F492955

General Info

Members Datasets Scaffolds Average Seq Length
1318 503 2636 144

Family's Representative Sequence

Representative Sequence 3300053097|Ga0500648_071668|Ga0500648_071668_56_520
Length 154
Sequence MTTDTTPHAVPDGYEPHFRRSPFTDPWEPLYSQRTDRAVILALRLAKPHTNSRGLIHGGLIAALADNAMGYSCGQVMSRGVGGEMGGQSSLVTISLAVDFIGSAQIGQWLAVESEVIRTGHTICFAQSLIKADEAVIARANATFRVVTKRAVVA

Samples

Sample ID Description Type Environment
1 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
9 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
80 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
83 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
84 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
85 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
86 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
87 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
88 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
89 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
90 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
91 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
92 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
97 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
98 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
99 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
104 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
105 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
106 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
107 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
108 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
109 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
110 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
112 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
113 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
115 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
116 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
117 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
118 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
119 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
120 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
121 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
122 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
123 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
124 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
125 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
126 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
127 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
128 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
129 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
130 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
131 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
132 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
133 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
134 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
135 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
136 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
137 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
138 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
139 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
140 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
141 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
144 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
146 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
210 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
211 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
212 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
214 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
215 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
216 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
220 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
221 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
222 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
223 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
224 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
225 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
226 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
227 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
228 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
229 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
230 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
231 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
232 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
233 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
234 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
235 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
236 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
237 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
238 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
239 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
240 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
241 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
242 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
243 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
244 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
245 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
246 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
247 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
248 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
249 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
250 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
251 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
252 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
253 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
254 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
255 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
256 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
257 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
258 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
259 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
260 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
261 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
262 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
263 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
264 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
265 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
266 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
267 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
268 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
269 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
270 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
271 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
272 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
273 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
274 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
275 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
276 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
277 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
278 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
279 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
280 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
281 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
282 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
283 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
284 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
285 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
286 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
287 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
288 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
289 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
290 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
291 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
292 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
293 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
294 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
295 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
296 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
297 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
298 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
299 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
300 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
301 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
302 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
303 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
304 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
305 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
306 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
307 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
308 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
309 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
310 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
311 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
312 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
313 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
314 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
315 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
316 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
317 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
318 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
319 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
320 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
321 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
322 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
323 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
324 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
325 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
326 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
327 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
328 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
329 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
330 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
331 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
332 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
333 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
334 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
335 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
336 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
337 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
338 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
339 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
340 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
341 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
342 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
343 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
344 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
345 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
346 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
347 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
348 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
349 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
350 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
351 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
352 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
353 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
354 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
355 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
356 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
357 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
358 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
359 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
360 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
361 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
362 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
363 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
364 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
365 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
366 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
367 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
368 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
369 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
370 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
371 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
372 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
373 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
374 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
375 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
376 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
377 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
378 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
379 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
380 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
381 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
382 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
383 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
384 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
385 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
386 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
387 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
388 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
389 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
390 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
391 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
392 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
393 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
394 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
395 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
396 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
397 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
398 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
399 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
400 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
401 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
402 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
403 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
404 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
405 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
406 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
407 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
408 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
409 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
410 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
411 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
412 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
413 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
414 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
415 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
416 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
417 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
418 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
419 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
420 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
421 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
422 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
423 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
424 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
425 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
426 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
427 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
428 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
429 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
430 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
431 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
432 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
433 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
434 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
