F493002
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1323 | 489 | 1297 | 220 |
Family's Representative Sequence
| Representative Sequence | 3300031238|Ga0265332_10093416|Ga0265332_100934162 |
| Length | 247 |
| Sequence | MGPGSRAFALGRDDHRRMWPELGSAWMDALIQQFFNLDIMARALPLVLSGLRETLLLCLIVIPLGLAGGLLFALASLAPSRTVRWGMIVAIDFFRAVPPLVLLIFVYSGLPFSGVRLSPLAAVAVAFFLNTSSYYGEIYRAGLESVGRGQWDAARSTGLNVFHTLGFVVLPQAVRNVLPDLVSNTVEVVKLTSIASVVALPEMLYSADMARSVTFNASPIVLAAAIYLVMLWPVVRLISRLERRMAS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 2 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 3 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 4 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 5 | 2687453129 | Halotalea alkalilenta IHB B 13600 | Isolate | Unclassified |
| 6 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 7 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 8 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 9 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 10 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 11 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 12 | 2854681122 | Luteovulum sphaeroides SCJ | Isolate | Unclassified |
| 13 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 14 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 15 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 16 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 17 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 18 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 19 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 20 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 21 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 22 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 23 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 24 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 25 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 28 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 35 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 38 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 67 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 76 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 84 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 86 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 87 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 88 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 90 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 91 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 92 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 93 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 94 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 95 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 96 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 97 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 98 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 99 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 100 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 101 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 102 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 103 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 105 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 106 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 107 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 108 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 109 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 110 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 111 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 112 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 113 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 114 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 115 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 116 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 118 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 119 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 120 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 121 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 122 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 123 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 124 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 125 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 126 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 127 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 129 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 130 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 131 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 132 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 146 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 158 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 163 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 164 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 165 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 166 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 167 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 169 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 233 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 242 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 244 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 248 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 249 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 250 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 251 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 252 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 253 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 254 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 255 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 256 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 257 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 258 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 259 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 260 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 261 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 262 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 263 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 264 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 265 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 266 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 267 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 268 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 269 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 270 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 271 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 272 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 273 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 274 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 275 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 276 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 277 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 278 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 279 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 280 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 281 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 282 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 283 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 284 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 285 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 286 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 287 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 288 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 289 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 290 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 291 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 292 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 293 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 294 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 295 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 296 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 297 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 298 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 299 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 300 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 301 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 302 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 303 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 304 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 305 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 306 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 307 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 308 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 309 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 310 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 311 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 312 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 374 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 375 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 376 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 377 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 378 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 379 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 380 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 381 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 382 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 383 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 384 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 385 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 386 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 387 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 388 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 389 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 390 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 391 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 392 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 393 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 394 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 395 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 396 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 397 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 398 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 399 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 400 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 401 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 402 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 403 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 406 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 407 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 413 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 415 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 416 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 418 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 420 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 423 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 424 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 426 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 428 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 429 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 430 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 431 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 432 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 433 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 434 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 435 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 436 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 437 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 438 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 439 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 440 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 441 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 442 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 443 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 444 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 445 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 446 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 447 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 448 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 451 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 455 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 456 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 457 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 458 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 459 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 460 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 461 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 462 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 463 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 464 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 465 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 466 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 467 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 468 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 469 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 470 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 471 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 472 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 473 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 474 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 475 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 476 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 477 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 478 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 479 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 480 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 481 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 482 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 483 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 484 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 485 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 486 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 487 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 488 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 489 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.03 |
| Metatranscriptomes | 0 |
| Isolates | 1.97 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.15 |
| Bulb | 0 |
| Endosphere | 7.11 |
| Nodule | 0.53 |
| Rhizoplane | 4.31 |
| Rhizosphere | 82.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.44 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10025895 | 3300003203 | Bacteria | 2270 |
| 2 | JGI25406J46586_10027405 | 3300003203 | Bacteria | 2185 |
| 3 | JGI25406J46586_10035480 | 3300003203 | Bacteria | 1820 |
| 4 | JGI25404J52841_10000578 | 3300003659 | Bacteria | 5452 |
| 5 | Ga0055526_1000200 | 3300003771 | Bacteria | 51514 |
| 6 | Ga0055524_1020229 | 3300003775 | Bacteria | 2250 |
| 7 | JGI25405J52794_10009095 | 3300003911 | Bacteria | 1869 |
| 8 | Ga0065707_10099009 | 3300005295 | Bacteria | 3039 |
| 9 | Ga0065707_10307618 | 3300005295 | Bacteria | 991 |
| 10 | Ga0070658_10063135 | 3300005327 | Bacteria | 3019 |
| 11 | Ga0070676_10000559 | 3300005328 | Bacteria | 17996 |
| 12 | Ga0070676_10093706 | 3300005328 | Bacteria | 1844 |
| 13 | Ga0070676_10608658 | 3300005328 | Bacteria | 789 |
| 14 | Ga0070683_100022527 | 3300005329 | Bacteria | 5631 |
| 15 | Ga0070683_100109723 | 3300005329 | Bacteria | 2603 |
| 16 | Ga0070683_100435421 | 3300005329 | Bacteria | 1251 |
| 17 | Ga0070683_100789481 | 3300005329 | Bacteria | 910 |
| 18 | Ga0070690_100011676 | 3300005330 | Bacteria | 5144 |
| 19 | Ga0070690_100145401 | 3300005330 | Bacteria | 1613 |
| 20 | Ga0070690_100208328 | 3300005330 | Bacteria | 1363 |
| 21 | Ga0070670_100001348 | 3300005331 | Bacteria | 19649 |
| 22 | Ga0070670_100368524 | 3300005331 | Bacteria | 1264 |
| 23 | Ga0068869_100008769 | 3300005334 | Bacteria | 6536 |
| 24 | Ga0068869_100015289 | 3300005334 | Bacteria | 5144 |
| 25 | Ga0068869_100104727 | 3300005334 | Bacteria | 2145 |
| 26 | Ga0068869_100395732 | 3300005334 | Bacteria | 1135 |
| 27 | Ga0070680_100002153 | 3300005336 | Bacteria | 14561 |
| 28 | Ga0070680_100011581 | 3300005336 | Bacteria | 6831 |
| 29 | Ga0070680_100033740 | 3300005336 | Bacteria | 4127 |
| 30 | Ga0070680_100050708 | 3300005336 | Bacteria | 3385 |
| 31 | Ga0070680_100104795 | 3300005336 | Bacteria | 2350 |
| 32 | Ga0070682_100004797 | 3300005337 | Bacteria | 7512 |
| 33 | Ga0070682_100023337 | 3300005337 | Bacteria | 3671 |
| 34 | Ga0068868_100006085 | 3300005338 | Bacteria | 8521 |
| 35 | Ga0070660_100074612 | 3300005339 | Bacteria | 2654 |
| 36 | Ga0070689_100131593 | 3300005340 | Bacteria | 2006 |
| 37 | Ga0070689_100132186 | 3300005340 | Bacteria | 2002 |
| 38 | Ga0070689_100219523 | 3300005340 | Bacteria | 1559 |
| 39 | Ga0070691_10004567 | 3300005341 | Bacteria | 6288 |
| 40 | Ga0070691_10012722 | 3300005341 | Bacteria | 3854 |
| 41 | Ga0070691_10028644 | 3300005341 | Bacteria | 2603 |
| 42 | Ga0070691_10049164 | 3300005341 | Bacteria | 2008 |
| 43 | Ga0070661_100000426 | 3300005344 | Bacteria | 32270 |
| 44 | Ga0070661_100437479 | 3300005344 | Bacteria | 1039 |
| 45 | Ga0070692_10001134 | 3300005345 | Bacteria | 9340 |
| 46 | Ga0070692_10008527 | 3300005345 | Bacteria | 4577 |
| 47 | Ga0070692_10014012 | 3300005345 | Bacteria | 3753 |
| 48 | Ga0070692_10072681 | 3300005345 | Bacteria | 1836 |
| 49 | Ga0070668_100140618 | 3300005347 | Bacteria | 1945 |
| 50 | Ga0070668_100491618 | 3300005347 | Bacteria | 1061 |
| 51 | Ga0070669_100004771 | 3300005353 | Bacteria | 9777 |
| 52 | Ga0070669_100091905 | 3300005353 | Bacteria | 2277 |
| 53 | Ga0070669_100175184 | 3300005353 | Bacteria | 1675 |
| 54 | Ga0070669_100431049 | 3300005353 | Bacteria | 1084 |
| 55 | Ga0070675_100167056 | 3300005354 | Bacteria | 1895 |
| 56 | Ga0070671_100184948 | 3300005355 | Bacteria | 1765 |
| 57 | Ga0070671_100233496 | 3300005355 | Bacteria | 1561 |
| 58 | Ga0070671_100481329 | 3300005355 | Bacteria | 1067 |
| 59 | Ga0070674_100073491 | 3300005356 | Bacteria | 2424 |
| 60 | Ga0070674_100299507 | 3300005356 | Bacteria | 1281 |
| 61 | Ga0070673_100057312 | 3300005364 | Bacteria | 3078 |
| 62 | Ga0070673_100112949 | 3300005364 | Bacteria | 2255 |
| 63 | Ga0070673_100221808 | 3300005364 | Bacteria | 1637 |
| 64 | Ga0070688_100517420 | 3300005365 | Bacteria | 902 |
| 65 | Ga0070659_100000529 | 3300005366 | Bacteria | 27921 |
| 66 | Ga0070667_100134910 | 3300005367 | Bacteria | 2158 |
| 67 | Ga0070667_100621099 | 3300005367 | Bacteria | 996 |
| 68 | Ga0070667_100697199 | 3300005367 | Bacteria | 939 |
| 69 | Ga0070703_10000497 | 3300005406 | Bacteria | 15492 |
| 70 | Ga0070703_10002171 | 3300005406 | Bacteria | 5706 |
| 71 | Ga0070703_10036231 | 3300005406 | Bacteria | 1515 |
| 72 | Ga0070703_10044504 | 3300005406 | Bacteria | 1396 |
| 73 | Ga0070709_10008649 | 3300005434 | Bacteria | 5599 |
| 74 | Ga0070714_100052483 | 3300005435 | Bacteria | 3477 |
| 75 | Ga0070714_100084750 | 3300005435 | Bacteria | 2766 |
| 76 | Ga0070714_100222632 | 3300005435 | Bacteria | 1735 |
| 77 | Ga0070714_100789415 | 3300005435 | Bacteria | 919 |
| 78 | Ga0070713_100040406 | 3300005436 | Bacteria | 3792 |
| 79 | Ga0070713_100132883 | 3300005436 | Bacteria | 2196 |
| 80 | Ga0070713_100445831 | 3300005436 | Bacteria | 1215 |
| 81 | Ga0070713_101097753 | 3300005436 | Bacteria | 769 |
| 82 | Ga0070710_10005794 | 3300005437 | Bacteria | 5890 |
| 83 | Ga0070710_10131912 | 3300005437 | Bacteria | 1524 |
| 84 | Ga0070710_10138186 | 3300005437 | Bacteria | 1491 |
| 85 | Ga0070710_10247894 | 3300005437 | Bacteria | 1144 |
| 86 | Ga0070701_10003786 | 3300005438 | Bacteria | 6043 |
| 87 | Ga0070701_10010068 | 3300005438 | Bacteria | 4167 |
| 88 | Ga0070701_10086009 | 3300005438 | Bacteria | 1713 |
| 89 | Ga0070701_10113393 | 3300005438 | Bacteria | 1518 |
| 90 | Ga0070705_100005181 | 3300005440 | Bacteria | 6332 |
| 91 | Ga0070705_100013875 | 3300005440 | Bacteria | 4131 |
| 92 | Ga0070705_100034461 | 3300005440 | Bacteria | 2831 |
| 93 | Ga0070705_100062206 | 3300005440 | Bacteria | 2221 |
| 94 | Ga0070705_100336997 | 3300005440 | Bacteria | 1095 |
| 95 | Ga0070700_100002783 | 3300005441 | Bacteria | 8955 |
| 96 | Ga0070700_100011918 | 3300005441 | Bacteria | 4829 |
| 97 | Ga0070700_100040815 | 3300005441 | Bacteria | 2843 |
| 98 | Ga0070700_100093420 | 3300005441 | Bacteria | 1967 |
| 99 | Ga0070700_100159024 | 3300005441 | Bacteria | 1553 |
| 100 | Ga0070694_100000056 | 3300005444 | Bacteria | 52311 |
| 101 | Ga0070694_100003659 | 3300005444 | Bacteria | 9169 |
| 102 | Ga0070694_100031929 | 3300005444 | Bacteria | 3455 |
| 103 | Ga0070694_100101883 | 3300005444 | Bacteria | 2032 |
| 104 | Ga0070694_100112371 | 3300005444 | Bacteria | 1943 |
| 105 | Ga0070708_100176203 | 3300005445 | Bacteria | 1998 |
| 106 | Ga0070663_100016249 | 3300005455 | Bacteria | 4828 |
| 107 | Ga0070678_100055656 | 3300005456 | Bacteria | 2889 |
| 108 | Ga0070678_100209720 | 3300005456 | Bacteria | 1613 |
| 109 | Ga0070678_100685077 | 3300005456 | Bacteria | 922 |
| 110 | Ga0070678_100727878 | 3300005456 | Bacteria | 896 |
| 111 | Ga0070662_100027841 | 3300005457 | Bacteria | 3929 |
| 112 | Ga0070662_100041551 | 3300005457 | Bacteria | 3281 |
| 113 | Ga0070662_100187991 | 3300005457 | Bacteria | 1631 |
| 114 | Ga0070681_10001086 | 3300005458 | Bacteria | 23200 |
| 115 | Ga0070681_10013926 | 3300005458 | Bacteria | 8003 |
| 116 | Ga0068867_100000546 | 3300005459 | Bacteria | 24785 |
| 117 | Ga0068867_100008175 | 3300005459 | Bacteria | 7390 |
| 118 | Ga0068867_100009055 | 3300005459 | Bacteria | 7024 |
| 119 | Ga0068867_100168536 | 3300005459 | Bacteria | 1732 |
| 120 | Ga0068867_100172681 | 3300005459 | Bacteria | 1713 |
| 121 | Ga0070685_10158514 | 3300005466 | Bacteria | 1440 |
| 122 | Ga0070685_10220800 | 3300005466 | Bacteria | 1241 |
| 123 | Ga0070706_100504794 | 3300005467 | Bacteria | 1125 |
| 124 | Ga0070706_100919450 | 3300005467 | Bacteria | 808 |
| 125 | Ga0070707_100012720 | 3300005468 | Bacteria | 7857 |
| 126 | Ga0070707_100213849 | 3300005468 | Bacteria | 1879 |
| 127 | Ga0070707_100236424 | 3300005468 | Bacteria | 1778 |
| 128 | Ga0070707_100312962 | 3300005468 | Bacteria | 1526 |
| 129 | Ga0070698_100029132 | 3300005471 | Bacteria | 5730 |
| 130 | Ga0070698_100120039 | 3300005471 | Bacteria | 2589 |
| 131 | Ga0070698_100317315 | 3300005471 | Bacteria | 1489 |
| 132 | Ga0070698_100411619 | 3300005471 | Bacteria | 1286 |
| 133 | Ga0070699_100000609 | 3300005518 | Bacteria | 33774 |
| 134 | Ga0070699_100114745 | 3300005518 | Bacteria | 2367 |
| 135 | Ga0070699_100198445 | 3300005518 | Bacteria | 1784 |
| 136 | Ga0070699_100200939 | 3300005518 | Bacteria | 1772 |
| 137 | Ga0070699_100437520 | 3300005518 | Bacteria | 1185 |
| 138 | Ga0070699_100679677 | 3300005518 | Bacteria | 940 |
| 139 | Ga0070679_100004895 | 3300005530 | Bacteria | 12348 |
| 140 | Ga0070679_100030304 | 3300005530 | Bacteria | 5342 |
| 141 | Ga0070679_100061552 | 3300005530 | Bacteria | 3741 |
| 142 | Ga0070679_100083819 | 3300005530 | Bacteria | 3176 |
| 143 | Ga0070679_100099185 | 3300005530 | Bacteria | 2900 |
| 144 | Ga0070679_100680949 | 3300005530 | Bacteria | 971 |
| 145 | Ga0070684_100004958 | 3300005535 | Bacteria | 10160 |
| 146 | Ga0070684_100007487 | 3300005535 | Bacteria | 8493 |
| 147 | Ga0070697_100097123 | 3300005536 | Bacteria | 2444 |
| 148 | Ga0070697_100169803 | 3300005536 | Bacteria | 1845 |
| 149 | Ga0070697_100397572 | 3300005536 | Bacteria | 1195 |
| 150 | Ga0068853_100010479 | 3300005539 | Bacteria | 7498 |
