218
426 3300025920 Ga0207649_10112049 Ga0207649_101120494 218
427 3300025921 Ga0207652_10003563 Ga0207652_1000356311 218
428 3300025921 Ga0207652_10008730 Ga0207652_100087309 218
429 3300025921 Ga0207652_10077220 Ga0207652_100772203 218
430 3300025922 Ga0207646_10152643 Ga0207646_101526433 218
431 3300025923 Ga0207681_10135091 Ga0207681_101350913 218
432 3300025925 Ga0207650_10004857 Ga0207650_100048574 218
433 3300025926 Ga0207659_10101321 Ga0207659_101013212 218
434 3300025927 Ga0207687_10065280 Ga0207687_100652803 218
435 3300025927 Ga0207687_10218754 Ga0207687_102187542 218
436 3300025928 Ga0207700_10535353 Ga0207700_105353532 218
437 3300025932 Ga0207690_10002782 Ga0207690_100027827 218
438 3300025933 Ga0207706_10046485 Ga0207706_100464856 218
439 3300025934 Ga0207686_10012265 Ga0207686_100122655 218
440 3300025936 Ga0207670_10796380 Ga0207670_107963802 218
441 3300025939 Ga0207665_10048759 Ga0207665_100487592 218
442 3300025940 Ga0207691_10076264 Ga0207691_100762642 218
443 3300025942 Ga0207689_10000257 Ga0207689_1000025714 218
444 3300025942 Ga0207689_10017442 Ga0207689_100174427 218
445 3300025942 Ga0207689_10053222 Ga0207689_100532223 218
446 3300025942 Ga0207689_10206082 Ga0207689_102060823 218
447 3300025944 Ga0207661_10384137 Ga0207661_103841372 218
448 3300025945 Ga0207679_10008189 Ga0207679_100081898 218
449 3300025949 Ga0207667_10003068 Ga0207667_100030682 218
450 3300025949 Ga0207667_10162023 Ga0207667_101620233 218
451 3300025960 Ga0207651_10087304 Ga0207651_100873043 218
452 3300025981 Ga0207640_10001086 Ga0207640_100010869 218
453 3300025986 Ga0207658_10111097 Ga0207658_101110973 218
454 3300026023 Ga0207677_10217798 Ga0207677_102177982 218
455 3300026041 Ga0207639_10005888 Ga0207639_100058887 218
456 3300026075 Ga0207708_10010496 Ga0207708_100104962 218
457 3300026075 Ga0207708_10018935 Ga0207708_100189352 218
458 3300026078 Ga0207702_10002765 Ga0207702_1000276519 218
459 3300026078 Ga0207702_10126077 Ga0207702_101260772 218
460 3300026088 Ga0207641_10094706 Ga0207641_100947063 218
461 3300026089 Ga0207648_10000854 Ga0207648_1000085438 218
462 3300026089 Ga0207648_10213670 Ga0207648_102136702 218
463 3300026089 Ga0207648_10227268 Ga0207648_102272683 218
464 3300026095 Ga0207676_10057909 Ga0207676_100579094 218
465 3300026095 Ga0207676_10386272 Ga0207676_103862722 218
466 3300026116 Ga0207674_10004234 Ga0207674_100042341 218
467 3300026116 Ga0207674_10041274 Ga0207674_100412744 218
468 3300026118 Ga0207675_100092764 Ga0207675_1000927642 218
469 3300026142 Ga0207698_10102855 Ga0207698_101028555 218
470 3300027378 Ga0209981_1021656 Ga0209981_10216561 218
471 3300027462 Ga0210000_1002064 Ga0210000_10020643 218
472 3300027471 Ga0209995_1016441 Ga0209995_10164412 218
473 3300027526 Ga0209968_1017095 Ga0209968_10170952 218
474 3300027907 Ga0207428_10000118 Ga0207428_1000011834 218
475 3300027907 Ga0207428_10024940 Ga0207428_100249404 218
476 3300027907 Ga0207428_10232506 Ga0207428_102325062 218
477 3300028380 Ga0268265_10004690 Ga0268265_1000469012 218
478 3300028381 Ga0268264_10243880 Ga0268264_102438803 218
479 3300028381 Ga0268264_10282914 Ga0268264_102829144 218
480 3300032005 Ga0307411_10328622 Ga0307411_103286222 218
481 3300034818 Ga0373950_0040159 Ga0373950_0040159_142_804 218
482 3300034820 Ga0373959_0019892 Ga0373959_0019892_282_944 218
483 3300035092 Ga0373952_0008015 Ga0373952_0008015_873_1529 218
484 3300035112 Ga0373932_0005232 Ga0373932_0005232_184_846 218
485 3300035114 Ga0373939_0020797 Ga0373939_0020797_183_839 218
486 3300035115 Ga0373941_0028074 Ga0373941_0028074_310_972 218
487 3300035692 Ga0373935_0054403 Ga0373935_0054403_1832_2497 218
488 3300035725 Ga0373947_0004079 Ga0373947_0004079_339_1004 218
489 3300036401 Ga0373937_0054737 Ga0373937_0054737_1655_2320 218
490 3300037068 Ga0373925_0008634 Ga0373925_0008634_6432_7097 218
491 3300042001 Ga0439441_013424 Ga0439441_013424_451_1113 218
492 3300042001 Ga0439441_025781 Ga0439441_025781_82_747 218
493 3300042005 Ga0439448_0000722 Ga0439448_0000722_6323_6985 218
494 3300042157 Ga0439458_0001256 Ga0439458_0001256_3747_4409 218
495 3300042876 Ga0451577_0009822 Ga0451577_0009822_7735_8397 218
496 3300042876 Ga0451577_0102161 Ga0451577_0102161_1029_1694 218
497 3300042876 Ga0451577_0756551 Ga0451577_0756551_74_736 218
498 3300044712 Ga0453684_0194743 Ga0453684_0194743_795_1457 218
499 3300045051 Ga0451576_0039924 Ga0451576_0039924_3855_4517 218
500 3300045051 Ga0451576_0210373 Ga0451576_0210373_694_1356 218
501 3300046472 Ga0495580_0214433 Ga0495580_0214433_248_910 218
502 3300046533 Ga0495640_0161037 Ga0495640_0161037_253_918 218
503 3300046664 Ga0495659_0087804 Ga0495659_0087804_299_961 218
504 3300048915 Ga0496112_0156578 Ga0496112_0156578_1099_1761 218
505 3300048916 Ga0496113_0388762 Ga0496113_0388762_230_892 218
506 3300049570 Ga0501033_0215358 Ga0501033_0215358_451_1116 218
507 3300049573 Ga0501037_0258359 Ga0501037_0258359_152_817 218
508 3300049584 Ga0501068_0578227 Ga0501068_0578227_48_710 218
509 3300049592 Ga0501076_0479249 Ga0501076_0479249_259_921 218
510 3300049592 Ga0501076_0575887 Ga0501076_0575887_93_755 218
511 3300049593 Ga0501077_0393678 Ga0501077_0393678_96_758 218
512 3300049823 Ga0501044_0194444 Ga0501044_0194444_1093_1758 218
513 3300050507 nmdc:mga05p37_245292_c1 nmdc:mga05p37_245292_c1_576_1238 218
514 3300050507 nmdc:mga05p37_284177_c1 nmdc:mga05p37_284177_c1_1270_1932 218
515 3300050507 nmdc:mga05p37_350268_c1 nmdc:mga05p37_350268_c1_75_737 218
516 3300050507 nmdc:mga05p37_8272_c1 nmdc:mga05p37_8272_c1_2830_3486 218
517 3300050507 nmdc:mga05p37_8460_c1 nmdc:mga05p37_8460_c1_1579_2247 218
518 3300050508 nmdc:mga09592_122_c1 nmdc:mga09592_122_c1_29830_30492 218
519 3300050508 nmdc:mga09592_150915_c1 nmdc:mga09592_150915_c1_1278_1940 218
520 3300050508 nmdc:mga09592_27000_c1 nmdc:mga09592_27000_c1_2873_3529 218
521 3300050509 nmdc:mga0qj67_183400_c1 nmdc:mga0qj67_183400_c1_136_798 218
522 3300050509 nmdc:mga0qj67_3256_c1 nmdc:mga0qj67_3256_c1_5742_6404 218
523 3300050510 nmdc:mga06r32_1168_c1 nmdc:mga06r32_1168_c1_12871_13533 218
524 3300050510 nmdc:mga06r32_17315_c1 nmdc:mga06r32_17315_c1_1954_2616 218
525 3300050510 nmdc:mga06r32_3605_c1 nmdc:mga06r32_3605_c1_6352_7014 218
526 3300050510 nmdc:mga06r32_54967_c1 nmdc:mga06r32_54967_c1_1255_1917 218
527 3300050510 nmdc:mga06r32_595302_c1 nmdc:mga06r32_595302_c1_10_678 218
528 3300050510 nmdc:mga06r32_96336_c1 nmdc:mga06r32_96336_c1_1253_1909 218
529 3300050511 nmdc:mga08y16_16961_c1 nmdc:mga08y16_16961_c1_2133_2789 218
530 3300050511 nmdc:mga08y16_197018_c1 nmdc:mga08y16_197018_c1_1326_1988 218
531 3300050511 nmdc:mga08y16_4215_c1 nmdc:mga08y16_4215_c1_13100_13762 218
532 3300050511 nmdc:mga08y16_562411_c1 nmdc:mga08y16_562411_c1_54_719 218
533 3300050512 nmdc:mga0n895_20484_c1 nmdc:mga0n895_20484_c1_4849_5511 218
534 3300050512 nmdc:mga0n895_367_c1 nmdc:mga0n895_367_c1_13179_13841 218
535 3300050512 nmdc:mga0n895_53331_c1 nmdc:mga0n895_53331_c1_1327_1989 218
536 3300050513 nmdc:mga0rr50_115538_c1 nmdc:mga0rr50_115538_c1_255_917 218
537 3300050513 nmdc:mga0rr50_147498_c2 nmdc:mga0rr50_147498_c2_255_917 218
538 3300050513 nmdc:mga0rr50_182397_c1 nmdc:mga0rr50_182397_c1_854_1516 218
539 3300050513 nmdc:mga0rr50_2408_c1 nmdc:mga0rr50_2408_c1_7028_7690 218