435 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
436 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
437 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
438 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
439 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
440 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
441 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
442 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
443 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
444 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
445 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
446 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
447 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
448 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
449 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
450 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
451 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
452 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
453 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
454 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
455 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
456 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
457 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
458 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
459 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
460 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
461 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
462 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
463 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
464 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
465 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
466 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
467 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
468 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
469 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
470 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
471 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
472 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
473 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
474 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
475 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
476 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
477 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
478 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
479 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
480 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
481 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
482 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
483 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
484 2904699407
485 2906610324
486 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
487 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
488 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
489 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
490 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
491 2922425934
492 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
493 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
494 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
495 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
496 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
497 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
498 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
499 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
500 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
501 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
502 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
503 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.41
Metatranscriptomes 0
Isolates 2.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.37
Nodule 2.5
Rhizoplane 6.9
Rhizosphere 72.38
Stem 0
Stem Tuber 0
Unclassified 0.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500648_071668 3300053097 Bacteria 1958
2 JGI24744J21845_10038047 3300002077 Bacteria 905
3 JGI25165J46597_1006290 3300003214 Bacteria 2120
4 JGI25165J46597_1028343 3300003214 Bacteria 723
5 JGI25153J46596_10032912 3300003215 Bacteria 1720
6 rootH2_10000947 3300003320 Bacteria 1921
7 JGI25160J50197_1002717 3300003354 Bacteria 8137
8 JGI25160J50197_1047327 3300003354 Bacteria 936
9 JGI25404J52841_10101509 3300003659 Bacteria 603
10 Ga0055539_1002207 3300003752 Bacteria 3094
11 Ga0055529_1004345 3300003763 Bacteria 2168
12 Ga0055529_1034042 3300003763 Bacteria 622
13 Ga0055526_1031085 3300003771 Bacteria 1540
14 Ga0055531_10005040 3300003794 Bacteria 7829
15 Ga0055543_1006115 3300004625 Bacteria 2964
16 Ga0065165_1002365 3300005262 Bacteria 16315
17 Ga0065165_1009969 3300005262 Bacteria 4179
18 Ga0070658_10103008 3300005327 Bacteria 2360
19 Ga0070658_10182122 3300005327 Bacteria 1768
20 Ga0070658_10292635 3300005327 Bacteria 1388
21 Ga0070658_11280166 3300005327 Bacteria 637
22 Ga0070676_10865643 3300005328 Bacteria 671
23 Ga0070676_10918115 3300005328 Bacteria 653
24 Ga0070690_100071372 3300005330 Bacteria 2256
25 Ga0070690_100071567 3300005330 Bacteria 2253
26 Ga0070670_101064560 3300005331 Bacteria 737
27 Ga0070670_101372890 3300005331 Bacteria 647
28 Ga0068869_100113815 3300005334 Bacteria 2061
29 Ga0068869_100175542 3300005334 Bacteria 1676
30 Ga0068869_100592412 3300005334 Bacteria 936
31 Ga0068869_100644735 3300005334 Bacteria 898
32 Ga0068869_101039746 3300005334 Bacteria 714
33 Ga0068869_101372215 3300005334 Bacteria 625
34 Ga0070666_10421153 3300005335 Bacteria 962
35 Ga0070666_10539424 3300005335 Bacteria 848
36 Ga0070680_100013830 3300005336 Bacteria 6296
37 Ga0070680_100032348 3300005336 Bacteria 4210
38 Ga0070680_100065382 3300005336 Bacteria 2980
39 Ga0070680_100221429 3300005336 Bacteria 1597
40 Ga0070682_100027255 3300005337 Bacteria 3428
41 Ga0070682_100513577 3300005337 Bacteria 931
42 Ga0070682_100909222 3300005337 Bacteria 724
43 Ga0070682_101359303 3300005337 Bacteria 606
44 Ga0070682_101461079 3300005337 Bacteria 586
45 Ga0068868_100050101 3300005338 Bacteria 3278
46 Ga0068868_100208887 3300005338 Bacteria 1631
47 Ga0068868_100468311 3300005338 Bacteria 1099
48 Ga0068868_100937391 3300005338 Bacteria 789
49 Ga0068868_100955070 3300005338 Bacteria 782
50 Ga0068868_101345856 3300005338 Bacteria 664
51 Ga0068868_101369740 3300005338 Bacteria 659
52 Ga0070660_100053169 3300005339 Bacteria 3123
53 Ga0070660_100200218 3300005339 Bacteria 1620
54 Ga0070660_100420662 3300005339 Bacteria 1106
55 Ga0070660_101058602 3300005339 Bacteria 686
56 Ga0070660_101083313 3300005339 Bacteria 678
57 Ga0070691_10340603 3300005341 Bacteria 830
58 Ga0070691_10464654 3300005341 Bacteria 725
59 Ga0070661_100739301 3300005344 Bacteria 804
60 Ga0070661_100784881 3300005344 Bacteria 781
61 Ga0070661_101387666 3300005344 Bacteria 591
62 Ga0070668_100024341 3300005347 Bacteria 4586
63 Ga0070668_100059725 3300005347 Bacteria 2951
64 Ga0070668_100091702 3300005347 Bacteria 2396
65 Ga0070668_100211016 3300005347 Bacteria 1597
66 Ga0070668_100241381 3300005347 Bacteria 1497
67 Ga0070668_100244840 3300005347 Bacteria 1486
68 Ga0070668_100355770 3300005347 Bacteria 1240
69 Ga0070668_100693725 3300005347 Bacteria 897
70 Ga0070668_100724415 3300005347 Bacteria 879
71 Ga0070668_100928861 3300005347 Bacteria 779
72 Ga0070669_100115968 3300005353 Bacteria 2038
73 Ga0070669_100122830 3300005353 Bacteria 1983
74 Ga0070669_100396359 3300005353 Bacteria 1128
75 Ga0070669_101131874 3300005353 Bacteria 675
76 Ga0070675_100302007 3300005354 Bacteria 1410
77 Ga0070675_100340784 3300005354 Bacteria 1328
78 Ga0070675_100573817 3300005354 Bacteria 1021
79 Ga0070671_100360218 3300005355 Bacteria 1242
80 Ga0070671_100491034 3300005355 Bacteria 1056
81 Ga0070671_100868957 3300005355 Bacteria 787
82 Ga0070671_101203392 3300005355 Unclassified 667
83 Ga0070674_100007000 3300005356 Bacteria 6623
84 Ga0070674_101103076 3300005356 Bacteria 701
85 Ga0070673_100295924 3300005364 Bacteria 1424
86 Ga0070688_100042378 3300005365 Bacteria 2800
87 Ga0070688_100104508 3300005365 Bacteria 1873
88 Ga0070659_100107453 3300005366 Bacteria 2250
89 Ga0070659_100174441 3300005366 Bacteria 1763
90 Ga0070667_100348731 3300005367 Bacteria 1340
91 Ga0070667_100485286 3300005367 Bacteria 1132
92 Ga0070667_100501518 3300005367 Bacteria 1113
93 Ga0070667_100986208 3300005367 Bacteria 786
94 Ga0070709_10001773 3300005434 Bacteria 11730
95 Ga0070714_100005907 3300005435 Bacteria 9391
96 Ga0070714_100551144 3300005435 Bacteria 1104
97 Ga0070714_101434259 3300005435 Bacteria 674
98 Ga0070713_100053086 3300005436 Bacteria 3358
99 Ga0070713_100225914 3300005436 Bacteria 1700
100 Ga0070710_10000733 3300005437 Bacteria 15629
101 Ga0070710_10018624 3300005437 Bacteria 3575
102 Ga0070710_11068529 3300005437 Unclassified 591
103 Ga0070701_10232593 3300005438 Bacteria 1105
104 Ga0070701_10726150 3300005438 Bacteria 671
105 Ga0070711_100005722 3300005439 Bacteria 7454
106 Ga0070711_100310649 3300005439 Bacteria 1256
107 Ga0070711_101033773 3300005439 Bacteria 706
108 Ga0070705_100484487 3300005440 Bacteria 935
109 Ga0070700_100293027 3300005441 Bacteria 1185
110 Ga0070694_101485840 3300005444 Bacteria 573
111 Ga0070708_101953017 3300005445 Bacteria 544
112 Ga0070663_100032985 3300005455 Bacteria 3574
113 Ga0070663_100052860 3300005455 Bacteria 2898
114 Ga0070663_100120480 3300005455 Bacteria 1981
115 Ga0070663_100166574 3300005455 Bacteria 1700
116 Ga0070663_100177156 3300005455 Bacteria 1651
117 Ga0070663_100180931 3300005455 Bacteria 1635
118 Ga0070663_101403445 3300005455 Bacteria 618
119 Ga0070678_100059864 3300005456 Bacteria 2800
120 Ga0070678_100105195 3300005456 Bacteria 2196
121 Ga0070678_100133310 3300005456 Bacteria 1977
122 Ga0070678_100146766 3300005456 Bacteria 1895
123 Ga0070678_100335365 3300005456 Bacteria 1295
124 Ga0070678_100351547 3300005456 Bacteria 1267
125 Ga0070678_100543393 3300005456 Bacteria 1031
126 Ga0070678_100730967 3300005456 Bacteria 894
127 Ga0070678_101334487 3300005456 Bacteria 668
128 Ga0070662_100141228 3300005457 Bacteria 1866
129 Ga0070662_101159435 3300005457 Bacteria 664
130 Ga0070662_101482603 3300005457 Bacteria 585
131 Ga0070681_10006411 3300005458 Bacteria 11447
132 Ga0070681_10014525 3300005458 Bacteria 7837
133 Ga0070681_10173382 3300005458 Bacteria 2078
134 Ga0070681_10316432 3300005458 Bacteria 1470
135 Ga0068867_100227394 3300005459 Bacteria 1506
136 Ga0068867_100318977 3300005459 Bacteria 1287
137 Ga0068867_100559410 3300005459 Bacteria 992
138 Ga0070685_10065354 3300005466 Bacteria 2141
139 Ga0070685_10758507 3300005466 Bacteria 712
140 Ga0070699_101130510 3300005518 Bacteria 719
141 Ga0070679_100013787 3300005530 Bacteria 7745
142 Ga0070679_100015371 3300005530 Bacteria 7354
143 Ga0070679_100018490 3300005530 Bacteria 6764
144 Ga0070684_100038107 3300005535 Bacteria 4128
145 Ga0070684_100355186 3300005535 Bacteria 1348
146 Ga0070684_101053956 3300005535 Bacteria 764
147 Ga0070697_100591225 3300005536 Bacteria 975
148 Ga0068853_100148054 3300005539 Bacteria 2112
149 Ga0068853_100721262 3300005539 Bacteria 952
150 Ga0068853_100795427 3300005539 Bacteria 905
151 Ga0068853_101833490 3300005539 Bacteria 588
152 Ga0070672_100053512 3300005543 Bacteria 3156
153 Ga0070672_100135006 3300005543 Bacteria 2031
154 Ga0070672_100232844 3300005543 Bacteria 1548
155 Ga0070686_100141921 3300005544 Bacteria 1673
156 Ga0070693_100062734 3300005547 Bacteria 2164
157 Ga0070693_100110273 3300005547 Bacteria 1692
158 Ga0070693_100143578 3300005547 Bacteria 1505
159 Ga0070693_100229771 3300005547 Bacteria 1220
160 Ga0070693_100384930 3300005547 Bacteria 968
161 Ga0070693_100877263 3300005547 Bacteria 671
162 Ga0070693_101104579 3300005547 Bacteria 605
163 Ga0070665_100038699 3300005548 Bacteria 4794
164 Ga0070665_100039004 3300005548 Bacteria 4776
165 Ga0070665_100060150 3300005548 Bacteria 3808
166 Ga0070665_100062787 3300005548 Bacteria 3724
167 Ga0070665_100122817 3300005548 Bacteria 2599
168 Ga0070665_100502647 3300005548 Bacteria 1223
169 Ga0070665_100629922 3300005548 Bacteria 1085
170 Ga0070665_100645084 3300005548 Bacteria 1072
171 Ga0070665_101402522 3300005548 Bacteria 708
172 Ga0070665_101689334 3300005548 Bacteria 640
173 Ga0070704_100830695 3300005549 Bacteria 827
174 Ga0068855_100027307 3300005563 Bacteria 6830
175 Ga0068855_100096562 3300005563 Bacteria 3404
176 Ga0068855_100160273 3300005563 Bacteria 2554
177 Ga0068855_100621766 3300005563 Bacteria 1163
178 Ga0068855_100765320 3300005563 Bacteria 1029
179 Ga0068855_100940564 3300005563 Bacteria 911
180 Ga0070664_100170152 3300005564 Bacteria 1932
181 Ga0070664_100182911 3300005564 Bacteria 1864
182 Ga0070664_101287003 3300005564 Bacteria 690
183 Ga0070664_101328258 3300005564 Bacteria 679
184 Ga0068857_100160318 3300005577 Bacteria 2041
185 Ga0068857_100271642 3300005577 Bacteria 1558
186 Ga0068857_100483314 3300005577 Bacteria 1161
187 Ga0068854_100647908 3300005578 Bacteria 907
188 Ga0068854_101306410 3300005578 Bacteria 653
189 Ga0068856_100037566 3300005614 Bacteria 4752
190 Ga0068856_100101906 3300005614 Bacteria 2864
191 Ga0068856_100202019 3300005614 Bacteria 2002
192 Ga0068856_100327317 3300005614 Bacteria 1550
193 Ga0070702_100037919 3300005615 Bacteria 2679
194 Ga0070702_100771055 3300005615 Bacteria 741
195 Ga0068852_100070895 3300005616 Bacteria 3058
196 Ga0068852_100084397 3300005616 Bacteria 2826
197 Ga0068852_100193465 3300005616 Bacteria 1921
198 Ga0068852_100350839 3300005616 Bacteria 1441
199 Ga0068852_101999120 3300005616 Bacteria 602
200 Ga0068859_100133974 3300005617 Bacteria 2549
201 Ga0068859_100379271 3300005617 Bacteria 1509
202 Ga0068859_100518138 3300005617 Bacteria 1287
203 Ga0068859_102220546 3300005617 Bacteria 605
204 Ga0068864_100386511 3300005618 Bacteria 1327
205 Ga0068864_100544940 3300005618 Bacteria 1121
206 Ga0068864_100977991 3300005618 Bacteria 838
207 Ga0068864_101296246 3300005618 Bacteria 729
208 Ga0068864_101321049 3300005618 Bacteria 722
209 Ga0068866_10036437 3300005718 Bacteria 2410
210 Ga0068866_10360428 3300005718 Bacteria 927
211 Ga0068866_10656744 3300005718 Bacteria 715
212 Ga0068861_100112343 3300005719 Bacteria 2184
213 Ga0068861_100266273 3300005719 Bacteria 1469
214 Ga0068851_10040575 3300005834 Bacteria 2339
215 Ga0068851_10093102 3300005834 Bacteria 1589
216 Ga0068851_10480322 3300005834 Bacteria 743
217 Ga0068870_10119581 3300005840 Bacteria 1516
218 Ga0068870_10772218 3300005840 Bacteria 669
219 Ga0068863_100279928 3300005841 Bacteria 1616
220 Ga0068863_100796162 3300005841 Bacteria 943
221 Ga0068863_101055557 3300005841 Bacteria 816
222 Ga0068863_101928836 3300005841 Bacteria 601
223 Ga0068858_100150877 3300005842 Bacteria 2185
224 Ga0068858_100184242 3300005842 Bacteria 1972
225 Ga0068858_100284128 3300005842 Bacteria 1576
226 Ga0068858_100440736 3300005842 Bacteria 1254
227 Ga0068858_100573225 3300005842 Bacteria 1094
228 Ga0068858_100785126 3300005842 Bacteria 929
229 Ga0068858_100897084 3300005842 Bacteria 867
230 Ga0068858_101751567 3300005842 Bacteria 614
231 Ga0068858_102368535 3300005842 Bacteria 525
232 Ga0068860_100000313 3300005843 Bacteria 66545
233 Ga0068860_100108777 3300005843 Bacteria 2649
234 Ga0068860_100222614 3300005843 Bacteria 1832
235 Ga0068860_100232285 3300005843 Bacteria 1792
236 Ga0068860_100329950 3300005843 Bacteria 1498
237 Ga0068862_100065140 3300005844 Bacteria 3138
238 Ga0068862_100398886 3300005844 Bacteria 1286
239 Ga0068862_101367367 3300005844 Bacteria 711
240 Ga0081455_10006340 3300005937 Bacteria 12701
241 Ga0081455_10029773 3300005937 Bacteria 4973
242 Ga0081455_10090122 3300005937 Bacteria 2487
243 Ga0081455_10364194 3300005937 Bacteria 1015
244 Ga0081538_10112325 3300005981 Bacteria 1334
245 Ga0081540_1002866 3300005983 Bacteria 13942
246 Ga0081540_1008557 3300005983 Bacteria 7138
247 Ga0081540_1012286 3300005983 Bacteria 5653
248 Ga0081540_1015992 3300005983 Bacteria 4725
249 Ga0081540_1095572 3300005983 Bacteria 1295
250 Ga0081540_1140862 3300005983 Bacteria 968
251 Ga0070717_10034976 3300006028 Bacteria 4063
252 Ga0070717_10065227 3300006028 Bacteria 3027
253 Ga0070717_10081829 3300006028 Bacteria 2712
254 Ga0070717_10556685 3300006028 Bacteria 1039
255 Ga0075365_10060159 3300006038 Bacteria 2533