| 151 | Ga0068853_100216191 | 3300005539 | Bacteria | 1749 |
| 152 | Ga0068853_100544297 | 3300005539 | Bacteria | 1099 |
| 153 | Ga0068853_100818973 | 3300005539 | Bacteria | 892 |
| 154 | Ga0070672_100055270 | 3300005543 | Bacteria | 3110 |
| 155 | Ga0070672_100162396 | 3300005543 | Bacteria | 1854 |
| 156 | Ga0070672_100205843 | 3300005543 | Bacteria | 1647 |
| 157 | Ga0070686_100128124 | 3300005544 | Bacteria | 1752 |
| 158 | Ga0070686_100399486 | 3300005544 | Bacteria | 1045 |
| 159 | Ga0070695_100000971 | 3300005545 | Bacteria | 15573 |
| 160 | Ga0070695_100028466 | 3300005545 | Bacteria | 3467 |
| 161 | Ga0070695_100028673 | 3300005545 | Bacteria | 3455 |
| 162 | Ga0070695_100040252 | 3300005545 | Bacteria | 2958 |
| 163 | Ga0070695_100045287 | 3300005545 | Bacteria | 2803 |
| 164 | Ga0070695_100082325 | 3300005545 | Bacteria | 2131 |
| 165 | Ga0070695_100103725 | 3300005545 | Bacteria | 1919 |
| 166 | Ga0070696_100001450 | 3300005546 | Bacteria | 15525 |
| 167 | Ga0070696_100001822 | 3300005546 | Bacteria | 13993 |
| 168 | Ga0070696_100085690 | 3300005546 | Bacteria | 2236 |
| 169 | Ga0070693_100000746 | 3300005547 | Bacteria | 14361 |
| 170 | Ga0070693_100004829 | 3300005547 | Bacteria | 6426 |
| 171 | Ga0070693_100380270 | 3300005547 | Bacteria | 974 |
| 172 | Ga0070665_100020948 | 3300005548 | Bacteria | 6570 |
| 173 | Ga0070665_100160818 | 3300005548 | Bacteria | 2248 |
| 174 | Ga0070665_100315349 | 3300005548 | Bacteria | 1568 |
| 175 | Ga0070704_100001063 | 3300005549 | Bacteria | 14206 |
| 176 | Ga0070704_100004757 | 3300005549 | Bacteria | 7858 |
| 177 | Ga0070704_100060292 | 3300005549 | Bacteria | 2710 |
| 178 | Ga0070704_100218539 | 3300005549 | Bacteria | 1548 |
| 179 | Ga0068855_100001718 | 3300005563 | Bacteria | 27377 |
| 180 | Ga0068855_100014476 | 3300005563 | Bacteria | 9499 |
| 181 | Ga0068855_100042273 | 3300005563 | Bacteria | 5400 |
| 182 | Ga0068855_100129023 | 3300005563 | Bacteria | 2889 |
| 183 | Ga0068855_100172440 | 3300005563 | Bacteria | 2449 |
| 184 | Ga0068855_100575008 | 3300005563 | Bacteria | 1217 |
| 185 | Ga0070664_100002931 | 3300005564 | Bacteria | 13807 |
| 186 | Ga0070664_100029888 | 3300005564 | Bacteria | 4543 |
| 187 | Ga0068857_100031133 | 3300005577 | Bacteria | 4714 |
| 188 | Ga0068857_100051335 | 3300005577 | Bacteria | 3658 |
| 189 | Ga0068857_100084017 | 3300005577 | Bacteria | 2845 |
| 190 | Ga0068857_100103025 | 3300005577 | Bacteria | 2562 |
| 191 | Ga0068857_100209266 | 3300005577 | Bacteria | 1779 |
| 192 | Ga0068854_100003866 | 3300005578 | Bacteria | 9385 |
| 193 | Ga0068854_100655802 | 3300005578 | Bacteria | 901 |
| 194 | Ga0068856_100002142 | 3300005614 | Bacteria | 20470 |
| 195 | Ga0068856_100011462 | 3300005614 | Bacteria | 8604 |
| 196 | Ga0068856_100156119 | 3300005614 | Bacteria | 2292 |
| 197 | Ga0070702_100000771 | 3300005615 | Bacteria | 12150 |
| 198 | Ga0070702_100178919 | 3300005615 | Bacteria | 1386 |
| 199 | Ga0070702_100742233 | 3300005615 | Bacteria | 753 |
| 200 | Ga0068852_100038297 | 3300005616 | Bacteria | 4029 |
| 201 | Ga0068852_100558397 | 3300005616 | Bacteria | 1146 |
| 202 | Ga0068859_100001597 | 3300005617 | Bacteria | 23138 |
| 203 | Ga0068859_100005571 | 3300005617 | Bacteria | 12828 |
| 204 | Ga0068859_100055540 | 3300005617 | Bacteria | 3985 |
| 205 | Ga0068859_100204859 | 3300005617 | Bacteria | 2058 |
| 206 | Ga0068859_100224910 | 3300005617 | Bacteria | 1965 |
| 207 | Ga0068859_100684711 | 3300005617 | Bacteria | 1116 |
| 208 | Ga0068864_100028986 | 3300005618 | Bacteria | 4683 |
| 209 | Ga0068864_100115669 | 3300005618 | Bacteria | 2392 |
| 210 | Ga0068864_100188249 | 3300005618 | Bacteria | 1890 |
| 211 | Ga0068866_10000362 | 3300005718 | Bacteria | 21390 |
| 212 | Ga0068866_10164802 | 3300005718 | Bacteria | 1296 |
| 213 | Ga0068861_100001160 | 3300005719 | Bacteria | 16414 |
| 214 | Ga0068861_100010779 | 3300005719 | Bacteria | 6354 |
| 215 | Ga0068861_100014550 | 3300005719 | Bacteria | 5523 |
| 216 | Ga0068861_100017163 | 3300005719 | Bacteria | 5133 |
| 217 | Ga0068851_10125978 | 3300005834 | Bacteria | 1381 |
| 218 | Ga0068870_10003097 | 3300005840 | Bacteria | 7015 |
| 219 | Ga0068870_10109163 | 3300005840 | Bacteria | 1577 |
| 220 | Ga0068870_10126731 | 3300005840 | Bacteria | 1478 |
| 221 | Ga0068863_100037848 | 3300005841 | Bacteria | 4591 |
| 222 | Ga0068860_100004116 | 3300005843 | Bacteria | 14897 |
| 223 | Ga0068860_100016914 | 3300005843 | Bacteria | 7108 |
| 224 | Ga0068860_100058303 | 3300005843 | Bacteria | 3670 |
| 225 | Ga0068860_100205916 | 3300005843 | Bacteria | 1908 |
| 226 | Ga0068860_100253941 | 3300005843 | Bacteria | 1713 |
| 227 | Ga0068860_100524568 | 3300005843 | Bacteria | 1184 |
| 228 | Ga0068862_100001395 | 3300005844 | Bacteria | 22389 |
| 229 | Ga0068862_100005139 | 3300005844 | Bacteria | 11002 |
| 230 | Ga0068862_100060263 | 3300005844 | Bacteria | 3259 |
| 231 | Ga0068862_100250144 | 3300005844 | Bacteria | 1615 |
| 232 | Ga0068862_100300280 | 3300005844 | Bacteria | 1477 |
| 233 | Ga0068862_100372021 | 3300005844 | Bacteria | 1330 |
| 234 | Ga0068862_100530238 | 3300005844 | Bacteria | 1122 |
| 235 | Ga0081455_10000079 | 3300005937 | Bacteria | 104277 |
| 236 | Ga0081455_10002810 | 3300005937 | Bacteria | 20504 |
| 237 | Ga0081455_10012998 | 3300005937 | Bacteria | 8253 |
| 238 | Ga0081455_10013137 | 3300005937 | Bacteria | 8207 |
| 239 | Ga0081455_10401277 | 3300005937 | Bacteria | 951 |
| 240 | Ga0081455_10434248 | 3300005937 | Bacteria | 902 |
| 241 | Ga0081538_10004698 | 3300005981 | Bacteria | 12504 |
| 242 | Ga0081538_10015644 | 3300005981 | Bacteria | 5862 |
| 243 | Ga0081540_1000008 | 3300005983 | Bacteria | 203702 |
| 244 | Ga0081540_1000050 | 3300005983 | Bacteria | 126528 |
| 245 | Ga0081540_1004321 | 3300005983 | Bacteria | 10890 |
| 246 | Ga0081540_1034793 | 3300005983 | Bacteria | 2710 |
| 247 | Ga0081539_10000539 | 3300005985 | Bacteria | 78266 |
| 248 | Ga0081539_10001341 | 3300005985 | Bacteria | 42889 |
| 249 | Ga0081539_10012567 | 3300005985 | Bacteria | 6504 |
| 250 | Ga0081539_10014480 | 3300005985 | Bacteria | 5830 |
| 251 | Ga0081539_10057916 | 3300005985 | Bacteria | 2141 |
| 252 | Ga0070717_10016819 | 3300006028 | Bacteria | 5677 |
| 253 | Ga0070717_10054333 | 3300006028 | Bacteria | 3303 |
| 254 | Ga0070717_10213617 | 3300006028 | Bacteria | 1694 |
| 255 | Ga0070717_10326036 | 3300006028 | Bacteria | 1369 |
| 256 | Ga0070717_10344113 | 3300006028 | Bacteria | 1332 |
| 257 | Ga0070717_10344954 | 3300006028 | Bacteria | 1330 |
| 258 | Ga0070717_10743259 | 3300006028 | Bacteria | 892 |
| 259 | Ga0075365_10005144 | 3300006038 | Bacteria | 7027 |
| 260 | Ga0075365_10006887 | 3300006038 | Bacteria | 6307 |
| 261 | Ga0075365_10039270 | 3300006038 | Bacteria | 3081 |
| 262 | Ga0075365_10114416 | 3300006038 | Bacteria | 1856 |
| 263 | Ga0075365_10164756 | 3300006038 | Bacteria | 1546 |
| 264 | Ga0075365_10412065 | 3300006038 | Bacteria | 954 |
| 265 | Ga0075368_10000566 | 3300006042 | Bacteria | 11090 |
| 266 | Ga0075363_100009008 | 3300006048 | Bacteria | 4678 |
| 267 | Ga0075363_100011166 | 3300006048 | Bacteria | 4292 |
| 268 | Ga0075364_10017908 | 3300006051 | Bacteria | 4429 |
| 269 | Ga0075364_10076667 | 3300006051 | Bacteria | 2206 |
| 270 | Ga0075364_10491400 | 3300006051 | Bacteria | 839 |
| 271 | Ga0075432_10060084 | 3300006058 | Bacteria | 1352 |
| 272 | Ga0070715_10190711 | 3300006163 | Bacteria | 1034 |
| 273 | Ga0070716_100022950 | 3300006173 | Bacteria | 3303 |
| 274 | Ga0070716_100283767 | 3300006173 | Bacteria | 1144 |
| 275 | Ga0070712_100022506 | 3300006175 | Bacteria | 4153 |
| 276 | Ga0070712_100082381 | 3300006175 | Bacteria | 2334 |
| 277 | Ga0070712_100340271 | 3300006175 | Bacteria | 1225 |
| 278 | Ga0070712_100696756 | 3300006175 | Bacteria | 866 |
| 279 | Ga0075362_10055905 | 3300006177 | Bacteria | 1775 |
| 280 | Ga0075362_10123507 | 3300006177 | Bacteria | 1227 |
| 281 | Ga0075367_10014031 | 3300006178 | Bacteria | 4327 |
| 282 | Ga0075367_10344917 | 3300006178 | Bacteria | 940 |
| 283 | Ga0075369_10006961 | 3300006186 | Bacteria | 4294 |
| 284 | Ga0075369_10024080 | 3300006186 | Bacteria | 2520 |
| 285 | Ga0075366_10006444 | 3300006195 | Bacteria | 6431 |
| 286 | Ga0075366_10012372 | 3300006195 | Bacteria | 4840 |
| 287 | Ga0075366_10210545 | 3300006195 | Bacteria | 1183 |
| 288 | Ga0097621_100001467 | 3300006237 | Bacteria | 16135 |
| 289 | Ga0097621_100237305 | 3300006237 | Bacteria | 1593 |
| 290 | Ga0075370_10124997 | 3300006353 | Bacteria | 1499 |
| 291 | Ga0068871_100002626 | 3300006358 | Bacteria | 12271 |
| 292 | Ga0068871_100197664 | 3300006358 | Bacteria | 1735 |
| 293 | Ga0068871_100227181 | 3300006358 | Bacteria | 1619 |
| 294 | Ga0075428_100000594 | 3300006844 | Bacteria | 36976 |
| 295 | Ga0075428_100000979 | 3300006844 | Bacteria | 30251 |
| 296 | Ga0075428_100010065 | 3300006844 | Bacteria | 10507 |
| 297 | Ga0075428_100013937 | 3300006844 | Bacteria | 8951 |
| 298 | Ga0075428_100035781 | 3300006844 | Bacteria | 5473 |
| 299 | Ga0075428_100066299 | 3300006844 | Bacteria | 3952 |
| 300 | Ga0075428_100141149 | 3300006844 | Bacteria | 2619 |
| 301 | Ga0075428_100200991 | 3300006844 | Bacteria | 2154 |
| 302 | Ga0075428_100257408 | 3300006844 | Bacteria | 1880 |
| 303 | Ga0075428_100270359 | 3300006844 | Bacteria | 1829 |
| 304 | Ga0075430_100000013 | 3300006846 | Bacteria | 93627 |
| 305 | Ga0075430_100012732 | 3300006846 | Bacteria | 7168 |
| 306 | Ga0075430_100051633 | 3300006846 | Bacteria | 3465 |
| 307 | Ga0075430_100070843 | 3300006846 | Bacteria | 2924 |
| 308 | Ga0075430_100090019 | 3300006846 | Bacteria | 2567 |
| 309 | Ga0075430_100125816 | 3300006846 | Bacteria | 2136 |
| 310 | Ga0075431_100000202 | 3300006847 | Bacteria | 43757 |
| 311 | Ga0075431_100001575 | 3300006847 | Bacteria | 21211 |
| 312 | Ga0075431_100008273 | 3300006847 | Bacteria | 10401 |
| 313 | Ga0075431_100036230 | 3300006847 | Bacteria | 5081 |
| 314 | Ga0075431_100046113 | 3300006847 | Bacteria | 4494 |
| 315 | Ga0075431_100053192 | 3300006847 | Bacteria | 4175 |
| 316 | Ga0075431_100102517 | 3300006847 | Bacteria | 2953 |
| 317 | Ga0075431_100134895 | 3300006847 | Bacteria | 2545 |
| 318 | Ga0075431_100159940 | 3300006847 | Bacteria | 2316 |
| 319 | Ga0075431_100199545 | 3300006847 | Bacteria | 2047 |
| 320 | Ga0075431_100297908 | 3300006847 | Bacteria | 1630 |
| 321 | Ga0075431_100341011 | 3300006847 | Unclassified | 1508 |
| 322 | Ga0075431_100450967 | 3300006847 | Bacteria | 1282 |
| 323 | Ga0075433_10000148 | 3300006852 | Bacteria | 37322 |
| 324 | Ga0075433_10014227 | 3300006852 | Bacteria | 6497 |
| 325 | Ga0075433_10014866 | 3300006852 | Bacteria | 6371 |
| 326 | Ga0075433_10016316 | 3300006852 | Bacteria | 6116 |
| 327 | Ga0075433_10028759 | 3300006852 | Bacteria | 4728 |
| 328 | Ga0075433_10029345 | 3300006852 | Bacteria | 4685 |
| 329 | Ga0075433_10039272 | 3300006852 | Bacteria | 4091 |
| 330 | Ga0075433_10058619 | 3300006852 | Bacteria | 3368 |
| 331 | Ga0075433_10070633 | 3300006852 | Bacteria | 3069 |
| 332 | Ga0075433_10252811 | 3300006852 | Bacteria | 1563 |
| 333 | Ga0075433_10330437 | 3300006852 | Bacteria | 1348 |
| 334 | Ga0075433_10430365 | 3300006852 | Bacteria | 1164 |
| 335 | Ga0075433_10459699 | 3300006852 | Bacteria | 1122 |
| 336 | Ga0075433_10514684 | 3300006852 | Bacteria | 1053 |
| 337 | Ga0075433_10782873 | 3300006852 | Bacteria | 834 |
| 338 | Ga0075434_100000484 | 3300006871 | Bacteria | 29868 |
| 339 | Ga0075434_100006228 | 3300006871 | Bacteria | 10931 |
| 340 | Ga0075434_100016507 | 3300006871 | Bacteria | 7098 |
| 341 | Ga0075434_100029302 | 3300006871 | Bacteria | 5414 |
| 342 | Ga0075434_100044530 | 3300006871 | Bacteria | 4402 |
| 343 | Ga0075434_100049485 | 3300006871 | Bacteria | 4173 |
| 344 | Ga0075434_100059874 | 3300006871 | Bacteria | 3787 |
| 345 | Ga0075434_100089713 | 3300006871 | Bacteria | 3075 |
| 346 | Ga0075434_100092842 | 3300006871 | Bacteria | 3021 |
| 347 | Ga0075434_100107975 | 3300006871 | Bacteria | 2794 |
| 348 | Ga0075434_100170174 | 3300006871 | Bacteria | 2198 |
| 349 | Ga0075434_100353039 | 3300006871 | Bacteria | 1491 |
| 350 | Ga0075429_100000234 | 3300006880 | Bacteria | 38034 |
| 351 | Ga0075429_100002284 | 3300006880 | Bacteria | 16086 |
| 352 | Ga0075429_100008027 | 3300006880 | Bacteria | 9171 |
| 353 | Ga0075429_100011751 | 3300006880 | Bacteria | 7595 |
| 354 | Ga0075429_100052004 | 3300006880 | Bacteria | 3563 |
| 355 | Ga0075429_100075151 | 3300006880 | Bacteria | 2943 |
| 356 | Ga0075429_100562991 | 3300006880 | Bacteria | 999 |
| 357 | Ga0075429_100968039 | 3300006880 | Bacteria | 744 |
| 358 | Ga0068865_100009339 | 3300006881 | Bacteria | 6076 |
| 359 | Ga0068865_100018548 | 3300006881 | Bacteria | 4491 |
| 360 | Ga0068865_100428839 | 3300006881 | Bacteria | 1089 |
| 361 | Ga0075436_100042237 | 3300006914 | Bacteria | 3145 |
| 362 | Ga0075436_100081809 | 3300006914 | Bacteria | 2239 |
| 363 | Ga0075436_100542626 | 3300006914 | Bacteria | 853 |
| 364 | Ga0097620_100001597 | 3300006931 | Bacteria | 23138 |
| 365 | Ga0097620_100005571 | 3300006931 | Bacteria | 12828 |
| 366 | Ga0097620_100055541 | 3300006931 | Bacteria | 3985 |
| 367 | Ga0097620_100204844 | 3300006931 | Bacteria | 2058 |
| 368 | Ga0097620_100224920 | 3300006931 | Bacteria | 1965 |
| 369 | Ga0097620_100684683 | 3300006931 | Bacteria | 1116 |
| 370 | Ga0079104_1000029 | 3300006946 | Bacteria | 207648 |
| 371 | Ga0075435_100011662 | 3300007076 | Bacteria | 6478 |
| 372 | Ga0075435_100017645 | 3300007076 | Bacteria | 5408 |
| 373 | Ga0075435_100044379 | 3300007076 | Bacteria | 3561 |
| 374 | Ga0075435_100052289 | 3300007076 | Bacteria | 3292 |
| 375 | Ga0075435_100177251 | 3300007076 | Bacteria | 1800 |
| 376 | Ga0075435_100180101 | 3300007076 | Bacteria | 1786 |
| 377 | Ga0075435_100191341 | 3300007076 | Bacteria | 1732 |
| 378 | Ga0075435_100318633 | 3300007076 | Bacteria | 1331 |
| 379 | Ga0075435_100494745 | 3300007076 | Bacteria | 1057 |
| 380 | Ga0075435_100593652 | 3300007076 | Bacteria | 960 |
| 381 | Ga0075435_100626184 | 3300007076 | Bacteria | 933 |
| 382 | Ga0099794_10027620 | 3300007265 | Bacteria | 2632 |
| 383 | Ga0099794_10034120 | 3300007265 | Bacteria | 2395 |
| 384 | Ga0099794_10053394 | 3300007265 | Bacteria | 1949 |
| 385 | Ga0099795_10007995 | 3300007788 | Bacteria | 2988 |
| 386 | Ga0105250_10071343 | 3300009092 | Bacteria | 1403 |
| 387 | Ga0105240_10001546 | 3300009093 | Bacteria | 39059 |
| 388 | Ga0105240_10089377 | 3300009093 | Bacteria | 3767 |
| 389 | Ga0105240_10152105 | 3300009093 | Bacteria | 2755 |
| 390 | Ga0105240_11366747 | 3300009093 | Bacteria | 745 |
| 391 | Ga0111539_10000369 | 3300009094 | Bacteria | 55645 |
| 392 | Ga0111539_10000618 | 3300009094 | Bacteria | 46089 |
| 393 | Ga0111539_10000708 | 3300009094 | Bacteria | 43220 |
| 394 | Ga0111539_10010911 | 3300009094 | Bacteria | 11435 |
| 395 | Ga0111539_10161316 | 3300009094 | Bacteria | 2622 |
| 396 | Ga0111539_10447030 | 3300009094 | Bacteria | 1505 |
| 397 | Ga0111539_10625048 | 3300009094 | Bacteria | 1254 |
| 398 | Ga0111539_10906443 | 3300009094 | Bacteria | 1025 |
| 399 | Ga0111539_11297329 | 3300009094 | Bacteria | 845 |
| 400 | Ga0105245_10010838 | 3300009098 | Bacteria | 7933 |
| 401 | Ga0105245_10102050 | 3300009098 | Bacteria | 2656 |
| 402 | Ga0105245_10384068 | 3300009098 | Bacteria | 1399 |
| 403 | Ga0105245_10669958 | 3300009098 | Bacteria | 1069 |
| 404 | Ga0105245_10686995 | 3300009098 | Bacteria | 1056 |
| 405 | Ga0105247_10143054 | 3300009101 | Bacteria | 1569 |
| 406 | Ga0114129_10000329 | 3300009147 | Bacteria | 55412 |
| 407 | Ga0114129_10002660 | 3300009147 | Bacteria | 24854 |
| 408 | Ga0114129_10022171 | 3300009147 | Bacteria | 9016 |
| 409 | Ga0114129_10057223 | 3300009147 | Bacteria | 5458 |
| 410 | Ga0114129_10102283 | 3300009147 | Bacteria | 3963 |
| 411 | Ga0114129_10116199 | 3300009147 | Bacteria | 3687 |
| 412 | Ga0114129_10162752 | 3300009147 | Bacteria | 3047 |
| 413 | Ga0114129_10181800 | 3300009147 | Bacteria | 2860 |
| 414 | Ga0114129_10186767 | 3300009147 | Bacteria | 2816 |
| 415 | Ga0114129_10222673 | 3300009147 | Bacteria | 2545 |
| 416 | Ga0114129_10575640 | 3300009147 | Bacteria | 1462 |
| 417 | Ga0114129_11461295 | 3300009147 | Bacteria | 841 |
| 418 | Ga0105243_10007704 | 3300009148 | Bacteria | 8278 |
| 419 | Ga0105243_10010240 | 3300009148 | Bacteria | 7126 |
| 420 | Ga0105243_10013484 | 3300009148 | Bacteria | 6181 |
| 421 | Ga0105243_10066097 | 3300009148 | Bacteria | 2907 |
| 422 | Ga0105243_11415390 | 3300009148 | Bacteria | 716 |
| 423 | Ga0105241_10000650 | 3300009174 | Bacteria | 26087 |
| 424 | Ga0105241_10032807 | 3300009174 | Bacteria | 3897 |
| 425 | Ga0105241_10054961 | 3300009174 | Bacteria | 3049 |
| 426 | Ga0105241_10234205 | 3300009174 | Bacteria | 1549 |
| 427 | Ga0105241_10413696 | 3300009174 | Bacteria | 1185 |
| 428 | Ga0105242_10006783 | 3300009176 | Bacteria | 8827 |
| 429 | Ga0105242_10021028 | 3300009176 | Bacteria | 5119 |
| 430 | Ga0105242_10153506 | 3300009176 | Bacteria | 2010 |
| 431 | Ga0105242_10423201 | 3300009176 | Bacteria | 1248 |
| 432 | Ga0105248_10255360 | 3300009177 | Bacteria | 1973 |
| 433 | Ga0105248_10329846 | 3300009177 | Bacteria | 1719 |
| 434 | Ga0105248_11730123 | 3300009177 | Bacteria | 709 |
| 435 | Ga0105237_10666232 | 3300009545 | Bacteria | 1047 |
| 436 | Ga0105238_10259967 | 3300009551 | Bacteria | 1715 |
| 437 | Ga0105238_11078645 | 3300009551 | Bacteria | 825 |
| 438 | Ga0105249_10013784 | 3300009553 | Bacteria | 7142 |
| 439 | Ga0105249_10020999 | 3300009553 | Bacteria | 5843 |
| 440 | Ga0105249_10071214 | 3300009553 | Bacteria | 3211 |
| 441 | Ga0105249_10669422 | 3300009553 | Bacteria | 1096 |
| 442 | Ga0099796_10002974 | 3300010159 | Bacteria | 3841 |
| 443 | Ga0099796_10066010 | 3300010159 | Bacteria | 1295 |
| 444 | Ga0105239_10103625 | 3300010375 | Bacteria | 3149 |
| 445 | Ga0105239_10435888 | 3300010375 | Bacteria | 1485 |
| 446 | Ga0105239_10949687 | 3300010375 | Bacteria | 987 |
| 447 | Ga0105239_11080591 | 3300010375 | Unclassified | 923 |
| 448 | Ga0105246_10122543 | 3300011119 | Bacteria | 1929 |
| 449 | Ga0105246_10474005 | 3300011119 | Bacteria | 1057 |
| 450 | Ga0157373_10005062 | 3300013100 | Bacteria | 9904 |
| 451 | Ga0157373_10167085 | 3300013100 | Bacteria | 1548 |
| 452 | Ga0157373_10260566 | 3300013100 | Bacteria | 1227 |
| 453 | Ga0157373_10364009 | 3300013100 | Bacteria | 1033 |
| 454 | Ga0157371_10003256 | 3300013102 | Bacteria | 14890 |
| 455 | Ga0157371_10021200 | 3300013102 | Bacteria | 4773 |
| 456 | Ga0157369_10015753 | 3300013105 | Bacteria | 8518 |
| 457 | Ga0157369_10096375 | 3300013105 | Bacteria | 3156 |
| 458 | Ga0157369_10216403 | 3300013105 | Bacteria | 2006 |
| 459 | Ga0157369_10326879 | 3300013105 | Bacteria | 1593 |
| 460 | Ga0157369_10509830 | 3300013105 | Bacteria | 1244 |
| 461 | Ga0157378_10003376 | 3300013297 | Bacteria | 14197 |
| 462 | Ga0157378_10018011 | 3300013297 | Bacteria | 6201 |
| 463 | Ga0157378_10080417 | 3300013297 | Bacteria | 2944 |
| 464 | Ga0157378_10423874 | 3300013297 | Bacteria | 1316 |
| 465 | Ga0163162_10107534 | 3300013306 | Bacteria | 2885 |
| 466 | Ga0157372_10000746 | 3300013307 | Bacteria | 35404 |
| 467 | Ga0157375_10090194 | 3300013308 | Bacteria | 3123 |
| 468 | Ga0157375_10150256 | 3300013308 | Bacteria | 2464 |
| 469 | Ga0163163_10002136 | 3300014325 | Bacteria | 16698 |
| 470 | Ga0163163_10078397 | 3300014325 | Bacteria | 3300 |
| 471 | Ga0163163_10154967 | 3300014325 | Bacteria | 2335 |
| 472 | Ga0163163_10793784 | 3300014325 | Bacteria | 1010 |
| 473 | Ga0163163_11076815 | 3300014325 | Bacteria | 867 |
| 474 | Ga0157380_10018569 | 3300014326 | Bacteria | 5163 |
| 475 | Ga0157380_10025645 | 3300014326 | Bacteria | 4471 |
| 476 | Ga0157380_10168602 | 3300014326 | Bacteria | 1910 |
| 477 | Ga0157380_10212947 | 3300014326 | Bacteria | 1723 |
| 478 | Ga0157380_10490032 | 3300014326 | Bacteria | 1191 |
| 479 | Ga0157380_11166404 | 3300014326 | Bacteria | 812 |
| 480 | Ga0182008_10144325 | 3300014497 | Bacteria | 1192 |
| 481 | Ga0157377_10086971 | 3300014745 | Bacteria | 1838 |
| 482 | Ga0157377_10218316 | 3300014745 | Bacteria | 1219 |
| 483 | Ga0157377_10236029 | 3300014745 | Bacteria | 1178 |
| 484 | Ga0157377_10297617 | 3300014745 | Bacteria | 1064 |
| 485 | Ga0157379_10107425 | 3300014968 | Bacteria | 2505 |
| 486 | Ga0157379_10199932 | 3300014968 | Bacteria | 1807 |
| 487 | Ga0157376_10003105 | 3300014969 | Bacteria | 11411 |
| 488 | Ga0157376_10019126 | 3300014969 | Bacteria | 5271 |
| 489 | Ga0157376_11235141 | 3300014969 | Bacteria | 776 |
| 490 | Ga0163161_10016668 | 3300017792 | Bacteria | 5133 |
| 491 | Ga0163161_10304459 | 3300017792 | Bacteria | 1256 |
| 492 | Ga0163161_10527199 | 3300017792 | Bacteria | 965 |
| 493 | Ga0213874_10087740 | 3300021377 | Bacteria | 1017 |
| 494 | Ga0213876_10005637 | 3300021384 | Bacteria | 6874 |
| 495 | Ga0213876_10026057 | 3300021384 | Bacteria | 3084 |
| 496 | Ga0213876_10152283 | 3300021384 | Bacteria | 1230 |
| 497 | Ga0213876_10183412 | 3300021384 | Bacteria | 1113 |
| 498 | Ga0213875_10021851 | 3300021388 | Bacteria | 3062 |
| 499 | Ga0213875_10029465 | 3300021388 | Bacteria | 2604 |
| 500 | Ga0224572_1008475 | 3300024225 | Bacteria | 1901 |
| 501 | Ga0209564_1000043 | 3300025295 | Bacteria | 388153 |
| 502 | Ga0209758_1007690 | 3300025297 | Bacteria | 7243 |
| 503 | Ga0209256_1000545 | 3300025299 | Bacteria | 54076 |
| 504 | Ga0207697_10081000 | 3300025315 | Bacteria | 1368 |
| 505 | Ga0207656_10044224 | 3300025321 | Bacteria | 1901 |
| 506 | Ga0207653_10008773 | 3300025885 | Bacteria | 3151 |
| 507 | Ga0207653_10034067 | 3300025885 | Bacteria | 1653 |
| 508 | Ga0207653_10117875 | 3300025885 | Bacteria | 953 |
| 509 | Ga0207682_10037193 | 3300025893 | Bacteria | 1971 |
| 510 | Ga0207692_10001508 | 3300025898 | Bacteria | 8753 |
| 511 | Ga0207692_10226036 | 3300025898 | Bacteria | 1112 |
| 512 | Ga0207692_10330136 | 3300025898 | Bacteria | 935 |
| 513 | Ga0207642_10007999 | 3300025899 | Bacteria | 3602 |
| 514 | Ga0207710_10015448 | 3300025900 | Bacteria | 3226 |
| 515 | Ga0207688_10017744 | 3300025901 | Bacteria | 3872 |
| 516 | Ga0207688_10042746 | 3300025901 | Bacteria | 2523 |
| 517 | Ga0207647_10171457 | 3300025904 | Bacteria | 1263 |
| 518 | Ga0207685_10035129 | 3300025905 | Bacteria | 1827 |
| 519 | Ga0207645_10000213 | 3300025907 | Bacteria | 48054 |
| 520 | Ga0207645_10072742 | 3300025907 | Bacteria | 2201 |
| 521 | Ga0207645_10186218 | 3300025907 | Bacteria | 1363 |
| 522 | Ga0207645_10217713 | 3300025907 | Bacteria | 1258 |
| 523 | Ga0207645_10406537 | 3300025907 | Bacteria | 916 |
| 524 | Ga0207643_10000590 | 3300025908 | Bacteria | 23060 |
| 525 | Ga0207643_10051270 | 3300025908 | Bacteria | 2342 |
| 526 | Ga0207643_10093273 | 3300025908 | Bacteria | 1758 |
| 527 | Ga0207705_10111855 | 3300025909 | Bacteria | 2018 |
| 528 | Ga0207684_10004444 | 3300025910 | Bacteria | 13218 |
| 529 | Ga0207684_10092676 | 3300025910 | Bacteria | 2575 |
| 530 | Ga0207684_10901755 | 3300025910 | Bacteria | 743 |
| 531 | Ga0207654_10032445 | 3300025911 | Bacteria | 2886 |
| 532 | Ga0207654_10136129 | 3300025911 | Bacteria | 1561 |
| 533 | Ga0207654_10145300 | 3300025911 | Bacteria | 1517 |
| 534 | Ga0207654_10251154 | 3300025911 | Bacteria | 1185 |
| 535 | Ga0207707_10001151 | 3300025912 | Bacteria | 25082 |
| 536 | Ga0207707_10115966 | 3300025912 | Bacteria | 2340 |
| 537 | Ga0207695_10048203 | 3300025913 | Bacteria | 4501 |
| 538 | Ga0207695_10281923 | 3300025913 | Bacteria | 1555 |
| 539 | Ga0207695_10516225 | 3300025913 | Bacteria | 1076 |
| 540 | Ga0207693_10025358 | 3300025915 | Bacteria | 4701 |
| 541 | Ga0207693_10031529 | 3300025915 | Bacteria | 4188 |
| 542 | Ga0207693_10133729 | 3300025915 | Bacteria | 1949 |
| 543 | Ga0207693_10277980 | 3300025915 | Bacteria | 1312 |
| 544 | Ga0207693_10668429 | 3300025915 | Bacteria | 806 |
| 545 | Ga0207663_10223042 | 3300025916 | Bacteria | 1373 |
| 546 | Ga0207663_10467601 | 3300025916 | Bacteria | 975 |
| 547 | Ga0207663_10605170 | 3300025916 | Bacteria | 861 |
| 548 | Ga0207660_10001357 | 3300025917 | Bacteria | 16423 |
| 549 | Ga0207660_10006875 | 3300025917 | Bacteria | 7367 |