540 3300050513 nmdc:mga0rr50_392515_c1 nmdc:mga0rr50_392515_c1_399_1067 218
541 3300050514 nmdc:mga08x19_6538_c1 nmdc:mga08x19_6538_c1_2720_3382 218
542 3300050514 nmdc:mga08x19_86296_c1 nmdc:mga08x19_86296_c1_1368_2030 218
543 3300050515 nmdc:mga0a205_123347_c1 nmdc:mga0a205_123347_c1_1281_1949 218
544 3300050515 nmdc:mga0a205_19958_c1 nmdc:mga0a205_19958_c1_3978_4640 218
545 3300050515 nmdc:mga0a205_32425_c1 nmdc:mga0a205_32425_c1_2918_3580 218
546 3300050515 nmdc:mga0a205_545545_c1 nmdc:mga0a205_545545_c1_303_965 218
547 3300050515 nmdc:mga0a205_6561_c1 nmdc:mga0a205_6561_c1_2158_2820 218
548 3300050515 nmdc:mga0a205_66_c1 nmdc:mga0a205_66_c1_51073_51735 218
549 3300053084 Ga0495595_0105175 Ga0495595_0105175_540_1205 218
550 3300053733 Ga0500552_001175 Ga0500552_001175_506_1171 218
551 3300005548 Ga0070665_100160818 Ga0070665_1001608183 219
552 3300028379 Ga0268266_10274083 Ga0268266_102740832 219
553 3300031911 Ga0307412_10494182 Ga0307412_104941822 219
554 3300046460 Ga0495638_0100790 Ga0495638_0100790_142_801 219
555 3300046460 Ga0495638_0133139 Ga0495638_0133139_112_771 219
556 3300046501 Ga0495607_0051144 Ga0495607_0051144_306_965 219
557 3300046507 Ga0495606_0035406 Ga0495606_0035406_1312_1971 219
558 3300046512 Ga0495610_0025112 Ga0495610_0025112_22_681 219
559 3300046513 Ga0495616_0057445 Ga0495616_0057445_1081_1740 219
560 3300046518 Ga0495631_0041424 Ga0495631_0041424_497_1156 219
561 3300046522 Ga0495643_0030338 Ga0495643_0030338_1637_2296 219
562 3300046530 Ga0495654_0033331 Ga0495654_0033331_1925_2584 219
563 3300046530 Ga0495654_0045976 Ga0495654_0045976_592_1251 219
564 3300046616 Ga0495668_0019509 Ga0495668_0019509_1584_2243 219
565 3300046665 Ga0495661_0019091 Ga0495661_0019091_1276_1935 219
566 3300046674 Ga0495588_0014772 Ga0495588_0014772_1436_2095 219
567 3300046691 Ga0495670_0036040 Ga0495670_0036040_685_1344 219
568 3300046692 Ga0495671_0023073 Ga0495671_0023073_1770_2429 219
569 3300047472 Ga0495686_0009809 Ga0495686_0009809_322_981 219
570 3300048091 Ga0495626_0025409 Ga0495626_0025409_228_887 219
571 3300048921 Ga0496118_0045851 Ga0496118_0045851_719_1378 219
572 3300048922 Ga0496119_0062440 Ga0496119_0062440_1539_2198 219
573 3300048923 Ga0496120_0129526 Ga0496120_0129526_490_1149 219
574 3300048924 Ga0496121_0007839 Ga0496121_0007839_2770_3429 219
575 3300048925 Ga0496122_0236254 Ga0496122_0236254_211_870 219
576 3300048926 Ga0496123_0005272 Ga0496123_0005272_824_1483 219
577 3300048927 Ga0496124_0183136 Ga0496124_0183136_638_1297 219
578 3300048928 Ga0496125_0001573 Ga0496125_0001573_12373_13032 219
579 3300048929 Ga0496126_0048869 Ga0496126_0048869_1109_1768 219
580 3300049823 Ga0501044_0029827 Ga0501044_0029827_3196_3855 219
581 3300050491 nmdc:mga00v17_240704_c1 nmdc:mga00v17_240704_c1_466_1125 219
582 3300050516 nmdc:mga0sz30_73067_c1 nmdc:mga0sz30_73067_c1_514_1173 219
583 3300053086 Ga0500578_0063399 Ga0500578_0063399_1554_2213 219
584 3300053087 Ga0500643_031603 Ga0500643_031603_812_1471 219
585 3300053093 Ga0500651_0038106 Ga0500651_0038106_578_1237 219
586 3300053096 Ga0500641_0002266 Ga0500641_0002266_1988_2647 219
587 3300053104 Ga0500556_0000003 Ga0500556_0000003_224549_225208 219
588 3300053108 Ga0500562_035725 Ga0500562_035725_324_983 219
589 3300053109 Ga0500569_006211 Ga0500569_006211_575_1234 219
590 3300053130 Ga0500642_0000006 Ga0500642_0000006_268331_268990 219
591 3300053131 Ga0500652_098908 Ga0500652_098908_308_967 219
592 3300053134 Ga0500658_0153682 Ga0500658_0153682_62_721 219
593 3300053153 Ga0500616_0000033 Ga0500616_0000033_299759_300418 219
594 3300053156 Ga0500622_0001548 Ga0500622_0001548_7805_8464 219
595 3300053158 Ga0500627_0074921 Ga0500627_0074921_571_1230 219
596 3300053730 Ga0500645_018432 Ga0500645_018432_823_1482 219
597 3300006038 Ga0075365_10006887 Ga0075365_100068875 220
598 3300048924 Ga0496121_0276991 Ga0496121_0276991_315_977 220
599 3300050492 nmdc:mga0yw44_1059_c1 nmdc:mga0yw44_1059_c1_3772_4434 220
600 3300050513 nmdc:mga0rr50_107633_c1 nmdc:mga0rr50_107633_c1_829_1500 220
601 3300003203 JGI25406J46586_10025895 JGI25406J46586_100258952 221
602 3300003203 JGI25406J46586_10027405 JGI25406J46586_100274051 221
603 3300003203 JGI25406J46586_10035480 JGI25406J46586_100354802 221
604 3300003659 JGI25404J52841_10000578 JGI25404J52841_100005784 221
605 3300003771 Ga0055526_1000200 Ga0055526_100020033 221
606 3300003775 Ga0055524_1020229 Ga0055524_10202293 221
607 3300003911 JGI25405J52794_10009095 JGI25405J52794_100090952 221
608 3300005329 Ga0070683_100109723 Ga0070683_1001097232 221
609 3300005329 Ga0070683_100789481 Ga0070683_1007894811 221
610 3300005330 Ga0070690_100011676 Ga0070690_1000116761 221
611 3300005334 Ga0068869_100015289 Ga0068869_1000152891 221
612 3300005334 Ga0068869_100395732 Ga0068869_1003957322 221
613 3300005336 Ga0070680_100033740 Ga0070680_1000337405 221
614 3300005337 Ga0070682_100004797 Ga0070682_1000047974 221
615 3300005338 Ga0068868_100006085 Ga0068868_1000060855 221
616 3300005340 Ga0070689_100131593 Ga0070689_1001315932 221
617 3300005341 Ga0070691_10049164 Ga0070691_100491643 221
618 3300005344 Ga0070661_100437479 Ga0070661_1004374791 221
619 3300005345 Ga0070692_10008527 Ga0070692_100085273 221
620 3300005347 Ga0070668_100491618 Ga0070668_1004916182 221
621 3300005353 Ga0070669_100175184 Ga0070669_1001751842 221
622 3300005353 Ga0070669_100431049 Ga0070669_1004310491 221
623 3300005355 Ga0070671_100184948 Ga0070671_1001849482 221
624 3300005355 Ga0070671_100233496 Ga0070671_1002334962 221
625 3300005355 Ga0070671_100481329 Ga0070671_1004813292 221
626 3300005356 Ga0070674_100299507 Ga0070674_1002995072 221
627 3300005364 Ga0070673_100112949 Ga0070673_1001129492 221
628 3300005364 Ga0070673_100221808 Ga0070673_1002218082 221
629 3300005365 Ga0070688_100517420 Ga0070688_1005174202 221
630 3300005367 Ga0070667_100621099 Ga0070667_1006210992 221
631 3300005367 Ga0070667_100697199 Ga0070667_1006971992 221
632 3300005406 Ga0070703_10002171 Ga0070703_100021714 221
633 3300005406 Ga0070703_10044504 Ga0070703_100445042 221
634 3300005434 Ga0070709_10008649 Ga0070709_100086492 221
635 3300005435 Ga0070714_100052483 Ga0070714_1000524832 221
636 3300005435 Ga0070714_100084750 Ga0070714_1000847504 221
637 3300005435 Ga0070714_100222632 Ga0070714_1002226323 221
638 3300005435 Ga0070714_100789415 Ga0070714_1007894151 221
639 3300005436 Ga0070713_100040406 Ga0070713_1000404064 221
640 3300005436 Ga0070713_101097753 Ga0070713_1010977531 221
641 3300005437 Ga0070710_10005794 Ga0070710_100057946 221
642 3300005437 Ga0070710_10131912 Ga0070710_101319122 221
643 3300005437 Ga0070710_10138186 Ga0070710_101381861 221
644 3300005438 Ga0070701_10003786 Ga0070701_100037865 221
645 3300005440 Ga0070705_100005181 Ga0070705_1000051811 221
646 3300005440 Ga0070705_100034461 Ga0070705_1000344612 221
647 3300005441 Ga0070700_100011918 Ga0070700_1000119185 221
648 3300005444 Ga0070694_100003659 Ga0070694_1000036595 221
649 3300005444 Ga0070694_100101883 Ga0070694_1001018832 221
650 3300005445 Ga0070708_100176203 Ga0070708_1001762032 221
651 3300005456 Ga0070678_100055656 Ga0070678_1000556563 221
652 3300005456 Ga0070678_100209720 Ga0070678_1002097202 221
653 3300005456 Ga0070678_100685077 Ga0070678_1006850772 221
654 3300005457 Ga0070662_100027841 Ga0070662_1000278415 221