256 Ga0075365_10120189 3300006038 Bacteria 1812
257 Ga0075365_10120491 3300006038 Bacteria 1809
258 Ga0075365_10238705 3300006038 Bacteria 1276
259 Ga0075365_10366829 3300006038 Bacteria 1015
260 Ga0075365_10698467 3300006038 Bacteria 716
261 Ga0075365_10812657 3300006038 Bacteria 660
262 Ga0075368_10002578 3300006042 Bacteria 5945
263 Ga0075368_10094681 3300006042 Bacteria 1223
264 Ga0075368_10116137 3300006042 Bacteria 1106
265 Ga0075363_100003641 3300006048 Bacteria 6610
266 Ga0075363_100012959 3300006048 Bacteria 4027
267 Ga0075363_100522246 3300006048 Bacteria 706
268 Ga0075363_100838329 3300006048 Bacteria 560
269 Ga0075364_10148444 3300006051 Bacteria 1579
270 Ga0075364_10226694 3300006051 Bacteria 1269
271 Ga0075432_10030829 3300006058 Bacteria 1855
272 Ga0070715_10973969 3300006163 Bacteria 527
273 Ga0070716_100008438 3300006173 Bacteria 5110
274 Ga0070716_100353041 3300006173 Bacteria 1041
275 Ga0070716_100511245 3300006173 Bacteria 888
276 Ga0070716_101198403 3300006173 Bacteria 610
277 Ga0070712_100009263 3300006175 Bacteria 6203
278 Ga0070712_100112642 3300006175 Bacteria 2033
279 Ga0070712_100320151 3300006175 Bacteria 1261
280 Ga0070712_100881676 3300006175 Bacteria 771
281 Ga0070712_100963777 3300006175 Bacteria 737
282 Ga0075367_10095272 3300006178 Bacteria 1815
283 Ga0075367_10107681 3300006178 Bacteria 1708
284 Ga0075367_10110818 3300006178 Bacteria 1684
285 Ga0075367_10129327 3300006178 Bacteria 1560
286 Ga0075367_10180577 3300006178 Bacteria 1316
287 Ga0075367_10380841 3300006178 Bacteria 891
288 Ga0075367_10498548 3300006178 Bacteria 772
289 Ga0075367_10787041 3300006178 Bacteria 606
290 Ga0075369_10039844 3300006186 Bacteria 2007
291 Ga0075369_10042198 3300006186 Bacteria 1955
292 Ga0075369_10142739 3300006186 Bacteria 1092
293 Ga0075369_10581603 3300006186 Bacteria 535
294 Ga0075366_10026120 3300006195 Bacteria 3418
295 Ga0075366_10529080 3300006195 Bacteria 729
296 Ga0075366_10595369 3300006195 Bacteria 685
297 Ga0097621_100311052 3300006237 Bacteria 1393
298 Ga0097621_100344412 3300006237 Bacteria 1324
299 Ga0097621_101178311 3300006237 Bacteria 721
300 Ga0097621_101799642 3300006237 Bacteria 584
301 Ga0075370_10084808 3300006353 Bacteria 1823
302 Ga0075370_10143111 3300006353 Bacteria 1398
303 Ga0075370_10201685 3300006353 Bacteria 1173
304 Ga0068871_100147970 3300006358 Bacteria 2001
305 Ga0068871_100239668 3300006358 Bacteria 1576
306 Ga0068871_100656134 3300006358 Bacteria 958
307 Ga0068871_100857917 3300006358 Bacteria 840
308 Ga0068871_102222520 3300006358 Bacteria 523
309 Ga0075428_100210354 3300006844 Bacteria 2102
310 Ga0075431_101637427 3300006847 Bacteria 601
311 Ga0075433_10654776 3300006852 Bacteria 921
312 Ga0075433_10941443 3300006852 Bacteria 753
313 Ga0075433_11371333 3300006852 Bacteria 612
314 Ga0075434_100738263 3300006871 Bacteria 1002
315 Ga0075434_101320281 3300006871 Bacteria 732
316 Ga0075434_101427718 3300006871 Bacteria 702
317 Ga0075434_101643424 3300006871 Bacteria 651
318 Ga0068865_100044082 3300006881 Bacteria 3051
319 Ga0068865_100087977 3300006881 Bacteria 2246
320 Ga0068865_100227390 3300006881 Bacteria 1462
321 Ga0068865_100548291 3300006881 Bacteria 971
322 Ga0075436_100613809 3300006914 Bacteria 802
323 Ga0097620_100133980 3300006931 Bacteria 2549
324 Ga0097620_100379283 3300006931 Bacteria 1509
325 Ga0097620_100518107 3300006931 Bacteria 1287
326 Ga0097620_102220600 3300006931 Bacteria 605
327 Ga0099824_1023299 3300006942 Bacteria 3871
328 Ga0099822_1000541 3300006943 Bacteria 35996
329 Ga0075435_100678376 3300007076 Bacteria 895
330 Ga0075435_100751095 3300007076 Bacteria 849
331 Ga0099794_10413957 3300007265 Bacteria 705
332 Ga0099795_10009533 3300007788 Bacteria 2822
333 Ga0099795_10043172 3300007788 Bacteria 1612
334 Ga0099795_10126162 3300007788 Bacteria 1028
335 Ga0105250_10421506 3300009092 Bacteria 595
336 Ga0105240_10013303 3300009093 Bacteria 11310
337 Ga0105240_10033307 3300009093 Bacteria 6659
338 Ga0105240_10143904 3300009093 Bacteria 2847
339 Ga0105240_10533120 3300009093 Bacteria 1301
340 Ga0111539_10284392 3300009094 Bacteria 1925
341 Ga0111539_12021495 3300009094 Bacteria 668
342 Ga0105245_10332453 3300009098 Bacteria 1500
343 Ga0105245_11709597 3300009098 Bacteria 682
344 Ga0105245_11730132 3300009098 Bacteria 678
345 Ga0105245_12060319 3300009098 Bacteria 624
346 Ga0105247_10196398 3300009101 Bacteria 1353
347 Ga0105247_10216033 3300009101 Bacteria 1296
348 Ga0105247_10327871 3300009101 Bacteria 1070
349 Ga0105247_10681775 3300009101 Bacteria 771
350 Ga0105247_11028037 3300009101 Bacteria 645
351 Ga0114129_10759367 3300009147 Bacteria 1241
352 Ga0105243_10036778 3300009148 Bacteria 3802
353 Ga0105243_10037774 3300009148 Bacteria 3757
354 Ga0105243_10466393 3300009148 Bacteria 1188
355 Ga0105243_12711526 3300009148 Bacteria 536
356 Ga0105243_12940348 3300009148 Unclassified 517
357 Ga0105241_10038277 3300009174 Bacteria 3615
358 Ga0105241_10075194 3300009174 Bacteria 2632
359 Ga0105241_10184164 3300009174 Bacteria 1734
360 Ga0105241_10235173 3300009174 Bacteria 1546
361 Ga0105241_10254163 3300009174 Bacteria 1491
362 Ga0105241_10723271 3300009174 Bacteria 911
363 Ga0105241_11509653 3300009174 Bacteria 647
364 Ga0105241_11700082 3300009174 Bacteria 613
365 Ga0105242_10094350 3300009176 Bacteria 2524
366 Ga0105242_10194312 3300009176 Bacteria 1799
367 Ga0105242_10320081 3300009176 Bacteria 1422
368 Ga0105242_10500984 3300009176 Bacteria 1155
369 Ga0105242_10758218 3300009176 Bacteria 956
370 Ga0105242_10954961 3300009176 Bacteria 862
371 Ga0105248_10118079 3300009177 Bacteria 2992
372 Ga0105248_10219712 3300009177 Bacteria 2139
373 Ga0105248_10270435 3300009177 Bacteria 1914
374 Ga0105248_10790504 3300009177 Bacteria 1071
375 Ga0105248_10933935 3300009177 Bacteria 980
376 Ga0105237_10002301 3300009545 Bacteria 23744
377 Ga0105237_10066311 3300009545 Bacteria 3605
378 Ga0105237_10083853 3300009545 Bacteria 3178
379 Ga0105237_10106054 3300009545 Bacteria 2802
380 Ga0105237_10144169 3300009545 Bacteria 2376
381 Ga0105237_10199553 3300009545 Bacteria 2000
382 Ga0105237_10838032 3300009545 Bacteria 926
383 Ga0105237_10992353 3300009545 Bacteria 847
384 Ga0105237_11133613 3300009545 Bacteria 789
385 Ga0105237_11180523 3300009545 Bacteria 772
386 Ga0105237_11807952 3300009545 Bacteria 619
387 Ga0105238_10085459 3300009551 Bacteria 3142
388 Ga0105238_10331061 3300009551 Bacteria 1510
389 Ga0105238_10407218 3300009551 Bacteria 1354
390 Ga0105238_10692882 3300009551 Bacteria 1031
391 Ga0105238_10799859 3300009551 Bacteria 958
392 Ga0105238_10867024 3300009551 Bacteria 920
393 Ga0105238_12370575 3300009551 Bacteria 566
394 Ga0105249_10079381 3300009553 Bacteria 3046
395 Ga0105249_10279317 3300009553 Bacteria 1667
396 Ga0105249_10426279 3300009553 Bacteria 1361
397 Ga0105249_10511956 3300009553 Bacteria 1247
398 Ga0105249_11122948 3300009553 Bacteria 856
399 Ga0105249_12838852 3300009553 Bacteria 556
400 Ga0099796_10043454 3300010159 Bacteria 1531
401 Ga0099796_10077483 3300010159 Bacteria 1213
402 Ga0099796_10131497 3300010159 Bacteria 971
403 Ga0099796_10134138 3300010159 Bacteria 963
404 Ga0099796_10432845 3300010159 Bacteria 582
405 Ga0105239_10035625 3300010375 Bacteria 5465
406 Ga0105239_10131830 3300010375 Bacteria 2781
407 Ga0105239_10140782 3300010375 Bacteria 2688
408 Ga0105239_10305305 3300010375 Bacteria 1792
409 Ga0105239_10409787 3300010375 Bacteria 1535
410 Ga0105239_10410225 3300010375 Bacteria 1534
411 Ga0105239_10570694 3300010375 Bacteria 1289
412 Ga0105239_10647769 3300010375 Bacteria 1207
413 Ga0105239_10655442 3300010375 Bacteria 1199
414 Ga0105239_11058262 3300010375 Bacteria 933
415 Ga0105239_11182910 3300010375 Bacteria 881
416 Ga0105239_11679802 3300010375 Bacteria 735
417 Ga0105239_12483383 3300010375 Bacteria 604
418 Ga0105239_13232696 3300010375 Bacteria 530
419 Ga0105246_10011987 3300011119 Bacteria 5397
420 Ga0105246_10035946 3300011119 Bacteria 3315
421 Ga0105246_10097071 3300011119 Bacteria 2137
422 Ga0105246_10541703 3300011119 Bacteria 996
423 Ga0105246_10863156 3300011119 Bacteria 808
424 Ga0105246_11228098 3300011119 Bacteria 691
425 Ga0105246_11573969 3300011119 Bacteria 620
426 Ga0105246_11843621 3300011119 Bacteria 579
427 Ga0105246_12019615 3300011119 Bacteria 557
428 Ga0157373_10293719 3300013100 Bacteria 1153
429 Ga0157373_10758846 3300013100 Bacteria 713
430 Ga0157370_10035301 3300013104 Bacteria 4862
431 Ga0157370_10141009 3300013104 Bacteria 2246
432 Ga0157369_10018692 3300013105 Bacteria 7770
433 Ga0157369_10094646 3300013105 Bacteria 3188
434 Ga0157369_10282633 3300013105 Bacteria 1728
435 Ga0157369_10601392 3300013105 Bacteria 1135
436 Ga0157374_10030777 3300013296 Bacteria 4875
437 Ga0157374_10357940 3300013296 Bacteria 1451
438 Ga0157374_10561190 3300013296 Bacteria 1150
439 Ga0157374_11207787 3300013296 Bacteria 777
440 Ga0157374_11947040 3300013296 Bacteria 614
441 Ga0157378_10155205 3300013297 Bacteria 2136
442 Ga0157378_10219928 3300013297 Bacteria 1805
443 Ga0157378_10710510 3300013297 Bacteria 1025
444 Ga0157378_12058940 3300013297 Bacteria 621
445 Ga0157378_13244901 3300013297 Bacteria 505
446 Ga0163162_10026136 3300013306 Bacteria 5769
447 Ga0163162_10031643 3300013306 Bacteria 5248
448 Ga0163162_10183057 3300013306 Bacteria 2221
449 Ga0163162_10242953 3300013306 Bacteria 1932
450 Ga0163162_10272397 3300013306 Bacteria 1825
451 Ga0163162_10591125 3300013306 Bacteria 1237
452 Ga0163162_10741575 3300013306 Bacteria 1102
453 Ga0163162_11419048 3300013306 Bacteria 790
454 Ga0163162_11770137 3300013306 Bacteria 706
455 Ga0157372_10030290 3300013307 Bacteria 5919
456 Ga0157372_10075935 3300013307 Bacteria 3793
457 Ga0157372_10148606 3300013307 Bacteria 2703
458 Ga0157375_10046484 3300013308 Bacteria 4233
459 Ga0157375_10149571 3300013308 Bacteria 2469
460 Ga0157375_10267498 3300013308 Bacteria 1871
461 Ga0157375_10391815 3300013308 Bacteria 1556
462 Ga0157375_10487036 3300013308 Bacteria 1398
463 Ga0157375_11018709 3300013308 Bacteria 967
464 Ga0157375_12882274 3300013308 Bacteria 575
465 Ga0163163_10007500 3300014325 Bacteria 9629
466 Ga0163163_10050743 3300014325 Bacteria 4087
467 Ga0163163_10078610 3300014325 Bacteria 3296
468 Ga0163163_10092490 3300014325 Bacteria 3040
469 Ga0163163_10342092 3300014325 Bacteria 1551
470 Ga0163163_10447602 3300014325 Bacteria 1351
471 Ga0163163_10489450 3300014325 Bacteria 1291
472 Ga0163163_10892774 3300014325 Bacteria 952
473 Ga0163163_11654517 3300014325 Bacteria 701
474 Ga0157380_10047597 3300014326 Bacteria 3374
475 Ga0157380_10315015 3300014326 Bacteria 1448
476 Ga0157380_10424194 3300014326 Bacteria 1270
477 Ga0157380_11114370 3300014326 Bacteria 829
478 Ga0157380_11570670 3300014326 Bacteria 713
479 Ga0157380_13050852 3300014326 Bacteria 534
480 Ga0182008_10106991 3300014497 Bacteria 1384
481 Ga0157377_10034041 3300014745 Bacteria 2785
482 Ga0157377_10082310 3300014745 Bacteria 1884
483 Ga0157377_10292193 3300014745 Bacteria 1072
484 Ga0157377_10505589 3300014745 Bacteria 845
485 Ga0157377_11009761 3300014745 Bacteria 631
486 Ga0157379_10092557 3300014968 Bacteria 2712
487 Ga0157379_10202799 3300014968 Bacteria 1794
488 Ga0157379_10204212 3300014968 Bacteria 1787
489 Ga0157379_10209807 3300014968 Bacteria 1763
490 Ga0157379_10255138 3300014968 Bacteria 1593
491 Ga0157379_12345560 3300014968 Bacteria 532
492 Ga0157376_10007382 3300014969 Bacteria 7842
493 Ga0157376_10146405 3300014969 Bacteria 2125
494 Ga0157376_10323650 3300014969 Bacteria 1466
495 Ga0157376_10510367 3300014969 Bacteria 1183
496 Ga0157376_10723427 3300014969 Bacteria 1002
497 Ga0157376_11085604 3300014969 Bacteria 826
498 Ga0157376_11329341 3300014969 Bacteria 749
499 Ga0157376_11388012 3300014969 Bacteria 734
500 Ga0157376_11627103 3300014969 Bacteria 680
501 Ga0157376_11708976 3300014969 Bacteria 665
502 Ga0182005_1124178 3300015265 Bacteria 737
503 Ga0163161_10025323 3300017792 Bacteria 4199
504 Ga0163161_10260401 3300017792 Bacteria 1355
505 Ga0163161_10440455 3300017792 Bacteria 1052
506 Ga0163161_10722028 3300017792 Bacteria 831
507 Ga0213876_10080161 3300021384 Bacteria 1726
508 Ga0213876_10194281 3300021384 Bacteria 1079
509 Ga0213876_10377566 3300021384 Bacteria 754
510 Ga0209677_102422 3300025253 Bacteria 7047
511 Ga0209148_1010927 3300025254 Bacteria 1703
512 Ga0209148_1019214 3300025254 Bacteria 1137
513 Ga0209233_1002344 3300025261 Bacteria 7057
514 Ga0209233_1023913 3300025261 Bacteria 1537
515 Ga0209455_1002785 3300025272 Bacteria 6531
516 Ga0209455_1006260 3300025272 Bacteria 3542
517 Ga0209758_1031951 3300025297 Bacteria 2148
518 Ga0207697_10016037 3300025315 Bacteria 3090
519 Ga0207656_10057503 3300025321 Bacteria 1697
520 Ga0207656_10252237 3300025321 Bacteria 865
521 Ga0207696_1069607 3300025711 Bacteria 980
522 Ga0207653_10309239 3300025885 Bacteria 613
523 Ga0207682_10206804 3300025893 Bacteria 904
524 Ga0207692_10097341 3300025898 Bacteria 1608
525 Ga0207642_10007135 3300025899 Bacteria 3757
526 Ga0207642_10084942 3300025899 Bacteria 1547
527 Ga0207642_10352017 3300025899 Bacteria 869
528 Ga0207710_10365367 3300025900 Bacteria 737
529 Ga0207688_10022442 3300025901 Bacteria 3453
530 Ga0207688_10054745 3300025901 Bacteria 2238
531 Ga0207688_10074637 3300025901 Bacteria 1929
532 Ga0207688_10197409 3300025901 Bacteria 1205
533 Ga0207688_10204797 3300025901 Bacteria 1184
534 Ga0207680_10177409 3300025903 Bacteria 1439
535 Ga0207647_10281401 3300025904 Bacteria 949
536 Ga0207647_10300873 3300025904 Bacteria 913
537 Ga0207647_10451834 3300025904 Bacteria 720
538 Ga0207699_10274178 3300025906 Bacteria 1170
539 Ga0207699_10553267 3300025906 Bacteria 835
540 Ga0207645_10100384 3300025907 Bacteria 1867
541 Ga0207645_10360065 3300025907 Bacteria 974
542 Ga0207645_10598951 3300025907 Bacteria 748
543 Ga0207643_10023049 3300025908 Bacteria 3431
544 Ga0207643_10176063 3300025908 Bacteria 1293
545 Ga0207643_10421309 3300025908 Bacteria 846
546 Ga0207705_10723542 3300025909 Bacteria 773
547 Ga0207684_11245498 3300025910 Bacteria 614
548 Ga0207654_10011023 3300025911 Bacteria 4600
549 Ga0207707_10000143 3300025912 Bacteria 74226
550 Ga0207707_10064118 3300025912 Bacteria 3198
551 Ga0207695_10000059 3300025913 Bacteria 363920
552 Ga0207695_10059849 3300025913 Bacteria 3947
553 Ga0207695_10093922 3300025913 Bacteria 3008
554 Ga0207695_10103267 3300025913 Bacteria 2842
555 Ga0207671_10001109 3300025914 Bacteria 32478
556 Ga0207671_10044193 3300025914 Bacteria 3294
557 Ga0207671_10190306 3300025914 Bacteria 1600
558 Ga0207671_10291378 3300025914 Bacteria 1289
559 Ga0207671_10353320 3300025914 Bacteria 1166
560 Ga0207693_10699614 3300025915 Bacteria 785
561 Ga0207663_10051956 3300025916 Bacteria 2554
562 Ga0207660_10017202 3300025917 Bacteria 4798
563 Ga0207660_10079923 3300025917 Bacteria 2399
564 Ga0207660_10233402 3300025917 Bacteria 1447
565 Ga0207660_10365126 3300025917 Bacteria 1158
566 Ga0207662_10072536 3300025918 Bacteria 2087
567 Ga0207657_10087843 3300025919 Bacteria 2600
568 Ga0207657_10323832 3300025919 Bacteria 1218
569 Ga0207657_10391102 3300025919 Bacteria 1094
570 Ga0207649_10346624 3300025920 Bacteria 1098
571 Ga0207649_10645440 3300025920 Bacteria 817
572 Ga0207649_10977608 3300025920 Bacteria 666
573 Ga0207652_10011338 3300025921 Bacteria 7184
574 Ga0207652_10609593 3300025921 Bacteria 978
575 Ga0207694_10118714 3300025924 Bacteria 2110
576 Ga0207694_10796339 3300025924 Bacteria 798
577 Ga0207650_10204856 3300025925 Bacteria 1582
578 Ga0207650_10908580 3300025925 Bacteria 748
579 Ga0207659_10090791 3300025926 Bacteria 2281
580 Ga0207659_10939719 3300025926 Bacteria 744
581 Ga0207664_11193314 3300025929 Bacteria 679
582 Ga0207690_10464135 3300025932 Bacteria 1019
583 Ga0207690_10484324 3300025932 Bacteria 999
584 Ga0207690_10685337 3300025932 Bacteria 842
585 Ga0207706_10032508 3300025933 Bacteria 4646
586 Ga0207706_10153740 3300025933 Bacteria 2024
587 Ga0207706_10514060 3300025933 Bacteria 1033
588 Ga0207706_11586832 3300025933 Bacteria 531
589 Ga0207686_10147999 3300025934 Bacteria 1631
590 Ga0207686_10387458 3300025934 Bacteria 1061
591 Ga0207709_10042251 3300025935 Bacteria 2741
592 Ga0207709_10241584 3300025935 Bacteria 1314
593 Ga0207670_10457592 3300025936 Bacteria 1030
594 Ga0207669_10256569 3300025937 Bacteria 1305
595 Ga0207669_10574961 3300025937 Bacteria 912
596 Ga0207669_11420761 3300025937 Bacteria 591
597 Ga0207704_10014406 3300025938 Bacteria 3990