| 550 | Ga0207660_10020025 | 3300025917 | Bacteria | 4483 |
| 551 | Ga0207660_10155678 | 3300025917 | Bacteria | 1759 |
| 552 | Ga0207662_10000065 | 3300025918 | Bacteria | 46256 |
| 553 | Ga0207662_10024979 | 3300025918 | Bacteria | 3439 |
| 554 | Ga0207662_10159902 | 3300025918 | Bacteria | 1438 |
| 555 | Ga0207657_10000300 | 3300025919 | Bacteria | 52449 |
| 556 | Ga0207649_10112049 | 3300025920 | Bacteria | 1825 |
| 557 | Ga0207652_10003563 | 3300025921 | Bacteria | 12843 |
| 558 | Ga0207652_10008730 | 3300025921 | Bacteria | 8155 |
| 559 | Ga0207652_10077220 | 3300025921 | Bacteria | 2906 |
| 560 | Ga0207652_10124613 | 3300025921 | Bacteria | 2294 |
| 561 | Ga0207652_10273087 | 3300025921 | Bacteria | 1525 |
| 562 | Ga0207646_10048348 | 3300025922 | Bacteria | 3813 |
| 563 | Ga0207646_10152643 | 3300025922 | Bacteria | 2083 |
| 564 | Ga0207681_10006788 | 3300025923 | Bacteria | 7018 |
| 565 | Ga0207681_10135091 | 3300025923 | Bacteria | 1829 |
| 566 | Ga0207681_10305383 | 3300025923 | Bacteria | 1260 |
| 567 | Ga0207694_10531429 | 3300025924 | Bacteria | 986 |
| 568 | Ga0207650_10004857 | 3300025925 | Bacteria | 9180 |
| 569 | Ga0207659_10101321 | 3300025926 | Bacteria | 2171 |
| 570 | Ga0207659_10102227 | 3300025926 | Bacteria | 2163 |
| 571 | Ga0207687_10007409 | 3300025927 | Bacteria | 7225 |
| 572 | Ga0207687_10065280 | 3300025927 | Bacteria | 2584 |
| 573 | Ga0207687_10158464 | 3300025927 | Bacteria | 1734 |
| 574 | Ga0207687_10218754 | 3300025927 | Bacteria | 1498 |
| 575 | Ga0207687_10288188 | 3300025927 | Bacteria | 1319 |
| 576 | Ga0207700_10016207 | 3300025928 | Bacteria | 4945 |
| 577 | Ga0207700_10053142 | 3300025928 | Bacteria | 3033 |
| 578 | Ga0207700_10388172 | 3300025928 | Bacteria | 1222 |
| 579 | Ga0207700_10535353 | 3300025928 | Bacteria | 1038 |
| 580 | Ga0207664_10040367 | 3300025929 | Bacteria | 3628 |
| 581 | Ga0207664_10089861 | 3300025929 | Bacteria | 2516 |
| 582 | Ga0207664_10099514 | 3300025929 | Bacteria | 2400 |
| 583 | Ga0207664_10370197 | 3300025929 | Bacteria | 1271 |
| 584 | Ga0207664_10523443 | 3300025929 | Bacteria | 1063 |
| 585 | Ga0207644_10108556 | 3300025931 | Bacteria | 2095 |
| 586 | Ga0207644_10312934 | 3300025931 | Bacteria | 1268 |
| 587 | Ga0207644_10663544 | 3300025931 | Bacteria | 868 |
| 588 | Ga0207690_10002782 | 3300025932 | Bacteria | 10563 |
| 589 | Ga0207690_10180760 | 3300025932 | Bacteria | 1588 |
| 590 | Ga0207690_10495624 | 3300025932 | Bacteria | 987 |
| 591 | Ga0207706_10025916 | 3300025933 | Bacteria | 5250 |
| 592 | Ga0207706_10046485 | 3300025933 | Bacteria | 3842 |
| 593 | Ga0207706_10064455 | 3300025933 | Bacteria | 3226 |
| 594 | Ga0207706_10099603 | 3300025933 | Bacteria | 2557 |
| 595 | Ga0207706_10173754 | 3300025933 | Bacteria | 1893 |
| 596 | Ga0207706_10215971 | 3300025933 | Bacteria | 1680 |
| 597 | Ga0207706_10669012 | 3300025933 | Bacteria | 888 |
| 598 | Ga0207686_10012265 | 3300025934 | Bacteria | 4709 |
| 599 | Ga0207709_10008586 | 3300025935 | Bacteria | 5643 |
| 600 | Ga0207709_10011883 | 3300025935 | Bacteria | 4803 |
| 601 | Ga0207670_10109074 | 3300025936 | Bacteria | 1991 |
| 602 | Ga0207670_10129912 | 3300025936 | Bacteria | 1844 |
| 603 | Ga0207670_10174772 | 3300025936 | Bacteria | 1613 |
| 604 | Ga0207670_10433911 | 3300025936 | Bacteria | 1056 |
| 605 | Ga0207670_10668920 | 3300025936 | Bacteria | 857 |
| 606 | Ga0207670_10796380 | 3300025936 | Bacteria | 787 |
| 607 | Ga0207669_10012946 | 3300025937 | Bacteria | 4123 |
| 608 | Ga0207669_10022230 | 3300025937 | Bacteria | 3365 |
| 609 | Ga0207669_10112591 | 3300025937 | Bacteria | 1827 |
| 610 | Ga0207669_10350158 | 3300025937 | Bacteria | 1141 |
| 611 | Ga0207704_10009642 | 3300025938 | Bacteria | 4669 |
| 612 | Ga0207704_10023649 | 3300025938 | Bacteria | 3315 |
| 613 | Ga0207704_10066243 | 3300025938 | Bacteria | 2266 |
| 614 | Ga0207704_10190072 | 3300025938 | Bacteria | 1493 |
| 615 | Ga0207665_10014564 | 3300025939 | Bacteria | 5178 |
| 616 | Ga0207665_10048759 | 3300025939 | Bacteria | 2844 |
| 617 | Ga0207665_10088398 | 3300025939 | Bacteria | 2143 |
| 618 | Ga0207665_10127531 | 3300025939 | Bacteria | 1803 |
| 619 | Ga0207665_10273598 | 3300025939 | Bacteria | 1255 |
| 620 | Ga0207691_10042527 | 3300025940 | Bacteria | 4188 |
| 621 | Ga0207691_10076264 | 3300025940 | Bacteria | 3021 |
| 622 | Ga0207689_10000257 | 3300025942 | Bacteria | 47544 |
| 623 | Ga0207689_10000438 | 3300025942 | Bacteria | 39053 |
| 624 | Ga0207689_10017442 | 3300025942 | Bacteria | 6076 |
| 625 | Ga0207689_10053222 | 3300025942 | Bacteria | 3335 |
| 626 | Ga0207689_10206082 | 3300025942 | Bacteria | 1624 |
| 627 | Ga0207689_10303975 | 3300025942 | Bacteria | 1322 |
| 628 | Ga0207661_10017221 | 3300025944 | Bacteria | 5344 |
| 629 | Ga0207661_10129668 | 3300025944 | Bacteria | 2158 |
| 630 | Ga0207661_10384137 | 3300025944 | Bacteria | 1271 |
| 631 | Ga0207661_10721792 | 3300025944 | Bacteria | 917 |
| 632 | Ga0207679_10008189 | 3300025945 | Bacteria | 6653 |
| 633 | Ga0207679_10069292 | 3300025945 | Bacteria | 2654 |
| 634 | Ga0207679_10116041 | 3300025945 | Bacteria | 2122 |
| 635 | Ga0207667_10003068 | 3300025949 | Bacteria | 20705 |
| 636 | Ga0207667_10162023 | 3300025949 | Bacteria | 2300 |
| 637 | Ga0207651_10087304 | 3300025960 | Bacteria | 2270 |
| 638 | Ga0207651_10171331 | 3300025960 | Bacteria | 1712 |
| 639 | Ga0207712_10092184 | 3300025961 | Bacteria | 2233 |
| 640 | Ga0207712_10739497 | 3300025961 | Bacteria | 861 |
| 641 | Ga0207712_10792230 | 3300025961 | Bacteria | 833 |
| 642 | Ga0207668_10003050 | 3300025972 | Bacteria | 9818 |
| 643 | Ga0207668_10049211 | 3300025972 | Bacteria | 2896 |
| 644 | Ga0207640_10001086 | 3300025981 | Bacteria | 15053 |
| 645 | Ga0207640_10561431 | 3300025981 | Bacteria | 961 |
| 646 | Ga0207658_10111097 | 3300025986 | Bacteria | 2167 |
| 647 | Ga0207677_10010414 | 3300026023 | Bacteria | 5260 |
| 648 | Ga0207677_10217798 | 3300026023 | Bacteria | 1529 |
| 649 | Ga0207677_10862584 | 3300026023 | Unclassified | 814 |
| 650 | Ga0207639_10005888 | 3300026041 | Bacteria | 8307 |
| 651 | Ga0207678_10071215 | 3300026067 | Bacteria | 2981 |
| 652 | Ga0207678_10164500 | 3300026067 | Bacteria | 1894 |
| 653 | Ga0207678_10218201 | 3300026067 | Bacteria | 1632 |
| 654 | Ga0207678_10497040 | 3300026067 | Bacteria | 1063 |
| 655 | Ga0207708_10000961 | 3300026075 | Bacteria | 21578 |
| 656 | Ga0207708_10002431 | 3300026075 | Bacteria | 13681 |
| 657 | Ga0207708_10010496 | 3300026075 | Bacteria | 6876 |
| 658 | Ga0207708_10018935 | 3300026075 | Bacteria | 5184 |
| 659 | Ga0207708_10168264 | 3300026075 | Bacteria | 1734 |
| 660 | Ga0207702_10002765 | 3300026078 | Bacteria | 16425 |
| 661 | Ga0207702_10126077 | 3300026078 | Bacteria | 2299 |
| 662 | Ga0207702_10222911 | 3300026078 | Bacteria | 1758 |
| 663 | Ga0207641_10094706 | 3300026088 | Bacteria | 2619 |
| 664 | Ga0207641_10181299 | 3300026088 | Bacteria | 1929 |
| 665 | Ga0207641_10757817 | 3300026088 | Bacteria | 959 |
| 666 | Ga0207648_10000210 | 3300026089 | Bacteria | 62827 |
| 667 | Ga0207648_10000854 | 3300026089 | Bacteria | 34339 |
| 668 | Ga0207648_10002687 | 3300026089 | Bacteria | 18922 |
| 669 | Ga0207648_10121925 | 3300026089 | Bacteria | 2292 |
| 670 | Ga0207648_10213670 | 3300026089 | Bacteria | 1713 |
| 671 | Ga0207648_10227268 | 3300026089 | Bacteria | 1659 |
| 672 | Ga0207676_10057909 | 3300026095 | Bacteria | 3054 |
| 673 | Ga0207676_10386272 | 3300026095 | Bacteria | 1304 |
| 674 | Ga0207674_10004234 | 3300026116 | Bacteria | 17311 |
| 675 | Ga0207674_10041274 | 3300026116 | Bacteria | 4773 |
| 676 | Ga0207675_100000473 | 3300026118 | Bacteria | 39053 |
| 677 | Ga0207675_100006447 | 3300026118 | Bacteria | 11111 |
| 678 | Ga0207675_100092764 | 3300026118 | Bacteria | 2840 |
| 679 | Ga0207675_100103181 | 3300026118 | Bacteria | 2687 |
| 680 | Ga0207675_100277917 | 3300026118 | Bacteria | 1626 |
| 681 | Ga0207683_10002061 | 3300026121 | Bacteria | 17777 |
| 682 | Ga0207683_10125234 | 3300026121 | Bacteria | 2309 |
| 683 | Ga0207683_10138240 | 3300026121 | Bacteria | 2194 |
| 684 | Ga0207683_10594669 | 3300026121 | Bacteria | 1024 |
| 685 | Ga0207698_10102855 | 3300026142 | Bacteria | 2372 |
| 686 | Ga0207698_10214236 | 3300026142 | Bacteria | 1735 |
| 687 | Ga0209281_1000118 | 3300027111 | Bacteria | 208448 |
| 688 | Ga0209981_1021656 | 3300027378 | Bacteria | 920 |
| 689 | Ga0210000_1002064 | 3300027462 | Bacteria | 2841 |
| 690 | Ga0210000_1005546 | 3300027462 | Bacteria | 1831 |
| 691 | Ga0209995_1010877 | 3300027471 | Bacteria | 1478 |
| 692 | Ga0209995_1016441 | 3300027471 | Bacteria | 1215 |
| 693 | Ga0209968_1017095 | 3300027526 | Bacteria | 1156 |
| 694 | Ga0209999_1000258 | 3300027543 | Bacteria | 7699 |
| 695 | Ga0209588_1025122 | 3300027671 | Bacteria | 1883 |
| 696 | Ga0209588_1036890 | 3300027671 | Bacteria | 1573 |
| 697 | Ga0209971_1026348 | 3300027682 | Bacteria | 1390 |
| 698 | Ga0209966_1000058 | 3300027695 | Bacteria | 48823 |
| 699 | Ga0209813_10037422 | 3300027866 | Bacteria | 1462 |
| 700 | Ga0209974_10025440 | 3300027876 | Bacteria | 1959 |
| 701 | Ga0207428_10000118 | 3300027907 | Bacteria | 107695 |
| 702 | Ga0207428_10000519 | 3300027907 | Bacteria | 46036 |
| 703 | Ga0207428_10006083 | 3300027907 | Bacteria | 11163 |
| 704 | Ga0207428_10022374 | 3300027907 | Bacteria | 5336 |
| 705 | Ga0207428_10024940 | 3300027907 | Bacteria | 5014 |
| 706 | Ga0207428_10034027 | 3300027907 | Bacteria | 4178 |
| 707 | Ga0207428_10232506 | 3300027907 | Bacteria | 1379 |
| 708 | Ga0268266_10147662 | 3300028379 | Bacteria | 2116 |
| 709 | Ga0268266_10274083 | 3300028379 | Bacteria | 1567 |
| 710 | Ga0268266_10508984 | 3300028379 | Bacteria | 1150 |
| 711 | Ga0268265_10004690 | 3300028380 | Bacteria | 9438 |
| 712 | Ga0268265_10004813 | 3300028380 | Bacteria | 9307 |
| 713 | Ga0268265_10012057 | 3300028380 | Bacteria | 5852 |
| 714 | Ga0268265_10039138 | 3300028380 | Bacteria | 3492 |
| 715 | Ga0268265_11061606 | 3300028380 | Bacteria | 803 |
| 716 | Ga0268264_10059356 | 3300028381 | Bacteria | 3205 |
| 717 | Ga0268264_10243880 | 3300028381 | Bacteria | 1666 |
| 718 | Ga0268264_10282914 | 3300028381 | Bacteria | 1554 |
| 719 | Ga0268264_10669895 | 3300028381 | Bacteria | 1028 |
| 720 | Ga0268264_11175131 | 3300028381 | Bacteria | 776 |
| 721 | Ga0265338_10288969 | 3300028800 | Bacteria | 1195 |
| 722 | Ga0307511_10000964 | 3300030521 | Bacteria | 30506 |
| 723 | Ga0265332_10093416 | 3300031238 | Bacteria | 1271 |
| 724 | Ga0265325_10018690 | 3300031241 | Bacteria | 3843 |
| 725 | Ga0265325_10052246 | 3300031241 | Bacteria | 2099 |
| 726 | Ga0265329_10024025 | 3300031242 | Bacteria | 2025 |
| 727 | Ga0265340_10033586 | 3300031247 | Bacteria | 2553 |
| 728 | Ga0265340_10060264 | 3300031247 | Bacteria | 1818 |
| 729 | Ga0265340_10159291 | 3300031247 | Bacteria | 1026 |
| 730 | Ga0265339_10046918 | 3300031249 | Bacteria | 2373 |
| 731 | Ga0265339_10158103 | 3300031249 | Bacteria | 1142 |
| 732 | Ga0265331_10132943 | 3300031250 | Bacteria | 1134 |
| 733 | Ga0265327_10059193 | 3300031251 | Bacteria | 1963 |
| 734 | Ga0265316_10015448 | 3300031344 | Bacteria | 6676 |
| 735 | Ga0265316_10173583 | 3300031344 | Bacteria | 1607 |
| 736 | Ga0265316_10175146 | 3300031344 | Bacteria | 1599 |
| 737 | Ga0265313_10057900 | 3300031595 | Bacteria | 1827 |
| 738 | Ga0265342_10059052 | 3300031712 | Bacteria | 2266 |
| 739 | Ga0265342_10069012 | 3300031712 | Bacteria | 2065 |
| 740 | Ga0265342_10076058 | 3300031712 | Bacteria | 1947 |
| 741 | Ga0307412_10494182 | 3300031911 | Bacteria | 1017 |
| 742 | Ga0307416_100536624 | 3300032002 | Bacteria | 1241 |
| 743 | Ga0307411_10328622 | 3300032005 | Bacteria | 1238 |
| 744 | Ga0373950_0040159 | 3300034818 | Bacteria | 893 |
| 745 | Ga0373958_0020166 | 3300034819 | Bacteria | 1225 |
| 746 | Ga0373959_0015312 | 3300034820 | Bacteria | 1407 |
| 747 | Ga0373959_0019892 | 3300034820 | Bacteria | 1276 |
| 748 | Ga0373926_0000195 | 3300035083 | Bacteria | 13918 |
| 749 | Ga0373952_0008015 | 3300035092 | Bacteria | 1995 |
| 750 | Ga0373952_0089523 | 3300035092 | Bacteria | 797 |
| 751 | Ga0373932_0005232 | 3300035112 | Bacteria | 3050 |
| 752 | Ga0373932_0017858 | 3300035112 | Bacteria | 1827 |
| 753 | Ga0373936_0000690 | 3300035113 | Bacteria | 11780 |
| 754 | Ga0373939_0003205 | 3300035114 | Bacteria | 3835 |
| 755 | Ga0373939_0020267 | 3300035114 | Bacteria | 1804 |
| 756 | Ga0373939_0020797 | 3300035114 | Bacteria | 1788 |
| 757 | Ga0373939_0030256 | 3300035114 | Bacteria | 1556 |
| 758 | Ga0373939_0030780 | 3300035114 | Bacteria | 1546 |
| 759 | Ga0373941_0009155 | 3300035115 | Bacteria | 2486 |
| 760 | Ga0373941_0028074 | 3300035115 | Bacteria | 1649 |
| 761 | Ga0373941_0057439 | 3300035115 | Bacteria | 1256 |
| 762 | Ga0373945_0031260 | 3300035116 | Bacteria | 1881 |
| 763 | Ga0373945_0128217 | 3300035116 | Bacteria | 1014 |
| 764 | Ga0373960_0002402 | 3300035121 | Bacteria | 4206 |
| 765 | Ga0373960_0056340 | 3300035121 | Unclassified | 1180 |
| 766 | Ga0373943_0001726 | 3300035170 | Bacteria | 9908 |
| 767 | Ga0373943_0014469 | 3300035170 | Bacteria | 3573 |
| 768 | Ga0373943_0123991 | 3300035170 | Unclassified | 1376 |
| 769 | Ga0373946_0002235 | 3300035171 | Bacteria | 6832 |
| 770 | Ga0373946_0116727 | 3300035171 | Bacteria | 1214 |
| 771 | Ga0373961_0014093 | 3300035241 | Bacteria | 2026 |
| 772 | Ga0373961_0038044 | 3300035241 | Bacteria | 1377 |
| 773 | Ga0373962_0008778 | 3300035242 | Bacteria | 2495 |
| 774 | Ga0373962_0038862 | 3300035242 | Bacteria | 1334 |
| 775 | Ga0373931_0003181 | 3300035691 | Bacteria | 7326 |
| 776 | Ga0373931_0008868 | 3300035691 | Bacteria | 4788 |
| 777 | Ga0373931_0009669 | 3300035691 | Bacteria | 4617 |
| 778 | Ga0373931_0029645 | 3300035691 | Bacteria | 2811 |
| 779 | Ga0373931_0061586 | 3300035691 | Bacteria | 2024 |
| 780 | Ga0373931_0160061 | 3300035691 | Bacteria | 1319 |
| 781 | Ga0373935_0005776 | 3300035692 | Bacteria | 7317 |
| 782 | Ga0373935_0011481 | 3300035692 | Bacteria | 5317 |
| 783 | Ga0373935_0054403 | 3300035692 | Bacteria | 2548 |
| 784 | Ga0373935_0103669 | 3300035692 | Bacteria | 1879 |
| 785 | Ga0373935_0252399 | 3300035692 | Bacteria | 1235 |
| 786 | Ga0373935_0335321 | 3300035692 | Bacteria | 1076 |
| 787 | Ga0373927_0004235 | 3300035695 | Bacteria | 10074 |
| 788 | Ga0373927_0103608 | 3300035695 | Bacteria | 1852 |
| 789 | Ga0373927_0165826 | 3300035695 | Bacteria | 1448 |
| 790 | Ga0373933_0386934 | 3300035724 | Bacteria | 911 |
| 791 | Ga0373947_0003323 | 3300035725 | Bacteria | 9531 |
| 792 | Ga0373947_0004079 | 3300035725 | Bacteria | 8598 |
| 793 | Ga0373947_0009876 | 3300035725 | Bacteria | 5480 |
| 794 | Ga0373947_0036819 | 3300035725 | Bacteria | 2902 |
| 795 | Ga0373947_0104588 | 3300035725 | Bacteria | 1783 |
| 796 | Ga0373947_0436590 | 3300035725 | Bacteria | 886 |
| 797 | Ga0373947_0605505 | 3300035725 | Bacteria | 747 |
| 798 | Ga0373937_0054737 | 3300036401 | Bacteria | 3662 |
| 799 | Ga0373937_0288338 | 3300036401 | Bacteria | 1551 |
| 800 | Ga0373937_0518324 | 3300036401 | Bacteria | 1133 |
| 801 | Ga0316584_0096222 | 3300036712 | Bacteria | 2216 |
| 802 | Ga0373925_0003648 | 3300037068 | Bacteria | 11860 |
| 803 | Ga0373925_0008634 | 3300037068 | Bacteria | 7422 |
| 804 | Ga0373925_0062614 | 3300037068 | Bacteria | 2798 |
| 805 | Ga0373925_0080820 | 3300037068 | Bacteria | 2471 |
| 806 | Ga0373925_0769336 | 3300037068 | Bacteria | 794 |
| 807 | Ga0395899_0013907 | 3300037312 | Bacteria | 6146 |
| 808 | Ga0395899_0066534 | 3300037312 | Bacteria | 2646 |
| 809 | Ga0395899_0144741 | 3300037312 | Bacteria | 1688 |
| 810 | Ga0395900_0177284 | 3300037418 | Bacteria | 2167 |
| 811 | Ga0395900_0285319 | 3300037418 | Bacteria | 1641 |
| 812 | Ga0395900_0314098 | 3300037418 | Bacteria | 1549 |
| 813 | Ga0395900_0338071 | 3300037418 | Bacteria | 1482 |
| 814 | Ga0395898_0028788 | 3300037466 | Bacteria | 5568 |
| 815 | Ga0395898_0053657 | 3300037466 | Bacteria | 3937 |
| 816 | Ga0395898_0110566 | 3300037466 | Bacteria | 2634 |
| 817 | Ga0395905_0189564 | 3300037471 | Bacteria | 1929 |
| 818 | Ga0395905_0776267 | 3300037471 | Bacteria | 861 |
| 819 | Ga0436364_0024334 | 3300037853 | Bacteria | 2869 |
| 820 | Ga0436364_0036231 | 3300037853 | Bacteria | 1987 |
| 821 | Ga0436364_0102492 | 3300037853 | Bacteria | 17015 |
| 822 | Ga0436364_0604575 | 3300037853 | Bacteria | 2837 |
| 823 | Ga0436364_1011929 | 3300037853 | Bacteria | 4091 |
| 824 | Ga0436364_1368626 | 3300037853 | Bacteria | 2925 |
| 825 | Ga0395901_0004531 | 3300038443 | Bacteria | 14013 |
| 826 | Ga0395901_0024595 | 3300038443 | Bacteria | 6184 |
| 827 | Ga0395901_0066966 | 3300038443 | Bacteria | 3740 |
| 828 | Ga0395901_0373912 | 3300038443 | Bacteria | 1467 |
| 829 | Ga0436365_0079845 | 3300039437 | Bacteria | 4018 |
| 830 | Ga0436365_0116924 | 3300039437 | Bacteria | 1279 |
| 831 | Ga0436365_0129764 | 3300039437 | Bacteria | 1748 |
| 832 | Ga0436365_0356319 | 3300039437 | Bacteria | 21022 |
| 833 | Ga0436365_0449923 | 3300039437 | Unclassified | 894 |
| 834 | Ga0436365_0653192 | 3300039437 | Bacteria | 2205 |
| 835 | Ga0436365_0763573 | 3300039437 | Bacteria | 1821 |
| 836 | Ga0436365_1191589 | 3300039437 | Bacteria | 754 |
| 837 | Ga0436365_1712439 | 3300039437 | Bacteria | 1071 |
| 838 | Ga0436365_1731595 | 3300039437 | Bacteria | 1714 |
| 839 | Ga0436360_0485582 | 3300039438 | Bacteria | 1626 |
| 840 | Ga0436360_0638353 | 3300039438 | Bacteria | 2264 |
| 841 | Ga0436360_0878352 | 3300039438 | Bacteria | 1579 |
| 842 | Ga0436360_1051847 | 3300039438 | Bacteria | 1257 |
| 843 | Ga0436360_1282173 | 3300039438 | Bacteria | 1363 |
| 844 | Ga0436361_0602437 | 3300039447 | Bacteria | 1592 |
| 845 | Ga0436363_0619359 | 3300039450 | Bacteria | 5836 |
| 846 | Ga0436363_0815889 | 3300039450 | Bacteria | 881 |
| 847 | Ga0436363_0858438 | 3300039450 | Bacteria | 947 |
| 848 | Ga0439453_0005684 | 3300041408 | Bacteria | 1908 |
| 849 | Ga0439465_0077408 | 3300041413 | Bacteria | 1123 |
| 850 | Ga0451807_2679455 | 3300041486 | Bacteria | 2972 |
| 851 | Ga0451853_2031171 | 3300041512 | Bacteria | 1099 |
| 852 | Ga0439441_009658 | 3300042001 | Bacteria | 1603 |
| 853 | Ga0439441_013424 | 3300042001 | Bacteria | 1421 |
| 854 | Ga0439441_025781 | 3300042001 | Bacteria | 1112 |
| 855 | Ga0439443_000435 | 3300042003 | Bacteria | 3627 |
| 856 | Ga0439448_0000722 | 3300042005 | Bacteria | 7963 |
| 857 | Ga0439463_012567 | 3300042016 | Bacteria | 2083 |
| 858 | Ga0450923_041328 | 3300042125 | Bacteria | 970 |
| 859 | Ga0439458_0001256 | 3300042157 | Bacteria | 6398 |
| 860 | Ga0439435_0007496 | 3300042436 | Bacteria | 2497 |
| 861 | Ga0439460_0010765 | 3300042461 | Bacteria | 2348 |
| 862 | Ga0451577_0002781 | 3300042876 | Bacteria | 20227 |
| 863 | Ga0451577_0009822 | 3300042876 | Bacteria | 9170 |
| 864 | Ga0451577_0102161 | 3300042876 | Bacteria | 2562 |
| 865 | Ga0451577_0155692 | 3300042876 | Bacteria | 2057 |
| 866 | Ga0451577_0756551 | 3300042876 | Bacteria | 879 |
| 867 | Ga0453684_0027486 | 3300044712 | Bacteria | 8157 |
| 868 | Ga0453684_0194743 | 3300044712 | Bacteria | 2368 |
| 869 | Ga0466968_0142555 | 3300044735 | Bacteria | 1097 |
| 870 | Ga0466959_0132286 | 3300045049 | Bacteria | 1768 |
| 871 | Ga0451576_0000675 | 3300045051 | Bacteria | 69506 |
| 872 | Ga0451576_0001560 | 3300045051 | Bacteria | 38618 |
| 873 | Ga0451576_0016703 | 3300045051 | Bacteria | 8095 |
| 874 | Ga0451576_0020927 | 3300045051 | Bacteria | 7119 |
| 875 | Ga0451576_0039924 | 3300045051 | Bacteria | 4968 |
| 876 | Ga0451576_0210373 | 3300045051 | Bacteria | 2031 |
| 877 | Ga0495603_0032349 | 3300046455 | Bacteria | 3147 |
| 878 | Ga0495603_0042369 | 3300046455 | Bacteria | 2721 |
| 879 | Ga0495591_022367 | 3300046458 | Bacteria | 2045 |
| 880 | Ga0495638_0012261 | 3300046460 | Bacteria | 5882 |
| 881 | Ga0495638_0100790 | 3300046460 | Bacteria | 1727 |
| 882 | Ga0495638_0106886 | 3300046460 | Bacteria | 1667 |
| 883 | Ga0495638_0127966 | 3300046460 | Bacteria | 1495 |
| 884 | Ga0495638_0133139 | 3300046460 | Bacteria | 1458 |
| 885 | Ga0495580_0001101 | 3300046472 | Bacteria | 23723 |
| 886 | Ga0495580_0002735 | 3300046472 | Bacteria | 15211 |
| 887 | Ga0495580_0214433 | 3300046472 | Bacteria | 1324 |
| 888 | Ga0495582_0032106 | 3300046473 | Bacteria | 2889 |
| 889 | Ga0495605_0017300 | 3300046474 | Bacteria | 3886 |
| 890 | Ga0495662_0053818 | 3300046476 | Bacteria | 1944 |
| 891 | Ga0495584_0021909 | 3300046491 | Bacteria | 3244 |
| 892 | Ga0495584_0172803 | 3300046491 | Bacteria | 1098 |
| 893 | Ga0495585_0005753 | 3300046492 | Bacteria | 7777 |
| 894 | Ga0495596_0005581 | 3300046500 | Bacteria | 5914 |
| 895 | Ga0495607_0051144 | 3300046501 | Bacteria | 2401 |
| 896 | Ga0495607_0154453 | 3300046501 | Bacteria | 1172 |
| 897 | Ga0495606_0035406 | 3300046507 | Bacteria | 3412 |
| 898 | Ga0495610_0025112 | 3300046512 | Bacteria | 3205 |
| 899 | Ga0495616_0012462 | 3300046513 | Bacteria | 4827 |
| 900 | Ga0495616_0057445 | 3300046513 | Bacteria | 1918 |
| 901 | Ga0495620_0103105 | 3300046515 | Bacteria | 1136 |
| 902 | Ga0495630_0264030 | 3300046517 | Bacteria | 1315 |
| 903 | Ga0495631_0041424 | 3300046518 | Bacteria | 2038 |
| 904 | Ga0495632_0135841 | 3300046519 | Bacteria | 1143 |
| 905 | Ga0495637_0032492 | 3300046520 | Bacteria | 2298 |
| 906 | Ga0495643_0030338 | 3300046522 | Bacteria | 3020 |
| 907 | Ga0495644_0001773 | 3300046523 | Bacteria | 8705 |
| 908 | Ga0495648_0028648 | 3300046524 | Bacteria | 3706 |
| 909 | Ga0495648_0202072 | 3300046524 | Bacteria | 994 |
| 910 | Ga0495663_0001218 | 3300046525 | Bacteria | 8268 |
| 911 | Ga0495663_0039050 | 3300046525 | Bacteria | 1437 |
| 912 | Ga0495666_0001865 | 3300046526 | Bacteria | 10400 |
| 913 | Ga0495642_0045202 | 3300046528 | Bacteria | 1800 |
| 914 | Ga0495642_0049393 | 3300046528 | Bacteria | 1728 |
| 915 | Ga0495654_0001080 | 3300046530 | Bacteria | 19872 |
| 916 | Ga0495654_0033331 | 3300046530 | Bacteria | 2607 |
| 917 | Ga0495654_0045976 | 3300046530 | Bacteria | 2152 |
| 918 | Ga0495640_0161037 | 3300046533 | Bacteria | 1438 |
| 919 | Ga0495640_0238574 | 3300046533 | Bacteria | 1142 |
| 920 | Ga0495586_0007994 | 3300046535 | Bacteria | 5642 |
| 921 | Ga0495598_0000982 | 3300046537 | Bacteria | 5491 |
| 922 | Ga0495598_0045429 | 3300046537 | Bacteria | 1301 |
| 923 | Ga0495609_0011376 | 3300046538 | Bacteria | 4240 |
| 924 | Ga0495597_0178523 | 3300046542 | Unclassified | 859 |
| 925 | Ga0495645_0606382 | 3300046543 | Bacteria | 673 |
| 926 | Ga0495622_0037855 | 3300046557 | Bacteria | 2246 |
| 927 | Ga0495633_0031180 | 3300046558 | Bacteria | 2587 |
| 928 | Ga0495656_0007268 | 3300046615 | Bacteria | 3907 |
| 929 | Ga0495668_0019509 | 3300046616 | Bacteria | 3907 |
| 930 | Ga0495611_0005578 | 3300046648 | Bacteria | 5369 |
| 931 | Ga0495659_0009620 | 3300046664 | Bacteria | 3090 |
| 932 | Ga0495659_0087804 | 3300046664 | Bacteria | 1190 |
| 933 | Ga0495661_0019091 | 3300046665 | Bacteria | 4497 |
| 934 | Ga0495661_0035705 | 3300046665 | Bacteria | 3117 |
| 935 | Ga0495588_0014772 | 3300046674 | Bacteria | 3745 |
| 936 | Ga0495588_0016816 | 3300046674 | Bacteria | 3540 |
| 937 | Ga0495657_0182727 | 3300046675 | Bacteria | 1286 |
| 938 | Ga0495647_0000948 | 3300046681 | Bacteria | 8744 |
| 939 | Ga0495658_0010802 | 3300046683 | Bacteria | 4573 |
| 940 | Ga0495658_0067177 | 3300046683 | Bacteria | 2073 |
| 941 | Ga0495658_0293597 | 3300046683 | Bacteria | 1027 |
| 942 | Ga0495669_0007268 | 3300046684 | Bacteria | 4639 |
| 943 | Ga0495669_0021483 | 3300046684 | Bacteria | 2802 |
| 944 | Ga0495669_0091938 | 3300046684 | Bacteria | 1401 |
| 945 | Ga0495624_0140034 | 3300046690 | Bacteria | 1482 |
| 946 | Ga0495670_0021776 | 3300046691 | Bacteria | 3163 |
| 947 | Ga0495670_0036040 | 3300046691 | Bacteria | 2464 |
| 948 | Ga0495671_0006022 | 3300046692 | Bacteria | 7048 |
| 949 | Ga0495671_0023073 | 3300046692 | Bacteria | 3254 |
| 950 | Ga0495649_0026038 | 3300046694 | Bacteria | 3256 |
| 951 | Ga0495660_0065974 | 3300046810 | Bacteria | 1931 |
| 952 | Ga0495636_0058461 | 3300047318 | Bacteria | 1626 |
| 953 | Ga0495674_0218795 | 3300047319 | Unclassified | 1575 |
| 954 | Ga0495672_0087001 | 3300047320 | Bacteria | 1727 |
| 955 | Ga0495676_0007035 | 3300047321 | Bacteria | 10328 |