655 3300005457 Ga0070662_100187991 Ga0070662_1001879912 221
656 3300005458 Ga0070681_10001086 Ga0070681_100010865 221
657 3300005459 Ga0068867_100000546 Ga0068867_10000054616 221
658 3300005459 Ga0068867_100168536 Ga0068867_1001685362 221
659 3300005466 Ga0070685_10158514 Ga0070685_101585141 221
660 3300005466 Ga0070685_10220800 Ga0070685_102208002 221
661 3300005467 Ga0070706_100504794 Ga0070706_1005047942 221
662 3300005467 Ga0070706_100919450 Ga0070706_1009194501 221
663 3300005468 Ga0070707_100236424 Ga0070707_1002364243 221
664 3300005468 Ga0070707_100312962 Ga0070707_1003129622 221
665 3300005471 Ga0070698_100317315 Ga0070698_1003173152 221
666 3300005471 Ga0070698_100411619 Ga0070698_1004116192 221
667 3300005518 Ga0070699_100000609 Ga0070699_10000060927 221
668 3300005518 Ga0070699_100200939 Ga0070699_1002009392 221
669 3300005518 Ga0070699_100679677 Ga0070699_1006796772 221
670 3300005530 Ga0070679_100061552 Ga0070679_1000615525 221
671 3300005530 Ga0070679_100083819 Ga0070679_1000838193 221
672 3300005530 Ga0070679_100680949 Ga0070679_1006809492 221
673 3300005536 Ga0070697_100397572 Ga0070697_1003975722 221
674 3300005539 Ga0068853_100818973 Ga0068853_1008189731 221
675 3300005543 Ga0070672_100162396 Ga0070672_1001623962 221
676 3300005544 Ga0070686_100399486 Ga0070686_1003994862 221
677 3300005545 Ga0070695_100000971 Ga0070695_1000009715 221
678 3300005545 Ga0070695_100045287 Ga0070695_1000452874 221
679 3300005545 Ga0070695_100103725 Ga0070695_1001037251 221
680 3300005546 Ga0070696_100001450 Ga0070696_10000145012 221
681 3300005547 Ga0070693_100004829 Ga0070693_1000048292 221
682 3300005548 Ga0070665_100315349 Ga0070665_1003153492 221
683 3300005549 Ga0070704_100001063 Ga0070704_10000106315 221
684 3300005549 Ga0070704_100218539 Ga0070704_1002185391 221
685 3300005563 Ga0068855_100001718 Ga0068855_1000017185 221
686 3300005577 Ga0068857_100084017 Ga0068857_1000840172 221
687 3300005578 Ga0068854_100655802 Ga0068854_1006558022 221
688 3300005615 Ga0070702_100000771 Ga0070702_1000007717 221
689 3300005615 Ga0070702_100178919 Ga0070702_1001789191 221
690 3300005616 Ga0068852_100558397 Ga0068852_1005583972 221
691 3300005617 Ga0068859_100005571 Ga0068859_1000055715 221
692 3300005617 Ga0068859_100055540 Ga0068859_1000555403 221
693 3300005617 Ga0068859_100224910 Ga0068859_1002249102 221
694 3300005618 Ga0068864_100188249 Ga0068864_1001882492 221
695 3300005718 Ga0068866_10000362 Ga0068866_100003629 221
696 3300005719 Ga0068861_100001160 Ga0068861_10000116015 221
697 3300005719 Ga0068861_100010779 Ga0068861_1000107794 221
698 3300005840 Ga0068870_10109163 Ga0068870_101091633 221
699 3300005843 Ga0068860_100016914 Ga0068860_1000169142 221
700 3300005844 Ga0068862_100005139 Ga0068862_1000051392 221
701 3300005844 Ga0068862_100372021 Ga0068862_1003720212 221
702 3300005844 Ga0068862_100530238 Ga0068862_1005302382 221
703 3300005937 Ga0081455_10000079 Ga0081455_1000007951 221
704 3300005937 Ga0081455_10002810 Ga0081455_1000281014 221
705 3300005937 Ga0081455_10013137 Ga0081455_100131372 221
706 3300005937 Ga0081455_10401277 Ga0081455_104012772 221
707 3300005937 Ga0081455_10434248 Ga0081455_104342481 221
708 3300005981 Ga0081538_10015644 Ga0081538_100156445 221
709 3300005983 Ga0081540_1000008 Ga0081540_100000886 221
710 3300005983 Ga0081540_1000050 Ga0081540_100005072 221
711 3300005983 Ga0081540_1004321 Ga0081540_100432111 221
712 3300005983 Ga0081540_1034793 Ga0081540_10347933 221
713 3300005985 Ga0081539_10000539 Ga0081539_1000053927 221
714 3300005985 Ga0081539_10001341 Ga0081539_100013416 221
715 3300005985 Ga0081539_10057916 Ga0081539_100579162 221
716 3300006028 Ga0070717_10016819 Ga0070717_100168196 221
717 3300006028 Ga0070717_10054333 Ga0070717_100543332 221
718 3300006028 Ga0070717_10213617 Ga0070717_102136172 221
719 3300006028 Ga0070717_10326036 Ga0070717_103260361 221
720 3300006028 Ga0070717_10344113 Ga0070717_103441132 221
721 3300006028 Ga0070717_10344954 Ga0070717_103449542 221
722 3300006028 Ga0070717_10743259 Ga0070717_107432592 221
723 3300006038 Ga0075365_10005144 Ga0075365_100051447 221
724 3300006038 Ga0075365_10039270 Ga0075365_100392703 221
725 3300006038 Ga0075365_10412065 Ga0075365_104120652 221
726 3300006048 Ga0075363_100009008 Ga0075363_1000090081 221
727 3300006051 Ga0075364_10017908 Ga0075364_100179086 221
728 3300006051 Ga0075364_10076667 Ga0075364_100766673 221
729 3300006163 Ga0070715_10190711 Ga0070715_101907112 221
730 3300006173 Ga0070716_100022950 Ga0070716_1000229504 221
731 3300006173 Ga0070716_100283767 Ga0070716_1002837672 221
732 3300006175 Ga0070712_100022506 Ga0070712_1000225064 221
733 3300006175 Ga0070712_100082381 Ga0070712_1000823814 221
734 3300006175 Ga0070712_100696756 Ga0070712_1006967561 221
735 3300006177 Ga0075362_10123507 Ga0075362_101235072 221
736 3300006178 Ga0075367_10344917 Ga0075367_103449171 221
737 3300006195 Ga0075366_10012372 Ga0075366_100123721 221
738 3300006237 Ga0097621_100001467 Ga0097621_10000146710 221
739 3300006358 Ga0068871_100002626 Ga0068871_1000026267 221
740 3300006358 Ga0068871_100227181 Ga0068871_1002271812 221
741 3300006844 Ga0075428_100000594 Ga0075428_10000059415 221
742 3300006844 Ga0075428_100013937 Ga0075428_1000139375 221
743 3300006844 Ga0075428_100035781 Ga0075428_1000357811 221
744 3300006844 Ga0075428_100141149 Ga0075428_1001411494 221
745 3300006844 Ga0075428_100200991 Ga0075428_1002009913 221
746 3300006844 Ga0075428_100270359 Ga0075428_1002703593 221
747 3300006846 Ga0075430_100012732 Ga0075430_1000127326 221
748 3300006846 Ga0075430_100051633 Ga0075430_1000516334 221
749 3300006846 Ga0075430_100090019 Ga0075430_1000900194 221
750 3300006846 Ga0075430_100125816 Ga0075430_1001258163 221
751 3300006847 Ga0075431_100000202 Ga0075431_10000020235 221
752 3300006847 Ga0075431_100036230 Ga0075431_1000362303 221
753 3300006847 Ga0075431_100102517 Ga0075431_1001025173 221
754 3300006847 Ga0075431_100134895 Ga0075431_1001348952 221
755 3300006847 Ga0075431_100159940 Ga0075431_1001599402 221
756 3300006847 Ga0075431_100199545 Ga0075431_1001995452 221
757 3300006847 Ga0075431_100341011 Ga0075431_1003410111 221
758 3300006847 Ga0075431_100450967 Ga0075431_1004509672 221
759 3300006852 Ga0075433_10070633 Ga0075433_100706332 221
760 3300006852 Ga0075433_10252811 Ga0075433_102528112 221
761 3300006852 Ga0075433_10430365 Ga0075433_104303652 221
762 3300006852 Ga0075433_10459699 Ga0075433_104596992 221
763 3300006871 Ga0075434_100006228 Ga0075434_1000062287 221
764 3300006871 Ga0075434_100059874 Ga0075434_1000598744 221
765 3300006871 Ga0075434_100170174 Ga0075434_1001701743 221
766 3300006871 Ga0075434_100353039 Ga0075434_1003530392 221
767 3300006880 Ga0075429_100011751 Ga0075429_1000117519 221
768 3300006880 Ga0075429_100075151 Ga0075429_1000751512 221
769 3300006880 Ga0075429_100562991 Ga0075429_1005629911 221
770 3300006880 Ga0075429_100968039 Ga0075429_1009680391 221
771 3300006881 Ga0068865_100009339 Ga0068865_1000093395 221
772 3300006881 Ga0068865_100428839 Ga0068865_1004288392 221
773 3300006931 Ga0097620_100005571 Ga0097620_1000055715 221
774 3300006931 Ga0097620_100055541 Ga0097620_1000555413 221
775 3300006931 Ga0097620_100224920 Ga0097620_1002249202 221
776 3300006946 Ga0079104_1000029 Ga0079104_1000029168 221