598 Ga0207704_10430400 3300025938 Bacteria 1048
599 Ga0207665_10023996 3300025939 Bacteria 4019
600 Ga0207665_10634684 3300025939 Bacteria 836
601 Ga0207691_10047055 3300025940 Bacteria 3961
602 Ga0207691_10210315 3300025940 Bacteria 1690
603 Ga0207691_10772306 3300025940 Bacteria 808
604 Ga0207711_10199624 3300025941 Bacteria 1825
605 Ga0207711_10220496 3300025941 Bacteria 1734
606 Ga0207711_10275951 3300025941 Bacteria 1547
607 Ga0207711_11268444 3300025941 Bacteria 679
608 Ga0207689_10052561 3300025942 Bacteria 3357
609 Ga0207689_10059101 3300025942 Bacteria 3154
610 Ga0207689_10180415 3300025942 Bacteria 1741
611 Ga0207689_10331490 3300025942 Bacteria 1264
612 Ga0207689_10505949 3300025942 Bacteria 1012
613 Ga0207661_10044679 3300025944 Bacteria 3502
614 Ga0207661_10355144 3300025944 Bacteria 1323
615 Ga0207679_10290602 3300025945 Bacteria 1405
616 Ga0207679_10452616 3300025945 Bacteria 1139
617 Ga0207679_11039177 3300025945 Bacteria 751
618 Ga0207679_11501058 3300025945 Bacteria 618
619 Ga0207667_10145811 3300025949 Bacteria 2437
620 Ga0207667_10154463 3300025949 Bacteria 2362
621 Ga0207651_10161862 3300025960 Bacteria 1755
622 Ga0207712_10102838 3300025961 Bacteria 2128
623 Ga0207712_10166274 3300025961 Bacteria 1720
624 Ga0207712_10194653 3300025961 Bacteria 1603
625 Ga0207712_10247656 3300025961 Bacteria 1439
626 Ga0207668_10122811 3300025972 Bacteria 1969
627 Ga0207668_10134695 3300025972 Bacteria 1891
628 Ga0207668_10207302 3300025972 Bacteria 1565
629 Ga0207668_10263666 3300025972 Bacteria 1405
630 Ga0207668_10438935 3300025972 Bacteria 1111
631 Ga0207668_10438946 3300025972 Bacteria 1111
632 Ga0207640_10089901 3300025981 Bacteria 2123
633 Ga0207640_10361292 3300025981 Bacteria 1170
634 Ga0207640_10386336 3300025981 Bacteria 1136
635 Ga0207640_10909477 3300025981 Bacteria 769
636 Ga0207658_10647475 3300025986 Bacteria 952
637 Ga0207658_10763870 3300025986 Bacteria 876
638 Ga0207677_10202638 3300026023 Bacteria 1578
639 Ga0207677_10860456 3300026023 Bacteria 815
640 Ga0207703_11200462 3300026035 Bacteria 729
641 Ga0207703_11210308 3300026035 Bacteria 726
642 Ga0207639_10160455 3300026041 Bacteria 1894
643 Ga0207639_10506472 3300026041 Bacteria 1104
644 Ga0207639_10992244 3300026041 Bacteria 786
645 Ga0207639_11397853 3300026041 Bacteria 657
646 Ga0207678_10015293 3300026067 Bacteria 6749
647 Ga0207678_10030059 3300026067 Bacteria 4743
648 Ga0207678_10067196 3300026067 Bacteria 3077
649 Ga0207678_10077044 3300026067 Bacteria 2856
650 Ga0207678_10132918 3300026067 Bacteria 2123
651 Ga0207678_10228037 3300026067 Bacteria 1595
652 Ga0207678_10606526 3300026067 Bacteria 960
653 Ga0207708_10036812 3300026075 Bacteria 3727
654 Ga0207708_10860127 3300026075 Bacteria 783
655 Ga0207702_10115752 3300026078 Bacteria 2391
656 Ga0207702_10163693 3300026078 Bacteria 2033
657 Ga0207702_10165497 3300026078 Bacteria 2022
658 Ga0207702_10240067 3300026078 Bacteria 1697
659 Ga0207702_10695115 3300026078 Bacteria 1002
660 Ga0207641_10068950 3300026088 Bacteria 3034
661 Ga0207641_10719009 3300026088 Bacteria 984
662 Ga0207641_11632619 3300026088 Bacteria 647
663 Ga0207648_10069067 3300026089 Bacteria 3079
664 Ga0207648_10674575 3300026089 Bacteria 956
665 Ga0207676_10520654 3300026095 Bacteria 1132
666 Ga0207674_10175284 3300026116 Bacteria 2097
667 Ga0207674_10284503 3300026116 Bacteria 1602
668 Ga0207675_100043034 3300026118 Bacteria 4217
669 Ga0207675_100069520 3300026118 Bacteria 3291
670 Ga0207675_100088011 3300026118 Bacteria 2917
671 Ga0207675_100099220 3300026118 Bacteria 2743
672 Ga0207675_100823183 3300026118 Bacteria 942
673 Ga0207675_101239980 3300026118 Bacteria 766
674 Ga0207683_10038386 3300026121 Bacteria 4174
675 Ga0207683_10063563 3300026121 Bacteria 3251
676 Ga0207683_10192873 3300026121 Bacteria 1850
677 Ga0207683_10209971 3300026121 Bacteria 1772
678 Ga0207683_10322426 3300026121 Bacteria 1415
679 Ga0207683_10752834 3300026121 Bacteria 904
680 Ga0207683_11080219 3300026121 Bacteria 744
681 Ga0207698_10039785 3300026142 Bacteria 3486
682 Ga0207698_10231586 3300026142 Bacteria 1677
683 Ga0207698_10277937 3300026142 Bacteria 1547
684 Ga0207698_10345855 3300026142 Bacteria 1402
685 Ga0207698_10429452 3300026142 Bacteria 1270
686 Ga0207698_12408026 3300026142 Bacteria 537
687 Ga0209589_1000015 3300027357 Bacteria 225913
688 Ga0209489_100015 3300027361 Bacteria 225913
689 Ga0209700_100025 3300027363 Bacteria 225913
690 Ga0209179_1000903 3300027512 Bacteria 3335
691 Ga0209813_10124429 3300027866 Bacteria 901
692 Ga0207428_10875977 3300027907 Bacteria 635
693 Ga0265356_1012512 3300028017 Bacteria 931
694 Ga0268266_10003191 3300028379 Bacteria 16594
695 Ga0268266_10018212 3300028379 Bacteria 5987
696 Ga0268266_10047304 3300028379 Bacteria 3685
697 Ga0268266_10115674 3300028379 Bacteria 2381
698 Ga0268265_10077246 3300028380 Bacteria 2615
699 Ga0268265_10719282 3300028380 Bacteria 966
700 Ga0268265_11347926 3300028380 Bacteria 714
701 Ga0268265_11384184 3300028380 Bacteria 705
702 Ga0268265_11467784 3300028380 Bacteria 685
703 Ga0268265_12440257 3300028380 Bacteria 529
704 Ga0268264_10000356 3300028381 Bacteria 68810
705 Ga0268264_10157667 3300028381 Bacteria 2041
706 Ga0268264_10263290 3300028381 Bacteria 1607
707 Ga0268264_10680756 3300028381 Bacteria 1020
708 Ga0268264_11141684 3300028381 Bacteria 788
709 Ga0307515_10045648 3300028794 Bacteria 6723
710 Ga0307511_10132509 3300030521 Bacteria 1496
711 Ga0307511_10194685 3300030521 Bacteria 1064
712 Ga0307512_10423455 3300030522 Bacteria 549
713 Ga0265330_10012848 3300031235 Bacteria 3909
714 Ga0265330_10199581 3300031235 Bacteria 846
715 Ga0307513_10168005 3300031456 Bacteria 2075
716 Ga0307509_10009216 3300031507 Bacteria 12388
717 Ga0307509_10376963 3300031507 Bacteria 1133
718 Ga0307509_10640941 3300031507 Bacteria 732
719 Ga0307408_100722853 3300031548 Bacteria 897
720 Ga0307508_10000715 3300031616 Bacteria 39415
721 Ga0307508_10073634 3300031616 Bacteria 2992
722 Ga0307508_10667726 3300031616 Bacteria 646
723 Ga0307508_10900221 3300031616 Bacteria 511
724 Ga0265342_10186629 3300031712 Bacteria 1133
725 Ga0307516_10005305 3300031730 Bacteria 15512
726 Ga0307516_10009786 3300031730 Bacteria 10635
727 Ga0307516_10099990 3300031730 Bacteria 2716
728 Ga0307516_10102108 3300031730 Bacteria 2683
729 Ga0307516_10142157 3300031730 Bacteria 2168
730 Ga0307516_10233822 3300031730 Bacteria 1540
731 Ga0307516_10245733 3300031730 Bacteria 1486
732 Ga0307516_10495779 3300031730 Bacteria 876
733 Ga0307405_10810442 3300031731 Bacteria 785
734 Ga0326468_10008419 3300031889 Bacteria 998
735 Ga0307406_10214720 3300031901 Bacteria 1426
736 Ga0307407_10142512 3300031903 Bacteria 1548
737 Ga0307412_10221792 3300031911 Bacteria 1450
738 Ga0307412_10798454 3300031911 Bacteria 819
739 Ga0307412_11864422 3300031911 Bacteria 554
740 Ga0307409_101058608 3300031995 Bacteria 831
741 Ga0307409_101068088 3300031995 Bacteria 828
742 Ga0307409_101665964 3300031995 Bacteria 666
743 Ga0307416_100370337 3300032002 Bacteria 1458
744 Ga0307416_100827607 3300032002 Bacteria 1023
745 Ga0307416_101523765 3300032002 Bacteria 774
746 Ga0307416_102246675 3300032002 Bacteria 646
747 Ga0307411_10271283 3300032005 Bacteria 1345
748 Ga0307411_10537234 3300032005 Bacteria 995
749 Ga0307415_100546883 3300032126 Bacteria 1021
750 Ga0307415_100614463 3300032126 Bacteria 969
751 Ga0307507_10190397 3300033179 Bacteria 1443
752 Ga0307510_10049561 3300033180 Bacteria 4465
753 Ga0307510_10078920 3300033180 Bacteria 3215
754 Ga0307510_10129800 3300033180 Bacteria 2197
755 Ga0307510_10179538 3300033180 Bacteria 1682
756 Ga0307510_10574515 3300033180 Bacteria 576
757 Ga0315911_1000021 3300033442 Bacteria 124874
758 Ga0373950_0060189 3300034818 Bacteria 761
759 Ga0373926_0245299 3300035083 Bacteria 694
760 Ga0373928_0068305 3300035084 Bacteria 873
761 Ga0373934_0005810 3300035086 Bacteria 4564
762 Ga0373940_0365362 3300035088 Bacteria 509
763 Ga0373952_0012727 3300035092 Bacteria 1660
764 Ga0373923_0001264 3300035111 Bacteria 7120
765 Ga0373932_0057673 3300035112 Bacteria 1171
766 Ga0373936_0292141 3300035113 Bacteria 734
767 Ga0373945_0578076 3300035116 Bacteria 506
768 Ga0373953_0009689 3300035117 Bacteria 3324
769 Ga0373953_0311352 3300035117 Bacteria 688
770 Ga0373954_0001440 3300035118 Bacteria 9662
771 Ga0373956_0000376 3300035119 Bacteria 18268
772 Ga0373956_0267324 3300035119 Bacteria 813
773 Ga0373957_0000575 3300035120 Bacteria 9302
774 Ga0373943_0093790 3300035170 Bacteria 1559
775 Ga0373943_0304847 3300035170 Bacteria 905
776 Ga0373943_0666580 3300035170 Bacteria 615
777 Ga0373955_0000325 3300035172 Bacteria 19823
778 Ga0373955_0094862 3300035172 Bacteria 1705
779 Ga0373924_0000567 3300035410 Bacteria 11368
780 Ga0373931_0006104 3300035691 Bacteria 5614
781 Ga0373935_0005959 3300035692 Bacteria 7231
782 Ga0373935_0141667 3300035692 Bacteria 1625
783 Ga0373935_0231401 3300035692 Bacteria 1287
784 Ga0373935_0479249 3300035692 Bacteria 901
785 Ga0373927_0005646 3300035695 Bacteria 8601
786 Ga0373927_0051745 3300035695 Bacteria 2656
787 Ga0373927_0056834 3300035695 Bacteria 2530
788 Ga0373927_0074127 3300035695 Bacteria 2204
789 Ga0373927_0139344 3300035695 Bacteria 1586
790 Ga0373927_0151302 3300035695 Bacteria 1519
791 Ga0373927_0622588 3300035695 Bacteria 713
792 Ga0373933_0000108 3300035724 Bacteria 53024
793 Ga0373933_0002337 3300035724 Bacteria 10758
794 Ga0373947_0054194 3300035725 Bacteria 2420
795 Ga0373947_0193833 3300035725 Bacteria 1327
796 Ga0373947_0225024 3300035725 Bacteria 1234
797 Ga0373937_0036844 3300036401 Bacteria 4456
798 Ga0373937_0294717 3300036401 Bacteria 1533
799 Ga0373937_0792342 3300036401 Bacteria 895
800 Ga0373925_0175704 3300037068 Bacteria 1693
801 Ga0373925_0218338 3300037068 Bacteria 1521
802 Ga0373925_0282962 3300037068 Bacteria 1336
803 Ga0373925_0288860 3300037068 Bacteria 1322
804 Ga0373925_0670134 3300037068 Bacteria 855
805 Ga0395899_0154932 3300037312 Bacteria 1622
806 Ga0395899_0652635 3300037312 Bacteria 665
807 Ga0395899_0797694 3300037312 Bacteria 584
808 Ga0395900_0139090 3300037418 Bacteria 2487
809 Ga0395900_0280928 3300037418 Bacteria 1657
810 Ga0395898_0136250 3300037466 Bacteria 2351
811 Ga0395898_0995894 3300037466 Bacteria 774
812 Ga0395898_1709599 3300037466 Bacteria 552
813 Ga0395905_0018632 3300037471 Bacteria 6584
814 Ga0395905_0294700 3300037471 Bacteria 1509
815 Ga0395905_1324186 3300037471 Bacteria 624
816 Ga0395905_1851601 3300037471 Bacteria 509
817 Ga0436364_0879350 3300037853 Bacteria 1041
818 Ga0395901_0058033 3300038443 Bacteria 4026
819 Ga0395901_0321389 3300038443 Bacteria 1601
820 Ga0395901_0436961 3300038443 Bacteria 1340
821 Ga0395901_1233128 3300038443 Bacteria 712
822 Ga0395901_1854960 3300038443 Bacteria 551
823 Ga0436365_0414572 3300039437 Bacteria 1032
824 Ga0436365_0429696 3300039437 Bacteria 1300
825 Ga0436365_1212947 3300039437 Bacteria 3094
826 Ga0436361_0899129 3300039447 Bacteria 806
827 Ga0439465_0058246 3300041413 Bacteria 1276
828 Ga0439465_0064370 3300041413 Bacteria 1220
829 Ga0451787_105515 3300041441 Bacteria 752
830 Ga0451791_0677543 3300041451 Bacteria 514
831 Ga0451791_1155178 3300041451 Bacteria 596
832 Ga0451797_0053473 3300041453 Bacteria 835
833 Ga0451797_1018948 3300041453 Bacteria 695
834 Ga0451800_0728190 3300041459 Bacteria 636
835 Ga0451800_1438690 3300041459 Bacteria 611
836 Ga0451802_1426775 3300041460 Bacteria 845
837 Ga0451804_0726654 3300041463 Bacteria 586
838 Ga0451833_0126247 3300041491 Bacteria 795
839 Ga0451837_1574521 3300041494 Bacteria 638
840 Ga0451847_0379818 3300041503 Bacteria 1140
841 Ga0451853_0473635 3300041512 Bacteria 720
842 Ga0439445_0101008 3300042004 Bacteria 818
843 Ga0439458_0210853 3300042157 Bacteria 533
844 Ga0439459_0150446 3300042438 Bacteria 608
845 Ga0466966_0000411 3300044684 Bacteria 27522
846 Ga0466961_0000065 3300044693 Bacteria 63259
847 Ga0466957_0149701 3300044842 Bacteria 1508
848 Ga0466957_0220346 3300044842 Bacteria 1253
849 Ga0466957_0769191 3300044842 Bacteria 683
850 Ga0466959_0000634 3300045049 Bacteria 20407
851 Ga0466959_0318213 3300045049 Bacteria 1064
852 Ga0495617_033360 3300046452 Bacteria 1727
853 Ga0495617_050127 3300046452 Bacteria 1389
854 Ga0495617_061551 3300046452 Bacteria 1241
855 Ga0495592_0000339 3300046454 Bacteria 38389
856 Ga0495592_0716043 3300046454 Bacteria 601
857 Ga0495592_0782603 3300046454 Bacteria 568
858 Ga0495603_0004729 3300046455 Bacteria 8133
859 Ga0495603_0053248 3300046455 Bacteria 2401
860 Ga0495603_0209080 3300046455 Bacteria 1127
861 Ga0495603_0323343 3300046455 Bacteria 885
862 Ga0495629_0001483 3300046459 Bacteria 18494
863 Ga0495629_0090157 3300046459 Bacteria 2139
864 Ga0495629_0412836 3300046459 Bacteria 917
865 Ga0495638_0050016 3300046460 Bacteria 2611
866 Ga0495638_0104997 3300046460 Bacteria 1684
867 Ga0495638_0174932 3300046460 Bacteria 1229
868 Ga0495651_0028813 3300046462 Bacteria 4328
869 Ga0495651_0044793 3300046462 Bacteria 3428
870 Ga0495651_0528313 3300046462 Bacteria 752
871 Ga0495653_0001063 3300046463 Bacteria 21155
872 Ga0495653_0057062 3300046463 Bacteria 2975
873 Ga0495650_0094542 3300046471 Bacteria 1131
874 Ga0495580_0072493 3300046472 Bacteria 2405
875 Ga0495580_0174340 3300046472 Bacteria 1486
876 Ga0495580_0307451 3300046472 Bacteria 1079
877 Ga0495582_0027690 3300046473 Bacteria 3108
878 Ga0495582_0230584 3300046473 Bacteria 1060
879 Ga0495582_0315786 3300046473 Bacteria 899
880 Ga0495605_0075002 3300046474 Bacteria 1591
881 Ga0495605_0092495 3300046474 Bacteria 1400
882 Ga0495639_0131831 3300046475 Bacteria 1197
883 Ga0495639_0490631 3300046475 Bacteria 626
884 Ga0495664_0097922 3300046477 Bacteria 1766
885 Ga0495664_0105741 3300046477 Bacteria 1697
886 Ga0495664_0228271 3300046477 Bacteria 1127
887 Ga0495584_0222648 3300046491 Bacteria 959
888 Ga0495584_0273818 3300046491 Bacteria 858
889 Ga0495585_0127932 3300046492 Bacteria 1339
890 Ga0495585_0148924 3300046492 Bacteria 1221
891 Ga0495585_0456162 3300046492 Bacteria 611
892 Ga0495594_0067703 3300046499 Bacteria 1982
893 Ga0495594_0134305 3300046499 Bacteria 1402
894 Ga0495583_0109181 3300046506 Bacteria 1174
895 Ga0495583_0215078 3300046506 Bacteria 778
896 Ga0495606_0174896 3300046507 Bacteria 1242
897 Ga0495606_0255921 3300046507 Bacteria 969
898 Ga0495606_0475627 3300046507 Bacteria 635
899 Ga0495608_0002749 3300046511 Bacteria 12636
900 Ga0495610_0101824 3300046512 Bacteria 1285
901 Ga0495616_0110849 3300046513 Bacteria 1275
902 Ga0495616_0182993 3300046513 Bacteria 930
903 Ga0495616_0315183 3300046513 Bacteria 658
904 Ga0495618_0049103 3300046514 Bacteria 2665
905 Ga0495620_0174465 3300046515 Bacteria 832
906 Ga0495620_0183369 3300046515 Bacteria 809
907 Ga0495628_0001554 3300046516 Bacteria 21033
908 Ga0495628_0189804 3300046516 Bacteria 1552
909 Ga0495628_0341361 3300046516 Bacteria 1102
910 Ga0495630_0601118 3300046517 Bacteria 843
911 Ga0495631_0036126 3300046518 Bacteria 2207
912 Ga0495631_0130116 3300046518 Bacteria 1081
913 Ga0495632_0109049 3300046519 Bacteria 1301
914 Ga0495632_0125432 3300046519 Bacteria 1197
915 Ga0495643_0185414 3300046522 Bacteria 1008
916 Ga0495644_0108805 3300046523 Bacteria 1051
917 Ga0495644_0137667 3300046523 Bacteria 932
918 Ga0495648_0003177 3300046524 Bacteria 14623
919 Ga0495648_0012566 3300046524 Bacteria 6304
920 Ga0495648_0165396 3300046524 Bacteria 1139
921 Ga0495648_0233855 3300046524 Bacteria 898
922 Ga0495652_0007546 3300046529 Bacteria 10022
923 Ga0495652_0222429 3300046529 Bacteria 1418
924 Ga0495640_0050475 3300046533 Bacteria 2865
925 Ga0495587_0006630 3300046536 Bacteria 7541
926 Ga0495587_0330207 3300046536 Bacteria 851
927 Ga0495587_0521198 3300046536 Bacteria 656
928 Ga0495609_0110055 3300046538 Bacteria 1189
929 Ga0495609_0159272 3300046538 Bacteria 958
930 Ga0495621_0077638 3300046539 Bacteria 1233
931 Ga0495621_0254890 3300046539 Bacteria 718
932 Ga0495597_0135553 3300046542 Bacteria 1018
933 Ga0495597_0270929 3300046542 Bacteria 663
934 Ga0495597_0425992 3300046542 Bacteria 503
935 Ga0495645_0003892 3300046543 Bacteria 10173
936 Ga0495622_0046414 3300046557 Bacteria 2018
937 Ga0495622_0049833 3300046557 Bacteria 1944
938 Ga0495622_0122333 3300046557 Bacteria 1188
939 Ga0495622_0210828 3300046557 Bacteria 863
940 Ga0495633_0039798 3300046558 Bacteria 2242
941 Ga0495633_0273372 3300046558 Bacteria 769
942 Ga0495667_0021740 3300046559 Bacteria 4328
943 Ga0495667_0435858 3300046559 Bacteria 824
944 Ga0495656_0007133 3300046615 Bacteria 3943