| 956 | Ga0495676_0019040 | 3300047321 | Bacteria | 6045 |
| 957 | Ga0495676_0025891 | 3300047321 | Bacteria | 5056 |
| 958 | Ga0495687_000388 | 3300047443 | Bacteria | 54492 |
| 959 | Ga0495677_0008087 | 3300047445 | Bacteria | 3905 |
| 960 | Ga0495679_043979 | 3300047446 | Bacteria | 1370 |
| 961 | Ga0495685_024288 | 3300047447 | Bacteria | 2086 |
| 962 | Ga0495684_0143697 | 3300047471 | Bacteria | 1788 |
| 963 | Ga0495686_0009809 | 3300047472 | Bacteria | 6871 |
| 964 | Ga0495615_0001640 | 3300048090 | Bacteria | 3374 |
| 965 | Ga0495626_0025409 | 3300048091 | Bacteria | 2898 |
| 966 | Ga0495626_0109708 | 3300048091 | Bacteria | 1196 |
| 967 | Ga0496100_0017604 | 3300048903 | Bacteria | 4222 |
| 968 | Ga0496100_0097712 | 3300048903 | Bacteria | 2017 |
| 969 | Ga0496100_0124854 | 3300048903 | Bacteria | 1805 |
| 970 | Ga0496100_0472800 | 3300048903 | Unclassified | 963 |
| 971 | Ga0496101_0030581 | 3300048904 | Bacteria | 3777 |
| 972 | Ga0496101_0076772 | 3300048904 | Bacteria | 2461 |
| 973 | Ga0496101_0094815 | 3300048904 | Bacteria | 2225 |
| 974 | Ga0496102_0022924 | 3300048905 | Bacteria | 5537 |
| 975 | Ga0496102_0235500 | 3300048905 | Bacteria | 1726 |
| 976 | Ga0496102_0316762 | 3300048905 | Bacteria | 1470 |
| 977 | Ga0496103_0038473 | 3300048906 | Bacteria | 2935 |
| 978 | Ga0496104_0001994 | 3300048907 | Bacteria | 17714 |
| 979 | Ga0496104_0010317 | 3300048907 | Bacteria | 8340 |
| 980 | Ga0496104_0013248 | 3300048907 | Bacteria | 7432 |
| 981 | Ga0496104_0061181 | 3300048907 | Bacteria | 3569 |
| 982 | Ga0496105_0026267 | 3300048908 | Bacteria | 4749 |
| 983 | Ga0496105_0041867 | 3300048908 | Bacteria | 3775 |
| 984 | Ga0496105_0214395 | 3300048908 | Bacteria | 1569 |
| 985 | Ga0496106_0006348 | 3300048909 | Bacteria | 8757 |
| 986 | Ga0496106_0037466 | 3300048909 | Bacteria | 3628 |
| 987 | Ga0496107_0043856 | 3300048910 | Bacteria | 3214 |
| 988 | Ga0496107_0108783 | 3300048910 | Bacteria | 2036 |
| 989 | Ga0496107_0173346 | 3300048910 | Unclassified | 1601 |
| 990 | Ga0496107_0836229 | 3300048910 | Bacteria | 673 |
| 991 | Ga0496108_0007201 | 3300048911 | Bacteria | 9016 |
| 992 | Ga0496108_0155646 | 3300048911 | Bacteria | 1974 |
| 993 | Ga0496109_0002300 | 3300048912 | Bacteria | 15893 |
| 994 | Ga0496109_0168093 | 3300048912 | Bacteria | 2057 |
| 995 | Ga0496109_0863253 | 3300048912 | Bacteria | 843 |
| 996 | Ga0496110_0008186 | 3300048913 | Bacteria | 8403 |
| 997 | Ga0496110_0011792 | 3300048913 | Bacteria | 7175 |
| 998 | Ga0496110_0026348 | 3300048913 | Bacteria | 4973 |
| 999 | Ga0496110_0226986 | 3300048913 | Bacteria | 1698 |
| 1000 | Ga0496110_0715883 | 3300048913 | Bacteria | 903 |
| 1001 | Ga0496111_0001890 | 3300048914 | Bacteria | 12398 |
| 1002 | Ga0496111_0119894 | 3300048914 | Bacteria | 1943 |
| 1003 | Ga0496112_0001865 | 3300048915 | Bacteria | 16603 |
| 1004 | Ga0496112_0156578 | 3300048915 | Bacteria | 2245 |
| 1005 | Ga0496112_0181169 | 3300048915 | Bacteria | 2071 |
| 1006 | Ga0496112_0563503 | 3300048915 | Bacteria | 1073 |
| 1007 | Ga0496113_0000167 | 3300048916 | Bacteria | 29216 |
| 1008 | Ga0496113_0132216 | 3300048916 | Bacteria | 1959 |
| 1009 | Ga0496113_0175855 | 3300048916 | Bacteria | 1696 |
| 1010 | Ga0496113_0289307 | 3300048916 | Bacteria | 1311 |
| 1011 | Ga0496113_0388762 | 3300048916 | Bacteria | 1120 |
| 1012 | Ga0496114_0051129 | 3300048917 | Bacteria | 3440 |
| 1013 | Ga0496114_0073163 | 3300048917 | Bacteria | 2884 |
| 1014 | Ga0496114_0176244 | 3300048917 | Bacteria | 1866 |
| 1015 | Ga0496114_0187205 | 3300048917 | Bacteria | 1810 |
| 1016 | Ga0496115_0018777 | 3300048918 | Bacteria | 5315 |
| 1017 | Ga0496115_0030258 | 3300048918 | Bacteria | 4258 |
| 1018 | Ga0496115_0038959 | 3300048918 | Bacteria | 3774 |
| 1019 | Ga0496115_0259112 | 3300048918 | Bacteria | 1430 |
| 1020 | Ga0496116_0000026 | 3300048919 | Bacteria | 450803 |
| 1021 | Ga0496116_0013539 | 3300048919 | Bacteria | 6565 |
| 1022 | Ga0496117_0004597 | 3300048920 | Bacteria | 15077 |
| 1023 | Ga0496117_0044695 | 3300048920 | Bacteria | 3206 |
| 1024 | Ga0496117_0092935 | 3300048920 | Bacteria | 1936 |
| 1025 | Ga0496118_0029029 | 3300048921 | Bacteria | 4646 |
| 1026 | Ga0496118_0045851 | 3300048921 | Bacteria | 3406 |
| 1027 | Ga0496118_0086133 | 3300048921 | Bacteria | 2184 |
| 1028 | Ga0496118_0189001 | 3300048921 | Bacteria | 1234 |
| 1029 | Ga0496119_0062440 | 3300048922 | Bacteria | 2220 |
| 1030 | Ga0496119_0203484 | 3300048922 | Bacteria | 1023 |
| 1031 | Ga0496120_0123119 | 3300048923 | Bacteria | 1338 |
| 1032 | Ga0496120_0129526 | 3300048923 | Bacteria | 1294 |
| 1033 | Ga0496121_0001905 | 3300048924 | Bacteria | 33397 |
| 1034 | Ga0496121_0007839 | 3300048924 | Bacteria | 12769 |
| 1035 | Ga0496121_0029508 | 3300048924 | Bacteria | 5070 |
| 1036 | Ga0496121_0276991 | 3300048924 | Bacteria | 1150 |
| 1037 | Ga0496122_0236254 | 3300048925 | Bacteria | 1034 |
| 1038 | Ga0496123_0005272 | 3300048926 | Bacteria | 13107 |
| 1039 | Ga0496123_0052936 | 3300048926 | Bacteria | 2687 |
| 1040 | Ga0496124_0035931 | 3300048927 | Bacteria | 4329 |
| 1041 | Ga0496124_0048988 | 3300048927 | Bacteria | 3606 |
| 1042 | Ga0496124_0061982 | 3300048927 | Bacteria | 3132 |
| 1043 | Ga0496124_0183136 | 3300048927 | Bacteria | 1610 |
| 1044 | Ga0496125_0001573 | 3300048928 | Bacteria | 32538 |
| 1045 | Ga0496125_0085042 | 3300048928 | Bacteria | 2398 |
| 1046 | Ga0496126_0000069 | 3300048929 | Bacteria | 246935 |
| 1047 | Ga0496126_0007545 | 3300048929 | Bacteria | 11901 |
| 1048 | Ga0496126_0048869 | 3300048929 | Bacteria | 3863 |
| 1049 | Ga0501032_0182089 | 3300049569 | Bacteria | 1375 |
| 1050 | Ga0501033_0000666 | 3300049570 | Bacteria | 31758 |
| 1051 | Ga0501033_0055354 | 3300049570 | Bacteria | 2933 |
| 1052 | Ga0501033_0215358 | 3300049570 | Bacteria | 1369 |
| 1053 | Ga0501034_0005553 | 3300049571 | Bacteria | 13753 |
| 1054 | Ga0501034_0077714 | 3300049571 | Bacteria | 3324 |
| 1055 | Ga0501034_0085624 | 3300049571 | Bacteria | 3153 |
| 1056 | Ga0501034_0140789 | 3300049571 | Bacteria | 2392 |
| 1057 | Ga0501036_0001754 | 3300049572 | Bacteria | 16852 |
| 1058 | Ga0501037_0063546 | 3300049573 | Bacteria | 2691 |
| 1059 | Ga0501037_0258359 | 3300049573 | Bacteria | 1217 |
| 1060 | Ga0501037_0485143 | 3300049573 | Bacteria | 840 |
| 1061 | Ga0501037_0578928 | 3300049573 | Bacteria | 755 |
| 1062 | Ga0501038_0002084 | 3300049574 | Bacteria | 18539 |
| 1063 | Ga0501038_0295632 | 3300049574 | Bacteria | 1272 |
| 1064 | Ga0501038_0384572 | 3300049574 | Bacteria | 1088 |
| 1065 | Ga0501039_0011020 | 3300049575 | Bacteria | 6887 |
| 1066 | Ga0501039_0138193 | 3300049575 | Bacteria | 1914 |
| 1067 | Ga0501039_0193256 | 3300049575 | Bacteria | 1600 |
| 1068 | Ga0501039_0458357 | 3300049575 | Bacteria | 1001 |
| 1069 | Ga0501040_0000304 | 3300049576 | Bacteria | 28753 |
| 1070 | Ga0501040_0049568 | 3300049576 | Bacteria | 2871 |
| 1071 | Ga0501040_0121838 | 3300049576 | Bacteria | 1830 |
| 1072 | Ga0501041_0000266 | 3300049577 | Bacteria | 24787 |
| 1073 | Ga0501041_0027096 | 3300049577 | Bacteria | 3452 |
| 1074 | Ga0501041_0093683 | 3300049577 | Bacteria | 1855 |
| 1075 | Ga0501041_0154012 | 3300049577 | Bacteria | 1436 |
| 1076 | Ga0501042_0003926 | 3300049578 | Bacteria | 9409 |
| 1077 | Ga0501042_0027014 | 3300049578 | Bacteria | 4035 |
| 1078 | Ga0501042_0044922 | 3300049578 | Bacteria | 3148 |
| 1079 | Ga0501042_0048605 | 3300049578 | Bacteria | 3025 |
| 1080 | Ga0501043_0013517 | 3300049579 | Bacteria | 6388 |
| 1081 | Ga0501046_0000413 | 3300049580 | Bacteria | 42578 |
| 1082 | Ga0501046_0073066 | 3300049580 | Bacteria | 2662 |
| 1083 | Ga0501048_0007453 | 3300049582 | Bacteria | 8293 |
| 1084 | Ga0501048_0022525 | 3300049582 | Bacteria | 4607 |
| 1085 | Ga0501048_0227559 | 3300049582 | Bacteria | 1323 |
| 1086 | Ga0501048_0410020 | 3300049582 | Bacteria | 969 |
| 1087 | Ga0501067_0019042 | 3300049583 | Bacteria | 3799 |
| 1088 | Ga0501068_0046421 | 3300049584 | Bacteria | 2620 |
| 1089 | Ga0501068_0222188 | 3300049584 | Bacteria | 1201 |
| 1090 | Ga0501068_0578227 | 3300049584 | Bacteria | 731 |
| 1091 | Ga0501070_0045012 | 3300049586 | Bacteria | 3671 |
| 1092 | Ga0501070_0495277 | 3300049586 | Bacteria | 982 |
| 1093 | Ga0501071_0001916 | 3300049587 | Bacteria | 12386 |
| 1094 | Ga0501071_0007364 | 3300049587 | Bacteria | 7217 |
| 1095 | Ga0501072_0003133 | 3300049588 | Bacteria | 12440 |
| 1096 | Ga0501072_0008557 | 3300049588 | Bacteria | 7759 |
| 1097 | Ga0501072_0009222 | 3300049588 | Bacteria | 7498 |
| 1098 | Ga0501072_0010196 | 3300049588 | Bacteria | 7160 |
| 1099 | Ga0501072_0104921 | 3300049588 | Bacteria | 2247 |
| 1100 | Ga0501072_0754948 | 3300049588 | Bacteria | 763 |
| 1101 | Ga0501074_0002421 | 3300049590 | Bacteria | 12998 |
| 1102 | Ga0501074_0299769 | 3300049590 | Bacteria | 1142 |
| 1103 | Ga0501075_0003585 | 3300049591 | Bacteria | 10398 |
| 1104 | Ga0501075_0136695 | 3300049591 | Bacteria | 1867 |
| 1105 | Ga0501076_0001446 | 3300049592 | Bacteria | 15968 |
| 1106 | Ga0501076_0001483 | 3300049592 | Bacteria | 15718 |
| 1107 | Ga0501076_0022711 | 3300049592 | Bacteria | 4824 |
| 1108 | Ga0501076_0022723 | 3300049592 | Bacteria | 4823 |
| 1109 | Ga0501076_0062208 | 3300049592 | Bacteria | 2972 |
| 1110 | Ga0501076_0120017 | 3300049592 | Bacteria | 2129 |
| 1111 | Ga0501076_0479249 | 3300049592 | Bacteria | 1025 |
| 1112 | Ga0501076_0575887 | 3300049592 | Bacteria | 929 |
| 1113 | Ga0501077_0003912 | 3300049593 | Bacteria | 8972 |
| 1114 | Ga0501077_0113475 | 3300049593 | Bacteria | 1718 |
| 1115 | Ga0501077_0393678 | 3300049593 | Bacteria | 885 |
| 1116 | Ga0501238_019607 | 3300049671 | Bacteria | 951 |
| 1117 | Ga0501079_0016515 | 3300049741 | Bacteria | 5638 |
| 1118 | Ga0501079_0017526 | 3300049741 | Bacteria | 5469 |
| 1119 | Ga0501079_0503698 | 3300049741 | Bacteria | 952 |
| 1120 | Ga0501080_0005621 | 3300049742 | Bacteria | 11204 |
| 1121 | Ga0501080_0035001 | 3300049742 | Bacteria | 4689 |
| 1122 | Ga0501081_0039325 | 3300049743 | Bacteria | 3235 |
| 1123 | Ga0501081_0141341 | 3300049743 | Bacteria | 1725 |
| 1124 | Ga0501081_0389709 | 3300049743 | Bacteria | 1030 |
| 1125 | Ga0501083_0096736 | 3300049744 | Bacteria | 1948 |
| 1126 | Ga0501083_0178895 | 3300049744 | Bacteria | 1385 |
| 1127 | Ga0501035_0033015 | 3300049822 | Bacteria | 4707 |
| 1128 | Ga0501035_0351323 | 3300049822 | Bacteria | 1233 |
| 1129 | Ga0501044_0029827 | 3300049823 | Bacteria | 5750 |
| 1130 | Ga0501044_0103882 | 3300049823 | Bacteria | 2856 |
| 1131 | Ga0501044_0194444 | 3300049823 | Bacteria | 1989 |
| 1132 | Ga0501045_0000295 | 3300049824 | Bacteria | 29176 |
| 1133 | Ga0501045_0007168 | 3300049824 | Bacteria | 7734 |
| 1134 | Ga0501045_0072370 | 3300049824 | Bacteria | 2538 |
| 1135 | Ga0501045_0177065 | 3300049824 | Bacteria | 1589 |
| 1136 | nmdc:mga03683_11477_c1 | 3300050489 | Bacteria | 1464 |
| 1137 | nmdc:mga03683_20338_c1 | 3300050489 | Bacteria | 2546 |
| 1138 | nmdc:mga03683_2429_c1 | 3300050489 | Bacteria | 5785 |
| 1139 | nmdc:mga03683_271126_c1 | 3300050489 | Bacteria | 791 |
| 1140 | nmdc:mga03n38_124545_c1 | 3300050490 | Bacteria | 1270 |
| 1141 | nmdc:mga03n38_136051_c1 | 3300050490 | Bacteria | 1223 |
| 1142 | nmdc:mga03n38_17332_c1 | 3300050490 | Bacteria | 2819 |
| 1143 | nmdc:mga00v17_145119_c1 | 3300050491 | Bacteria | 1523 |
| 1144 | nmdc:mga00v17_207742_c1 | 3300050491 | Bacteria | 1267 |
| 1145 | nmdc:mga00v17_240704_c1 | 3300050491 | Bacteria | 1173 |
| 1146 | nmdc:mga00v17_82603_c1 | 3300050491 | Bacteria | 2008 |
| 1147 | nmdc:mga0yw44_1059_c1 | 3300050492 | Bacteria | 10549 |
| 1148 | nmdc:mga0yw44_1573_c1 | 3300050492 | Bacteria | 9152 |
| 1149 | nmdc:mga0yw44_18590_c1 | 3300050492 | Bacteria | 3811 |
| 1150 | nmdc:mga0yw44_230281_c1 | 3300050492 | Bacteria | 1230 |
| 1151 | nmdc:mga0yw44_435161_c1 | 3300050492 | Bacteria | 889 |
| 1152 | nmdc:mga0yw44_8582_c1 | 3300050492 | Bacteria | 2820 |
| 1153 | nmdc:mga0k408_148172_c1 | 3300050493 | Bacteria | 1397 |
| 1154 | nmdc:mga0k408_22647_c1 | 3300050493 | Bacteria | 3539 |
| 1155 | nmdc:mga0k408_75725_c1 | 3300050493 | Bacteria | 1967 |
| 1156 | nmdc:mga06z11_10515_c1 | 3300050494 | Bacteria | 3950 |
| 1157 | nmdc:mga04h51_44764_c1 | 3300050495 | Bacteria | 1461 |
| 1158 | nmdc:mga07m45_176188_c1 | 3300050496 | Bacteria | 1243 |
| 1159 | nmdc:mga05p37_1030425_c1 | 3300050507 | Bacteria | 870 |
| 1160 | nmdc:mga05p37_13349_c1 | 3300050507 | Bacteria | 9840 |
| 1161 | nmdc:mga05p37_18147_c1 | 3300050507 | Bacteria | 8500 |
| 1162 | nmdc:mga05p37_245292_c1 | 3300050507 | Bacteria | 2151 |
| 1163 | nmdc:mga05p37_284177_c1 | 3300050507 | Bacteria | 1972 |
| 1164 | nmdc:mga05p37_350268_c1 | 3300050507 | Bacteria | 1739 |
| 1165 | nmdc:mga05p37_375_c1 | 3300050507 | Bacteria | 48034 |
| 1166 | nmdc:mga05p37_8272_c1 | 3300050507 | Bacteria | 12300 |
| 1167 | nmdc:mga05p37_8460_c1 | 3300050507 | Bacteria | 12167 |
| 1168 | nmdc:mga09592_122_c1 | 3300050508 | Bacteria | 49514 |
| 1169 | nmdc:mga09592_150915_c1 | 3300050508 | Bacteria | 2005 |
| 1170 | nmdc:mga09592_27000_c1 | 3300050508 | Bacteria | 4761 |
| 1171 | nmdc:mga09592_50873_c1 | 3300050508 | Bacteria | 3494 |
| 1172 | nmdc:mga09592_64067_c1 | 3300050508 | Bacteria | 3112 |
| 1173 | nmdc:mga09592_9811_c1 | 3300050508 | Bacteria | 7784 |
| 1174 | nmdc:mga0qj67_12117_c1 | 3300050509 | Bacteria | 6486 |
| 1175 | nmdc:mga0qj67_15530_c1 | 3300050509 | Bacteria | 5766 |
| 1176 | nmdc:mga0qj67_183400_c1 | 3300050509 | Bacteria | 1700 |
| 1177 | nmdc:mga0qj67_3256_c1 | 3300050509 | Bacteria | 11696 |
| 1178 | nmdc:mga0qj67_45584_c1 | 3300050509 | Bacteria | 3460 |
| 1179 | nmdc:mga0qj67_61926_c1 | 3300050509 | Bacteria | 2972 |
| 1180 | nmdc:mga06r32_1168_c1 | 3300050510 | Bacteria | 23647 |
| 1181 | nmdc:mga06r32_152492_c1 | 3300050510 | Bacteria | 2290 |
| 1182 | nmdc:mga06r32_17315_c1 | 3300050510 | Bacteria | 6579 |
| 1183 | nmdc:mga06r32_24989_c1 | 3300050510 | Bacteria | 5550 |
| 1184 | nmdc:mga06r32_30461_c1 | 3300050510 | Bacteria | 5062 |
| 1185 | nmdc:mga06r32_3605_c1 | 3300050510 | Bacteria | 13817 |
| 1186 | nmdc:mga06r32_49808_c1 | 3300050510 | Bacteria | 4007 |
| 1187 | nmdc:mga06r32_4_c1 | 3300050510 | Bacteria | 144637 |
| 1188 | nmdc:mga06r32_54967_c1 | 3300050510 | Bacteria | 3818 |
| 1189 | nmdc:mga06r32_551046_c1 | 3300050510 | Bacteria | 1127 |
| 1190 | nmdc:mga06r32_595302_c1 | 3300050510 | Bacteria | 1077 |
| 1191 | nmdc:mga06r32_96336_c1 | 3300050510 | Bacteria | 2897 |
| 1192 | nmdc:mga08y16_16961_c1 | 3300050511 | Bacteria | 7669 |
| 1193 | nmdc:mga08y16_197018_c1 | 3300050511 | Bacteria | 2088 |
| 1194 | nmdc:mga08y16_247461_c1 | 3300050511 | Bacteria | 1842 |
| 1195 | nmdc:mga08y16_348_c1 | 3300050511 | Bacteria | 41612 |
| 1196 | nmdc:mga08y16_4215_c1 | 3300050511 | Bacteria | 15001 |
| 1197 | nmdc:mga08y16_562411_c1 | 3300050511 | Bacteria | 1153 |
| 1198 | nmdc:mga08y16_756619_c1 | 3300050511 | Bacteria | 967 |
| 1199 | nmdc:mga08y16_8294_c1 | 3300050511 | Bacteria | 10872 |
| 1200 | nmdc:mga08y16_9100_c1 | 3300050511 | Bacteria | 10428 |
| 1201 | nmdc:mga0n895_1039876_c1 | 3300050512 | Bacteria | 798 |
| 1202 | nmdc:mga0n895_162047_c1 | 3300050512 | Bacteria | 2268 |
| 1203 | nmdc:mga0n895_20484_c1 | 3300050512 | Bacteria | 6169 |
| 1204 | nmdc:mga0n895_254848_c1 | 3300050512 | Bacteria | 1781 |
| 1205 | nmdc:mga0n895_33720_c1 | 3300050512 | Bacteria | 4921 |
| 1206 | nmdc:mga0n895_35879_c1 | 3300050512 | Bacteria | 4785 |
| 1207 | nmdc:mga0n895_365520_c1 | 3300050512 | Bacteria | 1461 |
| 1208 | nmdc:mga0n895_367_c1 | 3300050512 | Bacteria | 30485 |
| 1209 | nmdc:mga0n895_392704_c1 | 3300050512 | Bacteria | 1403 |
| 1210 | nmdc:mga0n895_3979_c1 | 3300050512 | Bacteria | 12016 |
| 1211 | nmdc:mga0n895_53331_c1 | 3300050512 | Bacteria | 3974 |
| 1212 | nmdc:mga0n895_95333_c1 | 3300050512 | Bacteria | 2980 |
| 1213 | nmdc:mga0rr50_107633_c1 | 3300050513 | Bacteria | 2201 |
| 1214 | nmdc:mga0rr50_115538_c1 | 3300050513 | Bacteria | 2130 |
| 1215 | nmdc:mga0rr50_12254_c1 | 3300050513 | Bacteria | 5530 |
| 1216 | nmdc:mga0rr50_147498_c2 | 3300050513 | Bacteria | 1277 |
| 1217 | nmdc:mga0rr50_182397_c1 | 3300050513 | Bacteria | 1717 |
| 1218 | nmdc:mga0rr50_2408_c1 | 3300050513 | Bacteria | 10528 |
| 1219 | nmdc:mga0rr50_392515_c1 | 3300050513 | Bacteria | 1171 |
| 1220 | nmdc:mga0rr50_404287_c1 | 3300050513 | Bacteria | 1154 |
| 1221 | nmdc:mga0rr50_895456_c1 | 3300050513 | Bacteria | 757 |
| 1222 | nmdc:mga08x19_194011_c1 | 3300050514 | Bacteria | 1390 |
| 1223 | nmdc:mga08x19_6538_c1 | 3300050514 | Bacteria | 3635 |
| 1224 | nmdc:mga08x19_73342_c1 | 3300050514 | Bacteria | 2234 |
| 1225 | nmdc:mga08x19_86296_c1 | 3300050514 | Bacteria | 2066 |
| 1226 | nmdc:mga0a205_123347_c1 | 3300050515 | Bacteria | 2490 |
| 1227 | nmdc:mga0a205_136101_c1 | 3300050515 | Bacteria | 2357 |
| 1228 | nmdc:mga0a205_159518_c1 | 3300050515 | Bacteria | 2153 |
| 1229 | nmdc:mga0a205_19958_c1 | 3300050515 | Bacteria | 6324 |
| 1230 | nmdc:mga0a205_2122_c1 | 3300050515 | Bacteria | 17397 |
| 1231 | nmdc:mga0a205_32425_c1 | 3300050515 | Bacteria | 5009 |
| 1232 | nmdc:mga0a205_4461_c2 | 3300050515 | Bacteria | 8877 |
| 1233 | nmdc:mga0a205_475509_c1 | 3300050515 | Bacteria | 1108 |
| 1234 | nmdc:mga0a205_545545_c1 | 3300050515 | Bacteria | 1015 |
| 1235 | nmdc:mga0a205_5700_c1 | 3300050515 | Bacteria | 11220 |
| 1236 | nmdc:mga0a205_6561_c1 | 3300050515 | Bacteria | 10523 |
| 1237 | nmdc:mga0a205_66_c1 | 3300050515 | Bacteria | 56771 |
| 1238 | nmdc:mga0sz30_54786_c1 | 3300050516 | Bacteria | 1696 |
| 1239 | nmdc:mga0sz30_73067_c1 | 3300050516 | Bacteria | 1478 |
| 1240 | nmdc:mga0sz30_98511_c1 | 3300050516 | Bacteria | 1276 |
| 1241 | Ga0495601_0167447 | 3300053077 | Bacteria | 1436 |
| 1242 | Ga0495612_0031633 | 3300053078 | Bacteria | 2134 |
| 1243 | Ga0500610_0179717 | 3300053079 | Bacteria | 1037 |
| 1244 | Ga0495655_0000541 | 3300053083 | Bacteria | 6202 |
| 1245 | Ga0495595_0105175 | 3300053084 | Bacteria | 1365 |
| 1246 | Ga0495619_0070046 | 3300053085 | Bacteria | 2345 |
| 1247 | Ga0495619_0486244 | 3300053085 | Bacteria | 849 |
| 1248 | Ga0500578_0063399 | 3300053086 | Bacteria | 2358 |
| 1249 | Ga0500643_031603 | 3300053087 | Bacteria | 1612 |
| 1250 | Ga0500646_0251360 | 3300053090 | Bacteria | 622 |
| 1251 | Ga0500651_0038106 | 3300053093 | Bacteria | 3029 |
| 1252 | Ga0500566_0000118 | 3300053094 | Bacteria | 40914 |
| 1253 | Ga0500641_0002266 | 3300053096 | Bacteria | 6820 |
| 1254 | Ga0500641_0004939 | 3300053096 | Bacteria | 4726 |
| 1255 | Ga0500650_0090972 | 3300053098 | Bacteria | 1428 |
| 1256 | Ga0500555_001804 | 3300053103 | Bacteria | 6390 |
| 1257 | Ga0500556_0000003 | 3300053104 | Bacteria | 679379 |
| 1258 | Ga0500562_035725 | 3300053108 | Bacteria | 1316 |
| 1259 | Ga0500569_006211 | 3300053109 | Bacteria | 2612 |
| 1260 | Ga0500593_002147 | 3300053117 | Bacteria | 7173 |
| 1261 | Ga0500608_000841 | 3300053122 | Bacteria | 11113 |
| 1262 | Ga0500608_084513 | 3300053122 | Bacteria | 1492 |
| 1263 | Ga0500618_000843 | 3300053125 | Bacteria | 16595 |
| 1264 | Ga0500618_036333 | 3300053125 | Bacteria | 1142 |
| 1265 | Ga0500642_0000006 | 3300053130 | Bacteria | 350064 |
| 1266 | Ga0500642_0002570 | 3300053130 | Bacteria | 5354 |
| 1267 | Ga0500652_098908 | 3300053131 | Bacteria | 1219 |
| 1268 | Ga0500655_001113 | 3300053133 | Bacteria | 5133 |
| 1269 | Ga0500658_0074878 | 3300053134 | Bacteria | 1436 |
| 1270 | Ga0500658_0153682 | 3300053134 | Bacteria | 1038 |
| 1271 | Ga0500559_0000284 | 3300053136 | Bacteria | 39133 |
| 1272 | Ga0500568_0006823 | 3300053139 | Bacteria | 5686 |
| 1273 | Ga0500568_0010309 | 3300053139 | Bacteria | 4383 |
| 1274 | Ga0500573_0172471 | 3300053140 | Bacteria | 1168 |
| 1275 | Ga0500574_000110 | 3300053141 | Bacteria | 8867 |
| 1276 | Ga0500577_0010379 | 3300053142 | Bacteria | 2740 |
| 1277 | Ga0500588_0090836 | 3300053146 | Bacteria | 1038 |
| 1278 | Ga0500604_0003713 | 3300053151 | Bacteria | 4083 |
| 1279 | Ga0500604_0006665 | 3300053151 | Bacteria | 3054 |
| 1280 | Ga0500616_0000033 | 3300053153 | Bacteria | 398830 |
| 1281 | Ga0500622_0001548 | 3300053156 | Bacteria | 18205 |
| 1282 | Ga0500627_0074921 | 3300053158 | Bacteria | 1503 |
| 1283 | Ga0500627_0085903 | 3300053158 | Bacteria | 1405 |
| 1284 | Ga0500636_0006124 | 3300053177 | Bacteria | 6906 |
| 1285 | Ga0500645_018432 | 3300053730 | Bacteria | 2180 |
| 1286 | Ga0500552_001175 | 3300053733 | Bacteria | 2480 |
| 1287 | Ga0501084_0010451 | 3300054114 | Bacteria | 7673 |
| 1288 | Ga0501084_0101727 | 3300054114 | Bacteria | 2413 |
| 1289 | Ga0501084_0217747 | 3300054114 | Bacteria | 1611 |
| 1290 | Ga0501084_0523183 | 3300054114 | Bacteria | 1003 |
| 1291 | Ga0501082_0000438 | 3300060353 | Bacteria | 36890 |
| 1292 | Ga0501082_0046888 | 3300060353 | Bacteria | 3724 |
| 1293 | Ga0501082_0082168 | 3300060353 | Bacteria | 2780 |
| 1294 | Ga0530510_0001413 | 3300061734 | Bacteria | 16087 |
| 1295 | Ga0530510_0297194 | 3300061734 | Bacteria | 1208 |
| 1296 | Ga0530510_0297786 | 3300061734 | Unclassified | 1207 |
| 1297 | Ga0530510_0660428 | 3300061734 | Bacteria | 796 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053090 | Ga0500646_0251360 | Ga0500646_0251360_13_603 | 187 |
| 2 | 3300049571 | Ga0501034_0140789 | Ga0501034_0140789_937_1602 | 194 |
| 3 | 3300006880 | Ga0075429_100008027 | Ga0075429_1000080273 | 195 |
| 4 | 3300009094 | Ga0111539_11297329 | Ga0111539_112973292 | 195 |
| 5 | 3300053096 | Ga0500641_0004939 | Ga0500641_0004939_3956_4621 | 195 |
| 6 | 3300006195 | Ga0075366_10210545 | Ga0075366_102105452 | 198 |
| 7 | 3300050493 | nmdc:mga0k408_148172_c1 | nmdc:mga0k408_148172_c1_204_878 | 198 |
| 8 | 3300005441 | Ga0070700_100159024 | Ga0070700_1001590242 | 199 |
| 9 | 3300005844 | Ga0068862_100300280 | Ga0068862_1003002802 | 199 |
| 10 | 3300048910 | Ga0496107_0836229 | Ga0496107_0836229_10_609 | 199 |
| 11 | 3300005615 | Ga0070702_100742233 | Ga0070702_1007422331 | 201 |
| 12 | 3300006852 | Ga0075433_10058619 | Ga0075433_100586193 | 201 |
| 13 | 3300013297 | Ga0157378_10080417 | Ga0157378_100804174 | 201 |
| 14 | 3300025938 | Ga0207704_10190072 | Ga0207704_101900722 | 201 |
| 15 | 3300037312 | Ga0395899_0013907 | Ga0395899_0013907_1658_2332 | 201 |
| 16 | 3300038443 | Ga0395901_0004531 | Ga0395901_0004531_7044_7718 | 201 |
| 17 | 3300046528 | Ga0495642_0045202 | Ga0495642_0045202_845_1507 | 201 |
| 18 | 3300046684 | Ga0495669_0021483 | Ga0495669_0021483_1414_2076 | 201 |
| 19 | 3300050512 | nmdc:mga0n895_254848_c1 | nmdc:mga0n895_254848_c1_430_1092 | 201 |
| 20 | 3300050515 | nmdc:mga0a205_136101_c1 | nmdc:mga0a205_136101_c1_817_1479 | 201 |
| 21 | 3300021384 | Ga0213876_10005637 | Ga0213876_100056377 | 202 |
| 22 | 3300039437 | Ga0436365_0356319 | Ga0436365_0356319_3580_4254 | 202 |
| 23 | 3300049570 | Ga0501033_0055354 | Ga0501033_0055354_136_810 | 202 |
| 24 | 3300005340 | Ga0070689_100219523 | Ga0070689_1002195232 | 203 |
| 25 | 3300006846 | Ga0075430_100070843 | Ga0075430_1000708433 | 203 |
| 26 | 3300006852 | Ga0075433_10016316 | Ga0075433_100163165 | 203 |
| 27 | 3300006871 | Ga0075434_100029302 | Ga0075434_1000293026 | 203 |
| 28 | 3300007076 | Ga0075435_100011662 | Ga0075435_1000116624 | 203 |
| 29 | 3300009147 | Ga0114129_10116199 | Ga0114129_101161993 | 203 |
| 30 | 3300035114 | Ga0373939_0030780 | Ga0373939_0030780_623_1285 | 203 |
| 31 | 3300035242 | Ga0373962_0038862 | Ga0373962_0038862_640_1302 | 203 |
| 32 | 3300046472 | Ga0495580_0002735 | Ga0495580_0002735_1260_1922 | 203 |
| 33 | 3300050508 | nmdc:mga09592_64067_c1 | nmdc:mga09592_64067_c1_1700_2362 | 203 |
| 34 | 3300050509 | nmdc:mga0qj67_61926_c1 | nmdc:mga0qj67_61926_c1_240_902 | 203 |
| 35 | 3300050514 | nmdc:mga08x19_73342_c1 | nmdc:mga08x19_73342_c1_417_1079 | 203 |
| 36 | 3300049671 | Ga0501238_019607 | Ga0501238_019607_327_941 | 204 |
| 37 | 3300049822 | Ga0501035_0351323 | Ga0501035_0351323_289_924 | 204 |
| 38 | 3300021377 | Ga0213874_10087740 | Ga0213874_100877402 | 206 |
| 39 | 3300039450 | Ga0436363_0619359 | Ga0436363_0619359_4922_5596 | 206 |
| 40 | 3300046519 | Ga0495632_0135841 | Ga0495632_0135841_10_630 | 206 |
| 41 | 3300048922 | Ga0496119_0203484 | Ga0496119_0203484_13_633 | 206 |