777 3300007076 Ga0075435_100180101 Ga0075435_1001801012 221
778 3300007076 Ga0075435_100318633 Ga0075435_1003186332 221
779 3300007265 Ga0099794_10027620 Ga0099794_100276203 221
780 3300007265 Ga0099794_10034120 Ga0099794_100341204 221
781 3300007788 Ga0099795_10007995 Ga0099795_100079952 221
782 3300009092 Ga0105250_10071343 Ga0105250_100713432 221
783 3300009093 Ga0105240_10152105 Ga0105240_101521052 221
784 3300009094 Ga0111539_10000369 Ga0111539_1000036915 221
785 3300009094 Ga0111539_10010911 Ga0111539_1001091110 221
786 3300009094 Ga0111539_10906443 Ga0111539_109064431 221
787 3300009098 Ga0105245_10010838 Ga0105245_100108384 221
788 3300009098 Ga0105245_10102050 Ga0105245_101020502 221
789 3300009098 Ga0105245_10384068 Ga0105245_103840682 221
790 3300009101 Ga0105247_10143054 Ga0105247_101430542 221
791 3300009147 Ga0114129_10000329 Ga0114129_1000032933 221
792 3300009147 Ga0114129_10162752 Ga0114129_101627524 221
793 3300009147 Ga0114129_10186767 Ga0114129_101867673 221
794 3300009147 Ga0114129_10575640 Ga0114129_105756402 221
795 3300009147 Ga0114129_11461295 Ga0114129_114612952 221
796 3300009148 Ga0105243_10007704 Ga0105243_100077047 221
797 3300009148 Ga0105243_10013484 Ga0105243_100134845 221
798 3300009148 Ga0105243_11415390 Ga0105243_114153901 221
799 3300009174 Ga0105241_10032807 Ga0105241_100328075 221
800 3300009174 Ga0105241_10054961 Ga0105241_100549613 221
801 3300009176 Ga0105242_10006783 Ga0105242_100067835 221
802 3300009176 Ga0105242_10153506 Ga0105242_101535062 221
803 3300009176 Ga0105242_10423201 Ga0105242_104232012 221
804 3300009177 Ga0105248_10255360 Ga0105248_102553603 221
805 3300009177 Ga0105248_10329846 Ga0105248_103298462 221
806 3300009177 Ga0105248_11730123 Ga0105248_117301231 221
807 3300009551 Ga0105238_10259967 Ga0105238_102599672 221
808 3300009551 Ga0105238_11078645 Ga0105238_110786451 221
809 3300009553 Ga0105249_10013784 Ga0105249_100137842 221
810 3300009553 Ga0105249_10071214 Ga0105249_100712143 221
811 3300009553 Ga0105249_10669422 Ga0105249_106694221 221
812 3300010159 Ga0099796_10002974 Ga0099796_100029745 221
813 3300010375 Ga0105239_10103625 Ga0105239_101036253 221
814 3300010375 Ga0105239_11080591 Ga0105239_110805911 221
815 3300011119 Ga0105246_10474005 Ga0105246_104740052 221
816 3300013100 Ga0157373_10167085 Ga0157373_101670852 221
817 3300013100 Ga0157373_10260566 Ga0157373_102605662 221
818 3300013102 Ga0157371_10003256 Ga0157371_100032566 221
819 3300013105 Ga0157369_10216403 Ga0157369_102164033 221
820 3300013105 Ga0157369_10326879 Ga0157369_103268792 221
821 3300013105 Ga0157369_10509830 Ga0157369_105098302 221
822 3300013297 Ga0157378_10003376 Ga0157378_1000337610 221
823 3300013297 Ga0157378_10018011 Ga0157378_100180112 221
824 3300013297 Ga0157378_10423874 Ga0157378_104238742 221
825 3300013306 Ga0163162_10107534 Ga0163162_101075342 221
826 3300014325 Ga0163163_10002136 Ga0163163_100021366 221
827 3300014325 Ga0163163_10078397 Ga0163163_100783972 221
828 3300014325 Ga0163163_10154967 Ga0163163_101549672 221
829 3300014326 Ga0157380_10018569 Ga0157380_100185693 221
830 3300014326 Ga0157380_10168602 Ga0157380_101686023 221
831 3300014326 Ga0157380_10212947 Ga0157380_102129472 221
832 3300014326 Ga0157380_10490032 Ga0157380_104900322 221
833 3300014968 Ga0157379_10107425 Ga0157379_101074254 221
834 3300014968 Ga0157379_10199932 Ga0157379_101999322 221
835 3300014969 Ga0157376_10003105 Ga0157376_100031052 221
836 3300014969 Ga0157376_10019126 Ga0157376_100191266 221
837 3300014969 Ga0157376_11235141 Ga0157376_112351411 221
838 3300017792 Ga0163161_10016668 Ga0163161_100166686 221
839 3300017792 Ga0163161_10527199 Ga0163161_105271992 221
840 3300021384 Ga0213876_10026057 Ga0213876_100260573 221
841 3300021384 Ga0213876_10152283 Ga0213876_101522832 221
842 3300021384 Ga0213876_10183412 Ga0213876_101834122 221
843 3300021388 Ga0213875_10029465 Ga0213875_100294654 221
844 3300024225 Ga0224572_1008475 Ga0224572_10084753 221
845 3300025295 Ga0209564_1000043 Ga0209564_100004386 221
846 3300025297 Ga0209758_1007690 Ga0209758_10076902 221
847 3300025299 Ga0209256_1000545 Ga0209256_100054542 221
848 3300025315 Ga0207697_10081000 Ga0207697_100810002 221
849 3300025885 Ga0207653_10008773 Ga0207653_100087732 221
850 3300025885 Ga0207653_10117875 Ga0207653_101178751 221
851 3300025893 Ga0207682_10037193 Ga0207682_100371931 221
852 3300025898 Ga0207692_10001508 Ga0207692_100015087 221
853 3300025898 Ga0207692_10226036 Ga0207692_102260362 221
854 3300025898 Ga0207692_10330136 Ga0207692_103301361 221
855 3300025900 Ga0207710_10015448 Ga0207710_100154483 221
856 3300025901 Ga0207688_10042746 Ga0207688_100427463 221
857 3300025904 Ga0207647_10171457 Ga0207647_101714572 221
858 3300025905 Ga0207685_10035129 Ga0207685_100351292 221
859 3300025907 Ga0207645_10217713 Ga0207645_102177132 221
860 3300025910 Ga0207684_10004444 Ga0207684_1000444412 221
861 3300025910 Ga0207684_10092676 Ga0207684_100926762 221
862 3300025910 Ga0207684_10901755 Ga0207684_109017551 221
863 3300025911 Ga0207654_10032445 Ga0207654_100324451 221
864 3300025913 Ga0207695_10516225 Ga0207695_105162252 221
865 3300025915 Ga0207693_10025358 Ga0207693_100253584 221
866 3300025915 Ga0207693_10031529 Ga0207693_100315294 221
867 3300025915 Ga0207693_10133729 Ga0207693_101337292 221
868 3300025915 Ga0207693_10668429 Ga0207693_106684291 221
869 3300025916 Ga0207663_10223042 Ga0207663_102230422 221
870 3300025916 Ga0207663_10467601 Ga0207663_104676012 221
871 3300025916 Ga0207663_10605170 Ga0207663_106051701 221
872 3300025917 Ga0207660_10006875 Ga0207660_100068757 221
873 3300025918 Ga0207662_10000065 Ga0207662_1000006530 221
874 3300025918 Ga0207662_10024979 Ga0207662_100249793 221
875 3300025918 Ga0207662_10159902 Ga0207662_101599022 221
876 3300025921 Ga0207652_10124613 Ga0207652_101246132 221
877 3300025922 Ga0207646_10048348 Ga0207646_100483484 221
878 3300025923 Ga0207681_10305383 Ga0207681_103053831 221
879 3300025924 Ga0207694_10531429 Ga0207694_105314291 221
880 3300025926 Ga0207659_10102227 Ga0207659_101022272 221
881 3300025927 Ga0207687_10007409 Ga0207687_100074092 221
882 3300025927 Ga0207687_10158464 Ga0207687_101584642 221
883 3300025927 Ga0207687_10288188 Ga0207687_102881881 221
884 3300025928 Ga0207700_10016207 Ga0207700_100162076 221
885 3300025928 Ga0207700_10388172 Ga0207700_103881722 221
886 3300025929 Ga0207664_10040367 Ga0207664_100403673 221
887 3300025929 Ga0207664_10089861 Ga0207664_100898612 221
888 3300025929 Ga0207664_10099514 Ga0207664_100995142 221
889 3300025929 Ga0207664_10370197 Ga0207664_103701972 221
890 3300025929 Ga0207664_10523443 Ga0207664_105234432 221
891 3300025931 Ga0207644_10312934 Ga0207644_103129342 221
892 3300025931 Ga0207644_10663544 Ga0207644_106635441 221
893 3300025932 Ga0207690_10180760 Ga0207690_101807602 221
894 3300025932 Ga0207690_10495624 Ga0207690_104956242 221
895 3300025933 Ga0207706_10025916 Ga0207706_100259163 221
896 3300025933 Ga0207706_10064455 Ga0207706_100644553 221
897 3300025933 Ga0207706_10215971 Ga0207706_102159712 221
898 3300025933 Ga0207706_10669012 Ga0207706_106690121 221
899 3300025935 Ga0207709_10011883 Ga0207709_100118833 221
900 3300025936 Ga0207670_10109074 Ga0207670_101090742 221
901 3300025936 Ga0207670_10129912 Ga0207670_101299122 221