945 Ga0495656_0043638 3300046615 Bacteria 1884
946 Ga0495656_0051008 3300046615 Bacteria 1769
947 Ga0495668_0235698 3300046616 Bacteria 1002
948 Ga0495668_0307684 3300046616 Bacteria 869
949 Ga0495668_0547249 3300046616 Bacteria 639
950 Ga0495634_0005678 3300046642 Bacteria 9546
951 Ga0495611_0067301 3300046648 Bacteria 1634
952 Ga0495611_0160048 3300046648 Bacteria 1052
953 Ga0495611_0262332 3300046648 Bacteria 800
954 Ga0495625_0128978 3300046660 Bacteria 1714
955 Ga0495625_0144480 3300046660 Bacteria 1603
956 Ga0495625_0372106 3300046660 Bacteria 898
957 Ga0495625_0448718 3300046660 Bacteria 797
958 Ga0495635_0000917 3300046663 Bacteria 19365
959 Ga0495659_0026348 3300046664 Bacteria 1997
960 Ga0495661_0191682 3300046665 Bacteria 1076
961 Ga0495661_0420965 3300046665 Bacteria 647
962 Ga0495588_0030267 3300046674 Bacteria 2720
963 Ga0495588_0212180 3300046674 Bacteria 1022
964 Ga0495657_0013656 3300046675 Bacteria 5983
965 Ga0495599_0001780 3300046678 Bacteria 12490
966 Ga0495599_0098299 3300046678 Bacteria 1824
967 Ga0495623_0009830 3300046679 Bacteria 6197
968 Ga0495646_0003865 3300046680 Bacteria 9362
969 Ga0495647_0332583 3300046681 Bacteria 689
970 Ga0495658_0076463 3300046683 Bacteria 1957
971 Ga0495669_0031697 3300046684 Bacteria 2321
972 Ga0495669_0153987 3300046684 Bacteria 1089
973 Ga0495669_0199113 3300046684 Bacteria 957
974 Ga0495613_0003569 3300046689 Bacteria 11661
975 Ga0495613_0914857 3300046689 Bacteria 567
976 Ga0495624_0426316 3300046690 Bacteria 795
977 Ga0495670_0051410 3300046691 Bacteria 2062
978 Ga0495670_0193047 3300046691 Bacteria 1077
979 Ga0495671_0127927 3300046692 Bacteria 1239
980 Ga0495671_0322461 3300046692 Bacteria 742
981 Ga0495671_0580337 3300046692 Bacteria 533
982 Ga0495649_0167739 3300046694 Bacteria 1150
983 Ga0495649_0187677 3300046694 Bacteria 1077
984 Ga0495649_0190004 3300046694 Bacteria 1069
985 Ga0495649_0193306 3300046694 Bacteria 1059
986 Ga0495649_0255972 3300046694 Bacteria 898
987 Ga0495589_0047632 3300046794 Bacteria 2123
988 Ga0495589_0051394 3300046794 Bacteria 2038
989 Ga0495589_0133765 3300046794 Bacteria 1190
990 Ga0495600_0005669 3300046809 Bacteria 7541
991 Ga0495600_0129344 3300046809 Bacteria 1642
992 Ga0495600_0367813 3300046809 Bacteria 899
993 Ga0495660_0233322 3300046810 Bacteria 861
994 Ga0495660_0451087 3300046810 Bacteria 556
995 Ga0495581_0367953 3300047315 Bacteria 839
996 Ga0495604_0031098 3300047317 Bacteria 4236
997 Ga0495604_0127537 3300047317 Bacteria 1832
998 Ga0495604_0134552 3300047317 Bacteria 1773
999 Ga0495674_0037829 3300047319 Bacteria 4335
1000 Ga0495674_0085898 3300047319 Bacteria 2695
1001 Ga0495674_0571770 3300047319 Bacteria 898
1002 Ga0495674_0809613 3300047319 Bacteria 728
1003 Ga0495674_1320507 3300047319 Bacteria 540
1004 Ga0495672_0068545 3300047320 Bacteria 2016
1005 Ga0495672_0072262 3300047320 Bacteria 1949
1006 Ga0495676_0259449 3300047321 Bacteria 1183
1007 Ga0495676_0269578 3300047321 Bacteria 1156
1008 Ga0495676_1079294 3300047321 Bacteria 511
1009 Ga0495680_0001065 3300047322 Bacteria 30372
1010 Ga0495683_0075406 3300047323 Bacteria 1652
1011 Ga0495683_0091695 3300047323 Bacteria 1471
1012 Ga0495683_0268973 3300047323 Bacteria 742
1013 Ga0495675_0000901 3300047444 Bacteria 18140
1014 Ga0495679_175126 3300047446 Bacteria 570
1015 Ga0495685_119706 3300047447 Bacteria 864
1016 Ga0495685_142129 3300047447 Bacteria 782
1017 Ga0495673_0006914 3300047469 Bacteria 6607
1018 Ga0495673_0192652 3300047469 Bacteria 766
1019 Ga0495673_0204152 3300047469 Bacteria 738
1020 Ga0495673_0329218 3300047469 Bacteria 542
1021 Ga0495681_0218515 3300047470 Bacteria 765
1022 Ga0495684_0000721 3300047471 Bacteria 26637
1023 Ga0495686_0053138 3300047472 Bacteria 2539
1024 Ga0495686_0104159 3300047472 Bacteria 1709
1025 Ga0495593_0003054 3300047673 Bacteria 10089
1026 Ga0495593_0237678 3300047673 Bacteria 913
1027 Ga0495602_0043034 3300048088 Bacteria 4109
1028 Ga0495602_0812247 3300048088 Bacteria 627
1029 Ga0495615_0162652 3300048090 Bacteria 671
1030 Ga0496100_0064188 3300048903 Bacteria 2429
1031 Ga0496100_0127505 3300048903 Bacteria 1788
1032 Ga0496100_0390952 3300048903 Bacteria 1058
1033 Ga0496100_0430424 3300048903 Bacteria 1009
1034 Ga0496100_1270213 3300048903 Bacteria 581
1035 Ga0496101_0033066 3300048904 Bacteria 3645
1036 Ga0496101_0092525 3300048904 Bacteria 2251
1037 Ga0496101_0097010 3300048904 Bacteria 2201
1038 Ga0496101_0432468 3300048904 Bacteria 1038
1039 Ga0496101_1145420 3300048904 Bacteria 610
1040 Ga0496102_0263478 3300048905 Bacteria 1625
1041 Ga0496102_0373178 3300048905 Bacteria 1342
1042 Ga0496102_0508738 3300048905 Bacteria 1127
1043 Ga0496102_0705585 3300048905 Bacteria 932
1044 Ga0496102_0775549 3300048905 Bacteria 881
1045 Ga0496102_0787488 3300048905 Bacteria 873
1046 Ga0496102_1633552 3300048905 Bacteria 563
1047 Ga0496103_0130391 3300048906 Bacteria 1605
1048 Ga0496103_0214391 3300048906 Bacteria 1238
1049 Ga0496103_0292461 3300048906 Bacteria 1048
1050 Ga0496104_0076570 3300048907 Bacteria 3186
1051 Ga0496104_0444521 3300048907 Bacteria 1208
1052 Ga0496104_0977471 3300048907 Bacteria 751
1053 Ga0496104_1057353 3300048907 Bacteria 715
1054 Ga0496105_0078902 3300048908 Bacteria 2718
1055 Ga0496105_0190363 3300048908 Bacteria 1678
1056 Ga0496105_0431547 3300048908 Bacteria 1042
1057 Ga0496106_0001953 3300048909 Bacteria 15491
1058 Ga0496106_0005142 3300048909 Bacteria 9697
1059 Ga0496106_0013044 3300048909 Bacteria 6132
1060 Ga0496106_0118296 3300048909 Bacteria 2069
1061 Ga0496106_0181218 3300048909 Bacteria 1672
1062 Ga0496106_0238959 3300048909 Bacteria 1451
1063 Ga0496106_0353282 3300048909 Bacteria 1181
1064 Ga0496107_0107732 3300048910 Bacteria 2046
1065 Ga0496107_0152462 3300048910 Bacteria 1710
1066 Ga0496107_0212262 3300048910 Bacteria 1439
1067 Ga0496107_0329489 3300048910 Bacteria 1136
1068 Ga0496107_0659024 3300048910 Bacteria 771
1069 Ga0496107_0894723 3300048910 Bacteria 647
1070 Ga0496107_1054493 3300048910 Bacteria 588
1071 Ga0496108_0029882 3300048911 Bacteria 4516
1072 Ga0496108_0042630 3300048911 Bacteria 3788
1073 Ga0496108_0047665 3300048911 Bacteria 3582
1074 Ga0496108_0692190 3300048911 Bacteria 884
1075 Ga0496109_0019726 3300048912 Bacteria 5948
1076 Ga0496109_0058661 3300048912 Bacteria 3516
1077 Ga0496109_0153066 3300048912 Bacteria 2160
1078 Ga0496109_0803475 3300048912 Bacteria 879
1079 Ga0496110_0029199 3300048913 Bacteria 4743
1080 Ga0496110_0043444 3300048913 Bacteria 3924
1081 Ga0496110_0099562 3300048913 Bacteria 2606
1082 Ga0496110_0303371 3300048913 Bacteria 1455
1083 Ga0496110_0317462 3300048913 Bacteria 1419
1084 Ga0496111_0175089 3300048914 Bacteria 1595
1085 Ga0496111_0185766 3300048914 Bacteria 1545
1086 Ga0496111_0754909 3300048914 Bacteria 705
1087 Ga0496112_0035435 3300048915 Bacteria 4862
1088 Ga0496112_0036732 3300048915 Bacteria 4780
1089 Ga0496112_0072004 3300048915 Bacteria 3416
1090 Ga0496112_0097007 3300048915 Bacteria 2918
1091 Ga0496112_0769085 3300048915 Bacteria 889
1092 Ga0496113_0051127 3300048916 Bacteria 3083
1093 Ga0496113_0112428 3300048916 Bacteria 2121
1094 Ga0496113_0192923 3300048916 Bacteria 1617
1095 Ga0496113_0365944 3300048916 Bacteria 1157
1096 Ga0496113_0410881 3300048916 Bacteria 1087
1097 Ga0496114_0053462 3300048917 Bacteria 3366
1098 Ga0496114_0158287 3300048917 Bacteria 1968
1099 Ga0496114_0204861 3300048917 Bacteria 1729
1100 Ga0496114_0293754 3300048917 Bacteria 1434
1101 Ga0496114_0891956 3300048917 Bacteria 770
1102 Ga0496114_0992713 3300048917 Bacteria 723
1103 Ga0496115_0004493 3300048918 Bacteria 10094
1104 Ga0496115_0060281 3300048918 Bacteria 3057
1105 Ga0496115_0113069 3300048918 Bacteria 2231
1106 Ga0496115_0226455 3300048918 Bacteria 1542
1107 Ga0496115_0289910 3300048918 Bacteria 1343
1108 Ga0496115_0494018 3300048918 Bacteria 984
1109 Ga0496115_0572113 3300048918 Bacteria 901
1110 Ga0496115_1267033 3300048918 Bacteria 551
1111 Ga0496117_0014058 3300048920 Bacteria 6924
1112 Ga0496117_0057259 3300048920 Bacteria 2709
1113 Ga0496118_0003027 3300048921 Bacteria 21693
1114 Ga0496118_0066793 3300048921 Bacteria 2623
1115 Ga0496118_0157901 3300048921 Bacteria 1408
1116 Ga0496118_0339093 3300048921 Bacteria 807
1117 Ga0496118_0497724 3300048921 Bacteria 607
1118 Ga0496119_0427137 3300048922 Bacteria 628
1119 Ga0496120_0213708 3300048923 Bacteria 926
1120 Ga0496121_0001622 3300048924 Bacteria 37285
1121 Ga0496121_0002689 3300048924 Bacteria 26584
1122 Ga0496121_0080207 3300048924 Bacteria 2588
1123 Ga0496121_0162356 3300048924 Bacteria 1632
1124 Ga0496121_0197492 3300048924 Bacteria 1437
1125 Ga0496121_0650170 3300048924 Bacteria 642
1126 Ga0496124_0002957 3300048927 Bacteria 21339
1127 Ga0496124_0199622 3300048927 Bacteria 1522
1128 Ga0496125_0009386 3300048928 Bacteria 10066
1129 Ga0496125_0070558 3300048928 Bacteria 2735
1130 Ga0496125_0094685 3300048928 Bacteria 2224
1131 Ga0496125_0179978 3300048928 Bacteria 1410
1132 Ga0496125_0249255 3300048928 Bacteria 1122
1133 Ga0496126_0003472 3300048929 Bacteria 19892
1134 Ga0496126_0003803 3300048929 Bacteria 18741
1135 Ga0496126_0228574 3300048929 Bacteria 1559
1136 Ga0496126_0303209 3300048929 Bacteria 1317
1137 Ga0496126_0314173 3300048929 Bacteria 1289
1138 Ga0496126_0431003 3300048929 Bacteria 1064
1139 Ga0496126_1178508 3300048929 Bacteria 564
1140 Ga0496126_1300247 3300048929 Bacteria 530
1141 Ga0495682_0026858 3300049460 Bacteria 2136
1142 Ga0495682_0167279 3300049460 Bacteria 783
1143 Ga0495682_0213961 3300049460 Bacteria 683
1144 Ga0501067_0070383 3300049583 Bacteria 1937
1145 Ga0501069_0866252 3300049585 Bacteria 549
1146 Ga0501071_0266307 3300049587 Bacteria 1295
1147 Ga0501074_0687003 3300049590 Bacteria 723
1148 Ga0501074_0838631 3300049590 Bacteria 647
1149 Ga0501080_0207467 3300049742 Bacteria 1796
1150 nmdc:mga03n38_20242_c1 3300050490 Bacteria 2658
1151 nmdc:mga03n38_35336_c1 3300050490 Bacteria 2140
1152 nmdc:mga03n38_528963_c1 3300050490 Bacteria 665
1153 nmdc:mga03n38_71183_c1 3300050490 Bacteria 1610
1154 nmdc:mga00v17_391001_c1 3300050491 Bacteria 904
1155 nmdc:mga00v17_75479_c1 3300050491 Bacteria 2096
1156 nmdc:mga0yw44_177417_c1 3300050492 Bacteria 1401
1157 nmdc:mga0yw44_198255_c1 3300050492 Bacteria 1325
1158 nmdc:mga0yw44_523416_c1 3300050492 Bacteria 805
1159 nmdc:mga0yw44_63381_c1 3300050492 Bacteria 2273
1160 nmdc:mga0yw44_872379_c1 3300050492 Bacteria 611
1161 nmdc:mga0k408_100972_c1 3300050493 Bacteria 1701
1162 nmdc:mga0k408_111125_c1 3300050493 Bacteria 1620
1163 nmdc:mga0k408_22789_c2 3300050493 Bacteria 2224
1164 nmdc:mga0k408_551798_c1 3300050493 Bacteria 681
1165 nmdc:mga06z11_203006_c1 3300050494 Bacteria 1152
1166 nmdc:mga06z11_252947_c1 3300050494 Bacteria 1038
1167 nmdc:mga06z11_303406_c1 3300050494 Bacteria 950
1168 nmdc:mga06z11_319602_c1 3300050494 Bacteria 926
1169 nmdc:mga06z11_366065_c1 3300050494 Bacteria 865
1170 nmdc:mga06z11_627_c1 3300050494 Bacteria 12858
1171 nmdc:mga06z11_771993_c1 3300050494 Bacteria 586
1172 nmdc:mga04h51_127125_c1 3300050495 Bacteria 955
1173 nmdc:mga04h51_45473_c1 3300050495 Bacteria 1452
1174 nmdc:mga07m45_270338_c1 3300050496 Bacteria 989
1175 nmdc:mga07m45_376983_c1 3300050496 Bacteria 824
1176 nmdc:mga07m45_57150_c1 3300050496 Bacteria 2206
1177 nmdc:mga07m45_601019_c1 3300050496 Bacteria 635
1178 nmdc:mga05p37_408930_c1 3300050507 Bacteria 1582
1179 nmdc:mga06r32_756603_c1 3300050510 Bacteria 934
1180 nmdc:mga08y16_1758664_c1 3300050511 Bacteria 574
1181 nmdc:mga08y16_406484_c1 3300050511 Bacteria 1393
1182 nmdc:mga0n895_1354839_c1 3300050512 Bacteria 681
1183 nmdc:mga0n895_1860804_c1 3300050512 Bacteria 561
1184 nmdc:mga0n895_225827_c1 3300050512 Bacteria 1901
1185 nmdc:mga0rr50_281033_c1 3300050513 Bacteria 1389
1186 nmdc:mga0rr50_593145_c1 3300050513 Bacteria 944
1187 nmdc:mga0a205_341599_c1 3300050515 Bacteria 1365
1188 nmdc:mga0a205_985218_c1 3300050515 Bacteria 690
1189 nmdc:mga0sz30_164624_c1 3300050516 Bacteria 983
1190 nmdc:mga0sz30_29112_c1 3300050516 Bacteria 2275
1191 nmdc:mga0sz30_9035_c2 3300050516 Bacteria 3438
1192 Ga0495601_0029491 3300053077 Bacteria 3403
1193 Ga0495601_0053486 3300053077 Bacteria 2552
1194 Ga0495601_0417342 3300053077 Bacteria 869
1195 Ga0495612_0416343 3300053078 Bacteria 612
1196 Ga0500610_0278880 3300053079 Bacteria 751
1197 Ga0500635_0009001 3300053080 Bacteria 2756
1198 Ga0500635_0055437 3300053080 Bacteria 1369
1199 Ga0500635_0160809 3300053080 Bacteria 861
1200 Ga0495655_0316876 3300053083 Bacteria 539
1201 Ga0495595_0001490 3300053084 Bacteria 9146
1202 Ga0495619_0000912 3300053085 Bacteria 19381
1203 Ga0495619_0083152 3300053085 Bacteria 2159
1204 Ga0495619_0126939 3300053085 Bacteria 1751
1205 Ga0495619_0149163 3300053085 Bacteria 1613
1206 Ga0495619_0179641 3300053085 Bacteria 1464
1207 Ga0500578_0040493 3300053086 Bacteria 2994
1208 Ga0500578_0132286 3300053086 Bacteria 1564
1209 Ga0500578_0164064 3300053086 Bacteria 1377
1210 Ga0500578_0370913 3300053086 Bacteria 832
1211 Ga0500644_0314103 3300053088 Bacteria 673
1212 Ga0500646_0117506 3300053090 Bacteria 852
1213 Ga0500646_0395972 3300053090 Bacteria 510
1214 Ga0500647_0155616 3300053091 Bacteria 1064
1215 Ga0500583_0260589 3300053092 Bacteria 854
1216 Ga0500583_0529834 3300053092 Bacteria 550
1217 Ga0500566_0032785 3300053094 Bacteria 3029
1218 Ga0500566_0498272 3300053094 Bacteria 525
1219 Ga0500640_187383 3300053095 Bacteria 741
1220 Ga0500641_0005231 3300053096 Bacteria 4598
1221 Ga0500641_0045528 3300053096 Bacteria 1787
1222 Ga0500650_0091755 3300053098 Bacteria 1422
1223 Ga0500556_0196097 3300053104 Bacteria 798
1224 Ga0500594_0045421 3300053118 Bacteria 1219
1225 Ga0500595_006657 3300053119 Bacteria 4874
1226 Ga0500595_020165 3300053119 Bacteria 2405
1227 Ga0500595_167868 3300053119 Bacteria 610
1228 Ga0500607_114426 3300053121 Bacteria 1316
1229 Ga0500608_060438 3300053122 Bacteria 1812
1230 Ga0500614_039754 3300053123 Bacteria 1190
1231 Ga0500614_066652 3300053123 Bacteria 979
1232 Ga0500655_009439 3300053133 Bacteria 1760
1233 Ga0500655_010286 3300053133 Bacteria 1689
1234 Ga0500658_0177111 3300053134 Bacteria 970
1235 Ga0500658_0224572 3300053134 Bacteria 861
1236 Ga0500559_0004946 3300053136 Bacteria 6197
1237 Ga0500559_0076358 3300053136 Bacteria 1516
1238 Ga0500561_0117032 3300053137 Bacteria 811
1239 Ga0500561_0140407 3300053137 Bacteria 748
1240 Ga0500564_079106 3300053138 Bacteria 1475
1241 Ga0500573_0316081 3300053140 Bacteria 773
1242 Ga0500577_0338541 3300053142 Bacteria 657
1243 Ga0500589_102370 3300053147 Bacteria 1242
1244 Ga0500589_155133 3300053147 Bacteria 927
1245 Ga0500590_059698 3300053148 Bacteria 1919
1246 Ga0500590_129150 3300053148 Bacteria 1172
1247 Ga0500590_136178 3300053148 Bacteria 1129
1248 Ga0500603_000540 3300053150 Bacteria 9573
1249 Ga0500603_048844 3300053150 Bacteria 1152
1250 Ga0500604_0018740 3300053151 Bacteria 1932
1251 Ga0500604_0138253 3300053151 Bacteria 822
1252 Ga0500620_039200 3300053155 Bacteria 1546
1253 Ga0500622_0387210 3300053156 Bacteria 571
1254 Ga0500633_0050319 3300053160 Bacteria 1436
1255 Ga0500633_0229240 3300053160 Bacteria 693
1256 Ga0500634_0089899 3300053161 Bacteria 1561
1257 Ga0500634_0159268 3300053161 Bacteria 1044
1258 Ga0500638_027293 3300053162 Bacteria 2740
1259 Ga0500638_263500 3300053162 Bacteria 686
1260 Ga0500639_295253 3300053163 Bacteria 613
1261 Ga0500636_0014674 3300053177 Bacteria 4608
1262 Ga0500636_0033475 3300053177 Bacteria 3042
1263 Ga0500636_0065119 3300053177 Bacteria 2121
1264 Ga0500636_0303953 3300053177 Bacteria 784
1265 Ga0500636_0342243 3300053177 Bacteria 717
1266 Ga0500637_0000131 3300053178 Bacteria 27270
1267 Ga0500649_068841 3300053722 Bacteria 1464
1268 Ga0500611_161427 3300053727 Bacteria 620
1269 Ga0500645_025184 3300053730 Bacteria 1816
1270 Ga0500609_006345 3300053731 Bacteria 1611
1271 Ga0500609_017029 3300053731 Bacteria 987
1272 Ga0500609_025521 3300053731 Bacteria 810
1273 Ga0500552_000562 3300053733 Bacteria 3474
1274 Ga0500596_002600 3300053735 Bacteria 3545
1275 Ga0500599_000712 3300053736 Bacteria 3597
1276 Ga0500601_003192 3300053737 Bacteria 1773
1277 Ga0500661_026136 3300055283 Bacteria 1032
1278 Ga0466962_0445465 3300061719 Bacteria 652
1279 Ga0466962_0566392 3300061719 Bacteria 578
1280 Ga0530510_0518858 3300061734 Bacteria 904
1281 Ga0530510_0553150 3300061734 Bacteria 874
1282 2513638775 2513237094 Bacteria 8789602
1283 2513659789 2513237096 Bacteria 8722461