| 42 | 3300006038 | Ga0075365_10114416 | Ga0075365_101144162 | 207 |
| 43 | 3300006186 | Ga0075369_10024080 | Ga0075369_100240803 | 207 |
| 44 | 3300006353 | Ga0075370_10124997 | Ga0075370_101249972 | 207 |
| 45 | 3300046557 | Ga0495622_0037855 | Ga0495622_0037855_1093_1752 | 207 |
| 46 | 3300048919 | Ga0496116_0013539 | Ga0496116_0013539_1015_1674 | 207 |
| 47 | 3300048920 | Ga0496117_0004597 | Ga0496117_0004597_4424_5083 | 207 |
| 48 | 3300048921 | Ga0496118_0086133 | Ga0496118_0086133_690_1349 | 207 |
| 49 | 3300048927 | Ga0496124_0061982 | Ga0496124_0061982_923_1582 | 207 |
| 50 | 3300048928 | Ga0496125_0085042 | Ga0496125_0085042_1392_2051 | 207 |
| 51 | 3300050490 | nmdc:mga03n38_124545_c1 | nmdc:mga03n38_124545_c1_264_923 | 207 |
| 52 | 3300050492 | nmdc:mga0yw44_8582_c1 | nmdc:mga0yw44_8582_c1_1156_1815 | 207 |
| 53 | 3300053094 | Ga0500566_0000118 | Ga0500566_0000118_956_1615 | 207 |
| 54 | 3300053122 | Ga0500608_084513 | Ga0500608_084513_785_1444 | 207 |
| 55 | 3300053136 | Ga0500559_0000284 | Ga0500559_0000284_35538_36197 | 207 |
| 56 | 3300005331 | Ga0070670_100368524 | Ga0070670_1003685242 | 208 |
| 57 | 3300005518 | Ga0070699_100198445 | Ga0070699_1001984452 | 208 |
| 58 | 3300005985 | Ga0081539_10012567 | Ga0081539_100125674 | 208 |
| 59 | 3300005985 | Ga0081539_10014480 | Ga0081539_100144809 | 208 |
| 60 | 3300010159 | Ga0099796_10066010 | Ga0099796_100660101 | 208 |
| 61 | 3300035725 | Ga0373947_0104588 | Ga0373947_0104588_918_1583 | 208 |
| 62 | 3300037068 | Ga0373925_0080820 | Ga0373925_0080820_1833_2459 | 208 |
| 63 | 3300039450 | Ga0436363_0858438 | Ga0436363_0858438_180_845 | 208 |
| 64 | 3300041413 | Ga0439465_0077408 | Ga0439465_0077408_195_860 | 208 |
| 65 | 3300046543 | Ga0495645_0606382 | Ga0495645_0606382_24_650 | 208 |
| 66 | 3300046665 | Ga0495661_0035705 | Ga0495661_0035705_13_639 | 208 |
| 67 | 3300046691 | Ga0495670_0021776 | Ga0495670_0021776_2524_3150 | 208 |
| 68 | 3300049588 | Ga0501072_0754948 | Ga0501072_0754948_121_747 | 208 |
| 69 | 3300053134 | Ga0500658_0074878 | Ga0500658_0074878_785_1420 | 208 |
| 70 | 3300005436 | Ga0070713_100132883 | Ga0070713_1001328833 | 210 |
| 71 | 3300005437 | Ga0070710_10247894 | Ga0070710_102478942 | 210 |
| 72 | 3300006175 | Ga0070712_100340271 | Ga0070712_1003402712 | 210 |
| 73 | 3300006852 | Ga0075433_10330437 | Ga0075433_103304372 | 210 |
| 74 | 3300006871 | Ga0075434_100089713 | Ga0075434_1000897134 | 210 |
| 75 | 3300007076 | Ga0075435_100052289 | Ga0075435_1000522894 | 210 |
| 76 | 3300025928 | Ga0207700_10053142 | Ga0207700_100531422 | 210 |
| 77 | 3300049571 | Ga0501034_0005553 | Ga0501034_0005553_12109_12786 | 210 |
| 78 | 3300050512 | nmdc:mga0n895_3979_c1 | nmdc:mga0n895_3979_c1_10586_11248 | 210 |
| 79 | 3300050515 | nmdc:mga0a205_159518_c1 | nmdc:mga0a205_159518_c1_924_1586 | 210 |
| 80 | 3300005844 | Ga0068862_100250144 | Ga0068862_1002501442 | 211 |
| 81 | 3300006844 | Ga0075428_100257408 | Ga0075428_1002574082 | 211 |
| 82 | 3300006852 | Ga0075433_10014866 | Ga0075433_100148667 | 211 |
| 83 | 3300006871 | Ga0075434_100092842 | Ga0075434_1000928424 | 211 |
| 84 | 3300006871 | Ga0075434_100107975 | Ga0075434_1001079752 | 211 |
| 85 | 3300007076 | Ga0075435_100044379 | Ga0075435_1000443793 | 211 |
| 86 | 3300009094 | Ga0111539_10000708 | Ga0111539_1000070828 | 211 |
| 87 | 3300025933 | Ga0207706_10099603 | Ga0207706_100996033 | 211 |
| 88 | 3300027682 | Ga0209971_1026348 | Ga0209971_10263482 | 211 |
| 89 | 3300027907 | Ga0207428_10000519 | Ga0207428_1000051917 | 211 |
| 90 | 3300028380 | Ga0268265_10039138 | Ga0268265_100391384 | 211 |
| 91 | 3300035112 | Ga0373932_0017858 | Ga0373932_0017858_66_740 | 211 |
| 92 | 3300035114 | Ga0373939_0030256 | Ga0373939_0030256_432_1106 | 211 |
| 93 | 3300035691 | Ga0373931_0009669 | Ga0373931_0009669_1736_2410 | 211 |
| 94 | 3300035695 | Ga0373927_0103608 | Ga0373927_0103608_908_1582 | 211 |
| 95 | 3300035725 | Ga0373947_0436590 | Ga0373947_0436590_61_735 | 211 |
| 96 | 3300036401 | Ga0373937_0518324 | Ga0373937_0518324_100_774 | 211 |
| 97 | 3300039437 | Ga0436365_0449923 | Ga0436365_0449923_196_876 | 211 |
| 98 | 3300042876 | Ga0451577_0002781 | Ga0451577_0002781_5892_6554 | 211 |
| 99 | 3300044712 | Ga0453684_0027486 | Ga0453684_0027486_1480_2142 | 211 |
| 100 | 3300045051 | Ga0451576_0016703 | Ga0451576_0016703_5116_5778 | 211 |
| 101 | 3300046683 | Ga0495658_0293597 | Ga0495658_0293597_148_786 | 211 |
| 102 | 3300050511 | nmdc:mga08y16_9100_c1 | nmdc:mga08y16_9100_c1_5689_6351 | 211 |
| 103 | 3300050512 | nmdc:mga0n895_365520_c1 | nmdc:mga0n895_365520_c1_439_1140 | 211 |
| 104 | 3300050512 | nmdc:mga0n895_95333_c1 | nmdc:mga0n895_95333_c1_252_914 | 211 |
| 105 | 3300050513 | nmdc:mga0rr50_895456_c1 | nmdc:mga0rr50_895456_c1_33_734 | 211 |
| 106 | 3300050515 | nmdc:mga0a205_4461_c2 | nmdc:mga0a205_4461_c2_7975_8637 | 211 |
| 107 | 3300005328 | Ga0070676_10093706 | Ga0070676_100937062 | 212 |
| 108 | 3300005539 | Ga0068853_100544297 | Ga0068853_1005442971 | 212 |
| 109 | 3300005544 | Ga0070686_100128124 | Ga0070686_1001281242 | 212 |
| 110 | 3300006038 | Ga0075365_10164756 | Ga0075365_101647563 | 212 |
| 111 | 3300013308 | Ga0157375_10150256 | Ga0157375_101502562 | 212 |
| 112 | 3300017792 | Ga0163161_10304459 | Ga0163161_103044592 | 212 |
| 113 | 3300025907 | Ga0207645_10186218 | Ga0207645_101862182 | 212 |
| 114 | 3300025931 | Ga0207644_10108556 | Ga0207644_101085563 | 212 |
| 115 | 3300025937 | Ga0207669_10350158 | Ga0207669_103501582 | 212 |
| 116 | 3300026121 | Ga0207683_10594669 | Ga0207683_105946692 | 212 |
| 117 | 3300035692 | Ga0373935_0335321 | Ga0373935_0335321_263_940 | 212 |
| 118 | 3300005440 | Ga0070705_100062206 | Ga0070705_1000622063 | 213 |
| 119 | 3300005577 | Ga0068857_100051335 | Ga0068857_1000513353 | 213 |
| 120 | 3300005937 | Ga0081455_10012998 | Ga0081455_100129988 | 213 |
| 121 | 3300006051 | Ga0075364_10491400 | Ga0075364_104914002 | 213 |
| 122 | 3300006852 | Ga0075433_10514684 | Ga0075433_105146841 | 213 |
| 123 | 3300009098 | Ga0105245_10669958 | Ga0105245_106699582 | 213 |
| 124 | 3300013100 | Ga0157373_10364009 | Ga0157373_103640092 | 213 |
| 125 | 3300025915 | Ga0207693_10277980 | Ga0207693_102779802 | 213 |
| 126 | 3300027671 | Ga0209588_1036890 | Ga0209588_10368901 | 213 |
| 127 | 3300037312 | Ga0395899_0066534 | Ga0395899_0066534_1844_2518 | 213 |
| 128 | 3300037418 | Ga0395900_0177284 | Ga0395900_0177284_420_1094 | 213 |
| 129 | 3300037466 | Ga0395898_0053657 | Ga0395898_0053657_2378_3052 | 213 |
| 130 | 3300038443 | Ga0395901_0024595 | Ga0395901_0024595_992_1666 | 213 |
| 131 | 3300050516 | nmdc:mga0sz30_54786_c1 | nmdc:mga0sz30_54786_c1_576_1241 | 213 |
| 132 | 3300009098 | Ga0105245_10686995 | Ga0105245_106869951 | 214 |
| 133 | 3300014325 | Ga0163163_11076815 | Ga0163163_110768152 | 214 |
| 134 | 3300049741 | Ga0501079_0503698 | Ga0501079_0503698_162_833 | 214 |
| 135 | 3300005548 | Ga0070665_100020948 | Ga0070665_1000209486 | 215 |
| 136 | 3300005843 | Ga0068860_100253941 | Ga0068860_1002539412 | 215 |
| 137 | 3300006042 | Ga0075368_10000566 | Ga0075368_100005663 | 215 |
| 138 | 3300006048 | Ga0075363_100011166 | Ga0075363_1000111663 | 215 |
| 139 | 3300006177 | Ga0075362_10055905 | Ga0075362_100559052 | 215 |
| 140 | 3300006178 | Ga0075367_10014031 | Ga0075367_100140315 | 215 |
| 141 | 3300006186 | Ga0075369_10006961 | Ga0075369_100069612 | 215 |
| 142 | 3300006195 | Ga0075366_10006444 | Ga0075366_100064442 | 215 |
| 143 | 3300026067 | Ga0207678_10164500 | Ga0207678_101645003 | 215 |
| 144 | 3300027866 | Ga0209813_10037422 | Ga0209813_100374221 | 215 |
| 145 | 3300035691 | Ga0373931_0160061 | Ga0373931_0160061_154_807 | 215 |
| 146 | 3300050489 | nmdc:mga03683_20338_c1 | nmdc:mga03683_20338_c1_1121_1792 | 215 |
| 147 | 3300050490 | nmdc:mga03n38_136051_c1 | nmdc:mga03n38_136051_c1_352_1023 | 215 |
| 148 | 3300050491 | nmdc:mga00v17_207742_c1 | nmdc:mga00v17_207742_c1_75_746 | 215 |
| 149 | 3300050492 | nmdc:mga0yw44_435161_c1 | nmdc:mga0yw44_435161_c1_92_763 | 215 |
| 150 | 3300050493 | nmdc:mga0k408_75725_c1 | nmdc:mga0k408_75725_c1_1182_1853 | 215 |
| 151 | 3300050494 | nmdc:mga06z11_10515_c1 | nmdc:mga06z11_10515_c1_1202_1873 | 215 |
| 152 | 3300050495 | nmdc:mga04h51_44764_c1 | nmdc:mga04h51_44764_c1_46_717 | 215 |
| 153 | iso_pu_bacteria | 2602042107 | 2603860263 | 215 |
| 154 | iso_pu_bacteria | 2857524615 | 2857525274 | 215 |
| 155 | iso_pu_bacteria | 2893066018 | 2893066609 | 215 |
| 156 | iso_pu_bacteria | 2919073203 | 2919075063 | 215 |
| 157 | iso_pu_bacteria | 2941499720 | 2941502067 | 215 |
| 158 | iso_pu_bacteria | 2978969890 | 2978970057 | 215 |
| 159 | iso_pu_bacteria | 2984587000 | 2984587077 | 215 |
| 160 | 3300005329 | Ga0070683_100022527 | Ga0070683_1000225276 | 216 |
| 161 | 3300005456 | Ga0070678_100727878 | Ga0070678_1007278782 | 216 |
| 162 | 3300005535 | Ga0070684_100004958 | Ga0070684_10000495812 | 216 |
| 163 | 3300005539 | Ga0068853_100216191 | Ga0068853_1002161911 | 216 |
| 164 | 3300005563 | Ga0068855_100172440 | Ga0068855_1001724402 | 216 |
| 165 | 3300005563 | Ga0068855_100575008 | Ga0068855_1005750082 | 216 |
| 166 | 3300005564 | Ga0070664_100029888 | Ga0070664_1000298884 | 216 |
| 167 | 3300005577 | Ga0068857_100103025 | Ga0068857_1001030252 | 216 |
| 168 | 3300005614 | Ga0068856_100011462 | Ga0068856_1000114626 | 216 |
| 169 | 3300005843 | Ga0068860_100524568 | Ga0068860_1005245682 | 216 |
| 170 | 3300006058 | Ga0075432_10060084 | Ga0075432_100600842 | 216 |
| 171 | 3300009093 | Ga0105240_10089377 | Ga0105240_100893773 | 216 |
| 172 | 3300009174 | Ga0105241_10413696 | Ga0105241_104136962 | 216 |
| 173 | 3300009545 | Ga0105237_10666232 | Ga0105237_106662322 | 216 |
| 174 | 3300010375 | Ga0105239_10435888 | Ga0105239_104358882 | 216 |
| 175 | 3300013102 | Ga0157371_10021200 | Ga0157371_100212004 | 216 |
| 176 | 3300013105 | Ga0157369_10015753 | Ga0157369_100157534 | 216 |
| 177 | 3300021388 | Ga0213875_10021851 | Ga0213875_100218512 | 216 |
| 178 | 3300025321 | Ga0207656_10044224 | Ga0207656_100442242 | 216 |
| 179 | 3300025911 | Ga0207654_10251154 | Ga0207654_102511542 | 216 |
| 180 | 3300025913 | Ga0207695_10281923 | Ga0207695_102819233 | 216 |
| 181 | 3300025921 | Ga0207652_10273087 | Ga0207652_102730872 | 216 |
| 182 | 3300025933 | Ga0207706_10173754 | Ga0207706_101737543 | 216 |
| 183 | 3300025936 | Ga0207670_10174772 | Ga0207670_101747721 | 216 |
| 184 | 3300025944 | Ga0207661_10017221 | Ga0207661_100172212 | 216 |
| 185 | 3300025945 | Ga0207679_10069292 | Ga0207679_100692922 | 216 |
| 186 | 3300026078 | Ga0207702_10222911 | Ga0207702_102229112 | 216 |
| 187 | 3300026088 | Ga0207641_10757817 | Ga0207641_107578172 | 216 |
| 188 | 3300028379 | Ga0268266_10147662 | Ga0268266_101476622 | 216 |
| 189 | 3300028380 | Ga0268265_11061606 | Ga0268265_110616061 | 216 |
| 190 | 3300037312 | Ga0395899_0144741 | Ga0395899_0144741_600_1277 | 216 |
| 191 | 3300037418 | Ga0395900_0285319 | Ga0395900_0285319_683_1360 | 216 |
| 192 | 3300037418 | Ga0395900_0314098 | Ga0395900_0314098_134_811 | 216 |
| 193 | 3300037466 | Ga0395898_0028788 | Ga0395898_0028788_3637_4314 | 216 |
| 194 | 3300037853 | Ga0436364_1011929 | Ga0436364_1011929_1112_1792 | 216 |
| 195 | 3300038443 | Ga0395901_0373912 | Ga0395901_0373912_496_1173 | 216 |
| 196 | 3300050489 | nmdc:mga03683_271126_c1 | nmdc:mga03683_271126_c1_40_714 | 216 |
| 197 | 3300053085 | Ga0495619_0070046 | Ga0495619_0070046_1172_1837 | 216 |
| 198 | 3300005295 | Ga0065707_10099009 | Ga0065707_100990093 | 217 |
| 199 | 3300005345 | Ga0070692_10072681 | Ga0070692_100726813 | 217 |
| 200 | 3300005347 | Ga0070668_100140618 | Ga0070668_1001406183 | 217 |
| 201 | 3300005353 | Ga0070669_100004771 | Ga0070669_10000477110 | 217 |
| 202 | 3300005356 | Ga0070674_100073491 | Ga0070674_1000734912 | 217 |
| 203 | 3300005406 | Ga0070703_10036231 | Ga0070703_100362312 | 217 |
| 204 | 3300005438 | Ga0070701_10086009 | Ga0070701_100860092 | 217 |
| 205 | 3300005441 | Ga0070700_100002783 | Ga0070700_1000027832 | 217 |
| 206 | 3300005444 | Ga0070694_100112371 | Ga0070694_1001123711 | 217 |
| 207 | 3300005459 | Ga0068867_100008175 | Ga0068867_1000081756 | 217 |
| 208 | 3300005543 | Ga0070672_100205843 | Ga0070672_1002058432 | 217 |
| 209 | 3300005718 | Ga0068866_10164802 | Ga0068866_101648022 | 217 |
| 210 | 3300005719 | Ga0068861_100014550 | Ga0068861_1000145503 | 217 |
| 211 | 3300005840 | Ga0068870_10126731 | Ga0068870_101267312 | 217 |
| 212 | 3300005844 | Ga0068862_100060263 | Ga0068862_1000602633 | 217 |
| 213 | 3300006881 | Ga0068865_100018548 | Ga0068865_1000185485 | 217 |
| 214 | 3300009094 | Ga0111539_10447030 | Ga0111539_104470302 | 217 |
| 215 | 3300009148 | Ga0105243_10010240 | Ga0105243_100102403 | 217 |
| 216 | 3300009553 | Ga0105249_10020999 | Ga0105249_100209994 | 217 |
| 217 | 3300014326 | Ga0157380_10025645 | Ga0157380_100256452 | 217 |
| 218 | 3300025899 | Ga0207642_10007999 | Ga0207642_100079993 | 217 |
| 219 | 3300025907 | Ga0207645_10072742 | Ga0207645_100727422 | 217 |
| 220 | 3300025908 | Ga0207643_10051270 | Ga0207643_100512702 | 217 |
| 221 | 3300025917 | Ga0207660_10020025 | Ga0207660_100200253 | 217 |
| 222 | 3300025917 | Ga0207660_10155678 | Ga0207660_101556782 | 217 |
| 223 | 3300025923 | Ga0207681_10006788 | Ga0207681_100067885 | 217 |
| 224 | 3300025935 | Ga0207709_10008586 | Ga0207709_100085863 | 217 |
| 225 | 3300025937 | Ga0207669_10022230 | Ga0207669_100222302 | 217 |
| 226 | 3300025938 | Ga0207704_10009642 | Ga0207704_100096423 | 217 |
| 227 | 3300025940 | Ga0207691_10042527 | Ga0207691_100425274 | 217 |
| 228 | 3300025961 | Ga0207712_10792230 | Ga0207712_107922302 | 217 |
| 229 | 3300025972 | Ga0207668_10003050 | Ga0207668_100030507 | 217 |
| 230 | 3300026075 | Ga0207708_10002431 | Ga0207708_1000243114 | 217 |
| 231 | 3300026089 | Ga0207648_10002687 | Ga0207648_100026879 | 217 |
| 232 | 3300026118 | Ga0207675_100006447 | Ga0207675_1000064478 | 217 |
| 233 | 3300027907 | Ga0207428_10034027 | Ga0207428_100340275 | 217 |
| 234 | 3300028380 | Ga0268265_10012057 | Ga0268265_100120573 | 217 |
| 235 | 3300032002 | Ga0307416_100536624 | Ga0307416_1005366242 | 217 |
| 236 | 3300042125 | Ga0450923_041328 | Ga0450923_041328_133_795 | 217 |
| 237 | iso_pu_bacteria | 2513237087 | 2513591621 | 217 |
| 238 | iso_pu_bacteria | 2599185236 | 2599724036 | 217 |
| 239 | iso_pu_bacteria | 2600254933 | 2600376205 | 217 |
| 240 | iso_pu_bacteria | 2687453129 | 2687577944 | 217 |
| 241 | iso_pu_bacteria | 2738541317 | 2738946963 | 217 |
| 242 | iso_pu_bacteria | 2818991467 | 2819717375 | 217 |
| 243 | iso_pu_bacteria | 2821123053 | 2821126883 | 217 |
| 244 | iso_pu_bacteria | 2838736955 | 2838740490 | 217 |
| 245 | iso_pu_bacteria | 2841840854 | 2841843386 | 217 |
| 246 | iso_pu_bacteria | 2842140634 | 2842143107 | 217 |
| 247 | iso_pu_bacteria | 2854681122 | 2854684671 | 217 |
| 248 | iso_pu_bacteria | 2857531043 | 2857535333 | 217 |
| 249 | iso_pu_bacteria | 2913308742 | 2913312212 | 217 |
| 250 | iso_pu_bacteria | 2935959822 | 2935960937 | 217 |
| 251 | iso_pu_bacteria | 2978969890 | 2978970051 | 217 |
| 252 | iso_pu_bacteria | 2984587000 | 2984587070 | 217 |
| 253 | iso_pu_bacteria | 2995392953 | 2995396721 | 217 |
| 254 | iso_pu_bacteria | 8054460903 | 8054464198 | 217 |
| 255 | iso_pu_bacteria | 8054563764 | 8054565578 | 217 |
| 256 | 3300005295 | Ga0065707_10307618 | Ga0065707_103076181 | 218 |
| 257 | 3300005327 | Ga0070658_10063135 | Ga0070658_100631352 | 218 |
| 258 | 3300005328 | Ga0070676_10000559 | Ga0070676_1000055914 | 218 |
| 259 | 3300005328 | Ga0070676_10608658 | Ga0070676_106086581 | 218 |
| 260 | 3300005329 | Ga0070683_100435421 | Ga0070683_1004354212 | 218 |
| 261 | 3300005330 | Ga0070690_100145401 | Ga0070690_1001454012 | 218 |
| 262 | 3300005330 | Ga0070690_100208328 | Ga0070690_1002083281 | 218 |
| 263 | 3300005331 | Ga0070670_100001348 | Ga0070670_1000013489 | 218 |
| 264 | 3300005334 | Ga0068869_100008769 | Ga0068869_1000087697 | 218 |
| 265 | 3300005334 | Ga0068869_100104727 | Ga0068869_1001047273 | 218 |
| 266 | 3300005336 | Ga0070680_100002153 | Ga0070680_10000215315 | 218 |
| 267 | 3300005336 | Ga0070680_100011581 | Ga0070680_1000115815 | 218 |
| 268 | 3300005336 | Ga0070680_100050708 | Ga0070680_1000507082 | 218 |
| 269 | 3300005336 | Ga0070680_100104795 | Ga0070680_1001047952 | 218 |
| 270 | 3300005337 | Ga0070682_100023337 | Ga0070682_1000233376 | 218 |
| 271 | 3300005339 | Ga0070660_100074612 | Ga0070660_1000746122 | 218 |
| 272 | 3300005340 | Ga0070689_100132186 | Ga0070689_1001321863 | 218 |
| 273 | 3300005341 | Ga0070691_10004567 | Ga0070691_100045673 | 218 |
| 274 | 3300005341 | Ga0070691_10012722 | Ga0070691_100127222 | 218 |
| 275 | 3300005341 | Ga0070691_10028644 | Ga0070691_100286444 | 218 |
| 276 | 3300005344 | Ga0070661_100000426 | Ga0070661_1000004265 | 218 |
| 277 | 3300005345 | Ga0070692_10001134 | Ga0070692_100011342 | 218 |
| 278 | 3300005345 | Ga0070692_10014012 | Ga0070692_100140126 | 218 |
| 279 | 3300005353 | Ga0070669_100091905 | Ga0070669_1000919052 | 218 |
| 280 | 3300005354 | Ga0070675_100167056 | Ga0070675_1001670563 | 218 |
| 281 | 3300005364 | Ga0070673_100057312 | Ga0070673_1000573123 | 218 |
| 282 | 3300005366 | Ga0070659_100000529 | Ga0070659_1000005298 | 218 |
| 283 | 3300005367 | Ga0070667_100134910 | Ga0070667_1001349103 | 218 |
| 284 | 3300005406 | Ga0070703_10000497 | Ga0070703_100004979 | 218 |
| 285 | 3300005436 | Ga0070713_100445831 | Ga0070713_1004458312 | 218 |
| 286 | 3300005438 | Ga0070701_10010068 | Ga0070701_100100684 | 218 |
| 287 | 3300005438 | Ga0070701_10113393 | Ga0070701_101133932 | 218 |
| 288 | 3300005440 | Ga0070705_100013875 | Ga0070705_1000138753 | 218 |
| 289 | 3300005440 | Ga0070705_100336997 | Ga0070705_1003369971 | 218 |
| 290 | 3300005441 | Ga0070700_100040815 | Ga0070700_1000408152 | 218 |
| 291 | 3300005441 | Ga0070700_100093420 | Ga0070700_1000934203 | 218 |
| 292 | 3300005444 | Ga0070694_100000056 | Ga0070694_1000000561 | 218 |
| 293 | 3300005444 | Ga0070694_100031929 | Ga0070694_1000319292 | 218 |
| 294 | 3300005455 | Ga0070663_100016249 | Ga0070663_1000162491 | 218 |
| 295 | 3300005457 | Ga0070662_100041551 | Ga0070662_1000415515 | 218 |
| 296 | 3300005458 | Ga0070681_10013926 | Ga0070681_100139264 | 218 |
| 297 | 3300005459 | Ga0068867_100009055 | Ga0068867_1000090558 | 218 |
| 298 | 3300005459 | Ga0068867_100172681 | Ga0068867_1001726812 | 218 |
| 299 | 3300005468 | Ga0070707_100012720 | Ga0070707_1000127202 | 218 |
| 300 | 3300005468 | Ga0070707_100213849 | Ga0070707_1002138492 | 218 |
| 301 | 3300005471 | Ga0070698_100029132 | Ga0070698_1000291329 | 218 |
| 302 | 3300005471 | Ga0070698_100120039 | Ga0070698_1001200395 | 218 |
| 303 | 3300005518 | Ga0070699_100114745 | Ga0070699_1001147452 | 218 |
| 304 | 3300005518 | Ga0070699_100437520 | Ga0070699_1004375202 | 218 |
| 305 | 3300005530 | Ga0070679_100004895 | Ga0070679_10000489510 | 218 |
| 306 | 3300005530 | Ga0070679_100030304 | Ga0070679_1000303047 | 218 |
| 307 | 3300005530 | Ga0070679_100099185 | Ga0070679_1000991853 | 218 |
| 308 | 3300005535 | Ga0070684_100007487 | Ga0070684_1000074875 | 218 |
| 309 | 3300005536 | Ga0070697_100097123 | Ga0070697_1000971232 | 218 |
| 310 | 3300005536 | Ga0070697_100169803 | Ga0070697_1001698032 | 218 |
| 311 | 3300005539 | Ga0068853_100010479 | Ga0068853_1000104797 | 218 |
| 312 | 3300005543 | Ga0070672_100055270 | Ga0070672_1000552702 | 218 |
| 313 | 3300005545 | Ga0070695_100028466 | Ga0070695_1000284665 | 218 |
| 314 | 3300005545 | Ga0070695_100028673 | Ga0070695_1000286732 | 218 |
| 315 | 3300005545 | Ga0070695_100040252 | Ga0070695_1000402522 | 218 |
| 316 | 3300005545 | Ga0070695_100082325 | Ga0070695_1000823252 | 218 |
| 317 | 3300005546 | Ga0070696_100001822 | Ga0070696_10000182215 | 218 |
| 318 | 3300005546 | Ga0070696_100085690 | Ga0070696_1000856902 | 218 |
| 319 | 3300005547 | Ga0070693_100000746 | Ga0070693_10000074616 | 218 |
| 320 | 3300005547 | Ga0070693_100380270 | Ga0070693_1003802701 | 218 |
| 321 | 3300005549 | Ga0070704_100004757 | Ga0070704_1000047578 | 218 |
| 322 | 3300005549 | Ga0070704_100060292 | Ga0070704_1000602923 | 218 |
| 323 | 3300005563 | Ga0068855_100014476 | Ga0068855_1000144765 | 218 |
| 324 | 3300005563 | Ga0068855_100042273 | Ga0068855_1000422737 | 218 |
| 325 | 3300005563 | Ga0068855_100129023 | Ga0068855_1001290233 | 218 |
| 326 | 3300005564 | Ga0070664_100002931 | Ga0070664_10000293114 | 218 |
| 327 | 3300005577 | Ga0068857_100031133 | Ga0068857_1000311336 | 218 |
| 328 | 3300005577 | Ga0068857_100209266 | Ga0068857_1002092662 | 218 |
| 329 | 3300005578 | Ga0068854_100003866 | Ga0068854_1000038661 | 218 |
| 330 | 3300005614 | Ga0068856_100002142 | Ga0068856_10000214216 | 218 |
| 331 | 3300005614 | Ga0068856_100156119 | Ga0068856_1001561192 | 218 |
| 332 | 3300005616 | Ga0068852_100038297 | Ga0068852_1000382976 | 218 |
| 333 | 3300005617 | Ga0068859_100001597 | Ga0068859_10000159721 | 218 |
| 334 | 3300005617 | Ga0068859_100204859 | Ga0068859_1002048592 | 218 |
| 335 | 3300005617 | Ga0068859_100684711 | Ga0068859_1006847112 | 218 |
| 336 | 3300005618 | Ga0068864_100028986 | Ga0068864_1000289866 | 218 |
| 337 | 3300005618 | Ga0068864_100115669 | Ga0068864_1001156692 | 218 |
| 338 | 3300005719 | Ga0068861_100017163 | Ga0068861_1000171635 | 218 |
| 339 | 3300005834 | Ga0068851_10125978 | Ga0068851_101259782 | 218 |
| 340 | 3300005840 | Ga0068870_10003097 | Ga0068870_100030974 | 218 |
| 341 | 3300005841 | Ga0068863_100037848 | Ga0068863_1000378485 | 218 |
| 342 | 3300005843 | Ga0068860_100004116 | Ga0068860_10000411610 | 218 |
| 343 | 3300005843 | Ga0068860_100058303 | Ga0068860_1000583032 | 218 |
| 344 | 3300005843 | Ga0068860_100205916 | Ga0068860_1002059163 | 218 |
| 345 | 3300005844 | Ga0068862_100001395 | Ga0068862_10000139512 | 218 |
| 346 | 3300005981 | Ga0081538_10004698 | Ga0081538_100046986 | 218 |
| 347 | 3300006237 | Ga0097621_100237305 | Ga0097621_1002373052 | 218 |
| 348 | 3300006358 | Ga0068871_100197664 | Ga0068871_1001976644 | 218 |
| 349 | 3300006844 | Ga0075428_100000979 | Ga0075428_10000097921 | 218 |
| 350 | 3300006844 | Ga0075428_100010065 | Ga0075428_1000100656 | 218 |
| 351 | 3300006844 | Ga0075428_100066299 | Ga0075428_1000662994 | 218 |
| 352 | 3300006846 | Ga0075430_100000013 | Ga0075430_10000001385 | 218 |
| 353 | 3300006847 | Ga0075431_100001575 | Ga0075431_1000015759 | 218 |
| 354 | 3300006847 | Ga0075431_100008273 | Ga0075431_1000082738 | 218 |
| 355 | 3300006847 | Ga0075431_100046113 | Ga0075431_1000461132 | 218 |
| 356 | 3300006847 | Ga0075431_100053192 | Ga0075431_1000531924 | 218 |
| 357 | 3300006847 | Ga0075431_100297908 | Ga0075431_1002979082 | 218 |
| 358 | 3300006852 | Ga0075433_10000148 | Ga0075433_1000014825 | 218 |
| 359 | 3300006852 | Ga0075433_10014227 | Ga0075433_100142273 | 218 |
| 360 | 3300006852 | Ga0075433_10028759 | Ga0075433_100287593 | 218 |
| 361 | 3300006852 | Ga0075433_10029345 | Ga0075433_100293455 | 218 |
| 362 | 3300006852 | Ga0075433_10039272 | Ga0075433_100392722 | 218 |
| 363 | 3300006852 | Ga0075433_10782873 | Ga0075433_107828732 | 218 |
| 364 | 3300006871 | Ga0075434_100000484 | Ga0075434_10000048415 | 218 |
| 365 | 3300006871 | Ga0075434_100016507 | Ga0075434_1000165074 | 218 |
| 366 | 3300006871 | Ga0075434_100044530 | Ga0075434_1000445306 | 218 |
| 367 | 3300006871 | Ga0075434_100049485 | Ga0075434_1000494855 | 218 |
| 368 | 3300006880 | Ga0075429_100000234 | Ga0075429_10000023418 | 218 |
| 369 | 3300006880 | Ga0075429_100002284 | Ga0075429_10000228412 | 218 |
| 370 | 3300006880 | Ga0075429_100052004 | Ga0075429_1000520041 | 218 |
| 371 | 3300006914 | Ga0075436_100042237 | Ga0075436_1000422374 | 218 |
| 372 | 3300006914 | Ga0075436_100081809 | Ga0075436_1000818093 | 218 |
| 373 | 3300006914 | Ga0075436_100542626 | Ga0075436_1005426261 | 218 |
| 374 | 3300006931 | Ga0097620_100001597 | Ga0097620_10000159721 | 218 |
| 375 | 3300006931 | Ga0097620_100204844 | Ga0097620_1002048442 | 218 |
| 376 | 3300006931 | Ga0097620_100684683 | Ga0097620_1006846832 | 218 |
| 377 | 3300007076 | Ga0075435_100017645 | Ga0075435_1000176454 | 218 |
| 378 | 3300007076 | Ga0075435_100177251 | Ga0075435_1001772512 | 218 |