902 3300025936 Ga0207670_10433911 Ga0207670_104339111 221
903 3300025936 Ga0207670_10668920 Ga0207670_106689202 221
904 3300025937 Ga0207669_10012946 Ga0207669_100129464 221
905 3300025937 Ga0207669_10112591 Ga0207669_101125912 221
906 3300025938 Ga0207704_10023649 Ga0207704_100236493 221
907 3300025938 Ga0207704_10066243 Ga0207704_100662433 221
908 3300025939 Ga0207665_10014564 Ga0207665_100145643 221
909 3300025939 Ga0207665_10088398 Ga0207665_100883983 221
910 3300025939 Ga0207665_10127531 Ga0207665_101275312 221
911 3300025939 Ga0207665_10273598 Ga0207665_102735982 221
912 3300025942 Ga0207689_10000438 Ga0207689_1000043814 221
913 3300025942 Ga0207689_10303975 Ga0207689_103039752 221
914 3300025944 Ga0207661_10129668 Ga0207661_101296682 221
915 3300025944 Ga0207661_10721792 Ga0207661_107217922 221
916 3300025945 Ga0207679_10116041 Ga0207679_101160411 221
917 3300025960 Ga0207651_10171331 Ga0207651_101713312 221
918 3300025961 Ga0207712_10092184 Ga0207712_100921842 221
919 3300025961 Ga0207712_10739497 Ga0207712_107394971 221
920 3300025972 Ga0207668_10049211 Ga0207668_100492112 221
921 3300025981 Ga0207640_10561431 Ga0207640_105614312 221
922 3300026023 Ga0207677_10010414 Ga0207677_100104144 221
923 3300026023 Ga0207677_10862584 Ga0207677_108625842 221
924 3300026067 Ga0207678_10071215 Ga0207678_100712153 221
925 3300026067 Ga0207678_10218201 Ga0207678_102182012 221
926 3300026067 Ga0207678_10497040 Ga0207678_104970402 221
927 3300026075 Ga0207708_10000961 Ga0207708_1000096122 221
928 3300026075 Ga0207708_10168264 Ga0207708_101682641 221
929 3300026088 Ga0207641_10181299 Ga0207641_101812992 221
930 3300026089 Ga0207648_10000210 Ga0207648_1000021062 221
931 3300026089 Ga0207648_10121925 Ga0207648_101219252 221
932 3300026118 Ga0207675_100000473 Ga0207675_10000047329 221
933 3300026118 Ga0207675_100103181 Ga0207675_1001031814 221
934 3300026118 Ga0207675_100277917 Ga0207675_1002779173 221
935 3300026121 Ga0207683_10002061 Ga0207683_1000206116 221
936 3300026121 Ga0207683_10125234 Ga0207683_101252343 221
937 3300026121 Ga0207683_10138240 Ga0207683_101382403 221
938 3300026142 Ga0207698_10214236 Ga0207698_102142362 221
939 3300027111 Ga0209281_1000118 Ga0209281_1000118161 221
940 3300027462 Ga0210000_1005546 Ga0210000_10055462 221
941 3300027471 Ga0209995_1010877 Ga0209995_10108772 221
942 3300027543 Ga0209999_1000258 Ga0209999_10002584 221
943 3300027671 Ga0209588_1025122 Ga0209588_10251222 221
944 3300027695 Ga0209966_1000058 Ga0209966_100005830 221
945 3300027876 Ga0209974_10025440 Ga0209974_100254403 221
946 3300027907 Ga0207428_10006083 Ga0207428_100060836 221
947 3300027907 Ga0207428_10022374 Ga0207428_100223746 221
948 3300028379 Ga0268266_10508984 Ga0268266_105089842 221
949 3300028380 Ga0268265_10004813 Ga0268265_100048133 221
950 3300028381 Ga0268264_10059356 Ga0268264_100593564 221
951 3300028381 Ga0268264_10669895 Ga0268264_106698952 221
952 3300028381 Ga0268264_11175131 Ga0268264_111751311 221
953 3300028800 Ga0265338_10288969 Ga0265338_102889692 221
954 3300030521 Ga0307511_10000964 Ga0307511_1000096427 221
955 3300031238 Ga0265332_10093416 Ga0265332_100934162 221
956 3300031241 Ga0265325_10018690 Ga0265325_100186903 221
957 3300031241 Ga0265325_10052246 Ga0265325_100522463 221
958 3300031242 Ga0265329_10024025 Ga0265329_100240252 221
959 3300031247 Ga0265340_10033586 Ga0265340_100335862 221
960 3300031247 Ga0265340_10060264 Ga0265340_100602642 221
961 3300031247 Ga0265340_10159291 Ga0265340_101592912 221
962 3300031249 Ga0265339_10046918 Ga0265339_100469182 221
963 3300031249 Ga0265339_10158103 Ga0265339_101581032 221
964 3300031250 Ga0265331_10132943 Ga0265331_101329431 221
965 3300031251 Ga0265327_10059193 Ga0265327_100591931 221
966 3300031344 Ga0265316_10015448 Ga0265316_100154483 221
967 3300031344 Ga0265316_10173583 Ga0265316_101735832 221
968 3300031344 Ga0265316_10175146 Ga0265316_101751462 221
969 3300031595 Ga0265313_10057900 Ga0265313_100579002 221
970 3300031712 Ga0265342_10059052 Ga0265342_100590521 221
971 3300031712 Ga0265342_10069012 Ga0265342_100690122 221
972 3300031712 Ga0265342_10076058 Ga0265342_100760582 221
973 3300034819 Ga0373958_0020166 Ga0373958_0020166_267_935 221
974 3300034820 Ga0373959_0015312 Ga0373959_0015312_292_960 221
975 3300035083 Ga0373926_0000195 Ga0373926_0000195_9106_9777 221
976 3300035092 Ga0373952_0089523 Ga0373952_0089523_117_785 221
977 3300035113 Ga0373936_0000690 Ga0373936_0000690_10808_11479 221
978 3300035114 Ga0373939_0003205 Ga0373939_0003205_886_1554 221
979 3300035114 Ga0373939_0020267 Ga0373939_0020267_253_924 221
980 3300035115 Ga0373941_0009155 Ga0373941_0009155_1310_1978 221
981 3300035115 Ga0373941_0057439 Ga0373941_0057439_238_906 221
982 3300035116 Ga0373945_0031260 Ga0373945_0031260_855_1520 221
983 3300035116 Ga0373945_0128217 Ga0373945_0128217_329_1000 221
984 3300035121 Ga0373960_0002402 Ga0373960_0002402_2855_3523 221
985 3300035121 Ga0373960_0056340 Ga0373960_0056340_136_807 221
986 3300035170 Ga0373943_0001726 Ga0373943_0001726_3240_3911 221
987 3300035170 Ga0373943_0014469 Ga0373943_0014469_11_676 221
988 3300035170 Ga0373943_0123991 Ga0373943_0123991_428_1093 221
989 3300035171 Ga0373946_0002235 Ga0373946_0002235_5679_6350 221
990 3300035171 Ga0373946_0116727 Ga0373946_0116727_148_813 221
991 3300035241 Ga0373961_0014093 Ga0373961_0014093_972_1640 221
992 3300035241 Ga0373961_0038044 Ga0373961_0038044_28_696 221
993 3300035242 Ga0373962_0008778 Ga0373962_0008778_447_1115 221
994 3300035691 Ga0373931_0003181 Ga0373931_0003181_5566_6234 221
995 3300035691 Ga0373931_0008868 Ga0373931_0008868_1938_2606 221
996 3300035691 Ga0373931_0029645 Ga0373931_0029645_1983_2654 221
997 3300035691 Ga0373931_0061586 Ga0373931_0061586_1080_1745 221
998 3300035692 Ga0373935_0005776 Ga0373935_0005776_6298_6969 221
999 3300035692 Ga0373935_0011481 Ga0373935_0011481_1300_1971 221
1000 3300035692 Ga0373935_0103669 Ga0373935_0103669_970_1635 221
1001 3300035692 Ga0373935_0252399 Ga0373935_0252399_491_1171 221
1002 3300035695 Ga0373927_0004235 Ga0373927_0004235_6106_6777 221
1003 3300035695 Ga0373927_0165826 Ga0373927_0165826_618_1298 221
1004 3300035724 Ga0373933_0386934 Ga0373933_0386934_80_745 221
1005 3300035725 Ga0373947_0003323 Ga0373947_0003323_6433_7104 221
1006 3300035725 Ga0373947_0009876 Ga0373947_0009876_3677_4357 221
1007 3300035725 Ga0373947_0036819 Ga0373947_0036819_208_873 221
1008 3300035725 Ga0373947_0605505 Ga0373947_0605505_38_703 221
1009 3300036401 Ga0373937_0288338 Ga0373937_0288338_189_869 221
1010 3300036712 Ga0316584_0096222 Ga0316584_0096222_59_724 221
1011 3300037068 Ga0373925_0003648 Ga0373925_0003648_4894_5565 221
1012 3300037068 Ga0373925_0062614 Ga0373925_0062614_2078_2749 221
1013 3300037068 Ga0373925_0769336 Ga0373925_0769336_66_731 221
1014 3300037418 Ga0395900_0338071 Ga0395900_0338071_662_1327 221
1015 3300037466 Ga0395898_0110566 Ga0395898_0110566_961_1626 221
1016 3300037471 Ga0395905_0189564 Ga0395905_0189564_336_1007 221
1017 3300037471 Ga0395905_0776267 Ga0395905_0776267_152_817 221
1018 3300037853 Ga0436364_0024334 Ga0436364_0024334_1252_1917 221
1019 3300037853 Ga0436364_0036231 Ga0436364_0036231_251_916 221
1020 3300037853 Ga0436364_0102492 Ga0436364_0102492_11285_11959 221