1284 2513676923 2513237098 Bacteria 9902361
1285 2513718674 2513237104 Bacteria 10034502
1286 2513720144 2513237104 Bacteria 10034502
1287 2513857250 2513237137 Bacteria 9558895
1288 2513918865 2513237145 Bacteria 8979722
1289 2517888190 2517572143 Bacteria 9484767
1290 2524533366 2524023228 Bacteria 10118060
1291 2671119351 2667528175 Bacteria 7532676
1292 2728753847 2728368998 Bacteria 8720350
1293 2793073869 2791355197 Bacteria 8420563
1294 2885380651 2885374607 Bacteria 8927485
1295 2885391422 2885383462 Bacteria 9473874
1296 2903752678 2903748898 Bacteria 9972761
1297 2903772252 2903768456 Bacteria 9749579
1298 2904695765 2904690495 Bacteria 9412302
1299 2904709893
1300 2906614453
1301 2906643424 2906635258 Bacteria 8601019
1302 2906666616 2906660503 Bacteria 8595048
1303 2908746718 2908739725 Bacteria 8628932
1304 2908764281 2908756301 Bacteria 8864324
1305 2922389347 2922386360 Bacteria 7017218
1306 2922426287
1307 2935632672 2935630451 Bacteria 8169952
1308 2941508664 2941507105 Bacteria 8166816
1309 2941516494 2941515067 Bacteria 8166720
1310 2941524490 2941523033 Bacteria 8169134
1311 3005475651 3005474847 Bacteria 9259049
1312 8006936985 8006933436 Bacteria 10410654
1313 8006976953 8006973647 Bacteria 10679141
1314 8019561687 8019555841 Bacteria 9642137
1315 8019571760 8019565922 Bacteria 9639779
1316 8019651706 8019648815 Bacteria 10014479
1317 8056683450 8056681323 Bacteria 8472857
1318 8056690827 8056689827 Bacteria 6712655
1319 Ga0500648_071668
1320 JGI24744J21845_10038047
1321 JGI25165J46597_1006290
1322 JGI25165J46597_1028343
1323 JGI25153J46596_10032912
1324 rootH2_10000947
1325 JGI25160J50197_1002717
1326 JGI25160J50197_1047327
1327 JGI25404J52841_10101509
1328 Ga0055539_1002207
1329 Ga0055529_1004345
1330 Ga0055529_1034042
1331 Ga0055526_1031085
1332 Ga0055531_10005040
1333 Ga0055543_1006115
1334 Ga0065165_1002365
1335 Ga0065165_1009969
1336 Ga0070658_10103008
1337 Ga0070658_10182122
1338 Ga0070658_10292635
1339 Ga0070658_11280166
1340 Ga0070676_10865643
1341 Ga0070676_10918115
1342 Ga0070690_100071372
1343 Ga0070690_100071567
1344 Ga0070670_101064560
1345 Ga0070670_101372890
1346 Ga0068869_100113815
1347 Ga0068869_100175542
1348 Ga0068869_100592412
1349 Ga0068869_100644735
1350 Ga0068869_101039746
1351 Ga0068869_101372215
1352 Ga0070666_10421153
1353 Ga0070666_10539424
1354 Ga0070680_100013830
1355 Ga0070680_100032348
1356 Ga0070680_100065382
1357 Ga0070680_100221429
1358 Ga0070682_100027255
1359 Ga0070682_100513577
1360 Ga0070682_100909222
1361 Ga0070682_101359303
1362 Ga0070682_101461079
1363 Ga0068868_100050101
1364 Ga0068868_100208887
1365 Ga0068868_100468311
1366 Ga0068868_100937391
1367 Ga0068868_100955070
1368 Ga0068868_101345856
1369 Ga0068868_101369740
1370 Ga0070660_100053169
1371 Ga0070660_100200218
1372 Ga0070660_100420662
1373 Ga0070660_101058602
1374 Ga0070660_101083313
1375 Ga0070691_10340603
1376 Ga0070691_10464654
1377 Ga0070661_100739301
1378 Ga0070661_100784881
1379 Ga0070661_101387666
1380 Ga0070668_100024341
1381 Ga0070668_100059725
1382 Ga0070668_100091702
1383 Ga0070668_100211016
1384 Ga0070668_100241381
1385 Ga0070668_100244840
1386 Ga0070668_100355770
1387 Ga0070668_100693725
1388 Ga0070668_100724415
1389 Ga0070668_100928861
1390 Ga0070669_100115968
1391 Ga0070669_100122830
1392 Ga0070669_100396359
1393 Ga0070669_101131874
1394 Ga0070675_100302007
1395 Ga0070675_100340784
1396 Ga0070675_100573817
1397 Ga0070671_100360218
1398 Ga0070671_100491034
1399 Ga0070671_100868957
1400 Ga0070671_101203392
1401 Ga0070674_100007000
1402 Ga0070674_101103076
1403 Ga0070673_100295924
1404 Ga0070688_100042378
1405 Ga0070688_100104508
1406 Ga0070659_100107453
1407 Ga0070659_100174441
1408 Ga0070667_100348731
1409 Ga0070667_100485286
1410 Ga0070667_100501518
1411 Ga0070667_100986208
1412 Ga0070709_10001773
1413 Ga0070714_100005907
1414 Ga0070714_100551144
1415 Ga0070714_101434259
1416 Ga0070713_100053086
1417 Ga0070713_100225914
1418 Ga0070710_10000733
1419 Ga0070710_10018624
1420 Ga0070710_11068529
1421 Ga0070701_10232593
1422 Ga0070701_10726150
1423 Ga0070711_100005722
1424 Ga0070711_100310649
1425 Ga0070711_101033773
1426 Ga0070705_100484487
1427 Ga0070700_100293027
1428 Ga0070694_101485840
1429 Ga0070708_101953017
1430 Ga0070663_100032985
1431 Ga0070663_100052860
1432 Ga0070663_100120480
1433 Ga0070663_100166574
1434 Ga0070663_100177156
1435 Ga0070663_100180931
1436 Ga0070663_101403445
1437 Ga0070678_100059864
1438 Ga0070678_100105195
1439 Ga0070678_100133310
1440 Ga0070678_100146766
1441 Ga0070678_100335365
1442 Ga0070678_100351547
1443 Ga0070678_100543393
1444 Ga0070678_100730967
1445 Ga0070678_101334487
1446 Ga0070662_100141228
1447 Ga0070662_101159435
1448 Ga0070662_101482603
1449 Ga0070681_10006411
1450 Ga0070681_10014525
1451 Ga0070681_10173382
1452 Ga0070681_10316432
1453 Ga0068867_100227394
1454 Ga0068867_100318977
1455 Ga0068867_100559410
1456 Ga0070685_10065354
1457 Ga0070685_10758507
1458 Ga0070699_101130510
1459 Ga0070679_100013787
1460 Ga0070679_100015371
1461 Ga0070679_100018490
1462 Ga0070684_100038107
1463 Ga0070684_100355186
1464 Ga0070684_101053956
1465 Ga0070697_100591225
1466 Ga0068853_100148054
1467 Ga0068853_100721262
1468 Ga0068853_100795427
1469 Ga0068853_101833490
1470 Ga0070672_100053512
1471 Ga0070672_100135006
1472 Ga0070672_100232844
1473 Ga0070686_100141921
1474 Ga0070693_100062734
1475 Ga0070693_100110273
1476 Ga0070693_100143578
1477 Ga0070693_100229771
1478 Ga0070693_100384930
1479 Ga0070693_100877263
1480 Ga0070693_101104579
1481 Ga0070665_100038699
1482 Ga0070665_100039004
1483 Ga0070665_100060150
1484 Ga0070665_100062787
1485 Ga0070665_100122817
1486 Ga0070665_100502647
1487 Ga0070665_100629922
1488 Ga0070665_100645084
1489 Ga0070665_101402522
1490 Ga0070665_101689334
1491 Ga0070704_100830695
1492 Ga0068855_100027307
1493 Ga0068855_100096562
1494 Ga0068855_100160273
1495 Ga0068855_100621766
1496 Ga0068855_100765320
1497 Ga0068855_100940564
1498 Ga0070664_100170152
1499 Ga0070664_100182911
1500 Ga0070664_101287003
1501 Ga0070664_101328258
1502 Ga0068857_100160318
1503 Ga0068857_100271642
1504 Ga0068857_100483314
1505 Ga0068854_100647908
1506 Ga0068854_101306410
1507 Ga0068856_100037566
1508 Ga0068856_100101906
1509 Ga0068856_100202019
1510 Ga0068856_100327317
1511 Ga0070702_100037919
1512 Ga0070702_100771055
1513 Ga0068852_100070895
1514 Ga0068852_100084397
1515 Ga0068852_100193465
1516 Ga0068852_100350839
1517 Ga0068852_101999120
1518 Ga0068859_100133974
1519 Ga0068859_100379271
1520 Ga0068859_100518138
1521 Ga0068859_102220546
1522 Ga0068864_100386511
1523 Ga0068864_100544940
1524 Ga0068864_100977991
1525 Ga0068864_101296246
1526 Ga0068864_101321049
1527 Ga0068866_10036437
1528 Ga0068866_10360428
1529 Ga0068866_10656744
1530 Ga0068861_100112343
1531 Ga0068861_100266273
1532 Ga0068851_10040575
1533 Ga0068851_10093102
1534 Ga0068851_10480322
1535 Ga0068870_10119581
1536 Ga0068870_10772218
1537 Ga0068863_100279928
1538 Ga0068863_100796162
1539 Ga0068863_101055557
1540 Ga0068863_101928836
1541 Ga0068858_100150877
1542 Ga0068858_100184242
1543 Ga0068858_100284128
1544 Ga0068858_100440736
1545 Ga0068858_100573225
1546 Ga0068858_100785126
1547 Ga0068858_100897084
1548 Ga0068858_101751567
1549 Ga0068858_102368535
1550 Ga0068860_100000313
1551 Ga0068860_100108777
1552 Ga0068860_100222614
1553 Ga0068860_100232285
1554 Ga0068860_100329950
1555 Ga0068862_100065140
1556 Ga0068862_100398886
1557 Ga0068862_101367367
1558 Ga0081455_10006340
1559 Ga0081455_10029773
1560 Ga0081455_10090122
1561 Ga0081455_10364194
1562 Ga0081538_10112325
1563 Ga0081540_1002866
1564 Ga0081540_1008557
1565 Ga0081540_1012286
1566 Ga0081540_1015992
1567 Ga0081540_1095572
1568 Ga0081540_1140862
1569 Ga0070717_10034976
1570 Ga0070717_10065227
1571 Ga0070717_10081829
1572 Ga0070717_10556685
1573 Ga0075365_10060159
1574 Ga0075365_10120189
1575 Ga0075365_10120491
1576 Ga0075365_10238705
1577 Ga0075365_10366829
1578 Ga0075365_10698467
1579 Ga0075365_10812657
1580 Ga0075368_10002578
1581 Ga0075368_10094681
1582 Ga0075368_10116137
1583 Ga0075363_100003641
1584 Ga0075363_100012959
1585 Ga0075363_100522246
1586 Ga0075363_100838329
1587 Ga0075364_10148444
1588 Ga0075364_10226694
1589 Ga0075432_10030829
1590 Ga0070715_10973969
1591 Ga0070716_100008438
1592 Ga0070716_100353041
1593 Ga0070716_100511245
1594 Ga0070716_101198403
1595 Ga0070712_100009263
1596 Ga0070712_100112642
1597 Ga0070712_100320151
1598 Ga0070712_100881676
1599 Ga0070712_100963777
1600 Ga0075367_10095272
1601 Ga0075367_10107681
1602 Ga0075367_10110818
1603 Ga0075367_10129327
1604 Ga0075367_10180577
1605 Ga0075367_10380841
1606 Ga0075367_10498548
1607 Ga0075367_10787041
1608 Ga0075369_10039844
1609 Ga0075369_10042198
1610 Ga0075369_10142739
1611 Ga0075369_10581603
1612 Ga0075366_10026120
1613 Ga0075366_10529080
1614 Ga0075366_10595369
1615 Ga0097621_100311052
1616 Ga0097621_100344412
1617 Ga0097621_101178311
1618 Ga0097621_101799642
1619 Ga0075370_10084808
1620 Ga0075370_10143111
1621 Ga0075370_10201685
1622 Ga0068871_100147970
1623 Ga0068871_100239668
1624 Ga0068871_100656134
1625 Ga0068871_100857917
1626 Ga0068871_102222520
1627 Ga0075428_100210354
1628 Ga0075431_101637427
1629 Ga0075433_10654776
1630 Ga0075433_10941443
1631 Ga0075433_11371333
1632 Ga0075434_100738263
1633 Ga0075434_101320281
1634 Ga0075434_101427718
1635 Ga0075434_101643424
1636 Ga0068865_100044082
1637 Ga0068865_100087977
1638 Ga0068865_100227390
1639 Ga0068865_100548291
1640 Ga0075436_100613809
1641 Ga0097620_100133980
1642 Ga0097620_100379283
1643 Ga0097620_100518107
1644 Ga0097620_102220600
1645 Ga0099824_1023299
1646 Ga0099822_1000541
1647 Ga0075435_100678376
1648 Ga0075435_100751095
1649 Ga0099794_10413957
1650 Ga0099795_10009533
1651 Ga0099795_10043172
1652 Ga0099795_10126162
1653 Ga0105250_10421506
1654 Ga0105240_10013303
1655 Ga0105240_10033307
1656 Ga0105240_10143904
1657 Ga0105240_10533120
1658 Ga0111539_10284392
1659 Ga0111539_12021495
1660 Ga0105245_10332453
1661 Ga0105245_11709597
1662 Ga0105245_11730132
1663 Ga0105245_12060319
1664 Ga0105247_10196398
1665 Ga0105247_10216033
1666 Ga0105247_10327871
1667 Ga0105247_10681775
1668 Ga0105247_11028037
1669 Ga0114129_10759367
1670 Ga0105243_10036778
1671 Ga0105243_10037774
1672 Ga0105243_10466393
1673 Ga0105243_12711526
1674 Ga0105243_12940348
1675 Ga0105241_10038277
1676 Ga0105241_10075194
1677 Ga0105241_10184164
1678 Ga0105241_10235173
1679 Ga0105241_10254163
1680 Ga0105241_10723271
1681 Ga0105241_11509653
1682 Ga0105241_11700082
1683 Ga0105242_10094350
1684 Ga0105242_10194312
1685 Ga0105242_10320081
1686 Ga0105242_10500984
1687 Ga0105242_10758218
1688 Ga0105242_10954961
1689 Ga0105248_10118079
1690 Ga0105248_10219712
1691 Ga0105248_10270435
1692 Ga0105248_10790504
1693 Ga0105248_10933935
1694 Ga0105237_10002301
1695 Ga0105237_10066311
1696 Ga0105237_10083853
1697 Ga0105237_10106054
1698 Ga0105237_10144169
1699 Ga0105237_10199553
1700 Ga0105237_10838032
1701 Ga0105237_10992353
1702 Ga0105237_11133613
1703 Ga0105237_11180523
1704 Ga0105237_11807952
1705 Ga0105238_10085459
1706 Ga0105238_10331061
1707 Ga0105238_10407218
1708 Ga0105238_10692882
1709 Ga0105238_10799859
1710 Ga0105238_10867024
1711 Ga0105238_12370575
1712 Ga0105249_10079381
1713 Ga0105249_10279317
1714 Ga0105249_10426279
1715 Ga0105249_10511956
1716 Ga0105249_11122948
1717 Ga0105249_12838852
1718 Ga0099796_10043454
1719 Ga0099796_10077483
1720 Ga0099796_10131497
1721 Ga0099796_10134138
1722 Ga0099796_10432845
1723 Ga0105239_10035625
1724 Ga0105239_10131830
1725 Ga0105239_10140782
1726 Ga0105239_10305305
1727 Ga0105239_10409787
1728 Ga0105239_10410225
1729 Ga0105239_10570694
1730 Ga0105239_10647769
1731 Ga0105239_10655442
1732 Ga0105239_11058262
1733 Ga0105239_11182910
1734 Ga0105239_11679802
1735 Ga0105239_12483383
1736 Ga0105239_13232696
1737 Ga0105246_10011987
1738 Ga0105246_10035946
1739 Ga0105246_10097071
1740 Ga0105246_10541703
1741 Ga0105246_10863156
1742 Ga0105246_11228098
1743 Ga0105246_11573969
1744 Ga0105246_11843621
1745 Ga0105246_12019615
1746 Ga0157373_10293719
1747 Ga0157373_10758846
1748 Ga0157370_10035301
1749 Ga0157370_10141009
1750 Ga0157369_10018692
1751 Ga0157369_10094646
1752 Ga0157369_10282633
1753 Ga0157369_10601392
1754 Ga0157374_10030777
1755 Ga0157374_10357940
1756 Ga0157374_10561190
1757 Ga0157374_11207787
1758 Ga0157374_11947040
1759 Ga0157378_10155205
1760 Ga0157378_10219928
1761 Ga0157378_10710510
1762 Ga0157378_12058940
1763 Ga0157378_13244901
1764 Ga0163162_10026136
1765 Ga0163162_10031643
1766 Ga0163162_10183057
1767 Ga0163162_10242953
1768 Ga0163162_10272397
1769 Ga0163162_10591125
1770 Ga0163162_10741575
1771 Ga0163162_11419048
1772 Ga0163162_11770137
1773 Ga0157372_10030290
1774 Ga0157372_10075935
1775 Ga0157372_10148606
1776 Ga0157375_10046484
1777 Ga0157375_10149571
1778 Ga0157375_10267498
1779 Ga0157375_10391815
1780 Ga0157375_10487036
1781 Ga0157375_11018709
1782 Ga0157375_12882274
1783 Ga0163163_10007500
1784 Ga0163163_10050743
1785 Ga0163163_10078610
1786 Ga0163163_10092490
1787 Ga0163163_10342092
1788 Ga0163163_10447602
1789 Ga0163163_10489450
1790 Ga0163163_10892774
1791 Ga0163163_11654517
1792 Ga0157380_10047597
1793 Ga0157380_10315015
1794 Ga0157380_10424194
1795 Ga0157380_11114370
1796 Ga0157380_11570670
1797 Ga0157380_13050852
1798 Ga0182008_10106991
1799 Ga0157377_10034041
1800 Ga0157377_10082310
1801 Ga0157377_10292193
1802 Ga0157377_10505589
1803 Ga0157377_11009761
1804 Ga0157379_10092557
1805 Ga0157379_10202799
1806 Ga0157379_10204212
1807 Ga0157379_10209807
1808 Ga0157379_10255138
1809 Ga0157379_12345560
1810 Ga0157376_10007382
1811 Ga0157376_10146405
1812 Ga0157376_10323650
1813 Ga0157376_10510367
1814 Ga0157376_10723427
1815 Ga0157376_11085604
1816 Ga0157376_11329341
1817 Ga0157376_11388012
1818 Ga0157376_11627103
1819 Ga0157376_11708976
1820 Ga0182005_1124178
1821 Ga0163161_10025323
1822 Ga0163161_10260401
1823 Ga0163161_10440455
1824 Ga0163161_10722028
1825 Ga0213876_10080161
1826 Ga0213876_10194281
1827 Ga0213876_10377566
1828 Ga0209677_102422
1829 Ga0209148_1010927
1830 Ga0209148_1019214
1831 Ga0209233_1002344
1832 Ga0209233_1023913
1833 Ga0209455_1002785
1834 Ga0209455_1006260
1835 Ga0209758_1031951
1836 Ga0207697_10016037
1837 Ga0207656_10057503
1838 Ga0207656_10252237
1839 Ga0207696_1069607
1840 Ga0207653_10309239
1841 Ga0207682_10206804
1842 Ga0207692_10097341
1843 Ga0207642_10007135
1844 Ga0207642_10084942
1845 Ga0207642_10352017
1846 Ga0207710_10365367
1847 Ga0207688_10022442
1848 Ga0207688_10054745
1849 Ga0207688_10074637
1850 Ga0207688_10197409
1851 Ga0207688_10204797
1852 Ga0207680_10177409
1853 Ga0207647_10281401
1854 Ga0207647_10300873
1855 Ga0207647_10451834
1856 Ga0207699_10274178
1857 Ga0207699_10553267
1858 Ga0207645_10100384
1859 Ga0207645_10360065
1860 Ga0207645_10598951
1861 Ga0207643_10023049
1862 Ga0207643_10176063
1863 Ga0207643_10421309
1864 Ga0207705_10723542
1865 Ga0207684_11245498
1866 Ga0207654_10011023
1867 Ga0207707_10000143
1868 Ga0207707_10064118
1869 Ga0207695_10000059
1870 Ga0207695_10059849
1871 Ga0207695_10093922
1872 Ga0207695_10103267
1873 Ga0207671_10001109
1874 Ga0207671_10044193
1875 Ga0207671_10190306
1876 Ga0207671_10291378
1877 Ga0207671_10353320
1878 Ga0207693_10699614
1879 Ga0207663_10051956
1880 Ga0207660_10017202
1881 Ga0207660_10079923
1882 Ga0207660_10233402
1883 Ga0207660_10365126
1884 Ga0207662_10072536
1885 Ga0207657_10087843
1886 Ga0207657_10323832
1887 Ga0207657_10391102
1888 Ga0207649_10346624
1889 Ga0207649_10645440
1890 Ga0207649_10977608
1891 Ga0207652_10011338
1892 Ga0207652_10609593
1893 Ga0207694_10118714
1894 Ga0207694_10796339
1895 Ga0207650_10204856
1896 Ga0207650_10908580
1897 Ga0207659_10090791
1898 Ga0207659_10939719
1899 Ga0207664_11193314
1900 Ga0207690_10464135
1901 Ga0207690_10484324
1902 Ga0207690_10685337
1903 Ga0207706_10032508
1904 Ga0207706_10153740
1905 Ga0207706_10514060
1906 Ga0207706_11586832
1907 Ga0207686_10147999
1908 Ga0207686_10387458
1909 Ga0207709_10042251
1910 Ga0207709_10241584
1911 Ga0207670_10457592
1912 Ga0207669_10256569
1913 Ga0207669_10574961
1914 Ga0207669_11420761
1915 Ga0207704_10014406
1916 Ga0207704_10430400
1917 Ga0207665_10023996
1918 Ga0207665_10634684
1919 Ga0207691_10047055
1920 Ga0207691_10210315
1921 Ga0207691_10772306
1922 Ga0207711_10199624
1923 Ga0207711_10220496
1924 Ga0207711_10275951
1925 Ga0207711_11268444
1926 Ga0207689_10052561
1927 Ga0207689_10059101
1928 Ga0207689_10180415
1929 Ga0207689_10331490