| 379 | 3300007076 | Ga0075435_100191341 | Ga0075435_1001913413 | 218 |
| 380 | 3300007076 | Ga0075435_100494745 | Ga0075435_1004947452 | 218 |
| 381 | 3300007076 | Ga0075435_100593652 | Ga0075435_1005936521 | 218 |
| 382 | 3300007076 | Ga0075435_100626184 | Ga0075435_1006261841 | 218 |
| 383 | 3300007265 | Ga0099794_10053394 | Ga0099794_100533942 | 218 |
| 384 | 3300009093 | Ga0105240_10001546 | Ga0105240_100015462 | 218 |
| 385 | 3300009093 | Ga0105240_11366747 | Ga0105240_113667471 | 218 |
| 386 | 3300009094 | Ga0111539_10000618 | Ga0111539_1000061812 | 218 |
| 387 | 3300009094 | Ga0111539_10161316 | Ga0111539_101613163 | 218 |
| 388 | 3300009094 | Ga0111539_10625048 | Ga0111539_106250482 | 218 |
| 389 | 3300009147 | Ga0114129_10002660 | Ga0114129_1000266017 | 218 |
| 390 | 3300009147 | Ga0114129_10022171 | Ga0114129_100221719 | 218 |
| 391 | 3300009147 | Ga0114129_10057223 | Ga0114129_100572235 | 218 |
| 392 | 3300009147 | Ga0114129_10102283 | Ga0114129_101022834 | 218 |
| 393 | 3300009147 | Ga0114129_10181800 | Ga0114129_101818004 | 218 |
| 394 | 3300009147 | Ga0114129_10222673 | Ga0114129_102226732 | 218 |
| 395 | 3300009148 | Ga0105243_10066097 | Ga0105243_100660972 | 218 |
| 396 | 3300009174 | Ga0105241_10000650 | Ga0105241_100006502 | 218 |
| 397 | 3300009174 | Ga0105241_10234205 | Ga0105241_102342052 | 218 |
| 398 | 3300009176 | Ga0105242_10021028 | Ga0105242_100210285 | 218 |
| 399 | 3300010375 | Ga0105239_10949687 | Ga0105239_109496872 | 218 |
| 400 | 3300011119 | Ga0105246_10122543 | Ga0105246_101225431 | 218 |
| 401 | 3300013100 | Ga0157373_10005062 | Ga0157373_100050621 | 218 |
| 402 | 3300013105 | Ga0157369_10096375 | Ga0157369_100963754 | 218 |
| 403 | 3300013307 | Ga0157372_10000746 | Ga0157372_1000074627 | 218 |
| 404 | 3300013308 | Ga0157375_10090194 | Ga0157375_100901944 | 218 |
| 405 | 3300014325 | Ga0163163_10793784 | Ga0163163_107937841 | 218 |
| 406 | 3300014326 | Ga0157380_11166404 | Ga0157380_111664041 | 218 |
| 407 | 3300014497 | Ga0182008_10144325 | Ga0182008_101443253 | 218 |
| 408 | 3300014745 | Ga0157377_10086971 | Ga0157377_100869711 | 218 |
| 409 | 3300014745 | Ga0157377_10218316 | Ga0157377_102183162 | 218 |
| 410 | 3300014745 | Ga0157377_10236029 | Ga0157377_102360292 | 218 |
| 411 | 3300014745 | Ga0157377_10297617 | Ga0157377_102976172 | 218 |
| 412 | 3300025885 | Ga0207653_10034067 | Ga0207653_100340672 | 218 |
| 413 | 3300025901 | Ga0207688_10017744 | Ga0207688_100177443 | 218 |
| 414 | 3300025907 | Ga0207645_10000213 | Ga0207645_1000021347 | 218 |
| 415 | 3300025907 | Ga0207645_10406537 | Ga0207645_104065371 | 218 |
| 416 | 3300025908 | Ga0207643_10000590 | Ga0207643_1000059012 | 218 |
| 417 | 3300025908 | Ga0207643_10093273 | Ga0207643_100932732 | 218 |
| 418 | 3300025909 | Ga0207705_10111855 | Ga0207705_101118552 | 218 |
| 419 | 3300025911 | Ga0207654_10136129 | Ga0207654_101361292 | 218 |
| 420 | 3300025911 | Ga0207654_10145300 | Ga0207654_101453004 | 218 |
| 421 | 3300025912 | Ga0207707_10001151 | Ga0207707_1000115114 | 218 |
| 422 | 3300025912 | Ga0207707_10115966 | Ga0207707_101159663 | 218 |
| 423 | 3300025913 | Ga0207695_10048203 | Ga0207695_100482033 | 218 |
| 424 | 3300025917 | Ga0207660_10001357 | Ga0207660_100013579 | 218 |
| 425 | 3300025919 | Ga0207657_10000300 | Ga0207657_100003002 | 218 |
| 426 | 3300025920 | Ga0207649_10112049 | Ga0207649_101120494 | 218 |
| 427 | 3300025921 | Ga0207652_10003563 | Ga0207652_1000356311 | 218 |
| 428 | 3300025921 | Ga0207652_10008730 | Ga0207652_100087309 | 218 |
| 429 | 3300025921 | Ga0207652_10077220 | Ga0207652_100772203 | 218 |
| 430 | 3300025922 | Ga0207646_10152643 | Ga0207646_101526433 | 218 |
| 431 | 3300025923 | Ga0207681_10135091 | Ga0207681_101350913 | 218 |
| 432 | 3300025925 | Ga0207650_10004857 | Ga0207650_100048574 | 218 |
| 433 | 3300025926 | Ga0207659_10101321 | Ga0207659_101013212 | 218 |
| 434 | 3300025927 | Ga0207687_10065280 | Ga0207687_100652803 | 218 |
| 435 | 3300025927 | Ga0207687_10218754 | Ga0207687_102187542 | 218 |
| 436 | 3300025928 | Ga0207700_10535353 | Ga0207700_105353532 | 218 |
| 437 | 3300025932 | Ga0207690_10002782 | Ga0207690_100027827 | 218 |
| 438 | 3300025933 | Ga0207706_10046485 | Ga0207706_100464856 | 218 |
| 439 | 3300025934 | Ga0207686_10012265 | Ga0207686_100122655 | 218 |
| 440 | 3300025936 | Ga0207670_10796380 | Ga0207670_107963802 | 218 |
| 441 | 3300025939 | Ga0207665_10048759 | Ga0207665_100487592 | 218 |
| 442 | 3300025940 | Ga0207691_10076264 | Ga0207691_100762642 | 218 |
| 443 | 3300025942 | Ga0207689_10000257 | Ga0207689_1000025714 | 218 |
| 444 | 3300025942 | Ga0207689_10017442 | Ga0207689_100174427 | 218 |
| 445 | 3300025942 | Ga0207689_10053222 | Ga0207689_100532223 | 218 |
| 446 | 3300025942 | Ga0207689_10206082 | Ga0207689_102060823 | 218 |
| 447 | 3300025944 | Ga0207661_10384137 | Ga0207661_103841372 | 218 |
| 448 | 3300025945 | Ga0207679_10008189 | Ga0207679_100081898 | 218 |
| 449 | 3300025949 | Ga0207667_10003068 | Ga0207667_100030682 | 218 |
| 450 | 3300025949 | Ga0207667_10162023 | Ga0207667_101620233 | 218 |
| 451 | 3300025960 | Ga0207651_10087304 | Ga0207651_100873043 | 218 |
| 452 | 3300025981 | Ga0207640_10001086 | Ga0207640_100010869 | 218 |
| 453 | 3300025986 | Ga0207658_10111097 | Ga0207658_101110973 | 218 |
| 454 | 3300026023 | Ga0207677_10217798 | Ga0207677_102177982 | 218 |
| 455 | 3300026041 | Ga0207639_10005888 | Ga0207639_100058887 | 218 |
| 456 | 3300026075 | Ga0207708_10010496 | Ga0207708_100104962 | 218 |
| 457 | 3300026075 | Ga0207708_10018935 | Ga0207708_100189352 | 218 |
| 458 | 3300026078 | Ga0207702_10002765 | Ga0207702_1000276519 | 218 |
| 459 | 3300026078 | Ga0207702_10126077 | Ga0207702_101260772 | 218 |
| 460 | 3300026088 | Ga0207641_10094706 | Ga0207641_100947063 | 218 |
| 461 | 3300026089 | Ga0207648_10000854 | Ga0207648_1000085438 | 218 |
| 462 | 3300026089 | Ga0207648_10213670 | Ga0207648_102136702 | 218 |
| 463 | 3300026089 | Ga0207648_10227268 | Ga0207648_102272683 | 218 |
| 464 | 3300026095 | Ga0207676_10057909 | Ga0207676_100579094 | 218 |
| 465 | 3300026095 | Ga0207676_10386272 | Ga0207676_103862722 | 218 |
| 466 | 3300026116 | Ga0207674_10004234 | Ga0207674_100042341 | 218 |
| 467 | 3300026116 | Ga0207674_10041274 | Ga0207674_100412744 | 218 |
| 468 | 3300026118 | Ga0207675_100092764 | Ga0207675_1000927642 | 218 |
| 469 | 3300026142 | Ga0207698_10102855 | Ga0207698_101028555 | 218 |
| 470 | 3300027378 | Ga0209981_1021656 | Ga0209981_10216561 | 218 |
| 471 | 3300027462 | Ga0210000_1002064 | Ga0210000_10020643 | 218 |
| 472 | 3300027471 | Ga0209995_1016441 | Ga0209995_10164412 | 218 |
| 473 | 3300027526 | Ga0209968_1017095 | Ga0209968_10170952 | 218 |
| 474 | 3300027907 | Ga0207428_10000118 | Ga0207428_1000011834 | 218 |
| 475 | 3300027907 | Ga0207428_10024940 | Ga0207428_100249404 | 218 |
| 476 | 3300027907 | Ga0207428_10232506 | Ga0207428_102325062 | 218 |
| 477 | 3300028380 | Ga0268265_10004690 | Ga0268265_1000469012 | 218 |
| 478 | 3300028381 | Ga0268264_10243880 | Ga0268264_102438803 | 218 |
| 479 | 3300028381 | Ga0268264_10282914 | Ga0268264_102829144 | 218 |
| 480 | 3300032005 | Ga0307411_10328622 | Ga0307411_103286222 | 218 |
| 481 | 3300034818 | Ga0373950_0040159 | Ga0373950_0040159_142_804 | 218 |
| 482 | 3300034820 | Ga0373959_0019892 | Ga0373959_0019892_282_944 | 218 |
| 483 | 3300035092 | Ga0373952_0008015 | Ga0373952_0008015_873_1529 | 218 |
| 484 | 3300035112 | Ga0373932_0005232 | Ga0373932_0005232_184_846 | 218 |
| 485 | 3300035114 | Ga0373939_0020797 | Ga0373939_0020797_183_839 | 218 |
| 486 | 3300035115 | Ga0373941_0028074 | Ga0373941_0028074_310_972 | 218 |
| 487 | 3300035692 | Ga0373935_0054403 | Ga0373935_0054403_1832_2497 | 218 |
| 488 | 3300035725 | Ga0373947_0004079 | Ga0373947_0004079_339_1004 | 218 |
| 489 | 3300036401 | Ga0373937_0054737 | Ga0373937_0054737_1655_2320 | 218 |
| 490 | 3300037068 | Ga0373925_0008634 | Ga0373925_0008634_6432_7097 | 218 |
| 491 | 3300042001 | Ga0439441_013424 | Ga0439441_013424_451_1113 | 218 |
| 492 | 3300042001 | Ga0439441_025781 | Ga0439441_025781_82_747 | 218 |
| 493 | 3300042005 | Ga0439448_0000722 | Ga0439448_0000722_6323_6985 | 218 |
| 494 | 3300042157 | Ga0439458_0001256 | Ga0439458_0001256_3747_4409 | 218 |
| 495 | 3300042876 | Ga0451577_0009822 | Ga0451577_0009822_7735_8397 | 218 |
| 496 | 3300042876 | Ga0451577_0102161 | Ga0451577_0102161_1029_1694 | 218 |
| 497 | 3300042876 | Ga0451577_0756551 | Ga0451577_0756551_74_736 | 218 |
| 498 | 3300044712 | Ga0453684_0194743 | Ga0453684_0194743_795_1457 | 218 |
| 499 | 3300045051 | Ga0451576_0039924 | Ga0451576_0039924_3855_4517 | 218 |
| 500 | 3300045051 | Ga0451576_0210373 | Ga0451576_0210373_694_1356 | 218 |
| 501 | 3300046472 | Ga0495580_0214433 | Ga0495580_0214433_248_910 | 218 |
| 502 | 3300046533 | Ga0495640_0161037 | Ga0495640_0161037_253_918 | 218 |
| 503 | 3300046664 | Ga0495659_0087804 | Ga0495659_0087804_299_961 | 218 |
| 504 | 3300048915 | Ga0496112_0156578 | Ga0496112_0156578_1099_1761 | 218 |
| 505 | 3300048916 | Ga0496113_0388762 | Ga0496113_0388762_230_892 | 218 |
| 506 | 3300049570 | Ga0501033_0215358 | Ga0501033_0215358_451_1116 | 218 |
| 507 | 3300049573 | Ga0501037_0258359 | Ga0501037_0258359_152_817 | 218 |
| 508 | 3300049584 | Ga0501068_0578227 | Ga0501068_0578227_48_710 | 218 |
| 509 | 3300049592 | Ga0501076_0479249 | Ga0501076_0479249_259_921 | 218 |
| 510 | 3300049592 | Ga0501076_0575887 | Ga0501076_0575887_93_755 | 218 |
| 511 | 3300049593 | Ga0501077_0393678 | Ga0501077_0393678_96_758 | 218 |
| 512 | 3300049823 | Ga0501044_0194444 | Ga0501044_0194444_1093_1758 | 218 |
| 513 | 3300050507 | nmdc:mga05p37_245292_c1 | nmdc:mga05p37_245292_c1_576_1238 | 218 |
| 514 | 3300050507 | nmdc:mga05p37_284177_c1 | nmdc:mga05p37_284177_c1_1270_1932 | 218 |
| 515 | 3300050507 | nmdc:mga05p37_350268_c1 | nmdc:mga05p37_350268_c1_75_737 | 218 |
| 516 | 3300050507 | nmdc:mga05p37_8272_c1 | nmdc:mga05p37_8272_c1_2830_3486 | 218 |
| 517 | 3300050507 | nmdc:mga05p37_8460_c1 | nmdc:mga05p37_8460_c1_1579_2247 | 218 |
| 518 | 3300050508 | nmdc:mga09592_122_c1 | nmdc:mga09592_122_c1_29830_30492 | 218 |
| 519 | 3300050508 | nmdc:mga09592_150915_c1 | nmdc:mga09592_150915_c1_1278_1940 | 218 |
| 520 | 3300050508 | nmdc:mga09592_27000_c1 | nmdc:mga09592_27000_c1_2873_3529 | 218 |
| 521 | 3300050509 | nmdc:mga0qj67_183400_c1 | nmdc:mga0qj67_183400_c1_136_798 | 218 |
| 522 | 3300050509 | nmdc:mga0qj67_3256_c1 | nmdc:mga0qj67_3256_c1_5742_6404 | 218 |
| 523 | 3300050510 | nmdc:mga06r32_1168_c1 | nmdc:mga06r32_1168_c1_12871_13533 | 218 |
| 524 | 3300050510 | nmdc:mga06r32_17315_c1 | nmdc:mga06r32_17315_c1_1954_2616 | 218 |
| 525 | 3300050510 | nmdc:mga06r32_3605_c1 | nmdc:mga06r32_3605_c1_6352_7014 | 218 |
| 526 | 3300050510 | nmdc:mga06r32_54967_c1 | nmdc:mga06r32_54967_c1_1255_1917 | 218 |
| 527 | 3300050510 | nmdc:mga06r32_595302_c1 | nmdc:mga06r32_595302_c1_10_678 | 218 |
| 528 | 3300050510 | nmdc:mga06r32_96336_c1 | nmdc:mga06r32_96336_c1_1253_1909 | 218 |
| 529 | 3300050511 | nmdc:mga08y16_16961_c1 | nmdc:mga08y16_16961_c1_2133_2789 | 218 |
| 530 | 3300050511 | nmdc:mga08y16_197018_c1 | nmdc:mga08y16_197018_c1_1326_1988 | 218 |
| 531 | 3300050511 | nmdc:mga08y16_4215_c1 | nmdc:mga08y16_4215_c1_13100_13762 | 218 |
| 532 | 3300050511 | nmdc:mga08y16_562411_c1 | nmdc:mga08y16_562411_c1_54_719 | 218 |
| 533 | 3300050512 | nmdc:mga0n895_20484_c1 | nmdc:mga0n895_20484_c1_4849_5511 | 218 |
| 534 | 3300050512 | nmdc:mga0n895_367_c1 | nmdc:mga0n895_367_c1_13179_13841 | 218 |
| 535 | 3300050512 | nmdc:mga0n895_53331_c1 | nmdc:mga0n895_53331_c1_1327_1989 | 218 |
| 536 | 3300050513 | nmdc:mga0rr50_115538_c1 | nmdc:mga0rr50_115538_c1_255_917 | 218 |
| 537 | 3300050513 | nmdc:mga0rr50_147498_c2 | nmdc:mga0rr50_147498_c2_255_917 | 218 |
| 538 | 3300050513 | nmdc:mga0rr50_182397_c1 | nmdc:mga0rr50_182397_c1_854_1516 | 218 |
| 539 | 3300050513 | nmdc:mga0rr50_2408_c1 | nmdc:mga0rr50_2408_c1_7028_7690 | 218 |
| 540 | 3300050513 | nmdc:mga0rr50_392515_c1 | nmdc:mga0rr50_392515_c1_399_1067 | 218 |
| 541 | 3300050514 | nmdc:mga08x19_6538_c1 | nmdc:mga08x19_6538_c1_2720_3382 | 218 |
| 542 | 3300050514 | nmdc:mga08x19_86296_c1 | nmdc:mga08x19_86296_c1_1368_2030 | 218 |
| 543 | 3300050515 | nmdc:mga0a205_123347_c1 | nmdc:mga0a205_123347_c1_1281_1949 | 218 |
| 544 | 3300050515 | nmdc:mga0a205_19958_c1 | nmdc:mga0a205_19958_c1_3978_4640 | 218 |
| 545 | 3300050515 | nmdc:mga0a205_32425_c1 | nmdc:mga0a205_32425_c1_2918_3580 | 218 |
| 546 | 3300050515 | nmdc:mga0a205_545545_c1 | nmdc:mga0a205_545545_c1_303_965 | 218 |
| 547 | 3300050515 | nmdc:mga0a205_6561_c1 | nmdc:mga0a205_6561_c1_2158_2820 | 218 |
| 548 | 3300050515 | nmdc:mga0a205_66_c1 | nmdc:mga0a205_66_c1_51073_51735 | 218 |
| 549 | 3300053084 | Ga0495595_0105175 | Ga0495595_0105175_540_1205 | 218 |
| 550 | 3300053733 | Ga0500552_001175 | Ga0500552_001175_506_1171 | 218 |
| 551 | 3300005548 | Ga0070665_100160818 | Ga0070665_1001608183 | 219 |
| 552 | 3300028379 | Ga0268266_10274083 | Ga0268266_102740832 | 219 |
| 553 | 3300031911 | Ga0307412_10494182 | Ga0307412_104941822 | 219 |
| 554 | 3300046460 | Ga0495638_0100790 | Ga0495638_0100790_142_801 | 219 |
| 555 | 3300046460 | Ga0495638_0133139 | Ga0495638_0133139_112_771 | 219 |
| 556 | 3300046501 | Ga0495607_0051144 | Ga0495607_0051144_306_965 | 219 |
| 557 | 3300046507 | Ga0495606_0035406 | Ga0495606_0035406_1312_1971 | 219 |
| 558 | 3300046512 | Ga0495610_0025112 | Ga0495610_0025112_22_681 | 219 |
| 559 | 3300046513 | Ga0495616_0057445 | Ga0495616_0057445_1081_1740 | 219 |
| 560 | 3300046518 | Ga0495631_0041424 | Ga0495631_0041424_497_1156 | 219 |
| 561 | 3300046522 | Ga0495643_0030338 | Ga0495643_0030338_1637_2296 | 219 |
| 562 | 3300046530 | Ga0495654_0033331 | Ga0495654_0033331_1925_2584 | 219 |
| 563 | 3300046530 | Ga0495654_0045976 | Ga0495654_0045976_592_1251 | 219 |
| 564 | 3300046616 | Ga0495668_0019509 | Ga0495668_0019509_1584_2243 | 219 |
| 565 | 3300046665 | Ga0495661_0019091 | Ga0495661_0019091_1276_1935 | 219 |
| 566 | 3300046674 | Ga0495588_0014772 | Ga0495588_0014772_1436_2095 | 219 |
| 567 | 3300046691 | Ga0495670_0036040 | Ga0495670_0036040_685_1344 | 219 |
| 568 | 3300046692 | Ga0495671_0023073 | Ga0495671_0023073_1770_2429 | 219 |
| 569 | 3300047472 | Ga0495686_0009809 | Ga0495686_0009809_322_981 | 219 |
| 570 | 3300048091 | Ga0495626_0025409 | Ga0495626_0025409_228_887 | 219 |
| 571 | 3300048921 | Ga0496118_0045851 | Ga0496118_0045851_719_1378 | 219 |
| 572 | 3300048922 | Ga0496119_0062440 | Ga0496119_0062440_1539_2198 | 219 |
| 573 | 3300048923 | Ga0496120_0129526 | Ga0496120_0129526_490_1149 | 219 |
| 574 | 3300048924 | Ga0496121_0007839 | Ga0496121_0007839_2770_3429 | 219 |
| 575 | 3300048925 | Ga0496122_0236254 | Ga0496122_0236254_211_870 | 219 |
| 576 | 3300048926 | Ga0496123_0005272 | Ga0496123_0005272_824_1483 | 219 |
| 577 | 3300048927 | Ga0496124_0183136 | Ga0496124_0183136_638_1297 | 219 |
| 578 | 3300048928 | Ga0496125_0001573 | Ga0496125_0001573_12373_13032 | 219 |
| 579 | 3300048929 | Ga0496126_0048869 | Ga0496126_0048869_1109_1768 | 219 |
| 580 | 3300049823 | Ga0501044_0029827 | Ga0501044_0029827_3196_3855 | 219 |
| 581 | 3300050491 | nmdc:mga00v17_240704_c1 | nmdc:mga00v17_240704_c1_466_1125 | 219 |
| 582 | 3300050516 | nmdc:mga0sz30_73067_c1 | nmdc:mga0sz30_73067_c1_514_1173 | 219 |
| 583 | 3300053086 | Ga0500578_0063399 | Ga0500578_0063399_1554_2213 | 219 |
| 584 | 3300053087 | Ga0500643_031603 | Ga0500643_031603_812_1471 | 219 |
| 585 | 3300053093 | Ga0500651_0038106 | Ga0500651_0038106_578_1237 | 219 |
| 586 | 3300053096 | Ga0500641_0002266 | Ga0500641_0002266_1988_2647 | 219 |
| 587 | 3300053104 | Ga0500556_0000003 | Ga0500556_0000003_224549_225208 | 219 |
| 588 | 3300053108 | Ga0500562_035725 | Ga0500562_035725_324_983 | 219 |
| 589 | 3300053109 | Ga0500569_006211 | Ga0500569_006211_575_1234 | 219 |
| 590 | 3300053130 | Ga0500642_0000006 | Ga0500642_0000006_268331_268990 | 219 |
| 591 | 3300053131 | Ga0500652_098908 | Ga0500652_098908_308_967 | 219 |
| 592 | 3300053134 | Ga0500658_0153682 | Ga0500658_0153682_62_721 | 219 |
| 593 | 3300053153 | Ga0500616_0000033 | Ga0500616_0000033_299759_300418 | 219 |
| 594 | 3300053156 | Ga0500622_0001548 | Ga0500622_0001548_7805_8464 | 219 |
| 595 | 3300053158 | Ga0500627_0074921 | Ga0500627_0074921_571_1230 | 219 |
| 596 | 3300053730 | Ga0500645_018432 | Ga0500645_018432_823_1482 | 219 |
| 597 | 3300006038 | Ga0075365_10006887 | Ga0075365_100068875 | 220 |
| 598 | 3300048924 | Ga0496121_0276991 | Ga0496121_0276991_315_977 | 220 |
| 599 | 3300050492 | nmdc:mga0yw44_1059_c1 | nmdc:mga0yw44_1059_c1_3772_4434 | 220 |
| 600 | 3300050513 | nmdc:mga0rr50_107633_c1 | nmdc:mga0rr50_107633_c1_829_1500 | 220 |
| 601 | 3300003203 | JGI25406J46586_10025895 | JGI25406J46586_100258952 | 221 |
| 602 | 3300003203 | JGI25406J46586_10027405 | JGI25406J46586_100274051 | 221 |
| 603 | 3300003203 | JGI25406J46586_10035480 | JGI25406J46586_100354802 | 221 |
| 604 | 3300003659 | JGI25404J52841_10000578 | JGI25404J52841_100005784 | 221 |
| 605 | 3300003771 | Ga0055526_1000200 | Ga0055526_100020033 | 221 |
| 606 | 3300003775 | Ga0055524_1020229 | Ga0055524_10202293 | 221 |
| 607 | 3300003911 | JGI25405J52794_10009095 | JGI25405J52794_100090952 | 221 |
| 608 | 3300005329 | Ga0070683_100109723 | Ga0070683_1001097232 | 221 |
| 609 | 3300005329 | Ga0070683_100789481 | Ga0070683_1007894811 | 221 |
| 610 | 3300005330 | Ga0070690_100011676 | Ga0070690_1000116761 | 221 |
| 611 | 3300005334 | Ga0068869_100015289 | Ga0068869_1000152891 | 221 |
| 612 | 3300005334 | Ga0068869_100395732 | Ga0068869_1003957322 | 221 |
| 613 | 3300005336 | Ga0070680_100033740 | Ga0070680_1000337405 | 221 |
| 614 | 3300005337 | Ga0070682_100004797 | Ga0070682_1000047974 | 221 |
| 615 | 3300005338 | Ga0068868_100006085 | Ga0068868_1000060855 | 221 |
| 616 | 3300005340 | Ga0070689_100131593 | Ga0070689_1001315932 | 221 |
| 617 | 3300005341 | Ga0070691_10049164 | Ga0070691_100491643 | 221 |
| 618 | 3300005344 | Ga0070661_100437479 | Ga0070661_1004374791 | 221 |
| 619 | 3300005345 | Ga0070692_10008527 | Ga0070692_100085273 | 221 |
| 620 | 3300005347 | Ga0070668_100491618 | Ga0070668_1004916182 | 221 |
| 621 | 3300005353 | Ga0070669_100175184 | Ga0070669_1001751842 | 221 |
| 622 | 3300005353 | Ga0070669_100431049 | Ga0070669_1004310491 | 221 |
| 623 | 3300005355 | Ga0070671_100184948 | Ga0070671_1001849482 | 221 |
| 624 | 3300005355 | Ga0070671_100233496 | Ga0070671_1002334962 | 221 |
| 625 | 3300005355 | Ga0070671_100481329 | Ga0070671_1004813292 | 221 |
| 626 | 3300005356 | Ga0070674_100299507 | Ga0070674_1002995072 | 221 |
| 627 | 3300005364 | Ga0070673_100112949 | Ga0070673_1001129492 | 221 |
| 628 | 3300005364 | Ga0070673_100221808 | Ga0070673_1002218082 | 221 |
| 629 | 3300005365 | Ga0070688_100517420 | Ga0070688_1005174202 | 221 |
| 630 | 3300005367 | Ga0070667_100621099 | Ga0070667_1006210992 | 221 |
| 631 | 3300005367 | Ga0070667_100697199 | Ga0070667_1006971992 | 221 |
| 632 | 3300005406 | Ga0070703_10002171 | Ga0070703_100021714 | 221 |
| 633 | 3300005406 | Ga0070703_10044504 | Ga0070703_100445042 | 221 |
| 634 | 3300005434 | Ga0070709_10008649 | Ga0070709_100086492 | 221 |
| 635 | 3300005435 | Ga0070714_100052483 | Ga0070714_1000524832 | 221 |
| 636 | 3300005435 | Ga0070714_100084750 | Ga0070714_1000847504 | 221 |
| 637 | 3300005435 | Ga0070714_100222632 | Ga0070714_1002226323 | 221 |
| 638 | 3300005435 | Ga0070714_100789415 | Ga0070714_1007894151 | 221 |
| 639 | 3300005436 | Ga0070713_100040406 | Ga0070713_1000404064 | 221 |
| 640 | 3300005436 | Ga0070713_101097753 | Ga0070713_1010977531 | 221 |
| 641 | 3300005437 | Ga0070710_10005794 | Ga0070710_100057946 | 221 |
| 642 | 3300005437 | Ga0070710_10131912 | Ga0070710_101319122 | 221 |
| 643 | 3300005437 | Ga0070710_10138186 | Ga0070710_101381861 | 221 |
| 644 | 3300005438 | Ga0070701_10003786 | Ga0070701_100037865 | 221 |
| 645 | 3300005440 | Ga0070705_100005181 | Ga0070705_1000051811 | 221 |
| 646 | 3300005440 | Ga0070705_100034461 | Ga0070705_1000344612 | 221 |
| 647 | 3300005441 | Ga0070700_100011918 | Ga0070700_1000119185 | 221 |
| 648 | 3300005444 | Ga0070694_100003659 | Ga0070694_1000036595 | 221 |
| 649 | 3300005444 | Ga0070694_100101883 | Ga0070694_1001018832 | 221 |
| 650 | 3300005445 | Ga0070708_100176203 | Ga0070708_1001762032 | 221 |
| 651 | 3300005456 | Ga0070678_100055656 | Ga0070678_1000556563 | 221 |
| 652 | 3300005456 | Ga0070678_100209720 | Ga0070678_1002097202 | 221 |
| 653 | 3300005456 | Ga0070678_100685077 | Ga0070678_1006850772 | 221 |
| 654 | 3300005457 | Ga0070662_100027841 | Ga0070662_1000278415 | 221 |
| 655 | 3300005457 | Ga0070662_100187991 | Ga0070662_1001879912 | 221 |
| 656 | 3300005458 | Ga0070681_10001086 | Ga0070681_100010865 | 221 |
| 657 | 3300005459 | Ga0068867_100000546 | Ga0068867_10000054616 | 221 |
| 658 | 3300005459 | Ga0068867_100168536 | Ga0068867_1001685362 | 221 |
| 659 | 3300005466 | Ga0070685_10158514 | Ga0070685_101585141 | 221 |
| 660 | 3300005466 | Ga0070685_10220800 | Ga0070685_102208002 | 221 |
| 661 | 3300005467 | Ga0070706_100504794 | Ga0070706_1005047942 | 221 |
| 662 | 3300005467 | Ga0070706_100919450 | Ga0070706_1009194501 | 221 |
| 663 | 3300005468 | Ga0070707_100236424 | Ga0070707_1002364243 | 221 |
| 664 | 3300005468 | Ga0070707_100312962 | Ga0070707_1003129622 | 221 |
| 665 | 3300005471 | Ga0070698_100317315 | Ga0070698_1003173152 | 221 |
| 666 | 3300005471 | Ga0070698_100411619 | Ga0070698_1004116192 | 221 |
| 667 | 3300005518 | Ga0070699_100000609 | Ga0070699_10000060927 | 221 |
| 668 | 3300005518 | Ga0070699_100200939 | Ga0070699_1002009392 | 221 |
| 669 | 3300005518 | Ga0070699_100679677 | Ga0070699_1006796772 | 221 |
| 670 | 3300005530 | Ga0070679_100061552 | Ga0070679_1000615525 | 221 |
| 671 | 3300005530 | Ga0070679_100083819 | Ga0070679_1000838193 | 221 |
| 672 | 3300005530 | Ga0070679_100680949 | Ga0070679_1006809492 | 221 |
| 673 | 3300005536 | Ga0070697_100397572 | Ga0070697_1003975722 | 221 |
| 674 | 3300005539 | Ga0068853_100818973 | Ga0068853_1008189731 | 221 |
| 675 | 3300005543 | Ga0070672_100162396 | Ga0070672_1001623962 | 221 |
| 676 | 3300005544 | Ga0070686_100399486 | Ga0070686_1003994862 | 221 |
| 677 | 3300005545 | Ga0070695_100000971 | Ga0070695_1000009715 | 221 |
| 678 | 3300005545 | Ga0070695_100045287 | Ga0070695_1000452874 | 221 |
| 679 | 3300005545 | Ga0070695_100103725 | Ga0070695_1001037251 | 221 |
| 680 | 3300005546 | Ga0070696_100001450 | Ga0070696_10000145012 | 221 |
| 681 | 3300005547 | Ga0070693_100004829 | Ga0070693_1000048292 | 221 |
| 682 | 3300005548 | Ga0070665_100315349 | Ga0070665_1003153492 | 221 |
| 683 | 3300005549 | Ga0070704_100001063 | Ga0070704_10000106315 | 221 |
| 684 | 3300005549 | Ga0070704_100218539 | Ga0070704_1002185391 | 221 |
| 685 | 3300005563 | Ga0068855_100001718 | Ga0068855_1000017185 | 221 |
| 686 | 3300005577 | Ga0068857_100084017 | Ga0068857_1000840172 | 221 |
| 687 | 3300005578 | Ga0068854_100655802 | Ga0068854_1006558022 | 221 |
| 688 | 3300005615 | Ga0070702_100000771 | Ga0070702_1000007717 | 221 |
| 689 | 3300005615 | Ga0070702_100178919 | Ga0070702_1001789191 | 221 |
| 690 | 3300005616 | Ga0068852_100558397 | Ga0068852_1005583972 | 221 |
| 691 | 3300005617 | Ga0068859_100005571 | Ga0068859_1000055715 | 221 |
| 692 | 3300005617 | Ga0068859_100055540 | Ga0068859_1000555403 | 221 |
| 693 | 3300005617 | Ga0068859_100224910 | Ga0068859_1002249102 | 221 |
| 694 | 3300005618 | Ga0068864_100188249 | Ga0068864_1001882492 | 221 |
| 695 | 3300005718 | Ga0068866_10000362 | Ga0068866_100003629 | 221 |
| 696 | 3300005719 | Ga0068861_100001160 | Ga0068861_10000116015 | 221 |
| 697 | 3300005719 | Ga0068861_100010779 | Ga0068861_1000107794 | 221 |
| 698 | 3300005840 | Ga0068870_10109163 | Ga0068870_101091633 | 221 |
| 699 | 3300005843 | Ga0068860_100016914 | Ga0068860_1000169142 | 221 |
| 700 | 3300005844 | Ga0068862_100005139 | Ga0068862_1000051392 | 221 |
| 701 | 3300005844 | Ga0068862_100372021 | Ga0068862_1003720212 | 221 |
| 702 | 3300005844 | Ga0068862_100530238 | Ga0068862_1005302382 | 221 |
| 703 | 3300005937 | Ga0081455_10000079 | Ga0081455_1000007951 | 221 |
| 704 | 3300005937 | Ga0081455_10002810 | Ga0081455_1000281014 | 221 |