1021 3300037853 Ga0436364_0604575 Ga0436364_0604575_67_738 221
1022 3300037853 Ga0436364_1368626 Ga0436364_1368626_2147_2848 221
1023 3300038443 Ga0395901_0066966 Ga0395901_0066966_2937_3602 221
1024 3300039437 Ga0436365_0079845 Ga0436365_0079845_1048_1713 221
1025 3300039437 Ga0436365_0116924 Ga0436365_0116924_17_682 221
1026 3300039437 Ga0436365_0129764 Ga0436365_0129764_410_1075 221
1027 3300039437 Ga0436365_0653192 Ga0436365_0653192_991_1656 221
1028 3300039437 Ga0436365_0763573 Ga0436365_0763573_102_767 221
1029 3300039437 Ga0436365_1191589 Ga0436365_1191589_33_701 221
1030 3300039437 Ga0436365_1712439 Ga0436365_1712439_278_943 221
1031 3300039437 Ga0436365_1731595 Ga0436365_1731595_858_1523 221
1032 3300039438 Ga0436360_0485582 Ga0436360_0485582_422_1087 221
1033 3300039438 Ga0436360_0638353 Ga0436360_0638353_1380_2051 221
1034 3300039438 Ga0436360_0878352 Ga0436360_0878352_549_1214 221
1035 3300039438 Ga0436360_1051847 Ga0436360_1051847_502_1170 221
1036 3300039438 Ga0436360_1282173 Ga0436360_1282173_287_958 221
1037 3300039447 Ga0436361_0602437 Ga0436361_0602437_847_1512 221
1038 3300039450 Ga0436363_0815889 Ga0436363_0815889_20_685 221
1039 3300041408 Ga0439453_0005684 Ga0439453_0005684_959_1624 221
1040 3300041486 Ga0451807_2679455 Ga0451807_2679455_587_1258 221
1041 3300041512 Ga0451853_2031171 Ga0451853_2031171_220_885 221
1042 3300042001 Ga0439441_009658 Ga0439441_009658_795_1460 221
1043 3300042003 Ga0439443_000435 Ga0439443_000435_1632_2297 221
1044 3300042016 Ga0439463_012567 Ga0439463_012567_1158_1829 221
1045 3300042436 Ga0439435_0007496 Ga0439435_0007496_257_922 221
1046 3300042461 Ga0439460_0010765 Ga0439460_0010765_737_1402 221
1047 3300042876 Ga0451577_0155692 Ga0451577_0155692_1224_1895 221
1048 3300044735 Ga0466968_0142555 Ga0466968_0142555_300_971 221
1049 3300045049 Ga0466959_0132286 Ga0466959_0132286_35_700 221
1050 3300045051 Ga0451576_0000675 Ga0451576_0000675_31803_32474 221
1051 3300045051 Ga0451576_0001560 Ga0451576_0001560_6729_7400 221
1052 3300045051 Ga0451576_0020927 Ga0451576_0020927_5940_6611 221
1053 3300046455 Ga0495603_0032349 Ga0495603_0032349_2238_2909 221
1054 3300046455 Ga0495603_0042369 Ga0495603_0042369_1958_2623 221
1055 3300046458 Ga0495591_022367 Ga0495591_022367_354_1019 221
1056 3300046460 Ga0495638_0012261 Ga0495638_0012261_2939_3604 221
1057 3300046460 Ga0495638_0106886 Ga0495638_0106886_636_1301 221
1058 3300046460 Ga0495638_0127966 Ga0495638_0127966_596_1261 221
1059 3300046472 Ga0495580_0001101 Ga0495580_0001101_18159_18830 221
1060 3300046473 Ga0495582_0032106 Ga0495582_0032106_1904_2575 221
1061 3300046474 Ga0495605_0017300 Ga0495605_0017300_1277_1942 221
1062 3300046476 Ga0495662_0053818 Ga0495662_0053818_450_1115 221
1063 3300046491 Ga0495584_0021909 Ga0495584_0021909_2486_3151 221
1064 3300046491 Ga0495584_0172803 Ga0495584_0172803_238_903 221
1065 3300046492 Ga0495585_0005753 Ga0495585_0005753_5644_6309 221
1066 3300046500 Ga0495596_0005581 Ga0495596_0005581_3939_4604 221
1067 3300046501 Ga0495607_0154453 Ga0495607_0154453_40_705 221
1068 3300046513 Ga0495616_0012462 Ga0495616_0012462_719_1384 221
1069 3300046515 Ga0495620_0103105 Ga0495620_0103105_277_942 221
1070 3300046517 Ga0495630_0264030 Ga0495630_0264030_150_821 221
1071 3300046520 Ga0495637_0032492 Ga0495637_0032492_1240_1905 221
1072 3300046523 Ga0495644_0001773 Ga0495644_0001773_5372_6037 221
1073 3300046524 Ga0495648_0028648 Ga0495648_0028648_1203_1868 221
1074 3300046524 Ga0495648_0202072 Ga0495648_0202072_39_704 221
1075 3300046525 Ga0495663_0001218 Ga0495663_0001218_6108_6773 221
1076 3300046525 Ga0495663_0039050 Ga0495663_0039050_233_898 221
1077 3300046526 Ga0495666_0001865 Ga0495666_0001865_9334_10005 221
1078 3300046528 Ga0495642_0049393 Ga0495642_0049393_148_813 221
1079 3300046530 Ga0495654_0001080 Ga0495654_0001080_14380_15045 221
1080 3300046533 Ga0495640_0238574 Ga0495640_0238574_208_873 221
1081 3300046535 Ga0495586_0007994 Ga0495586_0007994_1664_2335 221
1082 3300046537 Ga0495598_0000982 Ga0495598_0000982_1208_1873 221
1083 3300046537 Ga0495598_0045429 Ga0495598_0045429_543_1223 221
1084 3300046538 Ga0495609_0011376 Ga0495609_0011376_302_967 221
1085 3300046542 Ga0495597_0178523 Ga0495597_0178523_163_828 221
1086 3300046558 Ga0495633_0031180 Ga0495633_0031180_805_1470 221
1087 3300046615 Ga0495656_0007268 Ga0495656_0007268_2709_3374 221
1088 3300046648 Ga0495611_0005578 Ga0495611_0005578_2198_2863 221
1089 3300046664 Ga0495659_0009620 Ga0495659_0009620_2265_2930 221
1090 3300046674 Ga0495588_0016816 Ga0495588_0016816_1585_2256 221
1091 3300046675 Ga0495657_0182727 Ga0495657_0182727_593_1258 221
1092 3300046681 Ga0495647_0000948 Ga0495647_0000948_5413_6084 221
1093 3300046683 Ga0495658_0010802 Ga0495658_0010802_586_1257 221
1094 3300046683 Ga0495658_0067177 Ga0495658_0067177_279_944 221
1095 3300046684 Ga0495669_0007268 Ga0495669_0007268_3688_4353 221
1096 3300046684 Ga0495669_0091938 Ga0495669_0091938_106_777 221
1097 3300046690 Ga0495624_0140034 Ga0495624_0140034_661_1341 221
1098 3300046692 Ga0495671_0006022 Ga0495671_0006022_1207_1872 221
1099 3300046694 Ga0495649_0026038 Ga0495649_0026038_511_1176 221
1100 3300046810 Ga0495660_0065974 Ga0495660_0065974_674_1339 221
1101 3300047318 Ga0495636_0058461 Ga0495636_0058461_776_1441 221
1102 3300047319 Ga0495674_0218795 Ga0495674_0218795_609_1274 221
1103 3300047320 Ga0495672_0087001 Ga0495672_0087001_557_1222 221
1104 3300047321 Ga0495676_0007035 Ga0495676_0007035_2674_3339 221
1105 3300047321 Ga0495676_0019040 Ga0495676_0019040_5266_5937 221
1106 3300047321 Ga0495676_0025891 Ga0495676_0025891_1536_2216 221
1107 3300047443 Ga0495687_000388 Ga0495687_000388_17011_17676 221
1108 3300047445 Ga0495677_0008087 Ga0495677_0008087_705_1370 221
1109 3300047446 Ga0495679_043979 Ga0495679_043979_300_965 221
1110 3300047447 Ga0495685_024288 Ga0495685_024288_1303_1968 221
1111 3300047471 Ga0495684_0143697 Ga0495684_0143697_676_1341 221
1112 3300048090 Ga0495615_0001640 Ga0495615_0001640_2022_2687 221
1113 3300048091 Ga0495626_0109708 Ga0495626_0109708_259_924 221
1114 3300048903 Ga0496100_0017604 Ga0496100_0017604_2299_2964 221
1115 3300048903 Ga0496100_0097712 Ga0496100_0097712_670_1350 221
1116 3300048903 Ga0496100_0124854 Ga0496100_0124854_858_1523 221
1117 3300048903 Ga0496100_0472800 Ga0496100_0472800_276_941 221
1118 3300048904 Ga0496101_0030581 Ga0496101_0030581_2524_3189 221
1119 3300048904 Ga0496101_0076772 Ga0496101_0076772_1675_2355 221
1120 3300048904 Ga0496101_0094815 Ga0496101_0094815_1185_1850 221
1121 3300048905 Ga0496102_0022924 Ga0496102_0022924_1499_2164 221
1122 3300048905 Ga0496102_0235500 Ga0496102_0235500_539_1219 221
1123 3300048905 Ga0496102_0316762 Ga0496102_0316762_94_762 221
1124 3300048906 Ga0496103_0038473 Ga0496103_0038473_1254_1919 221
1125 3300048907 Ga0496104_0001994 Ga0496104_0001994_10_690 221
1126 3300048907 Ga0496104_0010317 Ga0496104_0010317_188_853 221
1127 3300048907 Ga0496104_0013248 Ga0496104_0013248_4885_5550 221
1128 3300048907 Ga0496104_0061181 Ga0496104_0061181_1937_2602 221
1129 3300048908 Ga0496105_0026267 Ga0496105_0026267_2582_3247 221
1130 3300048908 Ga0496105_0041867 Ga0496105_0041867_1174_1839 221
1131 3300048908 Ga0496105_0214395 Ga0496105_0214395_490_1155 221
1132 3300048909 Ga0496106_0006348 Ga0496106_0006348_2546_3211 221
1133 3300048909 Ga0496106_0037466 Ga0496106_0037466_1901_2566 221
1134 3300048910 Ga0496107_0043856 Ga0496107_0043856_266_931 221
1135 3300048910 Ga0496107_0108783 Ga0496107_0108783_786_1451 221
1136 3300048910 Ga0496107_0173346 Ga0496107_0173346_207_872 221
1137 3300048911 Ga0496108_0007201 Ga0496108_0007201_207_887 221
1138 3300048911 Ga0496108_0155646 Ga0496108_0155646_377_1042 221
1139 3300048912 Ga0496109_0002300 Ga0496109_0002300_735_1415 221
1140 3300048912 Ga0496109_0168093 Ga0496109_0168093_1197_1862 221
1141 3300048912 Ga0496109_0863253 Ga0496109_0863253_128_793 221
1142 3300048913 Ga0496110_0008186 Ga0496110_0008186_1631_2299 221
1143 3300048913 Ga0496110_0011792 Ga0496110_0011792_3258_3923 221
1144 3300048913 Ga0496110_0026348 Ga0496110_0026348_2712_3392 221
1145 3300048913 Ga0496110_0226986 Ga0496110_0226986_248_913 221
1146 3300048913 Ga0496110_0715883 Ga0496110_0715883_208_873 221
1147 3300048914 Ga0496111_0001890 Ga0496111_0001890_3077_3757 221
1148 3300048914 Ga0496111_0119894 Ga0496111_0119894_1193_1861 221
1149 3300048915 Ga0496112_0001865 Ga0496112_0001865_353_1033 221
1150 3300048915 Ga0496112_0181169 Ga0496112_0181169_135_800 221
1151 3300048915 Ga0496112_0563503 Ga0496112_0563503_312_977 221
1152 3300048916 Ga0496113_0000167 Ga0496113_0000167_8950_9630 221
1153 3300048916 Ga0496113_0132216 Ga0496113_0132216_200_865 221
1154 3300048916 Ga0496113_0175855 Ga0496113_0175855_600_1265 221
1155 3300048916 Ga0496113_0289307 Ga0496113_0289307_428_1093 221
1156 3300048917 Ga0496114_0051129 Ga0496114_0051129_1332_1997 221
1157 3300048917 Ga0496114_0073163 Ga0496114_0073163_353_1033 221
1158 3300048917 Ga0496114_0176244 Ga0496114_0176244_980_1645 221
1159 3300048917 Ga0496114_0187205 Ga0496114_0187205_530_1195 221
1160 3300048918 Ga0496115_0018777 Ga0496115_0018777_1540_2220 221
1161 3300048918 Ga0496115_0030258 Ga0496115_0030258_2587_3252 221
1162 3300048918 Ga0496115_0038959 Ga0496115_0038959_1716_2381 221
1163 3300048918 Ga0496115_0259112 Ga0496115_0259112_400_1068 221
1164 3300048919 Ga0496116_0000026 Ga0496116_0000026_154462_155127 221
1165 3300048920 Ga0496117_0044695 Ga0496117_0044695_1367_2032 221
1166 3300048920 Ga0496117_0092935 Ga0496117_0092935_181_846 221
1167 3300048921 Ga0496118_0029029 Ga0496118_0029029_2655_3320 221
1168 3300048921 Ga0496118_0189001 Ga0496118_0189001_207_872 221
1169 3300048923 Ga0496120_0123119 Ga0496120_0123119_404_1069 221
1170 3300048924 Ga0496121_0001905 Ga0496121_0001905_8149_8814 221
1171 3300048924 Ga0496121_0029508 Ga0496121_0029508_3215_3916 221
1172 3300048926 Ga0496123_0052936 Ga0496123_0052936_868_1533 221
1173 3300048927 Ga0496124_0035931 Ga0496124_0035931_2767_3432 221
1174 3300048927 Ga0496124_0048988 Ga0496124_0048988_2167_2832 221
1175 3300048929 Ga0496126_0000069 Ga0496126_0000069_121554_122219 221
1176 3300048929 Ga0496126_0007545 Ga0496126_0007545_10975_11676 221
1177 3300049569 Ga0501032_0182089 Ga0501032_0182089_616_1320 221
1178 3300049570 Ga0501033_0000666 Ga0501033_0000666_28139_28843 221
1179 3300049571 Ga0501034_0077714 Ga0501034_0077714_1115_1780 221
1180 3300049571 Ga0501034_0085624 Ga0501034_0085624_1234_1911 221
1181 3300049572 Ga0501036_0001754 Ga0501036_0001754_934_1638 221
1182 3300049573 Ga0501037_0063546 Ga0501037_0063546_1358_2029 221
1183 3300049573 Ga0501037_0485143 Ga0501037_0485143_22_693 221
1184 3300049573 Ga0501037_0578928 Ga0501037_0578928_11_715 221
1185 3300049574 Ga0501038_0002084 Ga0501038_0002084_5016_5720 221
1186 3300049574 Ga0501038_0295632 Ga0501038_0295632_11_682 221
1187 3300049574 Ga0501038_0384572 Ga0501038_0384572_133_804 221
1188 3300049575 Ga0501039_0011020 Ga0501039_0011020_436_1107 221
1189 3300049575 Ga0501039_0138193 Ga0501039_0138193_72_743 221
1190 3300049575 Ga0501039_0193256 Ga0501039_0193256_192_863 221
1191 3300049575 Ga0501039_0458357 Ga0501039_0458357_80_754 221
1192 3300049576 Ga0501040_0000304 Ga0501040_0000304_23841_24545 221
1193 3300049576 Ga0501040_0049568 Ga0501040_0049568_1179_1850 221
1194 3300049576 Ga0501040_0121838 Ga0501040_0121838_786_1457 221
1195 3300049577 Ga0501041_0000266 Ga0501041_0000266_1204_1908 221
1196 3300049577 Ga0501041_0027096 Ga0501041_0027096_964_1635 221
1197 3300049577 Ga0501041_0093683 Ga0501041_0093683_1125_1796 221
1198 3300049577 Ga0501041_0154012 Ga0501041_0154012_108_773 221
1199 3300049578 Ga0501042_0003926 Ga0501042_0003926_1205_1909 221
1200 3300049578 Ga0501042_0027014 Ga0501042_0027014_2645_3316 221
1201 3300049578 Ga0501042_0044922 Ga0501042_0044922_1123_1794 221
1202 3300049578 Ga0501042_0048605 Ga0501042_0048605_1249_1914 221
1203 3300049579 Ga0501043_0013517 Ga0501043_0013517_27_731 221
1204 3300049580 Ga0501046_0000413 Ga0501046_0000413_157_861 221
1205 3300049580 Ga0501046_0073066 Ga0501046_0073066_1201_1872 221
1206 3300049582 Ga0501048_0007453 Ga0501048_0007453_2938_3642 221
1207 3300049582 Ga0501048_0022525 Ga0501048_0022525_437_1108 221
1208 3300049582 Ga0501048_0227559 Ga0501048_0227559_358_1029 221
1209 3300049582 Ga0501048_0410020 Ga0501048_0410020_141_812 221
1210 3300049583 Ga0501067_0019042 Ga0501067_0019042_832_1503 221
1211 3300049584 Ga0501068_0046421 Ga0501068_0046421_1249_1920 221
1212 3300049584 Ga0501068_0222188 Ga0501068_0222188_235_909 221
1213 3300049586 Ga0501070_0045012 Ga0501070_0045012_2923_3627 221
1214 3300049586 Ga0501070_0495277 Ga0501070_0495277_153_824 221
1215 3300049587 Ga0501071_0001916 Ga0501071_0001916_3698_4402 221
1216 3300049587 Ga0501071_0007364 Ga0501071_0007364_2327_2998 221
1217 3300049588 Ga0501072_0003133 Ga0501072_0003133_9004_9675 221
1218 3300049588 Ga0501072_0008557 Ga0501072_0008557_4757_5461 221
1219 3300049588 Ga0501072_0009222 Ga0501072_0009222_4292_4957 221
1220 3300049588 Ga0501072_0010196 Ga0501072_0010196_1098_1772 221
1221 3300049588 Ga0501072_0104921 Ga0501072_0104921_421_1092 221
1222 3300049590 Ga0501074_0002421 Ga0501074_0002421_11377_12081 221
1223 3300049590 Ga0501074_0299769 Ga0501074_0299769_169_834 221
1224 3300049591 Ga0501075_0003585 Ga0501075_0003585_1530_2234 221
1225 3300049591 Ga0501075_0136695 Ga0501075_0136695_1085_1750 221
1226 3300049592 Ga0501076_0001446 Ga0501076_0001446_4749_5453 221
1227 3300049592 Ga0501076_0001483 Ga0501076_0001483_2766_3437 221
1228 3300049592 Ga0501076_0022711 Ga0501076_0022711_2736_3407 221
1229 3300049592 Ga0501076_0022723 Ga0501076_0022723_295_960 221
1230 3300049592 Ga0501076_0062208 Ga0501076_0062208_617_1288 221
1231 3300049592 Ga0501076_0120017 Ga0501076_0120017_264_938 221
1232 3300049593 Ga0501077_0003912 Ga0501077_0003912_7915_8619 221
1233 3300049593 Ga0501077_0113475 Ga0501077_0113475_713_1384 221
1234 3300049741 Ga0501079_0016515 Ga0501079_0016515_3245_3916 221
1235 3300049741 Ga0501079_0017526 Ga0501079_0017526_148_852 221
1236 3300049742 Ga0501080_0005621 Ga0501080_0005621_5697_6368 221
1237 3300049742 Ga0501080_0035001 Ga0501080_0035001_3933_4637 221
1238 3300049743 Ga0501081_0039325 Ga0501081_0039325_378_1082 221
1239 3300049743 Ga0501081_0141341 Ga0501081_0141341_639_1310 221
1240 3300049743 Ga0501081_0389709 Ga0501081_0389709_69_743 221
1241 3300049744 Ga0501083_0096736 Ga0501083_0096736_526_1230 221
1242 3300049744 Ga0501083_0178895 Ga0501083_0178895_35_715 221
1243 3300049822 Ga0501035_0033015 Ga0501035_0033015_844_1548 221
1244 3300049823 Ga0501044_0103882 Ga0501044_0103882_1070_1774 221
1245 3300049824 Ga0501045_0000295 Ga0501045_0000295_378_1082 221
1246 3300049824 Ga0501045_0007168 Ga0501045_0007168_2437_3108 221
1247 3300049824 Ga0501045_0072370 Ga0501045_0072370_1713_2384 221
1248 3300049824 Ga0501045_0177065 Ga0501045_0177065_824_1495 221
1249 3300050489 nmdc:mga03683_11477_c1 nmdc:mga03683_11477_c1_244_909 221
1250 3300050489 nmdc:mga03683_2429_c1 nmdc:mga03683_2429_c1_964_1629 221
1251 3300050490 nmdc:mga03n38_17332_c1 nmdc:mga03n38_17332_c1_1542_2207 221
1252 3300050491 nmdc:mga00v17_145119_c1 nmdc:mga00v17_145119_c1_736_1401 221
1253 3300050491 nmdc:mga00v17_82603_c1 nmdc:mga00v17_82603_c1_991_1656 221
1254 3300050492 nmdc:mga0yw44_1573_c1 nmdc:mga0yw44_1573_c1_7853_8518 221
1255 3300050492 nmdc:mga0yw44_18590_c1 nmdc:mga0yw44_18590_c1_921_1586 221
1256 3300050492 nmdc:mga0yw44_230281_c1 nmdc:mga0yw44_230281_c1_485_1150 221
1257 3300050493 nmdc:mga0k408_22647_c1 nmdc:mga0k408_22647_c1_2665_3330 221
1258 3300050496 nmdc:mga07m45_176188_c1 nmdc:mga07m45_176188_c1_225_890 221
1259 3300050507 nmdc:mga05p37_1030425_c1 nmdc:mga05p37_1030425_c1_179_844 221
1260 3300050507 nmdc:mga05p37_13349_c1 nmdc:mga05p37_13349_c1_5773_6438 221
1261 3300050507 nmdc:mga05p37_18147_c1 nmdc:mga05p37_18147_c1_430_1101 221
1262 3300050507 nmdc:mga05p37_375_c1 nmdc:mga05p37_375_c1_12884_13549 221
1263 3300050508 nmdc:mga09592_50873_c1 nmdc:mga09592_50873_c1_1065_1730 221
1264 3300050508 nmdc:mga09592_9811_c1 nmdc:mga09592_9811_c1_6501_7166 221
1265 3300050509 nmdc:mga0qj67_12117_c1 nmdc:mga0qj67_12117_c1_2139_2807 221
1266 3300050509 nmdc:mga0qj67_15530_c1 nmdc:mga0qj67_15530_c1_227_895 221
1267 3300050509 nmdc:mga0qj67_45584_c1 nmdc:mga0qj67_45584_c1_2610_3275 221
1268 3300050510 nmdc:mga06r32_152492_c1 nmdc:mga06r32_152492_c1_687_1352 221
1269 3300050510 nmdc:mga06r32_24989_c1 nmdc:mga06r32_24989_c1_4191_4856 221
1270 3300050510 nmdc:mga06r32_30461_c1 nmdc:mga06r32_30461_c1_3228_3896 221
1271 3300050510 nmdc:mga06r32_49808_c1 nmdc:mga06r32_49808_c1_1493_2161 221
1272 3300050510 nmdc:mga06r32_4_c1 nmdc:mga06r32_4_c1_101843_102508 221
1273 3300050510 nmdc:mga06r32_551046_c1 nmdc:mga06r32_551046_c1_208_879 221
1274 3300050511 nmdc:mga08y16_247461_c1 nmdc:mga08y16_247461_c1_554_1219 221
1275 3300050511 nmdc:mga08y16_348_c1 nmdc:mga08y16_348_c1_11048_11713 221
1276 3300050511 nmdc:mga08y16_756619_c1 nmdc:mga08y16_756619_c1_153_818 221
1277 3300050511 nmdc:mga08y16_8294_c1 nmdc:mga08y16_8294_c1_9289_9957 221
1278 3300050512 nmdc:mga0n895_1039876_c1 nmdc:mga0n895_1039876_c1_11_676 221
1279 3300050512 nmdc:mga0n895_162047_c1 nmdc:mga0n895_162047_c1_1376_2050 221
1280 3300050512 nmdc:mga0n895_33720_c1 nmdc:mga0n895_33720_c1_1597_2265 221
1281 3300050512 nmdc:mga0n895_35879_c1 nmdc:mga0n895_35879_c1_1364_2032 221
1282 3300050512 nmdc:mga0n895_392704_c1 nmdc:mga0n895_392704_c1_279_944 221
1283 3300050513 nmdc:mga0rr50_12254_c1 nmdc:mga0rr50_12254_c1_3652_4320 221
1284 3300050513 nmdc:mga0rr50_404287_c1 nmdc:mga0rr50_404287_c1_229_894 221
1285 3300050514 nmdc:mga08x19_194011_c1 nmdc:mga08x19_194011_c1_706_1371 221
1286 3300050515 nmdc:mga0a205_2122_c1 nmdc:mga0a205_2122_c1_23_691 221
1287 3300050515 nmdc:mga0a205_475509_c1 nmdc:mga0a205_475509_c1_216_884 221
1288 3300050515 nmdc:mga0a205_5700_c1 nmdc:mga0a205_5700_c1_6136_6807 221
1289 3300050516 nmdc:mga0sz30_98511_c1 nmdc:mga0sz30_98511_c1_535_1218 221
1290 3300053077 Ga0495601_0167447 Ga0495601_0167447_714_1379 221
1291 3300053078 Ga0495612_0031633 Ga0495612_0031633_883_1548 221
1292 3300053079 Ga0500610_0179717 Ga0500610_0179717_160_825 221
1293 3300053083 Ga0495655_0000541 Ga0495655_0000541_2361_3026 221
1294 3300053085 Ga0495619_0486244 Ga0495619_0486244_157_822 221
1295 3300053098 Ga0500650_0090972 Ga0500650_0090972_210_884 221
1296 3300053103 Ga0500555_001804 Ga0500555_001804_4510_5184 221
1297 3300053117 Ga0500593_002147 Ga0500593_002147_442_1107 221
1298 3300053122 Ga0500608_000841 Ga0500608_000841_4963_5628 221
1299 3300053125 Ga0500618_000843 Ga0500618_000843_7975_8646 221
1300 3300053125 Ga0500618_036333 Ga0500618_036333_372_1037 221
1301 3300053130 Ga0500642_0002570 Ga0500642_0002570_3485_4159 221
1302 3300053133 Ga0500655_001113 Ga0500655_001113_195_878 221
1303 3300053139 Ga0500568_0006823 Ga0500568_0006823_1612_2286 221
1304 3300053139 Ga0500568_0010309 Ga0500568_0010309_821_1504 221
1305 3300053140 Ga0500573_0172471 Ga0500573_0172471_124_789 221
1306 3300053141 Ga0500574_000110 Ga0500574_000110_4348_5013 221
1307 3300053142 Ga0500577_0010379 Ga0500577_0010379_74_748 221
1308 3300053146 Ga0500588_0090836 Ga0500588_0090836_188_853 221
1309 3300053151 Ga0500604_0003713 Ga0500604_0003713_936_1619 221
1310 3300053151 Ga0500604_0006665 Ga0500604_0006665_2132_2806 221
1311 3300053158 Ga0500627_0085903 Ga0500627_0085903_30_704 221
1312 3300053177 Ga0500636_0006124 Ga0500636_0006124_2654_3319 221
1313 3300054114 Ga0501084_0010451 Ga0501084_0010451_2672_3343 221
1314 3300054114 Ga0501084_0101727 Ga0501084_0101727_791_1456 221
1315 3300054114 Ga0501084_0217747 Ga0501084_0217747_721_1392 221
1316 3300054114 Ga0501084_0523183 Ga0501084_0523183_32_703 221
1317 3300060353 Ga0501082_0000438 Ga0501082_0000438_36172_36876 221
1318 3300060353 Ga0501082_0046888 Ga0501082_0046888_781_1452 221
1319 3300060353 Ga0501082_0082168 Ga0501082_0082168_187_861 221
1320 3300061734 Ga0530510_0001413 Ga0530510_0001413_15215_15919 221
1321 3300061734 Ga0530510_0297194 Ga0530510_0297194_202_873 221
1322 3300061734 Ga0530510_0297786 Ga0530510_0297786_22_693 221
1323 3300061734 Ga0530510_0660428 Ga0530510_0660428_44_709 221

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

65

247

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.8152 14 218
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.781 14 218
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.7616 8 215
4jbw-assembly1.cif.gz_F crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.7519 27 215
3dhw-assembly1.cif.gz_B crystal structure of methionine importer metni 0.7443 20 208
ID Description Score Start End Superfamily
af_P45768_144_364_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8476 28 219 1.10.3720.10
af_P0AFT2_3_219_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8443 11 219 1.10.3720.10
af_P0AEQ6_1_218_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8252 12 221 1.10.3720.10
af_Q2FX86_270_484_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8214 14 221 1.10.3720.10
af_P52094_1_222_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8179 14 221 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A4Q3V029-F1-model_v4 Transporter substrate-binding domain-containing protein 0.9598 9 163 GO:0006865
GO:0015276
GO:0043190
AF-A0A659PV92-F1-model_v4 Amino acid ABC transporter permease 0.9431 11 164 GO:0015184
GO:0043190
AF-X1R9Y8-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.9427 18 169 GO:0006865
GO:0022857
GO:0043190
AF-A0A728BTM9-F1-model_v4 ABC transporter permease subunit 0.9415 11 162 GO:0015184
GO:0043190
AF-E8KEL1-F1-model_v4 ABC transporter, permease protein 0.9387 9 163 GO:0006865
GO:0022857
GO:0043190

Feature Viewer

pLDDT pTM Quality
91.83 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map