1930 Ga0207689_10505949
1931 Ga0207661_10044679
1932 Ga0207661_10355144
1933 Ga0207679_10290602
1934 Ga0207679_10452616
1935 Ga0207679_11039177
1936 Ga0207679_11501058
1937 Ga0207667_10145811
1938 Ga0207667_10154463
1939 Ga0207651_10161862
1940 Ga0207712_10102838
1941 Ga0207712_10166274
1942 Ga0207712_10194653
1943 Ga0207712_10247656
1944 Ga0207668_10122811
1945 Ga0207668_10134695
1946 Ga0207668_10207302
1947 Ga0207668_10263666
1948 Ga0207668_10438935
1949 Ga0207668_10438946
1950 Ga0207640_10089901
1951 Ga0207640_10361292
1952 Ga0207640_10386336
1953 Ga0207640_10909477
1954 Ga0207658_10647475
1955 Ga0207658_10763870
1956 Ga0207677_10202638
1957 Ga0207677_10860456
1958 Ga0207703_11200462
1959 Ga0207703_11210308
1960 Ga0207639_10160455
1961 Ga0207639_10506472
1962 Ga0207639_10992244
1963 Ga0207639_11397853
1964 Ga0207678_10015293
1965 Ga0207678_10030059
1966 Ga0207678_10067196
1967 Ga0207678_10077044
1968 Ga0207678_10132918
1969 Ga0207678_10228037
1970 Ga0207678_10606526
1971 Ga0207708_10036812
1972 Ga0207708_10860127
1973 Ga0207702_10115752
1974 Ga0207702_10163693
1975 Ga0207702_10165497
1976 Ga0207702_10240067
1977 Ga0207702_10695115
1978 Ga0207641_10068950
1979 Ga0207641_10719009
1980 Ga0207641_11632619
1981 Ga0207648_10069067
1982 Ga0207648_10674575
1983 Ga0207676_10520654
1984 Ga0207674_10175284
1985 Ga0207674_10284503
1986 Ga0207675_100043034
1987 Ga0207675_100069520
1988 Ga0207675_100088011
1989 Ga0207675_100099220
1990 Ga0207675_100823183
1991 Ga0207675_101239980
1992 Ga0207683_10038386
1993 Ga0207683_10063563
1994 Ga0207683_10192873
1995 Ga0207683_10209971
1996 Ga0207683_10322426
1997 Ga0207683_10752834
1998 Ga0207683_11080219
1999 Ga0207698_10039785
2000 Ga0207698_10231586
2001 Ga0207698_10277937
2002 Ga0207698_10345855
2003 Ga0207698_10429452
2004 Ga0207698_12408026
2005 Ga0209589_1000015
2006 Ga0209489_100015
2007 Ga0209700_100025
2008 Ga0209179_1000903
2009 Ga0209813_10124429
2010 Ga0207428_10875977
2011 Ga0265356_1012512
2012 Ga0268266_10003191
2013 Ga0268266_10018212
2014 Ga0268266_10047304
2015 Ga0268266_10115674
2016 Ga0268265_10077246
2017 Ga0268265_10719282
2018 Ga0268265_11347926
2019 Ga0268265_11384184
2020 Ga0268265_11467784
2021 Ga0268265_12440257
2022 Ga0268264_10000356
2023 Ga0268264_10157667
2024 Ga0268264_10263290
2025 Ga0268264_10680756
2026 Ga0268264_11141684
2027 Ga0307515_10045648
2028 Ga0307511_10132509
2029 Ga0307511_10194685
2030 Ga0307512_10423455
2031 Ga0265330_10012848
2032 Ga0265330_10199581
2033 Ga0307513_10168005
2034 Ga0307509_10009216
2035 Ga0307509_10376963
2036 Ga0307509_10640941
2037 Ga0307408_100722853
2038 Ga0307508_10000715
2039 Ga0307508_10073634
2040 Ga0307508_10667726
2041 Ga0307508_10900221
2042 Ga0265342_10186629
2043 Ga0307516_10005305
2044 Ga0307516_10009786
2045 Ga0307516_10099990
2046 Ga0307516_10102108
2047 Ga0307516_10142157
2048 Ga0307516_10233822
2049 Ga0307516_10245733
2050 Ga0307516_10495779
2051 Ga0307405_10810442
2052 Ga0326468_10008419
2053 Ga0307406_10214720
2054 Ga0307407_10142512
2055 Ga0307412_10221792
2056 Ga0307412_10798454
2057 Ga0307412_11864422
2058 Ga0307409_101058608
2059 Ga0307409_101068088
2060 Ga0307409_101665964
2061 Ga0307416_100370337
2062 Ga0307416_100827607
2063 Ga0307416_101523765
2064 Ga0307416_102246675
2065 Ga0307411_10271283
2066 Ga0307411_10537234
2067 Ga0307415_100546883
2068 Ga0307415_100614463
2069 Ga0307507_10190397
2070 Ga0307510_10049561
2071 Ga0307510_10078920
2072 Ga0307510_10129800
2073 Ga0307510_10179538
2074 Ga0307510_10574515
2075 Ga0315911_1000021
2076 Ga0373950_0060189
2077 Ga0373926_0245299
2078 Ga0373928_0068305
2079 Ga0373934_0005810
2080 Ga0373940_0365362
2081 Ga0373952_0012727
2082 Ga0373923_0001264
2083 Ga0373932_0057673
2084 Ga0373936_0292141
2085 Ga0373945_0578076
2086 Ga0373953_0009689
2087 Ga0373953_0311352
2088 Ga0373954_0001440
2089 Ga0373956_0000376
2090 Ga0373956_0267324
2091 Ga0373957_0000575
2092 Ga0373943_0093790
2093 Ga0373943_0304847
2094 Ga0373943_0666580
2095 Ga0373955_0000325
2096 Ga0373955_0094862
2097 Ga0373924_0000567
2098 Ga0373931_0006104
2099 Ga0373935_0005959
2100 Ga0373935_0141667
2101 Ga0373935_0231401
2102 Ga0373935_0479249
2103 Ga0373927_0005646
2104 Ga0373927_0051745
2105 Ga0373927_0056834
2106 Ga0373927_0074127
2107 Ga0373927_0139344
2108 Ga0373927_0151302
2109 Ga0373927_0622588
2110 Ga0373933_0000108
2111 Ga0373933_0002337
2112 Ga0373947_0054194
2113 Ga0373947_0193833
2114 Ga0373947_0225024
2115 Ga0373937_0036844
2116 Ga0373937_0294717
2117 Ga0373937_0792342
2118 Ga0373925_0175704
2119 Ga0373925_0218338
2120 Ga0373925_0282962
2121 Ga0373925_0288860
2122 Ga0373925_0670134
2123 Ga0395899_0154932
2124 Ga0395899_0652635
2125 Ga0395899_0797694
2126 Ga0395900_0139090
2127 Ga0395900_0280928
2128 Ga0395898_0136250
2129 Ga0395898_0995894
2130 Ga0395898_1709599
2131 Ga0395905_0018632
2132 Ga0395905_0294700
2133 Ga0395905_1324186
2134 Ga0395905_1851601
2135 Ga0436364_0879350
2136 Ga0395901_0058033
2137 Ga0395901_0321389
2138 Ga0395901_0436961
2139 Ga0395901_1233128
2140 Ga0395901_1854960
2141 Ga0436365_0414572
2142 Ga0436365_0429696
2143 Ga0436365_1212947
2144 Ga0436361_0899129
2145 Ga0439465_0058246
2146 Ga0439465_0064370
2147 Ga0451787_105515
2148 Ga0451791_0677543
2149 Ga0451791_1155178
2150 Ga0451797_0053473
2151 Ga0451797_1018948
2152 Ga0451800_0728190
2153 Ga0451800_1438690
2154 Ga0451802_1426775
2155 Ga0451804_0726654
2156 Ga0451833_0126247
2157 Ga0451837_1574521
2158 Ga0451847_0379818
2159 Ga0451853_0473635
2160 Ga0439445_0101008
2161 Ga0439458_0210853
2162 Ga0439459_0150446
2163 Ga0466966_0000411
2164 Ga0466961_0000065
2165 Ga0466957_0149701
2166 Ga0466957_0220346
2167 Ga0466957_0769191
2168 Ga0466959_0000634
2169 Ga0466959_0318213
2170 Ga0495617_033360
2171 Ga0495617_050127
2172 Ga0495617_061551
2173 Ga0495592_0000339
2174 Ga0495592_0716043
2175 Ga0495592_0782603
2176 Ga0495603_0004729
2177 Ga0495603_0053248
2178 Ga0495603_0209080
2179 Ga0495603_0323343
2180 Ga0495629_0001483
2181 Ga0495629_0090157
2182 Ga0495629_0412836
2183 Ga0495638_0050016
2184 Ga0495638_0104997
2185 Ga0495638_0174932
2186 Ga0495651_0028813
2187 Ga0495651_0044793
2188 Ga0495651_0528313
2189 Ga0495653_0001063
2190 Ga0495653_0057062
2191 Ga0495650_0094542
2192 Ga0495580_0072493
2193 Ga0495580_0174340
2194 Ga0495580_0307451
2195 Ga0495582_0027690
2196 Ga0495582_0230584
2197 Ga0495582_0315786
2198 Ga0495605_0075002
2199 Ga0495605_0092495
2200 Ga0495639_0131831
2201 Ga0495639_0490631
2202 Ga0495664_0097922
2203 Ga0495664_0105741
2204 Ga0495664_0228271
2205 Ga0495584_0222648
2206 Ga0495584_0273818
2207 Ga0495585_0127932
2208 Ga0495585_0148924
2209 Ga0495585_0456162
2210 Ga0495594_0067703
2211 Ga0495594_0134305
2212 Ga0495583_0109181
2213 Ga0495583_0215078
2214 Ga0495606_0174896
2215 Ga0495606_0255921
2216 Ga0495606_0475627
2217 Ga0495608_0002749
2218 Ga0495610_0101824
2219 Ga0495616_0110849
2220 Ga0495616_0182993
2221 Ga0495616_0315183
2222 Ga0495618_0049103
2223 Ga0495620_0174465
2224 Ga0495620_0183369
2225 Ga0495628_0001554
2226 Ga0495628_0189804
2227 Ga0495628_0341361
2228 Ga0495630_0601118
2229 Ga0495631_0036126
2230 Ga0495631_0130116
2231 Ga0495632_0109049
2232 Ga0495632_0125432
2233 Ga0495643_0185414
2234 Ga0495644_0108805
2235 Ga0495644_0137667
2236 Ga0495648_0003177
2237 Ga0495648_0012566
2238 Ga0495648_0165396
2239 Ga0495648_0233855
2240 Ga0495652_0007546
2241 Ga0495652_0222429
2242 Ga0495640_0050475
2243 Ga0495587_0006630
2244 Ga0495587_0330207
2245 Ga0495587_0521198
2246 Ga0495609_0110055
2247 Ga0495609_0159272
2248 Ga0495621_0077638
2249 Ga0495621_0254890
2250 Ga0495597_0135553
2251 Ga0495597_0270929
2252 Ga0495597_0425992
2253 Ga0495645_0003892
2254 Ga0495622_0046414
2255 Ga0495622_0049833
2256 Ga0495622_0122333
2257 Ga0495622_0210828
2258 Ga0495633_0039798
2259 Ga0495633_0273372
2260 Ga0495667_0021740
2261 Ga0495667_0435858
2262 Ga0495656_0007133
2263 Ga0495656_0043638
2264 Ga0495656_0051008
2265 Ga0495668_0235698
2266 Ga0495668_0307684
2267 Ga0495668_0547249
2268 Ga0495634_0005678
2269 Ga0495611_0067301
2270 Ga0495611_0160048
2271 Ga0495611_0262332
2272 Ga0495625_0128978
2273 Ga0495625_0144480
2274 Ga0495625_0372106
2275 Ga0495625_0448718
2276 Ga0495635_0000917
2277 Ga0495659_0026348
2278 Ga0495661_0191682
2279 Ga0495661_0420965
2280 Ga0495588_0030267
2281 Ga0495588_0212180
2282 Ga0495657_0013656
2283 Ga0495599_0001780
2284 Ga0495599_0098299
2285 Ga0495623_0009830
2286 Ga0495646_0003865
2287 Ga0495647_0332583
2288 Ga0495658_0076463
2289 Ga0495669_0031697
2290 Ga0495669_0153987
2291 Ga0495669_0199113
2292 Ga0495613_0003569
2293 Ga0495613_0914857
2294 Ga0495624_0426316
2295 Ga0495670_0051410
2296 Ga0495670_0193047
2297 Ga0495671_0127927
2298 Ga0495671_0322461
2299 Ga0495671_0580337
2300 Ga0495649_0167739
2301 Ga0495649_0187677
2302 Ga0495649_0190004
2303 Ga0495649_0193306
2304 Ga0495649_0255972
2305 Ga0495589_0047632
2306 Ga0495589_0051394
2307 Ga0495589_0133765
2308 Ga0495600_0005669
2309 Ga0495600_0129344
2310 Ga0495600_0367813
2311 Ga0495660_0233322
2312 Ga0495660_0451087
2313 Ga0495581_0367953
2314 Ga0495604_0031098
2315 Ga0495604_0127537
2316 Ga0495604_0134552
2317 Ga0495674_0037829
2318 Ga0495674_0085898
2319 Ga0495674_0571770
2320 Ga0495674_0809613
2321 Ga0495674_1320507
2322 Ga0495672_0068545
2323 Ga0495672_0072262
2324 Ga0495676_0259449
2325 Ga0495676_0269578
2326 Ga0495676_1079294
2327 Ga0495680_0001065
2328 Ga0495683_0075406
2329 Ga0495683_0091695
2330 Ga0495683_0268973
2331 Ga0495675_0000901
2332 Ga0495679_175126
2333 Ga0495685_119706
2334 Ga0495685_142129
2335 Ga0495673_0006914
2336 Ga0495673_0192652
2337 Ga0495673_0204152
2338 Ga0495673_0329218
2339 Ga0495681_0218515
2340 Ga0495684_0000721
2341 Ga0495686_0053138
2342 Ga0495686_0104159
2343 Ga0495593_0003054
2344 Ga0495593_0237678
2345 Ga0495602_0043034
2346 Ga0495602_0812247
2347 Ga0495615_0162652
2348 Ga0496100_0064188
2349 Ga0496100_0127505
2350 Ga0496100_0390952
2351 Ga0496100_0430424
2352 Ga0496100_1270213
2353 Ga0496101_0033066
2354 Ga0496101_0092525
2355 Ga0496101_0097010
2356 Ga0496101_0432468
2357 Ga0496101_1145420
2358 Ga0496102_0263478
2359 Ga0496102_0373178
2360 Ga0496102_0508738
2361 Ga0496102_0705585
2362 Ga0496102_0775549
2363 Ga0496102_0787488
2364 Ga0496102_1633552
2365 Ga0496103_0130391
2366 Ga0496103_0214391
2367 Ga0496103_0292461
2368 Ga0496104_0076570
2369 Ga0496104_0444521
2370 Ga0496104_0977471
2371 Ga0496104_1057353
2372 Ga0496105_0078902
2373 Ga0496105_0190363
2374 Ga0496105_0431547
2375 Ga0496106_0001953
2376 Ga0496106_0005142
2377 Ga0496106_0013044
2378 Ga0496106_0118296
2379 Ga0496106_0181218
2380 Ga0496106_0238959
2381 Ga0496106_0353282
2382 Ga0496107_0107732
2383 Ga0496107_0152462
2384 Ga0496107_0212262
2385 Ga0496107_0329489
2386 Ga0496107_0659024
2387 Ga0496107_0894723
2388 Ga0496107_1054493
2389 Ga0496108_0029882
2390 Ga0496108_0042630
2391 Ga0496108_0047665
2392 Ga0496108_0692190
2393 Ga0496109_0019726
2394 Ga0496109_0058661
2395 Ga0496109_0153066
2396 Ga0496109_0803475
2397 Ga0496110_0029199
2398 Ga0496110_0043444
2399 Ga0496110_0099562
2400 Ga0496110_0303371
2401 Ga0496110_0317462
2402 Ga0496111_0175089
2403 Ga0496111_0185766
2404 Ga0496111_0754909
2405 Ga0496112_0035435
2406 Ga0496112_0036732
2407 Ga0496112_0072004
2408 Ga0496112_0097007
2409 Ga0496112_0769085
2410 Ga0496113_0051127
2411 Ga0496113_0112428
2412 Ga0496113_0192923
2413 Ga0496113_0365944
2414 Ga0496113_0410881
2415 Ga0496114_0053462
2416 Ga0496114_0158287
2417 Ga0496114_0204861
2418 Ga0496114_0293754
2419 Ga0496114_0891956
2420 Ga0496114_0992713
2421 Ga0496115_0004493
2422 Ga0496115_0060281
2423 Ga0496115_0113069
2424 Ga0496115_0226455
2425 Ga0496115_0289910
2426 Ga0496115_0494018
2427 Ga0496115_0572113
2428 Ga0496115_1267033
2429 Ga0496117_0014058
2430 Ga0496117_0057259
2431 Ga0496118_0003027
2432 Ga0496118_0066793
2433 Ga0496118_0157901
2434 Ga0496118_0339093
2435 Ga0496118_0497724
2436 Ga0496119_0427137
2437 Ga0496120_0213708
2438 Ga0496121_0001622
2439 Ga0496121_0002689
2440 Ga0496121_0080207
2441 Ga0496121_0162356
2442 Ga0496121_0197492
2443 Ga0496121_0650170
2444 Ga0496124_0002957
2445 Ga0496124_0199622
2446 Ga0496125_0009386
2447 Ga0496125_0070558
2448 Ga0496125_0094685
2449 Ga0496125_0179978
2450 Ga0496125_0249255
2451 Ga0496126_0003472
2452 Ga0496126_0003803
2453 Ga0496126_0228574
2454 Ga0496126_0303209
2455 Ga0496126_0314173
2456 Ga0496126_0431003
2457 Ga0496126_1178508
2458 Ga0496126_1300247
2459 Ga0495682_0026858
2460 Ga0495682_0167279
2461 Ga0495682_0213961
2462 Ga0501067_0070383
2463 Ga0501069_0866252
2464 Ga0501071_0266307
2465 Ga0501074_0687003
2466 Ga0501074_0838631
2467 Ga0501080_0207467
2468 nmdc:mga03n38_20242_c1
2469 nmdc:mga03n38_35336_c1
2470 nmdc:mga03n38_528963_c1
2471 nmdc:mga03n38_71183_c1
2472 nmdc:mga00v17_391001_c1
2473 nmdc:mga00v17_75479_c1
2474 nmdc:mga0yw44_177417_c1
2475 nmdc:mga0yw44_198255_c1
2476 nmdc:mga0yw44_523416_c1
2477 nmdc:mga0yw44_63381_c1
2478 nmdc:mga0yw44_872379_c1
2479 nmdc:mga0k408_100972_c1
2480 nmdc:mga0k408_111125_c1
2481 nmdc:mga0k408_22789_c2
2482 nmdc:mga0k408_551798_c1
2483 nmdc:mga06z11_203006_c1
2484 nmdc:mga06z11_252947_c1
2485 nmdc:mga06z11_303406_c1
2486 nmdc:mga06z11_319602_c1
2487 nmdc:mga06z11_366065_c1
2488 nmdc:mga06z11_627_c1
2489 nmdc:mga06z11_771993_c1
2490 nmdc:mga04h51_127125_c1
2491 nmdc:mga04h51_45473_c1
2492 nmdc:mga07m45_270338_c1
2493 nmdc:mga07m45_376983_c1
2494 nmdc:mga07m45_57150_c1
2495 nmdc:mga07m45_601019_c1
2496 nmdc:mga05p37_408930_c1
2497 nmdc:mga06r32_756603_c1
2498 nmdc:mga08y16_1758664_c1
2499 nmdc:mga08y16_406484_c1
2500 nmdc:mga0n895_1354839_c1
2501 nmdc:mga0n895_1860804_c1
2502 nmdc:mga0n895_225827_c1
2503 nmdc:mga0rr50_281033_c1
2504 nmdc:mga0rr50_593145_c1
2505 nmdc:mga0a205_341599_c1
2506 nmdc:mga0a205_985218_c1
2507 nmdc:mga0sz30_164624_c1
2508 nmdc:mga0sz30_29112_c1
2509 nmdc:mga0sz30_9035_c2
2510 Ga0495601_0029491
2511 Ga0495601_0053486
2512 Ga0495601_0417342
2513 Ga0495612_0416343
2514 Ga0500610_0278880
2515 Ga0500635_0009001
2516 Ga0500635_0055437
2517 Ga0500635_0160809
2518 Ga0495655_0316876
2519 Ga0495595_0001490
2520 Ga0495619_0000912
2521 Ga0495619_0083152
2522 Ga0495619_0126939
2523 Ga0495619_0149163
2524 Ga0495619_0179641
2525 Ga0500578_0040493
2526 Ga0500578_0132286
2527 Ga0500578_0164064
2528 Ga0500578_0370913
2529 Ga0500644_0314103
2530 Ga0500646_0117506
2531 Ga0500646_0395972
2532 Ga0500647_0155616
2533 Ga0500583_0260589
2534 Ga0500583_0529834
2535 Ga0500566_0032785
2536 Ga0500566_0498272
2537 Ga0500640_187383
2538 Ga0500641_0005231
2539 Ga0500641_0045528
2540 Ga0500650_0091755
2541 Ga0500556_0196097
2542 Ga0500594_0045421
2543 Ga0500595_006657
2544 Ga0500595_020165
2545 Ga0500595_167868
2546 Ga0500607_114426
2547 Ga0500608_060438
2548 Ga0500614_039754
2549 Ga0500614_066652
2550 Ga0500655_009439
2551 Ga0500655_010286
2552 Ga0500658_0177111
2553 Ga0500658_0224572
2554 Ga0500559_0004946
2555 Ga0500559_0076358
2556 Ga0500561_0117032
2557 Ga0500561_0140407
2558 Ga0500564_079106
2559 Ga0500573_0316081
2560 Ga0500577_0338541
2561 Ga0500589_102370
2562 Ga0500589_155133
2563 Ga0500590_059698
2564 Ga0500590_129150
2565 Ga0500590_136178
2566 Ga0500603_000540
2567 Ga0500603_048844
2568 Ga0500604_0018740
2569 Ga0500604_0138253
2570 Ga0500620_039200
2571 Ga0500622_0387210
2572 Ga0500633_0050319
2573 Ga0500633_0229240
2574 Ga0500634_0089899
2575 Ga0500634_0159268
2576 Ga0500638_027293
2577 Ga0500638_263500
2578 Ga0500639_295253
2579 Ga0500636_0014674
2580 Ga0500636_0033475
2581 Ga0500636_0065119
2582 Ga0500636_0303953
2583 Ga0500636_0342243
2584 Ga0500637_0000131
2585 Ga0500649_068841
2586 Ga0500611_161427
2587 Ga0500645_025184
2588 Ga0500609_006345
2589 Ga0500609_017029
2590 Ga0500609_025521
2591 Ga0500552_000562
2592 Ga0500596_002600
2593 Ga0500599_000712
2594 Ga0500601_003192
2595 Ga0500661_026136
2596 Ga0466962_0445465
2597 Ga0466962_0566392
2598 Ga0530510_0518858
2599 Ga0530510_0553150
2600 2513638775
2601 2513659789
2602 2513676923
2603 2513718674
2604 2513720144
2605 2513857250
2606 2513918865
2607 2517888190
2608 2524533366
2609 2671119351
2610 2728753847
2611 2793073869
2612 2885380651
2613 2885391422
2614 2903752678
2615 2903772252
2616 2904695765
2617 2904709893
2618 2906614453
2619 2906643424
2620 2906666616
2621 2908746718
2622 2908764281
2623 2922389347
2624 2922426287
2625 2935632672
2626 2941508664
2627 2941516494
2628 2941524490
2629 3005475651
2630 8006936985
2631 8006976953
2632 8019561687
2633 8019571760
2634 8019651706
2635 8056683450
2636 8056690827