| 705 | 3300005937 | Ga0081455_10013137 | Ga0081455_100131372 | 221 |
| 706 | 3300005937 | Ga0081455_10401277 | Ga0081455_104012772 | 221 |
| 707 | 3300005937 | Ga0081455_10434248 | Ga0081455_104342481 | 221 |
| 708 | 3300005981 | Ga0081538_10015644 | Ga0081538_100156445 | 221 |
| 709 | 3300005983 | Ga0081540_1000008 | Ga0081540_100000886 | 221 |
| 710 | 3300005983 | Ga0081540_1000050 | Ga0081540_100005072 | 221 |
| 711 | 3300005983 | Ga0081540_1004321 | Ga0081540_100432111 | 221 |
| 712 | 3300005983 | Ga0081540_1034793 | Ga0081540_10347933 | 221 |
| 713 | 3300005985 | Ga0081539_10000539 | Ga0081539_1000053927 | 221 |
| 714 | 3300005985 | Ga0081539_10001341 | Ga0081539_100013416 | 221 |
| 715 | 3300005985 | Ga0081539_10057916 | Ga0081539_100579162 | 221 |
| 716 | 3300006028 | Ga0070717_10016819 | Ga0070717_100168196 | 221 |
| 717 | 3300006028 | Ga0070717_10054333 | Ga0070717_100543332 | 221 |
| 718 | 3300006028 | Ga0070717_10213617 | Ga0070717_102136172 | 221 |
| 719 | 3300006028 | Ga0070717_10326036 | Ga0070717_103260361 | 221 |
| 720 | 3300006028 | Ga0070717_10344113 | Ga0070717_103441132 | 221 |
| 721 | 3300006028 | Ga0070717_10344954 | Ga0070717_103449542 | 221 |
| 722 | 3300006028 | Ga0070717_10743259 | Ga0070717_107432592 | 221 |
| 723 | 3300006038 | Ga0075365_10005144 | Ga0075365_100051447 | 221 |
| 724 | 3300006038 | Ga0075365_10039270 | Ga0075365_100392703 | 221 |
| 725 | 3300006038 | Ga0075365_10412065 | Ga0075365_104120652 | 221 |
| 726 | 3300006048 | Ga0075363_100009008 | Ga0075363_1000090081 | 221 |
| 727 | 3300006051 | Ga0075364_10017908 | Ga0075364_100179086 | 221 |
| 728 | 3300006051 | Ga0075364_10076667 | Ga0075364_100766673 | 221 |
| 729 | 3300006163 | Ga0070715_10190711 | Ga0070715_101907112 | 221 |
| 730 | 3300006173 | Ga0070716_100022950 | Ga0070716_1000229504 | 221 |
| 731 | 3300006173 | Ga0070716_100283767 | Ga0070716_1002837672 | 221 |
| 732 | 3300006175 | Ga0070712_100022506 | Ga0070712_1000225064 | 221 |
| 733 | 3300006175 | Ga0070712_100082381 | Ga0070712_1000823814 | 221 |
| 734 | 3300006175 | Ga0070712_100696756 | Ga0070712_1006967561 | 221 |
| 735 | 3300006177 | Ga0075362_10123507 | Ga0075362_101235072 | 221 |
| 736 | 3300006178 | Ga0075367_10344917 | Ga0075367_103449171 | 221 |
| 737 | 3300006195 | Ga0075366_10012372 | Ga0075366_100123721 | 221 |
| 738 | 3300006237 | Ga0097621_100001467 | Ga0097621_10000146710 | 221 |
| 739 | 3300006358 | Ga0068871_100002626 | Ga0068871_1000026267 | 221 |
| 740 | 3300006358 | Ga0068871_100227181 | Ga0068871_1002271812 | 221 |
| 741 | 3300006844 | Ga0075428_100000594 | Ga0075428_10000059415 | 221 |
| 742 | 3300006844 | Ga0075428_100013937 | Ga0075428_1000139375 | 221 |
| 743 | 3300006844 | Ga0075428_100035781 | Ga0075428_1000357811 | 221 |
| 744 | 3300006844 | Ga0075428_100141149 | Ga0075428_1001411494 | 221 |
| 745 | 3300006844 | Ga0075428_100200991 | Ga0075428_1002009913 | 221 |
| 746 | 3300006844 | Ga0075428_100270359 | Ga0075428_1002703593 | 221 |
| 747 | 3300006846 | Ga0075430_100012732 | Ga0075430_1000127326 | 221 |
| 748 | 3300006846 | Ga0075430_100051633 | Ga0075430_1000516334 | 221 |
| 749 | 3300006846 | Ga0075430_100090019 | Ga0075430_1000900194 | 221 |
| 750 | 3300006846 | Ga0075430_100125816 | Ga0075430_1001258163 | 221 |
| 751 | 3300006847 | Ga0075431_100000202 | Ga0075431_10000020235 | 221 |
| 752 | 3300006847 | Ga0075431_100036230 | Ga0075431_1000362303 | 221 |
| 753 | 3300006847 | Ga0075431_100102517 | Ga0075431_1001025173 | 221 |
| 754 | 3300006847 | Ga0075431_100134895 | Ga0075431_1001348952 | 221 |
| 755 | 3300006847 | Ga0075431_100159940 | Ga0075431_1001599402 | 221 |
| 756 | 3300006847 | Ga0075431_100199545 | Ga0075431_1001995452 | 221 |
| 757 | 3300006847 | Ga0075431_100341011 | Ga0075431_1003410111 | 221 |
| 758 | 3300006847 | Ga0075431_100450967 | Ga0075431_1004509672 | 221 |
| 759 | 3300006852 | Ga0075433_10070633 | Ga0075433_100706332 | 221 |
| 760 | 3300006852 | Ga0075433_10252811 | Ga0075433_102528112 | 221 |
| 761 | 3300006852 | Ga0075433_10430365 | Ga0075433_104303652 | 221 |
| 762 | 3300006852 | Ga0075433_10459699 | Ga0075433_104596992 | 221 |
| 763 | 3300006871 | Ga0075434_100006228 | Ga0075434_1000062287 | 221 |
| 764 | 3300006871 | Ga0075434_100059874 | Ga0075434_1000598744 | 221 |
| 765 | 3300006871 | Ga0075434_100170174 | Ga0075434_1001701743 | 221 |
| 766 | 3300006871 | Ga0075434_100353039 | Ga0075434_1003530392 | 221 |
| 767 | 3300006880 | Ga0075429_100011751 | Ga0075429_1000117519 | 221 |
| 768 | 3300006880 | Ga0075429_100075151 | Ga0075429_1000751512 | 221 |
| 769 | 3300006880 | Ga0075429_100562991 | Ga0075429_1005629911 | 221 |
| 770 | 3300006880 | Ga0075429_100968039 | Ga0075429_1009680391 | 221 |
| 771 | 3300006881 | Ga0068865_100009339 | Ga0068865_1000093395 | 221 |
| 772 | 3300006881 | Ga0068865_100428839 | Ga0068865_1004288392 | 221 |
| 773 | 3300006931 | Ga0097620_100005571 | Ga0097620_1000055715 | 221 |
| 774 | 3300006931 | Ga0097620_100055541 | Ga0097620_1000555413 | 221 |
| 775 | 3300006931 | Ga0097620_100224920 | Ga0097620_1002249202 | 221 |
| 776 | 3300006946 | Ga0079104_1000029 | Ga0079104_1000029168 | 221 |
| 777 | 3300007076 | Ga0075435_100180101 | Ga0075435_1001801012 | 221 |
| 778 | 3300007076 | Ga0075435_100318633 | Ga0075435_1003186332 | 221 |
| 779 | 3300007265 | Ga0099794_10027620 | Ga0099794_100276203 | 221 |
| 780 | 3300007265 | Ga0099794_10034120 | Ga0099794_100341204 | 221 |
| 781 | 3300007788 | Ga0099795_10007995 | Ga0099795_100079952 | 221 |
| 782 | 3300009092 | Ga0105250_10071343 | Ga0105250_100713432 | 221 |
| 783 | 3300009093 | Ga0105240_10152105 | Ga0105240_101521052 | 221 |
| 784 | 3300009094 | Ga0111539_10000369 | Ga0111539_1000036915 | 221 |
| 785 | 3300009094 | Ga0111539_10010911 | Ga0111539_1001091110 | 221 |
| 786 | 3300009094 | Ga0111539_10906443 | Ga0111539_109064431 | 221 |
| 787 | 3300009098 | Ga0105245_10010838 | Ga0105245_100108384 | 221 |
| 788 | 3300009098 | Ga0105245_10102050 | Ga0105245_101020502 | 221 |
| 789 | 3300009098 | Ga0105245_10384068 | Ga0105245_103840682 | 221 |
| 790 | 3300009101 | Ga0105247_10143054 | Ga0105247_101430542 | 221 |
| 791 | 3300009147 | Ga0114129_10000329 | Ga0114129_1000032933 | 221 |
| 792 | 3300009147 | Ga0114129_10162752 | Ga0114129_101627524 | 221 |
| 793 | 3300009147 | Ga0114129_10186767 | Ga0114129_101867673 | 221 |
| 794 | 3300009147 | Ga0114129_10575640 | Ga0114129_105756402 | 221 |
| 795 | 3300009147 | Ga0114129_11461295 | Ga0114129_114612952 | 221 |
| 796 | 3300009148 | Ga0105243_10007704 | Ga0105243_100077047 | 221 |
| 797 | 3300009148 | Ga0105243_10013484 | Ga0105243_100134845 | 221 |
| 798 | 3300009148 | Ga0105243_11415390 | Ga0105243_114153901 | 221 |
| 799 | 3300009174 | Ga0105241_10032807 | Ga0105241_100328075 | 221 |
| 800 | 3300009174 | Ga0105241_10054961 | Ga0105241_100549613 | 221 |
| 801 | 3300009176 | Ga0105242_10006783 | Ga0105242_100067835 | 221 |
| 802 | 3300009176 | Ga0105242_10153506 | Ga0105242_101535062 | 221 |
| 803 | 3300009176 | Ga0105242_10423201 | Ga0105242_104232012 | 221 |
| 804 | 3300009177 | Ga0105248_10255360 | Ga0105248_102553603 | 221 |
| 805 | 3300009177 | Ga0105248_10329846 | Ga0105248_103298462 | 221 |
| 806 | 3300009177 | Ga0105248_11730123 | Ga0105248_117301231 | 221 |
| 807 | 3300009551 | Ga0105238_10259967 | Ga0105238_102599672 | 221 |
| 808 | 3300009551 | Ga0105238_11078645 | Ga0105238_110786451 | 221 |
| 809 | 3300009553 | Ga0105249_10013784 | Ga0105249_100137842 | 221 |
| 810 | 3300009553 | Ga0105249_10071214 | Ga0105249_100712143 | 221 |
| 811 | 3300009553 | Ga0105249_10669422 | Ga0105249_106694221 | 221 |
| 812 | 3300010159 | Ga0099796_10002974 | Ga0099796_100029745 | 221 |
| 813 | 3300010375 | Ga0105239_10103625 | Ga0105239_101036253 | 221 |
| 814 | 3300010375 | Ga0105239_11080591 | Ga0105239_110805911 | 221 |
| 815 | 3300011119 | Ga0105246_10474005 | Ga0105246_104740052 | 221 |
| 816 | 3300013100 | Ga0157373_10167085 | Ga0157373_101670852 | 221 |
| 817 | 3300013100 | Ga0157373_10260566 | Ga0157373_102605662 | 221 |
| 818 | 3300013102 | Ga0157371_10003256 | Ga0157371_100032566 | 221 |
| 819 | 3300013105 | Ga0157369_10216403 | Ga0157369_102164033 | 221 |
| 820 | 3300013105 | Ga0157369_10326879 | Ga0157369_103268792 | 221 |
| 821 | 3300013105 | Ga0157369_10509830 | Ga0157369_105098302 | 221 |
| 822 | 3300013297 | Ga0157378_10003376 | Ga0157378_1000337610 | 221 |
| 823 | 3300013297 | Ga0157378_10018011 | Ga0157378_100180112 | 221 |
| 824 | 3300013297 | Ga0157378_10423874 | Ga0157378_104238742 | 221 |
| 825 | 3300013306 | Ga0163162_10107534 | Ga0163162_101075342 | 221 |
| 826 | 3300014325 | Ga0163163_10002136 | Ga0163163_100021366 | 221 |
| 827 | 3300014325 | Ga0163163_10078397 | Ga0163163_100783972 | 221 |
| 828 | 3300014325 | Ga0163163_10154967 | Ga0163163_101549672 | 221 |
| 829 | 3300014326 | Ga0157380_10018569 | Ga0157380_100185693 | 221 |
| 830 | 3300014326 | Ga0157380_10168602 | Ga0157380_101686023 | 221 |
| 831 | 3300014326 | Ga0157380_10212947 | Ga0157380_102129472 | 221 |
| 832 | 3300014326 | Ga0157380_10490032 | Ga0157380_104900322 | 221 |
| 833 | 3300014968 | Ga0157379_10107425 | Ga0157379_101074254 | 221 |
| 834 | 3300014968 | Ga0157379_10199932 | Ga0157379_101999322 | 221 |
| 835 | 3300014969 | Ga0157376_10003105 | Ga0157376_100031052 | 221 |
| 836 | 3300014969 | Ga0157376_10019126 | Ga0157376_100191266 | 221 |
| 837 | 3300014969 | Ga0157376_11235141 | Ga0157376_112351411 | 221 |
| 838 | 3300017792 | Ga0163161_10016668 | Ga0163161_100166686 | 221 |
| 839 | 3300017792 | Ga0163161_10527199 | Ga0163161_105271992 | 221 |
| 840 | 3300021384 | Ga0213876_10026057 | Ga0213876_100260573 | 221 |
| 841 | 3300021384 | Ga0213876_10152283 | Ga0213876_101522832 | 221 |
| 842 | 3300021384 | Ga0213876_10183412 | Ga0213876_101834122 | 221 |
| 843 | 3300021388 | Ga0213875_10029465 | Ga0213875_100294654 | 221 |
| 844 | 3300024225 | Ga0224572_1008475 | Ga0224572_10084753 | 221 |
| 845 | 3300025295 | Ga0209564_1000043 | Ga0209564_100004386 | 221 |
| 846 | 3300025297 | Ga0209758_1007690 | Ga0209758_10076902 | 221 |
| 847 | 3300025299 | Ga0209256_1000545 | Ga0209256_100054542 | 221 |
| 848 | 3300025315 | Ga0207697_10081000 | Ga0207697_100810002 | 221 |
| 849 | 3300025885 | Ga0207653_10008773 | Ga0207653_100087732 | 221 |
| 850 | 3300025885 | Ga0207653_10117875 | Ga0207653_101178751 | 221 |
| 851 | 3300025893 | Ga0207682_10037193 | Ga0207682_100371931 | 221 |
| 852 | 3300025898 | Ga0207692_10001508 | Ga0207692_100015087 | 221 |
| 853 | 3300025898 | Ga0207692_10226036 | Ga0207692_102260362 | 221 |
| 854 | 3300025898 | Ga0207692_10330136 | Ga0207692_103301361 | 221 |
| 855 | 3300025900 | Ga0207710_10015448 | Ga0207710_100154483 | 221 |
| 856 | 3300025901 | Ga0207688_10042746 | Ga0207688_100427463 | 221 |
| 857 | 3300025904 | Ga0207647_10171457 | Ga0207647_101714572 | 221 |
| 858 | 3300025905 | Ga0207685_10035129 | Ga0207685_100351292 | 221 |
| 859 | 3300025907 | Ga0207645_10217713 | Ga0207645_102177132 | 221 |
| 860 | 3300025910 | Ga0207684_10004444 | Ga0207684_1000444412 | 221 |
| 861 | 3300025910 | Ga0207684_10092676 | Ga0207684_100926762 | 221 |
| 862 | 3300025910 | Ga0207684_10901755 | Ga0207684_109017551 | 221 |
| 863 | 3300025911 | Ga0207654_10032445 | Ga0207654_100324451 | 221 |
| 864 | 3300025913 | Ga0207695_10516225 | Ga0207695_105162252 | 221 |
| 865 | 3300025915 | Ga0207693_10025358 | Ga0207693_100253584 | 221 |
| 866 | 3300025915 | Ga0207693_10031529 | Ga0207693_100315294 | 221 |
| 867 | 3300025915 | Ga0207693_10133729 | Ga0207693_101337292 | 221 |
| 868 | 3300025915 | Ga0207693_10668429 | Ga0207693_106684291 | 221 |
| 869 | 3300025916 | Ga0207663_10223042 | Ga0207663_102230422 | 221 |
| 870 | 3300025916 | Ga0207663_10467601 | Ga0207663_104676012 | 221 |
| 871 | 3300025916 | Ga0207663_10605170 | Ga0207663_106051701 | 221 |
| 872 | 3300025917 | Ga0207660_10006875 | Ga0207660_100068757 | 221 |
| 873 | 3300025918 | Ga0207662_10000065 | Ga0207662_1000006530 | 221 |
| 874 | 3300025918 | Ga0207662_10024979 | Ga0207662_100249793 | 221 |
| 875 | 3300025918 | Ga0207662_10159902 | Ga0207662_101599022 | 221 |
| 876 | 3300025921 | Ga0207652_10124613 | Ga0207652_101246132 | 221 |
| 877 | 3300025922 | Ga0207646_10048348 | Ga0207646_100483484 | 221 |
| 878 | 3300025923 | Ga0207681_10305383 | Ga0207681_103053831 | 221 |
| 879 | 3300025924 | Ga0207694_10531429 | Ga0207694_105314291 | 221 |
| 880 | 3300025926 | Ga0207659_10102227 | Ga0207659_101022272 | 221 |
| 881 | 3300025927 | Ga0207687_10007409 | Ga0207687_100074092 | 221 |
| 882 | 3300025927 | Ga0207687_10158464 | Ga0207687_101584642 | 221 |
| 883 | 3300025927 | Ga0207687_10288188 | Ga0207687_102881881 | 221 |
| 884 | 3300025928 | Ga0207700_10016207 | Ga0207700_100162076 | 221 |
| 885 | 3300025928 | Ga0207700_10388172 | Ga0207700_103881722 | 221 |
| 886 | 3300025929 | Ga0207664_10040367 | Ga0207664_100403673 | 221 |
| 887 | 3300025929 | Ga0207664_10089861 | Ga0207664_100898612 | 221 |
| 888 | 3300025929 | Ga0207664_10099514 | Ga0207664_100995142 | 221 |
| 889 | 3300025929 | Ga0207664_10370197 | Ga0207664_103701972 | 221 |
| 890 | 3300025929 | Ga0207664_10523443 | Ga0207664_105234432 | 221 |
| 891 | 3300025931 | Ga0207644_10312934 | Ga0207644_103129342 | 221 |
| 892 | 3300025931 | Ga0207644_10663544 | Ga0207644_106635441 | 221 |
| 893 | 3300025932 | Ga0207690_10180760 | Ga0207690_101807602 | 221 |
| 894 | 3300025932 | Ga0207690_10495624 | Ga0207690_104956242 | 221 |
| 895 | 3300025933 | Ga0207706_10025916 | Ga0207706_100259163 | 221 |
| 896 | 3300025933 | Ga0207706_10064455 | Ga0207706_100644553 | 221 |
| 897 | 3300025933 | Ga0207706_10215971 | Ga0207706_102159712 | 221 |
| 898 | 3300025933 | Ga0207706_10669012 | Ga0207706_106690121 | 221 |
| 899 | 3300025935 | Ga0207709_10011883 | Ga0207709_100118833 | 221 |
| 900 | 3300025936 | Ga0207670_10109074 | Ga0207670_101090742 | 221 |
| 901 | 3300025936 | Ga0207670_10129912 | Ga0207670_101299122 | 221 |
| 902 | 3300025936 | Ga0207670_10433911 | Ga0207670_104339111 | 221 |
| 903 | 3300025936 | Ga0207670_10668920 | Ga0207670_106689202 | 221 |
| 904 | 3300025937 | Ga0207669_10012946 | Ga0207669_100129464 | 221 |
| 905 | 3300025937 | Ga0207669_10112591 | Ga0207669_101125912 | 221 |
| 906 | 3300025938 | Ga0207704_10023649 | Ga0207704_100236493 | 221 |
| 907 | 3300025938 | Ga0207704_10066243 | Ga0207704_100662433 | 221 |
| 908 | 3300025939 | Ga0207665_10014564 | Ga0207665_100145643 | 221 |
| 909 | 3300025939 | Ga0207665_10088398 | Ga0207665_100883983 | 221 |
| 910 | 3300025939 | Ga0207665_10127531 | Ga0207665_101275312 | 221 |
| 911 | 3300025939 | Ga0207665_10273598 | Ga0207665_102735982 | 221 |
| 912 | 3300025942 | Ga0207689_10000438 | Ga0207689_1000043814 | 221 |
| 913 | 3300025942 | Ga0207689_10303975 | Ga0207689_103039752 | 221 |
| 914 | 3300025944 | Ga0207661_10129668 | Ga0207661_101296682 | 221 |
| 915 | 3300025944 | Ga0207661_10721792 | Ga0207661_107217922 | 221 |
| 916 | 3300025945 | Ga0207679_10116041 | Ga0207679_101160411 | 221 |
| 917 | 3300025960 | Ga0207651_10171331 | Ga0207651_101713312 | 221 |
| 918 | 3300025961 | Ga0207712_10092184 | Ga0207712_100921842 | 221 |
| 919 | 3300025961 | Ga0207712_10739497 | Ga0207712_107394971 | 221 |
| 920 | 3300025972 | Ga0207668_10049211 | Ga0207668_100492112 | 221 |
| 921 | 3300025981 | Ga0207640_10561431 | Ga0207640_105614312 | 221 |
| 922 | 3300026023 | Ga0207677_10010414 | Ga0207677_100104144 | 221 |
| 923 | 3300026023 | Ga0207677_10862584 | Ga0207677_108625842 | 221 |
| 924 | 3300026067 | Ga0207678_10071215 | Ga0207678_100712153 | 221 |
| 925 | 3300026067 | Ga0207678_10218201 | Ga0207678_102182012 | 221 |
| 926 | 3300026067 | Ga0207678_10497040 | Ga0207678_104970402 | 221 |
| 927 | 3300026075 | Ga0207708_10000961 | Ga0207708_1000096122 | 221 |
| 928 | 3300026075 | Ga0207708_10168264 | Ga0207708_101682641 | 221 |
| 929 | 3300026088 | Ga0207641_10181299 | Ga0207641_101812992 | 221 |
| 930 | 3300026089 | Ga0207648_10000210 | Ga0207648_1000021062 | 221 |
| 931 | 3300026089 | Ga0207648_10121925 | Ga0207648_101219252 | 221 |
| 932 | 3300026118 | Ga0207675_100000473 | Ga0207675_10000047329 | 221 |
| 933 | 3300026118 | Ga0207675_100103181 | Ga0207675_1001031814 | 221 |
| 934 | 3300026118 | Ga0207675_100277917 | Ga0207675_1002779173 | 221 |
| 935 | 3300026121 | Ga0207683_10002061 | Ga0207683_1000206116 | 221 |
| 936 | 3300026121 | Ga0207683_10125234 | Ga0207683_101252343 | 221 |
| 937 | 3300026121 | Ga0207683_10138240 | Ga0207683_101382403 | 221 |
| 938 | 3300026142 | Ga0207698_10214236 | Ga0207698_102142362 | 221 |
| 939 | 3300027111 | Ga0209281_1000118 | Ga0209281_1000118161 | 221 |
| 940 | 3300027462 | Ga0210000_1005546 | Ga0210000_10055462 | 221 |
| 941 | 3300027471 | Ga0209995_1010877 | Ga0209995_10108772 | 221 |
| 942 | 3300027543 | Ga0209999_1000258 | Ga0209999_10002584 | 221 |
| 943 | 3300027671 | Ga0209588_1025122 | Ga0209588_10251222 | 221 |
| 944 | 3300027695 | Ga0209966_1000058 | Ga0209966_100005830 | 221 |
| 945 | 3300027876 | Ga0209974_10025440 | Ga0209974_100254403 | 221 |
| 946 | 3300027907 | Ga0207428_10006083 | Ga0207428_100060836 | 221 |
| 947 | 3300027907 | Ga0207428_10022374 | Ga0207428_100223746 | 221 |
| 948 | 3300028379 | Ga0268266_10508984 | Ga0268266_105089842 | 221 |
| 949 | 3300028380 | Ga0268265_10004813 | Ga0268265_100048133 | 221 |
| 950 | 3300028381 | Ga0268264_10059356 | Ga0268264_100593564 | 221 |
| 951 | 3300028381 | Ga0268264_10669895 | Ga0268264_106698952 | 221 |
| 952 | 3300028381 | Ga0268264_11175131 | Ga0268264_111751311 | 221 |
| 953 | 3300028800 | Ga0265338_10288969 | Ga0265338_102889692 | 221 |
| 954 | 3300030521 | Ga0307511_10000964 | Ga0307511_1000096427 | 221 |
| 955 | 3300031238 | Ga0265332_10093416 | Ga0265332_100934162 | 221 |
| 956 | 3300031241 | Ga0265325_10018690 | Ga0265325_100186903 | 221 |
| 957 | 3300031241 | Ga0265325_10052246 | Ga0265325_100522463 | 221 |
| 958 | 3300031242 | Ga0265329_10024025 | Ga0265329_100240252 | 221 |
| 959 | 3300031247 | Ga0265340_10033586 | Ga0265340_100335862 | 221 |
| 960 | 3300031247 | Ga0265340_10060264 | Ga0265340_100602642 | 221 |
| 961 | 3300031247 | Ga0265340_10159291 | Ga0265340_101592912 | 221 |
| 962 | 3300031249 | Ga0265339_10046918 | Ga0265339_100469182 | 221 |
| 963 | 3300031249 | Ga0265339_10158103 | Ga0265339_101581032 | 221 |
| 964 | 3300031250 | Ga0265331_10132943 | Ga0265331_101329431 | 221 |
| 965 | 3300031251 | Ga0265327_10059193 | Ga0265327_100591931 | 221 |
| 966 | 3300031344 | Ga0265316_10015448 | Ga0265316_100154483 | 221 |
| 967 | 3300031344 | Ga0265316_10173583 | Ga0265316_101735832 | 221 |
| 968 | 3300031344 | Ga0265316_10175146 | Ga0265316_101751462 | 221 |
| 969 | 3300031595 | Ga0265313_10057900 | Ga0265313_100579002 | 221 |
| 970 | 3300031712 | Ga0265342_10059052 | Ga0265342_100590521 | 221 |
| 971 | 3300031712 | Ga0265342_10069012 | Ga0265342_100690122 | 221 |
| 972 | 3300031712 | Ga0265342_10076058 | Ga0265342_100760582 | 221 |
| 973 | 3300034819 | Ga0373958_0020166 | Ga0373958_0020166_267_935 | 221 |
| 974 | 3300034820 | Ga0373959_0015312 | Ga0373959_0015312_292_960 | 221 |
| 975 | 3300035083 | Ga0373926_0000195 | Ga0373926_0000195_9106_9777 | 221 |
| 976 | 3300035092 | Ga0373952_0089523 | Ga0373952_0089523_117_785 | 221 |
| 977 | 3300035113 | Ga0373936_0000690 | Ga0373936_0000690_10808_11479 | 221 |
| 978 | 3300035114 | Ga0373939_0003205 | Ga0373939_0003205_886_1554 | 221 |
| 979 | 3300035114 | Ga0373939_0020267 | Ga0373939_0020267_253_924 | 221 |
| 980 | 3300035115 | Ga0373941_0009155 | Ga0373941_0009155_1310_1978 | 221 |
| 981 | 3300035115 | Ga0373941_0057439 | Ga0373941_0057439_238_906 | 221 |
| 982 | 3300035116 | Ga0373945_0031260 | Ga0373945_0031260_855_1520 | 221 |
| 983 | 3300035116 | Ga0373945_0128217 | Ga0373945_0128217_329_1000 | 221 |
| 984 | 3300035121 | Ga0373960_0002402 | Ga0373960_0002402_2855_3523 | 221 |
| 985 | 3300035121 | Ga0373960_0056340 | Ga0373960_0056340_136_807 | 221 |
| 986 | 3300035170 | Ga0373943_0001726 | Ga0373943_0001726_3240_3911 | 221 |
| 987 | 3300035170 | Ga0373943_0014469 | Ga0373943_0014469_11_676 | 221 |
| 988 | 3300035170 | Ga0373943_0123991 | Ga0373943_0123991_428_1093 | 221 |
| 989 | 3300035171 | Ga0373946_0002235 | Ga0373946_0002235_5679_6350 | 221 |
| 990 | 3300035171 | Ga0373946_0116727 | Ga0373946_0116727_148_813 | 221 |
| 991 | 3300035241 | Ga0373961_0014093 | Ga0373961_0014093_972_1640 | 221 |
| 992 | 3300035241 | Ga0373961_0038044 | Ga0373961_0038044_28_696 | 221 |
| 993 | 3300035242 | Ga0373962_0008778 | Ga0373962_0008778_447_1115 | 221 |
| 994 | 3300035691 | Ga0373931_0003181 | Ga0373931_0003181_5566_6234 | 221 |
| 995 | 3300035691 | Ga0373931_0008868 | Ga0373931_0008868_1938_2606 | 221 |
| 996 | 3300035691 | Ga0373931_0029645 | Ga0373931_0029645_1983_2654 | 221 |
| 997 | 3300035691 | Ga0373931_0061586 | Ga0373931_0061586_1080_1745 | 221 |
| 998 | 3300035692 | Ga0373935_0005776 | Ga0373935_0005776_6298_6969 | 221 |
| 999 | 3300035692 | Ga0373935_0011481 | Ga0373935_0011481_1300_1971 | 221 |
| 1000 | 3300035692 | Ga0373935_0103669 | Ga0373935_0103669_970_1635 | 221 |
| 1001 | 3300035692 | Ga0373935_0252399 | Ga0373935_0252399_491_1171 | 221 |
| 1002 | 3300035695 | Ga0373927_0004235 | Ga0373927_0004235_6106_6777 | 221 |
| 1003 | 3300035695 | Ga0373927_0165826 | Ga0373927_0165826_618_1298 | 221 |
| 1004 | 3300035724 | Ga0373933_0386934 | Ga0373933_0386934_80_745 | 221 |
| 1005 | 3300035725 | Ga0373947_0003323 | Ga0373947_0003323_6433_7104 | 221 |
| 1006 | 3300035725 | Ga0373947_0009876 | Ga0373947_0009876_3677_4357 | 221 |
| 1007 | 3300035725 | Ga0373947_0036819 | Ga0373947_0036819_208_873 | 221 |
| 1008 | 3300035725 | Ga0373947_0605505 | Ga0373947_0605505_38_703 | 221 |
| 1009 | 3300036401 | Ga0373937_0288338 | Ga0373937_0288338_189_869 | 221 |
| 1010 | 3300036712 | Ga0316584_0096222 | Ga0316584_0096222_59_724 | 221 |
| 1011 | 3300037068 | Ga0373925_0003648 | Ga0373925_0003648_4894_5565 | 221 |
| 1012 | 3300037068 | Ga0373925_0062614 | Ga0373925_0062614_2078_2749 | 221 |
| 1013 | 3300037068 | Ga0373925_0769336 | Ga0373925_0769336_66_731 | 221 |
| 1014 | 3300037418 | Ga0395900_0338071 | Ga0395900_0338071_662_1327 | 221 |
| 1015 | 3300037466 | Ga0395898_0110566 | Ga0395898_0110566_961_1626 | 221 |
| 1016 | 3300037471 | Ga0395905_0189564 | Ga0395905_0189564_336_1007 | 221 |
| 1017 | 3300037471 | Ga0395905_0776267 | Ga0395905_0776267_152_817 | 221 |
| 1018 | 3300037853 | Ga0436364_0024334 | Ga0436364_0024334_1252_1917 | 221 |
| 1019 | 3300037853 | Ga0436364_0036231 | Ga0436364_0036231_251_916 | 221 |
| 1020 | 3300037853 | Ga0436364_0102492 | Ga0436364_0102492_11285_11959 | 221 |
| 1021 | 3300037853 | Ga0436364_0604575 | Ga0436364_0604575_67_738 | 221 |
| 1022 | 3300037853 | Ga0436364_1368626 | Ga0436364_1368626_2147_2848 | 221 |
| 1023 | 3300038443 | Ga0395901_0066966 | Ga0395901_0066966_2937_3602 | 221 |
| 1024 | 3300039437 | Ga0436365_0079845 | Ga0436365_0079845_1048_1713 | 221 |
| 1025 | 3300039437 | Ga0436365_0116924 | Ga0436365_0116924_17_682 | 221 |
| 1026 | 3300039437 | Ga0436365_0129764 | Ga0436365_0129764_410_1075 | 221 |
| 1027 | 3300039437 | Ga0436365_0653192 | Ga0436365_0653192_991_1656 | 221 |
| 1028 | 3300039437 | Ga0436365_0763573 | Ga0436365_0763573_102_767 | 221 |
| 1029 | 3300039437 | Ga0436365_1191589 | Ga0436365_1191589_33_701 | 221 |
| 1030 | 3300039437 | Ga0436365_1712439 | Ga0436365_1712439_278_943 | 221 |
| 1031 | 3300039437 | Ga0436365_1731595 | Ga0436365_1731595_858_1523 | 221 |
| 1032 | 3300039438 | Ga0436360_0485582 | Ga0436360_0485582_422_1087 | 221 |
| 1033 | 3300039438 | Ga0436360_0638353 | Ga0436360_0638353_1380_2051 | 221 |
| 1034 | 3300039438 | Ga0436360_0878352 | Ga0436360_0878352_549_1214 | 221 |
| 1035 | 3300039438 | Ga0436360_1051847 | Ga0436360_1051847_502_1170 | 221 |
| 1036 | 3300039438 | Ga0436360_1282173 | Ga0436360_1282173_287_958 | 221 |
| 1037 | 3300039447 | Ga0436361_0602437 | Ga0436361_0602437_847_1512 | 221 |
| 1038 | 3300039450 | Ga0436363_0815889 | Ga0436363_0815889_20_685 | 221 |
| 1039 | 3300041408 | Ga0439453_0005684 | Ga0439453_0005684_959_1624 | 221 |
| 1040 | 3300041486 | Ga0451807_2679455 | Ga0451807_2679455_587_1258 | 221 |
| 1041 | 3300041512 | Ga0451853_2031171 | Ga0451853_2031171_220_885 | 221 |