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

53

144

0.94

PF13622

4HBT_3

Acyl-CoA thioesterase N-terminal domain

46

145

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nwz-assembly3.cif.gz_D crystal structure of bh2602 protein from bacillus halodurans with coa, northeast structural genomics consortium target bhr199 0.9285 37 135
2h4u-assembly1.cif.gz_D crystal structure of human thioesterase superfamily member 2 0.9232 26 134
3nwz-assembly2.cif.gz_C crystal structure of bh2602 protein from bacillus halodurans with coa, northeast structural genomics consortium target bhr199 0.9224 36 135
3dkz-assembly1.cif.gz_A crystal structure of the q7w9w5_borpa protein from bordetella parapertussis. northeast structural genomics consortium target bpr208c. 0.9175 26 135
5ep5-assembly1.cif.gz_B the crystal structure of the hypothetical protein sav0944 mutant (glu47ala) from staphylococcus aureus. 0.9157 30 137
ID Description Score Start End Superfamily
af_P34419_18_155_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9295 26 135 3.10.129.10
af_Q9M2E4_49_183_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9261 26 134 3.10.129.10
af_Q54GL4_70_197_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9248 26 138 3.10.129.10
2h4uD00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9232 26 134 3.10.129.10
af_Q9FI76_3_136_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9173 26 133 3.10.129.10
ID Description Score Start End GO Terms
AF-Q6N8X2-F1-model_v4 Phenylacetic acid degradation-related protein 0.9843 2 139 GO:0047617
AF-H1SD47-F1-model_v4 Phenylacetic acid degradation-related protein 0.98 27 135 GO:0047617
AF-A0A125Q6S1-F1-model_v4 Thioesterase 0.9773 2 142 GO:0047617
AF-A0A257JKX7-F1-model_v4 Thioesterase 0.9762 3 138 GO:0016289
AF-A0A495RQ26-F1-model_v4 deleted 0.9684 3 142

Map