| 1042 | 3300042001 | Ga0439441_009658 | Ga0439441_009658_795_1460 | 221 |
| 1043 | 3300042003 | Ga0439443_000435 | Ga0439443_000435_1632_2297 | 221 |
| 1044 | 3300042016 | Ga0439463_012567 | Ga0439463_012567_1158_1829 | 221 |
| 1045 | 3300042436 | Ga0439435_0007496 | Ga0439435_0007496_257_922 | 221 |
| 1046 | 3300042461 | Ga0439460_0010765 | Ga0439460_0010765_737_1402 | 221 |
| 1047 | 3300042876 | Ga0451577_0155692 | Ga0451577_0155692_1224_1895 | 221 |
| 1048 | 3300044735 | Ga0466968_0142555 | Ga0466968_0142555_300_971 | 221 |
| 1049 | 3300045049 | Ga0466959_0132286 | Ga0466959_0132286_35_700 | 221 |
| 1050 | 3300045051 | Ga0451576_0000675 | Ga0451576_0000675_31803_32474 | 221 |
| 1051 | 3300045051 | Ga0451576_0001560 | Ga0451576_0001560_6729_7400 | 221 |
| 1052 | 3300045051 | Ga0451576_0020927 | Ga0451576_0020927_5940_6611 | 221 |
| 1053 | 3300046455 | Ga0495603_0032349 | Ga0495603_0032349_2238_2909 | 221 |
| 1054 | 3300046455 | Ga0495603_0042369 | Ga0495603_0042369_1958_2623 | 221 |
| 1055 | 3300046458 | Ga0495591_022367 | Ga0495591_022367_354_1019 | 221 |
| 1056 | 3300046460 | Ga0495638_0012261 | Ga0495638_0012261_2939_3604 | 221 |
| 1057 | 3300046460 | Ga0495638_0106886 | Ga0495638_0106886_636_1301 | 221 |
| 1058 | 3300046460 | Ga0495638_0127966 | Ga0495638_0127966_596_1261 | 221 |
| 1059 | 3300046472 | Ga0495580_0001101 | Ga0495580_0001101_18159_18830 | 221 |
| 1060 | 3300046473 | Ga0495582_0032106 | Ga0495582_0032106_1904_2575 | 221 |
| 1061 | 3300046474 | Ga0495605_0017300 | Ga0495605_0017300_1277_1942 | 221 |
| 1062 | 3300046476 | Ga0495662_0053818 | Ga0495662_0053818_450_1115 | 221 |
| 1063 | 3300046491 | Ga0495584_0021909 | Ga0495584_0021909_2486_3151 | 221 |
| 1064 | 3300046491 | Ga0495584_0172803 | Ga0495584_0172803_238_903 | 221 |
| 1065 | 3300046492 | Ga0495585_0005753 | Ga0495585_0005753_5644_6309 | 221 |
| 1066 | 3300046500 | Ga0495596_0005581 | Ga0495596_0005581_3939_4604 | 221 |
| 1067 | 3300046501 | Ga0495607_0154453 | Ga0495607_0154453_40_705 | 221 |
| 1068 | 3300046513 | Ga0495616_0012462 | Ga0495616_0012462_719_1384 | 221 |
| 1069 | 3300046515 | Ga0495620_0103105 | Ga0495620_0103105_277_942 | 221 |
| 1070 | 3300046517 | Ga0495630_0264030 | Ga0495630_0264030_150_821 | 221 |
| 1071 | 3300046520 | Ga0495637_0032492 | Ga0495637_0032492_1240_1905 | 221 |
| 1072 | 3300046523 | Ga0495644_0001773 | Ga0495644_0001773_5372_6037 | 221 |
| 1073 | 3300046524 | Ga0495648_0028648 | Ga0495648_0028648_1203_1868 | 221 |
| 1074 | 3300046524 | Ga0495648_0202072 | Ga0495648_0202072_39_704 | 221 |
| 1075 | 3300046525 | Ga0495663_0001218 | Ga0495663_0001218_6108_6773 | 221 |
| 1076 | 3300046525 | Ga0495663_0039050 | Ga0495663_0039050_233_898 | 221 |
| 1077 | 3300046526 | Ga0495666_0001865 | Ga0495666_0001865_9334_10005 | 221 |
| 1078 | 3300046528 | Ga0495642_0049393 | Ga0495642_0049393_148_813 | 221 |
| 1079 | 3300046530 | Ga0495654_0001080 | Ga0495654_0001080_14380_15045 | 221 |
| 1080 | 3300046533 | Ga0495640_0238574 | Ga0495640_0238574_208_873 | 221 |
| 1081 | 3300046535 | Ga0495586_0007994 | Ga0495586_0007994_1664_2335 | 221 |
| 1082 | 3300046537 | Ga0495598_0000982 | Ga0495598_0000982_1208_1873 | 221 |
| 1083 | 3300046537 | Ga0495598_0045429 | Ga0495598_0045429_543_1223 | 221 |
| 1084 | 3300046538 | Ga0495609_0011376 | Ga0495609_0011376_302_967 | 221 |
| 1085 | 3300046542 | Ga0495597_0178523 | Ga0495597_0178523_163_828 | 221 |
| 1086 | 3300046558 | Ga0495633_0031180 | Ga0495633_0031180_805_1470 | 221 |
| 1087 | 3300046615 | Ga0495656_0007268 | Ga0495656_0007268_2709_3374 | 221 |
| 1088 | 3300046648 | Ga0495611_0005578 | Ga0495611_0005578_2198_2863 | 221 |
| 1089 | 3300046664 | Ga0495659_0009620 | Ga0495659_0009620_2265_2930 | 221 |
| 1090 | 3300046674 | Ga0495588_0016816 | Ga0495588_0016816_1585_2256 | 221 |
| 1091 | 3300046675 | Ga0495657_0182727 | Ga0495657_0182727_593_1258 | 221 |
| 1092 | 3300046681 | Ga0495647_0000948 | Ga0495647_0000948_5413_6084 | 221 |
| 1093 | 3300046683 | Ga0495658_0010802 | Ga0495658_0010802_586_1257 | 221 |
| 1094 | 3300046683 | Ga0495658_0067177 | Ga0495658_0067177_279_944 | 221 |
| 1095 | 3300046684 | Ga0495669_0007268 | Ga0495669_0007268_3688_4353 | 221 |
| 1096 | 3300046684 | Ga0495669_0091938 | Ga0495669_0091938_106_777 | 221 |
| 1097 | 3300046690 | Ga0495624_0140034 | Ga0495624_0140034_661_1341 | 221 |
| 1098 | 3300046692 | Ga0495671_0006022 | Ga0495671_0006022_1207_1872 | 221 |
| 1099 | 3300046694 | Ga0495649_0026038 | Ga0495649_0026038_511_1176 | 221 |
| 1100 | 3300046810 | Ga0495660_0065974 | Ga0495660_0065974_674_1339 | 221 |
| 1101 | 3300047318 | Ga0495636_0058461 | Ga0495636_0058461_776_1441 | 221 |
| 1102 | 3300047319 | Ga0495674_0218795 | Ga0495674_0218795_609_1274 | 221 |
| 1103 | 3300047320 | Ga0495672_0087001 | Ga0495672_0087001_557_1222 | 221 |
| 1104 | 3300047321 | Ga0495676_0007035 | Ga0495676_0007035_2674_3339 | 221 |
| 1105 | 3300047321 | Ga0495676_0019040 | Ga0495676_0019040_5266_5937 | 221 |
| 1106 | 3300047321 | Ga0495676_0025891 | Ga0495676_0025891_1536_2216 | 221 |
| 1107 | 3300047443 | Ga0495687_000388 | Ga0495687_000388_17011_17676 | 221 |
| 1108 | 3300047445 | Ga0495677_0008087 | Ga0495677_0008087_705_1370 | 221 |
| 1109 | 3300047446 | Ga0495679_043979 | Ga0495679_043979_300_965 | 221 |
| 1110 | 3300047447 | Ga0495685_024288 | Ga0495685_024288_1303_1968 | 221 |
| 1111 | 3300047471 | Ga0495684_0143697 | Ga0495684_0143697_676_1341 | 221 |
| 1112 | 3300048090 | Ga0495615_0001640 | Ga0495615_0001640_2022_2687 | 221 |
| 1113 | 3300048091 | Ga0495626_0109708 | Ga0495626_0109708_259_924 | 221 |
| 1114 | 3300048903 | Ga0496100_0017604 | Ga0496100_0017604_2299_2964 | 221 |
| 1115 | 3300048903 | Ga0496100_0097712 | Ga0496100_0097712_670_1350 | 221 |
| 1116 | 3300048903 | Ga0496100_0124854 | Ga0496100_0124854_858_1523 | 221 |
| 1117 | 3300048903 | Ga0496100_0472800 | Ga0496100_0472800_276_941 | 221 |
| 1118 | 3300048904 | Ga0496101_0030581 | Ga0496101_0030581_2524_3189 | 221 |
| 1119 | 3300048904 | Ga0496101_0076772 | Ga0496101_0076772_1675_2355 | 221 |
| 1120 | 3300048904 | Ga0496101_0094815 | Ga0496101_0094815_1185_1850 | 221 |
| 1121 | 3300048905 | Ga0496102_0022924 | Ga0496102_0022924_1499_2164 | 221 |
| 1122 | 3300048905 | Ga0496102_0235500 | Ga0496102_0235500_539_1219 | 221 |
| 1123 | 3300048905 | Ga0496102_0316762 | Ga0496102_0316762_94_762 | 221 |
| 1124 | 3300048906 | Ga0496103_0038473 | Ga0496103_0038473_1254_1919 | 221 |
| 1125 | 3300048907 | Ga0496104_0001994 | Ga0496104_0001994_10_690 | 221 |
| 1126 | 3300048907 | Ga0496104_0010317 | Ga0496104_0010317_188_853 | 221 |
| 1127 | 3300048907 | Ga0496104_0013248 | Ga0496104_0013248_4885_5550 | 221 |
| 1128 | 3300048907 | Ga0496104_0061181 | Ga0496104_0061181_1937_2602 | 221 |
| 1129 | 3300048908 | Ga0496105_0026267 | Ga0496105_0026267_2582_3247 | 221 |
| 1130 | 3300048908 | Ga0496105_0041867 | Ga0496105_0041867_1174_1839 | 221 |
| 1131 | 3300048908 | Ga0496105_0214395 | Ga0496105_0214395_490_1155 | 221 |
| 1132 | 3300048909 | Ga0496106_0006348 | Ga0496106_0006348_2546_3211 | 221 |
| 1133 | 3300048909 | Ga0496106_0037466 | Ga0496106_0037466_1901_2566 | 221 |
| 1134 | 3300048910 | Ga0496107_0043856 | Ga0496107_0043856_266_931 | 221 |
| 1135 | 3300048910 | Ga0496107_0108783 | Ga0496107_0108783_786_1451 | 221 |
| 1136 | 3300048910 | Ga0496107_0173346 | Ga0496107_0173346_207_872 | 221 |
| 1137 | 3300048911 | Ga0496108_0007201 | Ga0496108_0007201_207_887 | 221 |
| 1138 | 3300048911 | Ga0496108_0155646 | Ga0496108_0155646_377_1042 | 221 |
| 1139 | 3300048912 | Ga0496109_0002300 | Ga0496109_0002300_735_1415 | 221 |
| 1140 | 3300048912 | Ga0496109_0168093 | Ga0496109_0168093_1197_1862 | 221 |
| 1141 | 3300048912 | Ga0496109_0863253 | Ga0496109_0863253_128_793 | 221 |
| 1142 | 3300048913 | Ga0496110_0008186 | Ga0496110_0008186_1631_2299 | 221 |
| 1143 | 3300048913 | Ga0496110_0011792 | Ga0496110_0011792_3258_3923 | 221 |
| 1144 | 3300048913 | Ga0496110_0026348 | Ga0496110_0026348_2712_3392 | 221 |
| 1145 | 3300048913 | Ga0496110_0226986 | Ga0496110_0226986_248_913 | 221 |
| 1146 | 3300048913 | Ga0496110_0715883 | Ga0496110_0715883_208_873 | 221 |
| 1147 | 3300048914 | Ga0496111_0001890 | Ga0496111_0001890_3077_3757 | 221 |
| 1148 | 3300048914 | Ga0496111_0119894 | Ga0496111_0119894_1193_1861 | 221 |
| 1149 | 3300048915 | Ga0496112_0001865 | Ga0496112_0001865_353_1033 | 221 |
| 1150 | 3300048915 | Ga0496112_0181169 | Ga0496112_0181169_135_800 | 221 |
| 1151 | 3300048915 | Ga0496112_0563503 | Ga0496112_0563503_312_977 | 221 |
| 1152 | 3300048916 | Ga0496113_0000167 | Ga0496113_0000167_8950_9630 | 221 |
| 1153 | 3300048916 | Ga0496113_0132216 | Ga0496113_0132216_200_865 | 221 |
| 1154 | 3300048916 | Ga0496113_0175855 | Ga0496113_0175855_600_1265 | 221 |
| 1155 | 3300048916 | Ga0496113_0289307 | Ga0496113_0289307_428_1093 | 221 |
| 1156 | 3300048917 | Ga0496114_0051129 | Ga0496114_0051129_1332_1997 | 221 |
| 1157 | 3300048917 | Ga0496114_0073163 | Ga0496114_0073163_353_1033 | 221 |
| 1158 | 3300048917 | Ga0496114_0176244 | Ga0496114_0176244_980_1645 | 221 |
| 1159 | 3300048917 | Ga0496114_0187205 | Ga0496114_0187205_530_1195 | 221 |
| 1160 | 3300048918 | Ga0496115_0018777 | Ga0496115_0018777_1540_2220 | 221 |
| 1161 | 3300048918 | Ga0496115_0030258 | Ga0496115_0030258_2587_3252 | 221 |
| 1162 | 3300048918 | Ga0496115_0038959 | Ga0496115_0038959_1716_2381 | 221 |
| 1163 | 3300048918 | Ga0496115_0259112 | Ga0496115_0259112_400_1068 | 221 |
| 1164 | 3300048919 | Ga0496116_0000026 | Ga0496116_0000026_154462_155127 | 221 |
| 1165 | 3300048920 | Ga0496117_0044695 | Ga0496117_0044695_1367_2032 | 221 |
| 1166 | 3300048920 | Ga0496117_0092935 | Ga0496117_0092935_181_846 | 221 |
| 1167 | 3300048921 | Ga0496118_0029029 | Ga0496118_0029029_2655_3320 | 221 |
| 1168 | 3300048921 | Ga0496118_0189001 | Ga0496118_0189001_207_872 | 221 |
| 1169 | 3300048923 | Ga0496120_0123119 | Ga0496120_0123119_404_1069 | 221 |
| 1170 | 3300048924 | Ga0496121_0001905 | Ga0496121_0001905_8149_8814 | 221 |
| 1171 | 3300048924 | Ga0496121_0029508 | Ga0496121_0029508_3215_3916 | 221 |
| 1172 | 3300048926 | Ga0496123_0052936 | Ga0496123_0052936_868_1533 | 221 |
| 1173 | 3300048927 | Ga0496124_0035931 | Ga0496124_0035931_2767_3432 | 221 |
| 1174 | 3300048927 | Ga0496124_0048988 | Ga0496124_0048988_2167_2832 | 221 |
| 1175 | 3300048929 | Ga0496126_0000069 | Ga0496126_0000069_121554_122219 | 221 |
| 1176 | 3300048929 | Ga0496126_0007545 | Ga0496126_0007545_10975_11676 | 221 |
| 1177 | 3300049569 | Ga0501032_0182089 | Ga0501032_0182089_616_1320 | 221 |
| 1178 | 3300049570 | Ga0501033_0000666 | Ga0501033_0000666_28139_28843 | 221 |
| 1179 | 3300049571 | Ga0501034_0077714 | Ga0501034_0077714_1115_1780 | 221 |
| 1180 | 3300049571 | Ga0501034_0085624 | Ga0501034_0085624_1234_1911 | 221 |
| 1181 | 3300049572 | Ga0501036_0001754 | Ga0501036_0001754_934_1638 | 221 |
| 1182 | 3300049573 | Ga0501037_0063546 | Ga0501037_0063546_1358_2029 | 221 |
| 1183 | 3300049573 | Ga0501037_0485143 | Ga0501037_0485143_22_693 | 221 |
| 1184 | 3300049573 | Ga0501037_0578928 | Ga0501037_0578928_11_715 | 221 |
| 1185 | 3300049574 | Ga0501038_0002084 | Ga0501038_0002084_5016_5720 | 221 |
| 1186 | 3300049574 | Ga0501038_0295632 | Ga0501038_0295632_11_682 | 221 |
| 1187 | 3300049574 | Ga0501038_0384572 | Ga0501038_0384572_133_804 | 221 |
| 1188 | 3300049575 | Ga0501039_0011020 | Ga0501039_0011020_436_1107 | 221 |
| 1189 | 3300049575 | Ga0501039_0138193 | Ga0501039_0138193_72_743 | 221 |
| 1190 | 3300049575 | Ga0501039_0193256 | Ga0501039_0193256_192_863 | 221 |
| 1191 | 3300049575 | Ga0501039_0458357 | Ga0501039_0458357_80_754 | 221 |
| 1192 | 3300049576 | Ga0501040_0000304 | Ga0501040_0000304_23841_24545 | 221 |
| 1193 | 3300049576 | Ga0501040_0049568 | Ga0501040_0049568_1179_1850 | 221 |
| 1194 | 3300049576 | Ga0501040_0121838 | Ga0501040_0121838_786_1457 | 221 |
| 1195 | 3300049577 | Ga0501041_0000266 | Ga0501041_0000266_1204_1908 | 221 |
| 1196 | 3300049577 | Ga0501041_0027096 | Ga0501041_0027096_964_1635 | 221 |
| 1197 | 3300049577 | Ga0501041_0093683 | Ga0501041_0093683_1125_1796 | 221 |
| 1198 | 3300049577 | Ga0501041_0154012 | Ga0501041_0154012_108_773 | 221 |
| 1199 | 3300049578 | Ga0501042_0003926 | Ga0501042_0003926_1205_1909 | 221 |
| 1200 | 3300049578 | Ga0501042_0027014 | Ga0501042_0027014_2645_3316 | 221 |
| 1201 | 3300049578 | Ga0501042_0044922 | Ga0501042_0044922_1123_1794 | 221 |
| 1202 | 3300049578 | Ga0501042_0048605 | Ga0501042_0048605_1249_1914 | 221 |
| 1203 | 3300049579 | Ga0501043_0013517 | Ga0501043_0013517_27_731 | 221 |
| 1204 | 3300049580 | Ga0501046_0000413 | Ga0501046_0000413_157_861 | 221 |
| 1205 | 3300049580 | Ga0501046_0073066 | Ga0501046_0073066_1201_1872 | 221 |
| 1206 | 3300049582 | Ga0501048_0007453 | Ga0501048_0007453_2938_3642 | 221 |
| 1207 | 3300049582 | Ga0501048_0022525 | Ga0501048_0022525_437_1108 | 221 |
| 1208 | 3300049582 | Ga0501048_0227559 | Ga0501048_0227559_358_1029 | 221 |
| 1209 | 3300049582 | Ga0501048_0410020 | Ga0501048_0410020_141_812 | 221 |
| 1210 | 3300049583 | Ga0501067_0019042 | Ga0501067_0019042_832_1503 | 221 |
| 1211 | 3300049584 | Ga0501068_0046421 | Ga0501068_0046421_1249_1920 | 221 |
| 1212 | 3300049584 | Ga0501068_0222188 | Ga0501068_0222188_235_909 | 221 |
| 1213 | 3300049586 | Ga0501070_0045012 | Ga0501070_0045012_2923_3627 | 221 |
| 1214 | 3300049586 | Ga0501070_0495277 | Ga0501070_0495277_153_824 | 221 |
| 1215 | 3300049587 | Ga0501071_0001916 | Ga0501071_0001916_3698_4402 | 221 |
| 1216 | 3300049587 | Ga0501071_0007364 | Ga0501071_0007364_2327_2998 | 221 |
| 1217 | 3300049588 | Ga0501072_0003133 | Ga0501072_0003133_9004_9675 | 221 |
| 1218 | 3300049588 | Ga0501072_0008557 | Ga0501072_0008557_4757_5461 | 221 |
| 1219 | 3300049588 | Ga0501072_0009222 | Ga0501072_0009222_4292_4957 | 221 |
| 1220 | 3300049588 | Ga0501072_0010196 | Ga0501072_0010196_1098_1772 | 221 |
| 1221 | 3300049588 | Ga0501072_0104921 | Ga0501072_0104921_421_1092 | 221 |
| 1222 | 3300049590 | Ga0501074_0002421 | Ga0501074_0002421_11377_12081 | 221 |
| 1223 | 3300049590 | Ga0501074_0299769 | Ga0501074_0299769_169_834 | 221 |
| 1224 | 3300049591 | Ga0501075_0003585 | Ga0501075_0003585_1530_2234 | 221 |
| 1225 | 3300049591 | Ga0501075_0136695 | Ga0501075_0136695_1085_1750 | 221 |
| 1226 | 3300049592 | Ga0501076_0001446 | Ga0501076_0001446_4749_5453 | 221 |
| 1227 | 3300049592 | Ga0501076_0001483 | Ga0501076_0001483_2766_3437 | 221 |
| 1228 | 3300049592 | Ga0501076_0022711 | Ga0501076_0022711_2736_3407 | 221 |
| 1229 | 3300049592 | Ga0501076_0022723 | Ga0501076_0022723_295_960 | 221 |
| 1230 | 3300049592 | Ga0501076_0062208 | Ga0501076_0062208_617_1288 | 221 |
| 1231 | 3300049592 | Ga0501076_0120017 | Ga0501076_0120017_264_938 | 221 |
| 1232 | 3300049593 | Ga0501077_0003912 | Ga0501077_0003912_7915_8619 | 221 |
| 1233 | 3300049593 | Ga0501077_0113475 | Ga0501077_0113475_713_1384 | 221 |
| 1234 | 3300049741 | Ga0501079_0016515 | Ga0501079_0016515_3245_3916 | 221 |
| 1235 | 3300049741 | Ga0501079_0017526 | Ga0501079_0017526_148_852 | 221 |
| 1236 | 3300049742 | Ga0501080_0005621 | Ga0501080_0005621_5697_6368 | 221 |
| 1237 | 3300049742 | Ga0501080_0035001 | Ga0501080_0035001_3933_4637 | 221 |
| 1238 | 3300049743 | Ga0501081_0039325 | Ga0501081_0039325_378_1082 | 221 |
| 1239 | 3300049743 | Ga0501081_0141341 | Ga0501081_0141341_639_1310 | 221 |
| 1240 | 3300049743 | Ga0501081_0389709 | Ga0501081_0389709_69_743 | 221 |
| 1241 | 3300049744 | Ga0501083_0096736 | Ga0501083_0096736_526_1230 | 221 |
| 1242 | 3300049744 | Ga0501083_0178895 | Ga0501083_0178895_35_715 | 221 |
| 1243 | 3300049822 | Ga0501035_0033015 | Ga0501035_0033015_844_1548 | 221 |
| 1244 | 3300049823 | Ga0501044_0103882 | Ga0501044_0103882_1070_1774 | 221 |
| 1245 | 3300049824 | Ga0501045_0000295 | Ga0501045_0000295_378_1082 | 221 |
| 1246 | 3300049824 | Ga0501045_0007168 | Ga0501045_0007168_2437_3108 | 221 |
| 1247 | 3300049824 | Ga0501045_0072370 | Ga0501045_0072370_1713_2384 | 221 |
| 1248 | 3300049824 | Ga0501045_0177065 | Ga0501045_0177065_824_1495 | 221 |
| 1249 | 3300050489 | nmdc:mga03683_11477_c1 | nmdc:mga03683_11477_c1_244_909 | 221 |
| 1250 | 3300050489 | nmdc:mga03683_2429_c1 | nmdc:mga03683_2429_c1_964_1629 | 221 |
| 1251 | 3300050490 | nmdc:mga03n38_17332_c1 | nmdc:mga03n38_17332_c1_1542_2207 | 221 |
| 1252 | 3300050491 | nmdc:mga00v17_145119_c1 | nmdc:mga00v17_145119_c1_736_1401 | 221 |
| 1253 | 3300050491 | nmdc:mga00v17_82603_c1 | nmdc:mga00v17_82603_c1_991_1656 | 221 |
| 1254 | 3300050492 | nmdc:mga0yw44_1573_c1 | nmdc:mga0yw44_1573_c1_7853_8518 | 221 |
| 1255 | 3300050492 | nmdc:mga0yw44_18590_c1 | nmdc:mga0yw44_18590_c1_921_1586 | 221 |
| 1256 | 3300050492 | nmdc:mga0yw44_230281_c1 | nmdc:mga0yw44_230281_c1_485_1150 | 221 |
| 1257 | 3300050493 | nmdc:mga0k408_22647_c1 | nmdc:mga0k408_22647_c1_2665_3330 | 221 |
| 1258 | 3300050496 | nmdc:mga07m45_176188_c1 | nmdc:mga07m45_176188_c1_225_890 | 221 |
| 1259 | 3300050507 | nmdc:mga05p37_1030425_c1 | nmdc:mga05p37_1030425_c1_179_844 | 221 |
| 1260 | 3300050507 | nmdc:mga05p37_13349_c1 | nmdc:mga05p37_13349_c1_5773_6438 | 221 |
| 1261 | 3300050507 | nmdc:mga05p37_18147_c1 | nmdc:mga05p37_18147_c1_430_1101 | 221 |
| 1262 | 3300050507 | nmdc:mga05p37_375_c1 | nmdc:mga05p37_375_c1_12884_13549 | 221 |
| 1263 | 3300050508 | nmdc:mga09592_50873_c1 | nmdc:mga09592_50873_c1_1065_1730 | 221 |
| 1264 | 3300050508 | nmdc:mga09592_9811_c1 | nmdc:mga09592_9811_c1_6501_7166 | 221 |
| 1265 | 3300050509 | nmdc:mga0qj67_12117_c1 | nmdc:mga0qj67_12117_c1_2139_2807 | 221 |
| 1266 | 3300050509 | nmdc:mga0qj67_15530_c1 | nmdc:mga0qj67_15530_c1_227_895 | 221 |
| 1267 | 3300050509 | nmdc:mga0qj67_45584_c1 | nmdc:mga0qj67_45584_c1_2610_3275 | 221 |
| 1268 | 3300050510 | nmdc:mga06r32_152492_c1 | nmdc:mga06r32_152492_c1_687_1352 | 221 |
| 1269 | 3300050510 | nmdc:mga06r32_24989_c1 | nmdc:mga06r32_24989_c1_4191_4856 | 221 |
| 1270 | 3300050510 | nmdc:mga06r32_30461_c1 | nmdc:mga06r32_30461_c1_3228_3896 | 221 |
| 1271 | 3300050510 | nmdc:mga06r32_49808_c1 | nmdc:mga06r32_49808_c1_1493_2161 | 221 |
| 1272 | 3300050510 | nmdc:mga06r32_4_c1 | nmdc:mga06r32_4_c1_101843_102508 | 221 |
| 1273 | 3300050510 | nmdc:mga06r32_551046_c1 | nmdc:mga06r32_551046_c1_208_879 | 221 |
| 1274 | 3300050511 | nmdc:mga08y16_247461_c1 | nmdc:mga08y16_247461_c1_554_1219 | 221 |
| 1275 | 3300050511 | nmdc:mga08y16_348_c1 | nmdc:mga08y16_348_c1_11048_11713 | 221 |
| 1276 | 3300050511 | nmdc:mga08y16_756619_c1 | nmdc:mga08y16_756619_c1_153_818 | 221 |
| 1277 | 3300050511 | nmdc:mga08y16_8294_c1 | nmdc:mga08y16_8294_c1_9289_9957 | 221 |
| 1278 | 3300050512 | nmdc:mga0n895_1039876_c1 | nmdc:mga0n895_1039876_c1_11_676 | 221 |
| 1279 | 3300050512 | nmdc:mga0n895_162047_c1 | nmdc:mga0n895_162047_c1_1376_2050 | 221 |
| 1280 | 3300050512 | nmdc:mga0n895_33720_c1 | nmdc:mga0n895_33720_c1_1597_2265 | 221 |
| 1281 | 3300050512 | nmdc:mga0n895_35879_c1 | nmdc:mga0n895_35879_c1_1364_2032 | 221 |
| 1282 | 3300050512 | nmdc:mga0n895_392704_c1 | nmdc:mga0n895_392704_c1_279_944 | 221 |
| 1283 | 3300050513 | nmdc:mga0rr50_12254_c1 | nmdc:mga0rr50_12254_c1_3652_4320 | 221 |
| 1284 | 3300050513 | nmdc:mga0rr50_404287_c1 | nmdc:mga0rr50_404287_c1_229_894 | 221 |
| 1285 | 3300050514 | nmdc:mga08x19_194011_c1 | nmdc:mga08x19_194011_c1_706_1371 | 221 |
| 1286 | 3300050515 | nmdc:mga0a205_2122_c1 | nmdc:mga0a205_2122_c1_23_691 | 221 |
| 1287 | 3300050515 | nmdc:mga0a205_475509_c1 | nmdc:mga0a205_475509_c1_216_884 | 221 |
| 1288 | 3300050515 | nmdc:mga0a205_5700_c1 | nmdc:mga0a205_5700_c1_6136_6807 | 221 |
| 1289 | 3300050516 | nmdc:mga0sz30_98511_c1 | nmdc:mga0sz30_98511_c1_535_1218 | 221 |
| 1290 | 3300053077 | Ga0495601_0167447 | Ga0495601_0167447_714_1379 | 221 |
| 1291 | 3300053078 | Ga0495612_0031633 | Ga0495612_0031633_883_1548 | 221 |
| 1292 | 3300053079 | Ga0500610_0179717 | Ga0500610_0179717_160_825 | 221 |
| 1293 | 3300053083 | Ga0495655_0000541 | Ga0495655_0000541_2361_3026 | 221 |
| 1294 | 3300053085 | Ga0495619_0486244 | Ga0495619_0486244_157_822 | 221 |
| 1295 | 3300053098 | Ga0500650_0090972 | Ga0500650_0090972_210_884 | 221 |
| 1296 | 3300053103 | Ga0500555_001804 | Ga0500555_001804_4510_5184 | 221 |
| 1297 | 3300053117 | Ga0500593_002147 | Ga0500593_002147_442_1107 | 221 |
| 1298 | 3300053122 | Ga0500608_000841 | Ga0500608_000841_4963_5628 | 221 |
| 1299 | 3300053125 | Ga0500618_000843 | Ga0500618_000843_7975_8646 | 221 |
| 1300 | 3300053125 | Ga0500618_036333 | Ga0500618_036333_372_1037 | 221 |
| 1301 | 3300053130 | Ga0500642_0002570 | Ga0500642_0002570_3485_4159 | 221 |
| 1302 | 3300053133 | Ga0500655_001113 | Ga0500655_001113_195_878 | 221 |
| 1303 | 3300053139 | Ga0500568_0006823 | Ga0500568_0006823_1612_2286 | 221 |
| 1304 | 3300053139 | Ga0500568_0010309 | Ga0500568_0010309_821_1504 | 221 |
| 1305 | 3300053140 | Ga0500573_0172471 | Ga0500573_0172471_124_789 | 221 |
| 1306 | 3300053141 | Ga0500574_000110 | Ga0500574_000110_4348_5013 | 221 |
| 1307 | 3300053142 | Ga0500577_0010379 | Ga0500577_0010379_74_748 | 221 |
| 1308 | 3300053146 | Ga0500588_0090836 | Ga0500588_0090836_188_853 | 221 |
| 1309 | 3300053151 | Ga0500604_0003713 | Ga0500604_0003713_936_1619 | 221 |
| 1310 | 3300053151 | Ga0500604_0006665 | Ga0500604_0006665_2132_2806 | 221 |
| 1311 | 3300053158 | Ga0500627_0085903 | Ga0500627_0085903_30_704 | 221 |
| 1312 | 3300053177 | Ga0500636_0006124 | Ga0500636_0006124_2654_3319 | 221 |
| 1313 | 3300054114 | Ga0501084_0010451 | Ga0501084_0010451_2672_3343 | 221 |
| 1314 | 3300054114 | Ga0501084_0101727 | Ga0501084_0101727_791_1456 | 221 |
| 1315 | 3300054114 | Ga0501084_0217747 | Ga0501084_0217747_721_1392 | 221 |
| 1316 | 3300054114 | Ga0501084_0523183 | Ga0501084_0523183_32_703 | 221 |
| 1317 | 3300060353 | Ga0501082_0000438 | Ga0501082_0000438_36172_36876 | 221 |
| 1318 | 3300060353 | Ga0501082_0046888 | Ga0501082_0046888_781_1452 | 221 |
| 1319 | 3300060353 | Ga0501082_0082168 | Ga0501082_0082168_187_861 | 221 |
| 1320 | 3300061734 | Ga0530510_0001413 | Ga0530510_0001413_15215_15919 | 221 |
| 1321 | 3300061734 | Ga0530510_0297194 | Ga0530510_0297194_202_873 | 221 |
| 1322 | 3300061734 | Ga0530510_0297786 | Ga0530510_0297786_22_693 | 221 |
| 1323 | 3300061734 | Ga0530510_0660428 | Ga0530510_0660428_44_709 | 221 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
65
247
0.95
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ymu-assembly1.cif.gz_C | crystal structure of an amino acid abc transporter complex with arginines and atps | 0.8152 | 14 | 218 |
| 4ymu-assembly1.cif.gz_C | crystal structure of an amino acid abc transporter complex with arginines and atps | 0.781 | 14 | 218 |
| 7cad-assembly1.cif.gz_A | mycobacterium smegmatis sugabc complex | 0.7616 | 8 | 215 |
| 4jbw-assembly1.cif.gz_F | crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc | 0.7519 | 27 | 215 |
| 3dhw-assembly1.cif.gz_B | crystal structure of methionine importer metni | 0.7443 | 20 | 208 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P45768_144_364_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8476 | 28 | 219 | 1.10.3720.10 |
| af_P0AFT2_3_219_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8443 | 11 | 219 | 1.10.3720.10 |
| af_P0AEQ6_1_218_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8252 | 12 | 221 | 1.10.3720.10 |
| af_Q2FX86_270_484_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8214 | 14 | 221 | 1.10.3720.10 |
| af_P52094_1_222_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8179 | 14 | 221 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3V029-F1-model_v4 | Transporter substrate-binding domain-containing protein | 0.9598 | 9 | 163 |
GO:0006865
GO:0015276 GO:0043190 |
| AF-A0A659PV92-F1-model_v4 | Amino acid ABC transporter permease | 0.9431 | 11 | 164 |
GO:0015184
GO:0043190 |
| AF-X1R9Y8-F1-model_v4 | ABC transmembrane type-1 domain-containing protein | 0.9427 | 18 | 169 |
GO:0006865
GO:0022857 GO:0043190 |
| AF-A0A728BTM9-F1-model_v4 | ABC transporter permease subunit | 0.9415 | 11 | 162 |
GO:0015184
GO:0043190 |
| AF-E8KEL1-F1-model_v4 | ABC transporter, permease protein | 0.9387 | 9 | 163 |
GO:0006865
GO:0022857 GO:0043190 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar