F492955
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1318 | 503 | 2636 | 144 |
Family's Representative Sequence
| Representative Sequence | 3300053097|Ga0500648_071668|Ga0500648_071668_56_520 |
| Length | 154 |
| Sequence | MTTDTTPHAVPDGYEPHFRRSPFTDPWEPLYSQRTDRAVILALRLAKPHTNSRGLIHGGLIAALADNAMGYSCGQVMSRGVGGEMGGQSSLVTISLAVDFIGSAQIGQWLAVESEVIRTGHTICFAQSLIKADEAVIARANATFRVVTKRAVVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 2 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 3 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 4 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 8 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 73 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 79 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 80 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 81 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 83 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 84 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 85 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 86 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 87 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 91 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 92 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 93 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 95 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 96 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 97 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 98 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 99 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 100 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 101 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 102 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 104 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 105 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 106 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 107 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 108 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 122 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 135 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 139 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 141 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 210 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 211 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 212 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 214 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 215 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 216 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 220 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 221 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 222 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 223 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 224 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 225 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 226 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 227 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 228 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 229 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 230 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 231 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 232 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 233 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 234 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 235 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 236 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 237 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 238 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 239 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 240 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 241 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 242 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 243 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 244 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 245 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 246 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 247 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 248 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 249 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 250 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 251 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 252 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 253 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 254 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 255 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 256 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 257 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 258 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 259 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 260 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 261 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 262 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 263 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 264 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 265 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 266 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 267 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 268 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 269 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 270 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 271 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 272 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 273 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 274 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 275 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 276 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 277 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 278 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 279 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 280 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 281 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 282 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 283 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 284 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 285 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 286 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 287 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 288 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 289 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 290 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 291 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 373 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 374 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 375 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 376 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 377 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 378 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 379 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 380 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 381 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 382 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 383 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 384 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 385 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 386 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 387 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 388 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 389 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 390 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 391 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 392 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 393 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 394 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 395 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 396 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 401 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 403 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 404 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 405 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 406 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 407 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 408 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 409 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 416 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 419 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 420 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 424 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 425 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 426 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 427 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 428 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 429 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 430 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 431 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 432 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 433 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 434 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 435 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 436 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 437 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 438 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 439 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 440 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 441 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 442 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 443 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 444 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 445 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 446 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 447 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 448 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 449 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 450 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 451 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 452 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 453 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 454 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 455 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 456 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 457 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 458 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 459 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 460 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 461 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 462 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 463 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 464 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 465 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 466 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 467 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 468 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 469 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 470 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 471 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 472 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 473 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 474 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 475 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 476 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 477 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 478 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 479 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 480 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 481 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 482 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 483 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 484 | 2904699407 | |||
| 485 | 2906610324 | |||
| 486 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 487 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 488 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 489 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 490 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 491 | 2922425934 | |||
| 492 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 493 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 494 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 495 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 496 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 497 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 498 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 499 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 500 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 501 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 502 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 503 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.41 |
| Metatranscriptomes | 0 |
| Isolates | 2.59 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.37 |
| Nodule | 2.5 |
| Rhizoplane | 6.9 |
| Rhizosphere | 72.38 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0500648_071668 | 3300053097 | Bacteria | 1958 |
| 2 | JGI24744J21845_10038047 | 3300002077 | Bacteria | 905 |
| 3 | JGI25165J46597_1006290 | 3300003214 | Bacteria | 2120 |
| 4 | JGI25165J46597_1028343 | 3300003214 | Bacteria | 723 |
| 5 | JGI25153J46596_10032912 | 3300003215 | Bacteria | 1720 |
| 6 | rootH2_10000947 | 3300003320 | Bacteria | 1921 |
| 7 | JGI25160J50197_1002717 | 3300003354 | Bacteria | 8137 |
| 8 | JGI25160J50197_1047327 | 3300003354 | Bacteria | 936 |
| 9 | JGI25404J52841_10101509 | 3300003659 | Bacteria | 603 |
| 10 | Ga0055539_1002207 | 3300003752 | Bacteria | 3094 |
| 11 | Ga0055529_1004345 | 3300003763 | Bacteria | 2168 |
| 12 | Ga0055529_1034042 | 3300003763 | Bacteria | 622 |
| 13 | Ga0055526_1031085 | 3300003771 | Bacteria | 1540 |
| 14 | Ga0055531_10005040 | 3300003794 | Bacteria | 7829 |
| 15 | Ga0055543_1006115 | 3300004625 | Bacteria | 2964 |
| 16 | Ga0065165_1002365 | 3300005262 | Bacteria | 16315 |
| 17 | Ga0065165_1009969 | 3300005262 | Bacteria | 4179 |
| 18 | Ga0070658_10103008 | 3300005327 | Bacteria | 2360 |
| 19 | Ga0070658_10182122 | 3300005327 | Bacteria | 1768 |
| 20 | Ga0070658_10292635 | 3300005327 | Bacteria | 1388 |
| 21 | Ga0070658_11280166 | 3300005327 | Bacteria | 637 |
| 22 | Ga0070676_10865643 | 3300005328 | Bacteria | 671 |
| 23 | Ga0070676_10918115 | 3300005328 | Bacteria | 653 |
| 24 | Ga0070690_100071372 | 3300005330 | Bacteria | 2256 |
| 25 | Ga0070690_100071567 | 3300005330 | Bacteria | 2253 |
| 26 | Ga0070670_101064560 | 3300005331 | Bacteria | 737 |
| 27 | Ga0070670_101372890 | 3300005331 | Bacteria | 647 |
| 28 | Ga0068869_100113815 | 3300005334 | Bacteria | 2061 |
| 29 | Ga0068869_100175542 | 3300005334 | Bacteria | 1676 |
| 30 | Ga0068869_100592412 | 3300005334 | Bacteria | 936 |
| 31 | Ga0068869_100644735 | 3300005334 | Bacteria | 898 |
| 32 | Ga0068869_101039746 | 3300005334 | Bacteria | 714 |
| 33 | Ga0068869_101372215 | 3300005334 | Bacteria | 625 |
| 34 | Ga0070666_10421153 | 3300005335 | Bacteria | 962 |
| 35 | Ga0070666_10539424 | 3300005335 | Bacteria | 848 |
| 36 | Ga0070680_100013830 | 3300005336 | Bacteria | 6296 |
| 37 | Ga0070680_100032348 | 3300005336 | Bacteria | 4210 |
| 38 | Ga0070680_100065382 | 3300005336 | Bacteria | 2980 |
| 39 | Ga0070680_100221429 | 3300005336 | Bacteria | 1597 |
| 40 | Ga0070682_100027255 | 3300005337 | Bacteria | 3428 |
| 41 | Ga0070682_100513577 | 3300005337 | Bacteria | 931 |
| 42 | Ga0070682_100909222 | 3300005337 | Bacteria | 724 |
| 43 | Ga0070682_101359303 | 3300005337 | Bacteria | 606 |
| 44 | Ga0070682_101461079 | 3300005337 | Bacteria | 586 |
| 45 | Ga0068868_100050101 | 3300005338 | Bacteria | 3278 |
| 46 | Ga0068868_100208887 | 3300005338 | Bacteria | 1631 |
| 47 | Ga0068868_100468311 | 3300005338 | Bacteria | 1099 |
| 48 | Ga0068868_100937391 | 3300005338 | Bacteria | 789 |
| 49 | Ga0068868_100955070 | 3300005338 | Bacteria | 782 |
| 50 | Ga0068868_101345856 | 3300005338 | Bacteria | 664 |
| 51 | Ga0068868_101369740 | 3300005338 | Bacteria | 659 |
| 52 | Ga0070660_100053169 | 3300005339 | Bacteria | 3123 |
| 53 | Ga0070660_100200218 | 3300005339 | Bacteria | 1620 |
| 54 | Ga0070660_100420662 | 3300005339 | Bacteria | 1106 |
| 55 | Ga0070660_101058602 | 3300005339 | Bacteria | 686 |
| 56 | Ga0070660_101083313 | 3300005339 | Bacteria | 678 |
| 57 | Ga0070691_10340603 | 3300005341 | Bacteria | 830 |
| 58 | Ga0070691_10464654 | 3300005341 | Bacteria | 725 |
| 59 | Ga0070661_100739301 | 3300005344 | Bacteria | 804 |
| 60 | Ga0070661_100784881 | 3300005344 | Bacteria | 781 |
| 61 | Ga0070661_101387666 | 3300005344 | Bacteria | 591 |
| 62 | Ga0070668_100024341 | 3300005347 | Bacteria | 4586 |
| 63 | Ga0070668_100059725 | 3300005347 | Bacteria | 2951 |
| 64 | Ga0070668_100091702 | 3300005347 | Bacteria | 2396 |
| 65 | Ga0070668_100211016 | 3300005347 | Bacteria | 1597 |
| 66 | Ga0070668_100241381 | 3300005347 | Bacteria | 1497 |
| 67 | Ga0070668_100244840 | 3300005347 | Bacteria | 1486 |
| 68 | Ga0070668_100355770 | 3300005347 | Bacteria | 1240 |
| 69 | Ga0070668_100693725 | 3300005347 | Bacteria | 897 |
| 70 | Ga0070668_100724415 | 3300005347 | Bacteria | 879 |
| 71 | Ga0070668_100928861 | 3300005347 | Bacteria | 779 |
| 72 | Ga0070669_100115968 | 3300005353 | Bacteria | 2038 |
| 73 | Ga0070669_100122830 | 3300005353 | Bacteria | 1983 |
| 74 | Ga0070669_100396359 | 3300005353 | Bacteria | 1128 |
| 75 | Ga0070669_101131874 | 3300005353 | Bacteria | 675 |
| 76 | Ga0070675_100302007 | 3300005354 | Bacteria | 1410 |
| 77 | Ga0070675_100340784 | 3300005354 | Bacteria | 1328 |
| 78 | Ga0070675_100573817 | 3300005354 | Bacteria | 1021 |
| 79 | Ga0070671_100360218 | 3300005355 | Bacteria | 1242 |
| 80 | Ga0070671_100491034 | 3300005355 | Bacteria | 1056 |
| 81 | Ga0070671_100868957 | 3300005355 | Bacteria | 787 |
| 82 | Ga0070671_101203392 | 3300005355 | Unclassified | 667 |
| 83 | Ga0070674_100007000 | 3300005356 | Bacteria | 6623 |
| 84 | Ga0070674_101103076 | 3300005356 | Bacteria | 701 |
| 85 | Ga0070673_100295924 | 3300005364 | Bacteria | 1424 |
| 86 | Ga0070688_100042378 | 3300005365 | Bacteria | 2800 |
| 87 | Ga0070688_100104508 | 3300005365 | Bacteria | 1873 |
| 88 | Ga0070659_100107453 | 3300005366 | Bacteria | 2250 |
| 89 | Ga0070659_100174441 | 3300005366 | Bacteria | 1763 |
| 90 | Ga0070667_100348731 | 3300005367 | Bacteria | 1340 |
| 91 | Ga0070667_100485286 | 3300005367 | Bacteria | 1132 |
| 92 | Ga0070667_100501518 | 3300005367 | Bacteria | 1113 |
| 93 | Ga0070667_100986208 | 3300005367 | Bacteria | 786 |
| 94 | Ga0070709_10001773 | 3300005434 | Bacteria | 11730 |
| 95 | Ga0070714_100005907 | 3300005435 | Bacteria | 9391 |
| 96 | Ga0070714_100551144 | 3300005435 | Bacteria | 1104 |
| 97 | Ga0070714_101434259 | 3300005435 | Bacteria | 674 |
| 98 | Ga0070713_100053086 | 3300005436 | Bacteria | 3358 |
| 99 | Ga0070713_100225914 | 3300005436 | Bacteria | 1700 |
| 100 | Ga0070710_10000733 | 3300005437 | Bacteria | 15629 |
| 101 | Ga0070710_10018624 | 3300005437 | Bacteria | 3575 |
| 102 | Ga0070710_11068529 | 3300005437 | Unclassified | 591 |
| 103 | Ga0070701_10232593 | 3300005438 | Bacteria | 1105 |
| 104 | Ga0070701_10726150 | 3300005438 | Bacteria | 671 |
| 105 | Ga0070711_100005722 | 3300005439 | Bacteria | 7454 |
| 106 | Ga0070711_100310649 | 3300005439 | Bacteria | 1256 |
| 107 | Ga0070711_101033773 | 3300005439 | Bacteria | 706 |
| 108 | Ga0070705_100484487 | 3300005440 | Bacteria | 935 |
| 109 | Ga0070700_100293027 | 3300005441 | Bacteria | 1185 |
| 110 | Ga0070694_101485840 | 3300005444 | Bacteria | 573 |
| 111 | Ga0070708_101953017 | 3300005445 | Bacteria | 544 |
| 112 | Ga0070663_100032985 | 3300005455 | Bacteria | 3574 |
| 113 | Ga0070663_100052860 | 3300005455 | Bacteria | 2898 |
| 114 | Ga0070663_100120480 | 3300005455 | Bacteria | 1981 |
| 115 | Ga0070663_100166574 | 3300005455 | Bacteria | 1700 |
| 116 | Ga0070663_100177156 | 3300005455 | Bacteria | 1651 |
| 117 | Ga0070663_100180931 | 3300005455 | Bacteria | 1635 |
| 118 | Ga0070663_101403445 | 3300005455 | Bacteria | 618 |
| 119 | Ga0070678_100059864 | 3300005456 | Bacteria | 2800 |
| 120 | Ga0070678_100105195 | 3300005456 | Bacteria | 2196 |
| 121 | Ga0070678_100133310 | 3300005456 | Bacteria | 1977 |
| 122 | Ga0070678_100146766 | 3300005456 | Bacteria | 1895 |
| 123 | Ga0070678_100335365 | 3300005456 | Bacteria | 1295 |
| 124 | Ga0070678_100351547 | 3300005456 | Bacteria | 1267 |
| 125 | Ga0070678_100543393 | 3300005456 | Bacteria | 1031 |
| 126 | Ga0070678_100730967 | 3300005456 | Bacteria | 894 |
| 127 | Ga0070678_101334487 | 3300005456 | Bacteria | 668 |
| 128 | Ga0070662_100141228 | 3300005457 | Bacteria | 1866 |
| 129 | Ga0070662_101159435 | 3300005457 | Bacteria | 664 |
| 130 | Ga0070662_101482603 | 3300005457 | Bacteria | 585 |
| 131 | Ga0070681_10006411 | 3300005458 | Bacteria | 11447 |
| 132 | Ga0070681_10014525 | 3300005458 | Bacteria | 7837 |
| 133 | Ga0070681_10173382 | 3300005458 | Bacteria | 2078 |
| 134 | Ga0070681_10316432 | 3300005458 | Bacteria | 1470 |
| 135 | Ga0068867_100227394 | 3300005459 | Bacteria | 1506 |
| 136 | Ga0068867_100318977 | 3300005459 | Bacteria | 1287 |
| 137 | Ga0068867_100559410 | 3300005459 | Bacteria | 992 |
| 138 | Ga0070685_10065354 | 3300005466 | Bacteria | 2141 |
| 139 | Ga0070685_10758507 | 3300005466 | Bacteria | 712 |
| 140 | Ga0070699_101130510 | 3300005518 | Bacteria | 719 |
| 141 | Ga0070679_100013787 | 3300005530 | Bacteria | 7745 |
| 142 | Ga0070679_100015371 | 3300005530 | Bacteria | 7354 |
| 143 | Ga0070679_100018490 | 3300005530 | Bacteria | 6764 |
| 144 | Ga0070684_100038107 | 3300005535 | Bacteria | 4128 |
| 145 | Ga0070684_100355186 | 3300005535 | Bacteria | 1348 |
| 146 | Ga0070684_101053956 | 3300005535 | Bacteria | 764 |
| 147 | Ga0070697_100591225 | 3300005536 | Bacteria | 975 |
| 148 | Ga0068853_100148054 | 3300005539 | Bacteria | 2112 |
| 149 | Ga0068853_100721262 | 3300005539 | Bacteria | 952 |
| 150 | Ga0068853_100795427 | 3300005539 | Bacteria | 905 |
| 151 | Ga0068853_101833490 | 3300005539 | Bacteria | 588 |
| 152 | Ga0070672_100053512 | 3300005543 | Bacteria | 3156 |
| 153 | Ga0070672_100135006 | 3300005543 | Bacteria | 2031 |
| 154 | Ga0070672_100232844 | 3300005543 | Bacteria | 1548 |
| 155 | Ga0070686_100141921 | 3300005544 | Bacteria | 1673 |
| 156 | Ga0070693_100062734 | 3300005547 | Bacteria | 2164 |
| 157 | Ga0070693_100110273 | 3300005547 | Bacteria | 1692 |
| 158 | Ga0070693_100143578 | 3300005547 | Bacteria | 1505 |
| 159 | Ga0070693_100229771 | 3300005547 | Bacteria | 1220 |
| 160 | Ga0070693_100384930 | 3300005547 | Bacteria | 968 |
| 161 | Ga0070693_100877263 | 3300005547 | Bacteria | 671 |
| 162 | Ga0070693_101104579 | 3300005547 | Bacteria | 605 |
| 163 | Ga0070665_100038699 | 3300005548 | Bacteria | 4794 |
| 164 | Ga0070665_100039004 | 3300005548 | Bacteria | 4776 |
| 165 | Ga0070665_100060150 | 3300005548 | Bacteria | 3808 |
| 166 | Ga0070665_100062787 | 3300005548 | Bacteria | 3724 |
| 167 | Ga0070665_100122817 | 3300005548 | Bacteria | 2599 |
| 168 | Ga0070665_100502647 | 3300005548 | Bacteria | 1223 |
| 169 | Ga0070665_100629922 | 3300005548 | Bacteria | 1085 |
| 170 | Ga0070665_100645084 | 3300005548 | Bacteria | 1072 |
| 171 | Ga0070665_101402522 | 3300005548 | Bacteria | 708 |
| 172 | Ga0070665_101689334 | 3300005548 | Bacteria | 640 |
| 173 | Ga0070704_100830695 | 3300005549 | Bacteria | 827 |
| 174 | Ga0068855_100027307 | 3300005563 | Bacteria | 6830 |
| 175 | Ga0068855_100096562 | 3300005563 | Bacteria | 3404 |
| 176 | Ga0068855_100160273 | 3300005563 | Bacteria | 2554 |
| 177 | Ga0068855_100621766 | 3300005563 | Bacteria | 1163 |
| 178 | Ga0068855_100765320 | 3300005563 | Bacteria | 1029 |
| 179 | Ga0068855_100940564 | 3300005563 | Bacteria | 911 |
| 180 | Ga0070664_100170152 | 3300005564 | Bacteria | 1932 |
| 181 | Ga0070664_100182911 | 3300005564 | Bacteria | 1864 |
| 182 | Ga0070664_101287003 | 3300005564 | Bacteria | 690 |
| 183 | Ga0070664_101328258 | 3300005564 | Bacteria | 679 |
| 184 | Ga0068857_100160318 | 3300005577 | Bacteria | 2041 |
| 185 | Ga0068857_100271642 | 3300005577 | Bacteria | 1558 |
| 186 | Ga0068857_100483314 | 3300005577 | Bacteria | 1161 |
| 187 | Ga0068854_100647908 | 3300005578 | Bacteria | 907 |
| 188 | Ga0068854_101306410 | 3300005578 | Bacteria | 653 |
| 189 | Ga0068856_100037566 | 3300005614 | Bacteria | 4752 |
| 190 | Ga0068856_100101906 | 3300005614 | Bacteria | 2864 |
| 191 | Ga0068856_100202019 | 3300005614 | Bacteria | 2002 |
| 192 | Ga0068856_100327317 | 3300005614 | Bacteria | 1550 |
| 193 | Ga0070702_100037919 | 3300005615 | Bacteria | 2679 |
| 194 | Ga0070702_100771055 | 3300005615 | Bacteria | 741 |
| 195 | Ga0068852_100070895 | 3300005616 | Bacteria | 3058 |
| 196 | Ga0068852_100084397 | 3300005616 | Bacteria | 2826 |
| 197 | Ga0068852_100193465 | 3300005616 | Bacteria | 1921 |
| 198 | Ga0068852_100350839 | 3300005616 | Bacteria | 1441 |
| 199 | Ga0068852_101999120 | 3300005616 | Bacteria | 602 |
| 200 | Ga0068859_100133974 | 3300005617 | Bacteria | 2549 |
| 201 | Ga0068859_100379271 | 3300005617 | Bacteria | 1509 |
| 202 | Ga0068859_100518138 | 3300005617 | Bacteria | 1287 |
| 203 | Ga0068859_102220546 | 3300005617 | Bacteria | 605 |
| 204 | Ga0068864_100386511 | 3300005618 | Bacteria | 1327 |
| 205 | Ga0068864_100544940 | 3300005618 | Bacteria | 1121 |
| 206 | Ga0068864_100977991 | 3300005618 | Bacteria | 838 |
| 207 | Ga0068864_101296246 | 3300005618 | Bacteria | 729 |
| 208 | Ga0068864_101321049 | 3300005618 | Bacteria | 722 |
| 209 | Ga0068866_10036437 | 3300005718 | Bacteria | 2410 |
| 210 | Ga0068866_10360428 | 3300005718 | Bacteria | 927 |
| 211 | Ga0068866_10656744 | 3300005718 | Bacteria | 715 |
| 212 | Ga0068861_100112343 | 3300005719 | Bacteria | 2184 |
| 213 | Ga0068861_100266273 | 3300005719 | Bacteria | 1469 |
| 214 | Ga0068851_10040575 | 3300005834 | Bacteria | 2339 |
| 215 | Ga0068851_10093102 | 3300005834 | Bacteria | 1589 |
| 216 | Ga0068851_10480322 | 3300005834 | Bacteria | 743 |
| 217 | Ga0068870_10119581 | 3300005840 | Bacteria | 1516 |
| 218 | Ga0068870_10772218 | 3300005840 | Bacteria | 669 |
| 219 | Ga0068863_100279928 | 3300005841 | Bacteria | 1616 |
| 220 | Ga0068863_100796162 | 3300005841 | Bacteria | 943 |
| 221 | Ga0068863_101055557 | 3300005841 | Bacteria | 816 |
| 222 | Ga0068863_101928836 | 3300005841 | Bacteria | 601 |
| 223 | Ga0068858_100150877 | 3300005842 | Bacteria | 2185 |
| 224 | Ga0068858_100184242 | 3300005842 | Bacteria | 1972 |
| 225 | Ga0068858_100284128 | 3300005842 | Bacteria | 1576 |
| 226 | Ga0068858_100440736 | 3300005842 | Bacteria | 1254 |
| 227 | Ga0068858_100573225 | 3300005842 | Bacteria | 1094 |
| 228 | Ga0068858_100785126 | 3300005842 | Bacteria | 929 |
| 229 | Ga0068858_100897084 | 3300005842 | Bacteria | 867 |
| 230 | Ga0068858_101751567 | 3300005842 | Bacteria | 614 |
| 231 | Ga0068858_102368535 | 3300005842 | Bacteria | 525 |
| 232 | Ga0068860_100000313 | 3300005843 | Bacteria | 66545 |
| 233 | Ga0068860_100108777 | 3300005843 | Bacteria | 2649 |
| 234 | Ga0068860_100222614 | 3300005843 | Bacteria | 1832 |
| 235 | Ga0068860_100232285 | 3300005843 | Bacteria | 1792 |
| 236 | Ga0068860_100329950 | 3300005843 | Bacteria | 1498 |
| 237 | Ga0068862_100065140 | 3300005844 | Bacteria | 3138 |
| 238 | Ga0068862_100398886 | 3300005844 | Bacteria | 1286 |
| 239 | Ga0068862_101367367 | 3300005844 | Bacteria | 711 |
| 240 | Ga0081455_10006340 | 3300005937 | Bacteria | 12701 |
| 241 | Ga0081455_10029773 | 3300005937 | Bacteria | 4973 |
| 242 | Ga0081455_10090122 | 3300005937 | Bacteria | 2487 |
| 243 | Ga0081455_10364194 | 3300005937 | Bacteria | 1015 |
| 244 | Ga0081538_10112325 | 3300005981 | Bacteria | 1334 |
| 245 | Ga0081540_1002866 | 3300005983 | Bacteria | 13942 |
| 246 | Ga0081540_1008557 | 3300005983 | Bacteria | 7138 |
| 247 | Ga0081540_1012286 | 3300005983 | Bacteria | 5653 |
| 248 | Ga0081540_1015992 | 3300005983 | Bacteria | 4725 |
| 249 | Ga0081540_1095572 | 3300005983 | Bacteria | 1295 |
| 250 | Ga0081540_1140862 | 3300005983 | Bacteria | 968 |
| 251 | Ga0070717_10034976 | 3300006028 | Bacteria | 4063 |
| 252 | Ga0070717_10065227 | 3300006028 | Bacteria | 3027 |
| 253 | Ga0070717_10081829 | 3300006028 | Bacteria | 2712 |
| 254 | Ga0070717_10556685 | 3300006028 | Bacteria | 1039 |
| 255 | Ga0075365_10060159 | 3300006038 | Bacteria | 2533 |
| 256 | Ga0075365_10120189 | 3300006038 | Bacteria | 1812 |
| 257 | Ga0075365_10120491 | 3300006038 | Bacteria | 1809 |
| 258 | Ga0075365_10238705 | 3300006038 | Bacteria | 1276 |
| 259 | Ga0075365_10366829 | 3300006038 | Bacteria | 1015 |
| 260 | Ga0075365_10698467 | 3300006038 | Bacteria | 716 |
| 261 | Ga0075365_10812657 | 3300006038 | Bacteria | 660 |
| 262 | Ga0075368_10002578 | 3300006042 | Bacteria | 5945 |
| 263 | Ga0075368_10094681 | 3300006042 | Bacteria | 1223 |
| 264 | Ga0075368_10116137 | 3300006042 | Bacteria | 1106 |
| 265 | Ga0075363_100003641 | 3300006048 | Bacteria | 6610 |
| 266 | Ga0075363_100012959 | 3300006048 | Bacteria | 4027 |
| 267 | Ga0075363_100522246 | 3300006048 | Bacteria | 706 |
| 268 | Ga0075363_100838329 | 3300006048 | Bacteria | 560 |
| 269 | Ga0075364_10148444 | 3300006051 | Bacteria | 1579 |
| 270 | Ga0075364_10226694 | 3300006051 | Bacteria | 1269 |
| 271 | Ga0075432_10030829 | 3300006058 | Bacteria | 1855 |
| 272 | Ga0070715_10973969 | 3300006163 | Bacteria | 527 |
| 273 | Ga0070716_100008438 | 3300006173 | Bacteria | 5110 |
| 274 | Ga0070716_100353041 | 3300006173 | Bacteria | 1041 |
| 275 | Ga0070716_100511245 | 3300006173 | Bacteria | 888 |
| 276 | Ga0070716_101198403 | 3300006173 | Bacteria | 610 |
| 277 | Ga0070712_100009263 | 3300006175 | Bacteria | 6203 |
| 278 | Ga0070712_100112642 | 3300006175 | Bacteria | 2033 |
| 279 | Ga0070712_100320151 | 3300006175 | Bacteria | 1261 |
| 280 | Ga0070712_100881676 | 3300006175 | Bacteria | 771 |
| 281 | Ga0070712_100963777 | 3300006175 | Bacteria | 737 |
| 282 | Ga0075367_10095272 | 3300006178 | Bacteria | 1815 |
| 283 | Ga0075367_10107681 | 3300006178 | Bacteria | 1708 |
| 284 | Ga0075367_10110818 | 3300006178 | Bacteria | 1684 |
| 285 | Ga0075367_10129327 | 3300006178 | Bacteria | 1560 |
| 286 | Ga0075367_10180577 | 3300006178 | Bacteria | 1316 |
| 287 | Ga0075367_10380841 | 3300006178 | Bacteria | 891 |
| 288 | Ga0075367_10498548 | 3300006178 | Bacteria | 772 |
| 289 | Ga0075367_10787041 | 3300006178 | Bacteria | 606 |
| 290 | Ga0075369_10039844 | 3300006186 | Bacteria | 2007 |
| 291 | Ga0075369_10042198 | 3300006186 | Bacteria | 1955 |
| 292 | Ga0075369_10142739 | 3300006186 | Bacteria | 1092 |
| 293 | Ga0075369_10581603 | 3300006186 | Bacteria | 535 |
| 294 | Ga0075366_10026120 | 3300006195 | Bacteria | 3418 |
| 295 | Ga0075366_10529080 | 3300006195 | Bacteria | 729 |
| 296 | Ga0075366_10595369 | 3300006195 | Bacteria | 685 |
| 297 | Ga0097621_100311052 | 3300006237 | Bacteria | 1393 |
| 298 | Ga0097621_100344412 | 3300006237 | Bacteria | 1324 |
| 299 | Ga0097621_101178311 | 3300006237 | Bacteria | 721 |
| 300 | Ga0097621_101799642 | 3300006237 | Bacteria | 584 |
| 301 | Ga0075370_10084808 | 3300006353 | Bacteria | 1823 |
| 302 | Ga0075370_10143111 | 3300006353 | Bacteria | 1398 |
| 303 | Ga0075370_10201685 | 3300006353 | Bacteria | 1173 |
| 304 | Ga0068871_100147970 | 3300006358 | Bacteria | 2001 |
| 305 | Ga0068871_100239668 | 3300006358 | Bacteria | 1576 |
| 306 | Ga0068871_100656134 | 3300006358 | Bacteria | 958 |
| 307 | Ga0068871_100857917 | 3300006358 | Bacteria | 840 |
| 308 | Ga0068871_102222520 | 3300006358 | Bacteria | 523 |
| 309 | Ga0075428_100210354 | 3300006844 | Bacteria | 2102 |
| 310 | Ga0075431_101637427 | 3300006847 | Bacteria | 601 |
| 311 | Ga0075433_10654776 | 3300006852 | Bacteria | 921 |
| 312 | Ga0075433_10941443 | 3300006852 | Bacteria | 753 |
| 313 | Ga0075433_11371333 | 3300006852 | Bacteria | 612 |
| 314 | Ga0075434_100738263 | 3300006871 | Bacteria | 1002 |
| 315 | Ga0075434_101320281 | 3300006871 | Bacteria | 732 |
| 316 | Ga0075434_101427718 | 3300006871 | Bacteria | 702 |
| 317 | Ga0075434_101643424 | 3300006871 | Bacteria | 651 |
| 318 | Ga0068865_100044082 | 3300006881 | Bacteria | 3051 |
| 319 | Ga0068865_100087977 | 3300006881 | Bacteria | 2246 |
| 320 | Ga0068865_100227390 | 3300006881 | Bacteria | 1462 |
| 321 | Ga0068865_100548291 | 3300006881 | Bacteria | 971 |
| 322 | Ga0075436_100613809 | 3300006914 | Bacteria | 802 |
| 323 | Ga0097620_100133980 | 3300006931 | Bacteria | 2549 |
| 324 | Ga0097620_100379283 | 3300006931 | Bacteria | 1509 |
| 325 | Ga0097620_100518107 | 3300006931 | Bacteria | 1287 |
| 326 | Ga0097620_102220600 | 3300006931 | Bacteria | 605 |
| 327 | Ga0099824_1023299 | 3300006942 | Bacteria | 3871 |
| 328 | Ga0099822_1000541 | 3300006943 | Bacteria | 35996 |
| 329 | Ga0075435_100678376 | 3300007076 | Bacteria | 895 |
| 330 | Ga0075435_100751095 | 3300007076 | Bacteria | 849 |
| 331 | Ga0099794_10413957 | 3300007265 | Bacteria | 705 |
| 332 | Ga0099795_10009533 | 3300007788 | Bacteria | 2822 |
| 333 | Ga0099795_10043172 | 3300007788 | Bacteria | 1612 |
| 334 | Ga0099795_10126162 | 3300007788 | Bacteria | 1028 |
| 335 | Ga0105250_10421506 | 3300009092 | Bacteria | 595 |
| 336 | Ga0105240_10013303 | 3300009093 | Bacteria | 11310 |
| 337 | Ga0105240_10033307 | 3300009093 | Bacteria | 6659 |
| 338 | Ga0105240_10143904 | 3300009093 | Bacteria | 2847 |
| 339 | Ga0105240_10533120 | 3300009093 | Bacteria | 1301 |
| 340 | Ga0111539_10284392 | 3300009094 | Bacteria | 1925 |
| 341 | Ga0111539_12021495 | 3300009094 | Bacteria | 668 |
| 342 | Ga0105245_10332453 | 3300009098 | Bacteria | 1500 |
| 343 | Ga0105245_11709597 | 3300009098 | Bacteria | 682 |
| 344 | Ga0105245_11730132 | 3300009098 | Bacteria | 678 |
| 345 | Ga0105245_12060319 | 3300009098 | Bacteria | 624 |
| 346 | Ga0105247_10196398 | 3300009101 | Bacteria | 1353 |
| 347 | Ga0105247_10216033 | 3300009101 | Bacteria | 1296 |
| 348 | Ga0105247_10327871 | 3300009101 | Bacteria | 1070 |
| 349 | Ga0105247_10681775 | 3300009101 | Bacteria | 771 |
| 350 | Ga0105247_11028037 | 3300009101 | Bacteria | 645 |
| 351 | Ga0114129_10759367 | 3300009147 | Bacteria | 1241 |
| 352 | Ga0105243_10036778 | 3300009148 | Bacteria | 3802 |
| 353 | Ga0105243_10037774 | 3300009148 | Bacteria | 3757 |
| 354 | Ga0105243_10466393 | 3300009148 | Bacteria | 1188 |
| 355 | Ga0105243_12711526 | 3300009148 | Bacteria | 536 |
| 356 | Ga0105243_12940348 | 3300009148 | Unclassified | 517 |
| 357 | Ga0105241_10038277 | 3300009174 | Bacteria | 3615 |
| 358 | Ga0105241_10075194 | 3300009174 | Bacteria | 2632 |
| 359 | Ga0105241_10184164 | 3300009174 | Bacteria | 1734 |
| 360 | Ga0105241_10235173 | 3300009174 | Bacteria | 1546 |
| 361 | Ga0105241_10254163 | 3300009174 | Bacteria | 1491 |
| 362 | Ga0105241_10723271 | 3300009174 | Bacteria | 911 |
| 363 | Ga0105241_11509653 | 3300009174 | Bacteria | 647 |
| 364 | Ga0105241_11700082 | 3300009174 | Bacteria | 613 |
| 365 | Ga0105242_10094350 | 3300009176 | Bacteria | 2524 |
| 366 | Ga0105242_10194312 | 3300009176 | Bacteria | 1799 |
| 367 | Ga0105242_10320081 | 3300009176 | Bacteria | 1422 |
| 368 | Ga0105242_10500984 | 3300009176 | Bacteria | 1155 |
| 369 | Ga0105242_10758218 | 3300009176 | Bacteria | 956 |
| 370 | Ga0105242_10954961 | 3300009176 | Bacteria | 862 |
| 371 | Ga0105248_10118079 | 3300009177 | Bacteria | 2992 |
| 372 | Ga0105248_10219712 | 3300009177 | Bacteria | 2139 |
| 373 | Ga0105248_10270435 | 3300009177 | Bacteria | 1914 |
| 374 | Ga0105248_10790504 | 3300009177 | Bacteria | 1071 |
| 375 | Ga0105248_10933935 | 3300009177 | Bacteria | 980 |
| 376 | Ga0105237_10002301 | 3300009545 | Bacteria | 23744 |
| 377 | Ga0105237_10066311 | 3300009545 | Bacteria | 3605 |
| 378 | Ga0105237_10083853 | 3300009545 | Bacteria | 3178 |
| 379 | Ga0105237_10106054 | 3300009545 | Bacteria | 2802 |
| 380 | Ga0105237_10144169 | 3300009545 | Bacteria | 2376 |
| 381 | Ga0105237_10199553 | 3300009545 | Bacteria | 2000 |
| 382 | Ga0105237_10838032 | 3300009545 | Bacteria | 926 |
| 383 | Ga0105237_10992353 | 3300009545 | Bacteria | 847 |
| 384 | Ga0105237_11133613 | 3300009545 | Bacteria | 789 |
| 385 | Ga0105237_11180523 | 3300009545 | Bacteria | 772 |
| 386 | Ga0105237_11807952 | 3300009545 | Bacteria | 619 |
| 387 | Ga0105238_10085459 | 3300009551 | Bacteria | 3142 |
| 388 | Ga0105238_10331061 | 3300009551 | Bacteria | 1510 |
| 389 | Ga0105238_10407218 | 3300009551 | Bacteria | 1354 |
| 390 | Ga0105238_10692882 | 3300009551 | Bacteria | 1031 |
| 391 | Ga0105238_10799859 | 3300009551 | Bacteria | 958 |
| 392 | Ga0105238_10867024 | 3300009551 | Bacteria | 920 |
| 393 | Ga0105238_12370575 | 3300009551 | Bacteria | 566 |
| 394 | Ga0105249_10079381 | 3300009553 | Bacteria | 3046 |
| 395 | Ga0105249_10279317 | 3300009553 | Bacteria | 1667 |
| 396 | Ga0105249_10426279 | 3300009553 | Bacteria | 1361 |
| 397 | Ga0105249_10511956 | 3300009553 | Bacteria | 1247 |
| 398 | Ga0105249_11122948 | 3300009553 | Bacteria | 856 |
| 399 | Ga0105249_12838852 | 3300009553 | Bacteria | 556 |
| 400 | Ga0099796_10043454 | 3300010159 | Bacteria | 1531 |
| 401 | Ga0099796_10077483 | 3300010159 | Bacteria | 1213 |
| 402 | Ga0099796_10131497 | 3300010159 | Bacteria | 971 |
| 403 | Ga0099796_10134138 | 3300010159 | Bacteria | 963 |
| 404 | Ga0099796_10432845 | 3300010159 | Bacteria | 582 |
| 405 | Ga0105239_10035625 | 3300010375 | Bacteria | 5465 |
| 406 | Ga0105239_10131830 | 3300010375 | Bacteria | 2781 |
| 407 | Ga0105239_10140782 | 3300010375 | Bacteria | 2688 |
| 408 | Ga0105239_10305305 | 3300010375 | Bacteria | 1792 |
| 409 | Ga0105239_10409787 | 3300010375 | Bacteria | 1535 |
| 410 | Ga0105239_10410225 | 3300010375 | Bacteria | 1534 |
| 411 | Ga0105239_10570694 | 3300010375 | Bacteria | 1289 |
| 412 | Ga0105239_10647769 | 3300010375 | Bacteria | 1207 |
| 413 | Ga0105239_10655442 | 3300010375 | Bacteria | 1199 |
| 414 | Ga0105239_11058262 | 3300010375 | Bacteria | 933 |
| 415 | Ga0105239_11182910 | 3300010375 | Bacteria | 881 |
| 416 | Ga0105239_11679802 | 3300010375 | Bacteria | 735 |
| 417 | Ga0105239_12483383 | 3300010375 | Bacteria | 604 |
| 418 | Ga0105239_13232696 | 3300010375 | Bacteria | 530 |
| 419 | Ga0105246_10011987 | 3300011119 | Bacteria | 5397 |
| 420 | Ga0105246_10035946 | 3300011119 | Bacteria | 3315 |
| 421 | Ga0105246_10097071 | 3300011119 | Bacteria | 2137 |
| 422 | Ga0105246_10541703 | 3300011119 | Bacteria | 996 |
| 423 | Ga0105246_10863156 | 3300011119 | Bacteria | 808 |
| 424 | Ga0105246_11228098 | 3300011119 | Bacteria | 691 |
| 425 | Ga0105246_11573969 | 3300011119 | Bacteria | 620 |
| 426 | Ga0105246_11843621 | 3300011119 | Bacteria | 579 |
| 427 | Ga0105246_12019615 | 3300011119 | Bacteria | 557 |
| 428 | Ga0157373_10293719 | 3300013100 | Bacteria | 1153 |
| 429 | Ga0157373_10758846 | 3300013100 | Bacteria | 713 |
| 430 | Ga0157370_10035301 | 3300013104 | Bacteria | 4862 |
| 431 | Ga0157370_10141009 | 3300013104 | Bacteria | 2246 |
| 432 | Ga0157369_10018692 | 3300013105 | Bacteria | 7770 |
| 433 | Ga0157369_10094646 | 3300013105 | Bacteria | 3188 |
| 434 | Ga0157369_10282633 | 3300013105 | Bacteria | 1728 |
| 435 | Ga0157369_10601392 | 3300013105 | Bacteria | 1135 |
| 436 | Ga0157374_10030777 | 3300013296 | Bacteria | 4875 |
| 437 | Ga0157374_10357940 | 3300013296 | Bacteria | 1451 |
| 438 | Ga0157374_10561190 | 3300013296 | Bacteria | 1150 |
| 439 | Ga0157374_11207787 | 3300013296 | Bacteria | 777 |
| 440 | Ga0157374_11947040 | 3300013296 | Bacteria | 614 |
| 441 | Ga0157378_10155205 | 3300013297 | Bacteria | 2136 |
| 442 | Ga0157378_10219928 | 3300013297 | Bacteria | 1805 |
| 443 | Ga0157378_10710510 | 3300013297 | Bacteria | 1025 |
| 444 | Ga0157378_12058940 | 3300013297 | Bacteria | 621 |
| 445 | Ga0157378_13244901 | 3300013297 | Bacteria | 505 |
| 446 | Ga0163162_10026136 | 3300013306 | Bacteria | 5769 |
| 447 | Ga0163162_10031643 | 3300013306 | Bacteria | 5248 |
| 448 | Ga0163162_10183057 | 3300013306 | Bacteria | 2221 |
| 449 | Ga0163162_10242953 | 3300013306 | Bacteria | 1932 |
| 450 | Ga0163162_10272397 | 3300013306 | Bacteria | 1825 |
| 451 | Ga0163162_10591125 | 3300013306 | Bacteria | 1237 |
| 452 | Ga0163162_10741575 | 3300013306 | Bacteria | 1102 |
| 453 | Ga0163162_11419048 | 3300013306 | Bacteria | 790 |
| 454 | Ga0163162_11770137 | 3300013306 | Bacteria | 706 |
| 455 | Ga0157372_10030290 | 3300013307 | Bacteria | 5919 |
| 456 | Ga0157372_10075935 | 3300013307 | Bacteria | 3793 |
| 457 | Ga0157372_10148606 | 3300013307 | Bacteria | 2703 |
| 458 | Ga0157375_10046484 | 3300013308 | Bacteria | 4233 |
| 459 | Ga0157375_10149571 | 3300013308 | Bacteria | 2469 |
| 460 | Ga0157375_10267498 | 3300013308 | Bacteria | 1871 |
| 461 | Ga0157375_10391815 | 3300013308 | Bacteria | 1556 |
| 462 | Ga0157375_10487036 | 3300013308 | Bacteria | 1398 |
| 463 | Ga0157375_11018709 | 3300013308 | Bacteria | 967 |
| 464 | Ga0157375_12882274 | 3300013308 | Bacteria | 575 |
| 465 | Ga0163163_10007500 | 3300014325 | Bacteria | 9629 |
| 466 | Ga0163163_10050743 | 3300014325 | Bacteria | 4087 |
| 467 | Ga0163163_10078610 | 3300014325 | Bacteria | 3296 |
| 468 | Ga0163163_10092490 | 3300014325 | Bacteria | 3040 |
| 469 | Ga0163163_10342092 | 3300014325 | Bacteria | 1551 |
| 470 | Ga0163163_10447602 | 3300014325 | Bacteria | 1351 |
| 471 | Ga0163163_10489450 | 3300014325 | Bacteria | 1291 |
| 472 | Ga0163163_10892774 | 3300014325 | Bacteria | 952 |
| 473 | Ga0163163_11654517 | 3300014325 | Bacteria | 701 |
| 474 | Ga0157380_10047597 | 3300014326 | Bacteria | 3374 |
| 475 | Ga0157380_10315015 | 3300014326 | Bacteria | 1448 |
| 476 | Ga0157380_10424194 | 3300014326 | Bacteria | 1270 |
| 477 | Ga0157380_11114370 | 3300014326 | Bacteria | 829 |
| 478 | Ga0157380_11570670 | 3300014326 | Bacteria | 713 |
| 479 | Ga0157380_13050852 | 3300014326 | Bacteria | 534 |
| 480 | Ga0182008_10106991 | 3300014497 | Bacteria | 1384 |
| 481 | Ga0157377_10034041 | 3300014745 | Bacteria | 2785 |
| 482 | Ga0157377_10082310 | 3300014745 | Bacteria | 1884 |
| 483 | Ga0157377_10292193 | 3300014745 | Bacteria | 1072 |
| 484 | Ga0157377_10505589 | 3300014745 | Bacteria | 845 |
| 485 | Ga0157377_11009761 | 3300014745 | Bacteria | 631 |
| 486 | Ga0157379_10092557 | 3300014968 | Bacteria | 2712 |
| 487 | Ga0157379_10202799 | 3300014968 | Bacteria | 1794 |
| 488 | Ga0157379_10204212 | 3300014968 | Bacteria | 1787 |
| 489 | Ga0157379_10209807 | 3300014968 | Bacteria | 1763 |
| 490 | Ga0157379_10255138 | 3300014968 | Bacteria | 1593 |
| 491 | Ga0157379_12345560 | 3300014968 | Bacteria | 532 |
| 492 | Ga0157376_10007382 | 3300014969 | Bacteria | 7842 |
| 493 | Ga0157376_10146405 | 3300014969 | Bacteria | 2125 |
| 494 | Ga0157376_10323650 | 3300014969 | Bacteria | 1466 |
| 495 | Ga0157376_10510367 | 3300014969 | Bacteria | 1183 |
| 496 | Ga0157376_10723427 | 3300014969 | Bacteria | 1002 |
| 497 | Ga0157376_11085604 | 3300014969 | Bacteria | 826 |
| 498 | Ga0157376_11329341 | 3300014969 | Bacteria | 749 |
| 499 | Ga0157376_11388012 | 3300014969 | Bacteria | 734 |
| 500 | Ga0157376_11627103 | 3300014969 | Bacteria | 680 |
| 501 | Ga0157376_11708976 | 3300014969 | Bacteria | 665 |
| 502 | Ga0182005_1124178 | 3300015265 | Bacteria | 737 |
| 503 | Ga0163161_10025323 | 3300017792 | Bacteria | 4199 |
| 504 | Ga0163161_10260401 | 3300017792 | Bacteria | 1355 |
| 505 | Ga0163161_10440455 | 3300017792 | Bacteria | 1052 |
| 506 | Ga0163161_10722028 | 3300017792 | Bacteria | 831 |
| 507 | Ga0213876_10080161 | 3300021384 | Bacteria | 1726 |
| 508 | Ga0213876_10194281 | 3300021384 | Bacteria | 1079 |
| 509 | Ga0213876_10377566 | 3300021384 | Bacteria | 754 |
| 510 | Ga0209677_102422 | 3300025253 | Bacteria | 7047 |
| 511 | Ga0209148_1010927 | 3300025254 | Bacteria | 1703 |
| 512 | Ga0209148_1019214 | 3300025254 | Bacteria | 1137 |
| 513 | Ga0209233_1002344 | 3300025261 | Bacteria | 7057 |
| 514 | Ga0209233_1023913 | 3300025261 | Bacteria | 1537 |
| 515 | Ga0209455_1002785 | 3300025272 | Bacteria | 6531 |
| 516 | Ga0209455_1006260 | 3300025272 | Bacteria | 3542 |
| 517 | Ga0209758_1031951 | 3300025297 | Bacteria | 2148 |
| 518 | Ga0207697_10016037 | 3300025315 | Bacteria | 3090 |
| 519 | Ga0207656_10057503 | 3300025321 | Bacteria | 1697 |
| 520 | Ga0207656_10252237 | 3300025321 | Bacteria | 865 |
| 521 | Ga0207696_1069607 | 3300025711 | Bacteria | 980 |
| 522 | Ga0207653_10309239 | 3300025885 | Bacteria | 613 |
| 523 | Ga0207682_10206804 | 3300025893 | Bacteria | 904 |
| 524 | Ga0207692_10097341 | 3300025898 | Bacteria | 1608 |
| 525 | Ga0207642_10007135 | 3300025899 | Bacteria | 3757 |
| 526 | Ga0207642_10084942 | 3300025899 | Bacteria | 1547 |
| 527 | Ga0207642_10352017 | 3300025899 | Bacteria | 869 |
| 528 | Ga0207710_10365367 | 3300025900 | Bacteria | 737 |
| 529 | Ga0207688_10022442 | 3300025901 | Bacteria | 3453 |
| 530 | Ga0207688_10054745 | 3300025901 | Bacteria | 2238 |
| 531 | Ga0207688_10074637 | 3300025901 | Bacteria | 1929 |
| 532 | Ga0207688_10197409 | 3300025901 | Bacteria | 1205 |
| 533 | Ga0207688_10204797 | 3300025901 | Bacteria | 1184 |
| 534 | Ga0207680_10177409 | 3300025903 | Bacteria | 1439 |
| 535 | Ga0207647_10281401 | 3300025904 | Bacteria | 949 |
| 536 | Ga0207647_10300873 | 3300025904 | Bacteria | 913 |
| 537 | Ga0207647_10451834 | 3300025904 | Bacteria | 720 |
| 538 | Ga0207699_10274178 | 3300025906 | Bacteria | 1170 |
| 539 | Ga0207699_10553267 | 3300025906 | Bacteria | 835 |
| 540 | Ga0207645_10100384 | 3300025907 | Bacteria | 1867 |
| 541 | Ga0207645_10360065 | 3300025907 | Bacteria | 974 |
| 542 | Ga0207645_10598951 | 3300025907 | Bacteria | 748 |
| 543 | Ga0207643_10023049 | 3300025908 | Bacteria | 3431 |
| 544 | Ga0207643_10176063 | 3300025908 | Bacteria | 1293 |
| 545 | Ga0207643_10421309 | 3300025908 | Bacteria | 846 |
| 546 | Ga0207705_10723542 | 3300025909 | Bacteria | 773 |
| 547 | Ga0207684_11245498 | 3300025910 | Bacteria | 614 |
| 548 | Ga0207654_10011023 | 3300025911 | Bacteria | 4600 |
| 549 | Ga0207707_10000143 | 3300025912 | Bacteria | 74226 |
| 550 | Ga0207707_10064118 | 3300025912 | Bacteria | 3198 |
| 551 | Ga0207695_10000059 | 3300025913 | Bacteria | 363920 |
| 552 | Ga0207695_10059849 | 3300025913 | Bacteria | 3947 |
| 553 | Ga0207695_10093922 | 3300025913 | Bacteria | 3008 |
| 554 | Ga0207695_10103267 | 3300025913 | Bacteria | 2842 |
| 555 | Ga0207671_10001109 | 3300025914 | Bacteria | 32478 |
| 556 | Ga0207671_10044193 | 3300025914 | Bacteria | 3294 |
| 557 | Ga0207671_10190306 | 3300025914 | Bacteria | 1600 |
| 558 | Ga0207671_10291378 | 3300025914 | Bacteria | 1289 |
| 559 | Ga0207671_10353320 | 3300025914 | Bacteria | 1166 |
| 560 | Ga0207693_10699614 | 3300025915 | Bacteria | 785 |
| 561 | Ga0207663_10051956 | 3300025916 | Bacteria | 2554 |
| 562 | Ga0207660_10017202 | 3300025917 | Bacteria | 4798 |
| 563 | Ga0207660_10079923 | 3300025917 | Bacteria | 2399 |
| 564 | Ga0207660_10233402 | 3300025917 | Bacteria | 1447 |
| 565 | Ga0207660_10365126 | 3300025917 | Bacteria | 1158 |
| 566 | Ga0207662_10072536 | 3300025918 | Bacteria | 2087 |
| 567 | Ga0207657_10087843 | 3300025919 | Bacteria | 2600 |
| 568 | Ga0207657_10323832 | 3300025919 | Bacteria | 1218 |
| 569 | Ga0207657_10391102 | 3300025919 | Bacteria | 1094 |
| 570 | Ga0207649_10346624 | 3300025920 | Bacteria | 1098 |
| 571 | Ga0207649_10645440 | 3300025920 | Bacteria | 817 |
| 572 | Ga0207649_10977608 | 3300025920 | Bacteria | 666 |
| 573 | Ga0207652_10011338 | 3300025921 | Bacteria | 7184 |
| 574 | Ga0207652_10609593 | 3300025921 | Bacteria | 978 |
| 575 | Ga0207694_10118714 | 3300025924 | Bacteria | 2110 |
| 576 | Ga0207694_10796339 | 3300025924 | Bacteria | 798 |
| 577 | Ga0207650_10204856 | 3300025925 | Bacteria | 1582 |
| 578 | Ga0207650_10908580 | 3300025925 | Bacteria | 748 |
| 579 | Ga0207659_10090791 | 3300025926 | Bacteria | 2281 |
| 580 | Ga0207659_10939719 | 3300025926 | Bacteria | 744 |
| 581 | Ga0207664_11193314 | 3300025929 | Bacteria | 679 |
| 582 | Ga0207690_10464135 | 3300025932 | Bacteria | 1019 |
| 583 | Ga0207690_10484324 | 3300025932 | Bacteria | 999 |
| 584 | Ga0207690_10685337 | 3300025932 | Bacteria | 842 |
| 585 | Ga0207706_10032508 | 3300025933 | Bacteria | 4646 |
| 586 | Ga0207706_10153740 | 3300025933 | Bacteria | 2024 |
| 587 | Ga0207706_10514060 | 3300025933 | Bacteria | 1033 |
| 588 | Ga0207706_11586832 | 3300025933 | Bacteria | 531 |
| 589 | Ga0207686_10147999 | 3300025934 | Bacteria | 1631 |
| 590 | Ga0207686_10387458 | 3300025934 | Bacteria | 1061 |
| 591 | Ga0207709_10042251 | 3300025935 | Bacteria | 2741 |
| 592 | Ga0207709_10241584 | 3300025935 | Bacteria | 1314 |
| 593 | Ga0207670_10457592 | 3300025936 | Bacteria | 1030 |
| 594 | Ga0207669_10256569 | 3300025937 | Bacteria | 1305 |
| 595 | Ga0207669_10574961 | 3300025937 | Bacteria | 912 |
| 596 | Ga0207669_11420761 | 3300025937 | Bacteria | 591 |
| 597 | Ga0207704_10014406 | 3300025938 | Bacteria | 3990 |
| 598 | Ga0207704_10430400 | 3300025938 | Bacteria | 1048 |
| 599 | Ga0207665_10023996 | 3300025939 | Bacteria | 4019 |
| 600 | Ga0207665_10634684 | 3300025939 | Bacteria | 836 |
| 601 | Ga0207691_10047055 | 3300025940 | Bacteria | 3961 |
| 602 | Ga0207691_10210315 | 3300025940 | Bacteria | 1690 |
| 603 | Ga0207691_10772306 | 3300025940 | Bacteria | 808 |
| 604 | Ga0207711_10199624 | 3300025941 | Bacteria | 1825 |
| 605 | Ga0207711_10220496 | 3300025941 | Bacteria | 1734 |
| 606 | Ga0207711_10275951 | 3300025941 | Bacteria | 1547 |
| 607 | Ga0207711_11268444 | 3300025941 | Bacteria | 679 |
| 608 | Ga0207689_10052561 | 3300025942 | Bacteria | 3357 |
| 609 | Ga0207689_10059101 | 3300025942 | Bacteria | 3154 |
| 610 | Ga0207689_10180415 | 3300025942 | Bacteria | 1741 |
| 611 | Ga0207689_10331490 | 3300025942 | Bacteria | 1264 |
| 612 | Ga0207689_10505949 | 3300025942 | Bacteria | 1012 |
| 613 | Ga0207661_10044679 | 3300025944 | Bacteria | 3502 |
| 614 | Ga0207661_10355144 | 3300025944 | Bacteria | 1323 |
| 615 | Ga0207679_10290602 | 3300025945 | Bacteria | 1405 |
| 616 | Ga0207679_10452616 | 3300025945 | Bacteria | 1139 |
| 617 | Ga0207679_11039177 | 3300025945 | Bacteria | 751 |
| 618 | Ga0207679_11501058 | 3300025945 | Bacteria | 618 |
| 619 | Ga0207667_10145811 | 3300025949 | Bacteria | 2437 |
| 620 | Ga0207667_10154463 | 3300025949 | Bacteria | 2362 |
| 621 | Ga0207651_10161862 | 3300025960 | Bacteria | 1755 |
| 622 | Ga0207712_10102838 | 3300025961 | Bacteria | 2128 |
| 623 | Ga0207712_10166274 | 3300025961 | Bacteria | 1720 |
| 624 | Ga0207712_10194653 | 3300025961 | Bacteria | 1603 |
| 625 | Ga0207712_10247656 | 3300025961 | Bacteria | 1439 |
| 626 | Ga0207668_10122811 | 3300025972 | Bacteria | 1969 |
| 627 | Ga0207668_10134695 | 3300025972 | Bacteria | 1891 |
| 628 | Ga0207668_10207302 | 3300025972 | Bacteria | 1565 |
| 629 | Ga0207668_10263666 | 3300025972 | Bacteria | 1405 |
| 630 | Ga0207668_10438935 | 3300025972 | Bacteria | 1111 |
| 631 | Ga0207668_10438946 | 3300025972 | Bacteria | 1111 |
| 632 | Ga0207640_10089901 | 3300025981 | Bacteria | 2123 |
| 633 | Ga0207640_10361292 | 3300025981 | Bacteria | 1170 |
| 634 | Ga0207640_10386336 | 3300025981 | Bacteria | 1136 |
| 635 | Ga0207640_10909477 | 3300025981 | Bacteria | 769 |
| 636 | Ga0207658_10647475 | 3300025986 | Bacteria | 952 |
| 637 | Ga0207658_10763870 | 3300025986 | Bacteria | 876 |
| 638 | Ga0207677_10202638 | 3300026023 | Bacteria | 1578 |
| 639 | Ga0207677_10860456 | 3300026023 | Bacteria | 815 |
| 640 | Ga0207703_11200462 | 3300026035 | Bacteria | 729 |
| 641 | Ga0207703_11210308 | 3300026035 | Bacteria | 726 |
| 642 | Ga0207639_10160455 | 3300026041 | Bacteria | 1894 |
| 643 | Ga0207639_10506472 | 3300026041 | Bacteria | 1104 |
| 644 | Ga0207639_10992244 | 3300026041 | Bacteria | 786 |
| 645 | Ga0207639_11397853 | 3300026041 | Bacteria | 657 |
| 646 | Ga0207678_10015293 | 3300026067 | Bacteria | 6749 |
| 647 | Ga0207678_10030059 | 3300026067 | Bacteria | 4743 |
| 648 | Ga0207678_10067196 | 3300026067 | Bacteria | 3077 |
| 649 | Ga0207678_10077044 | 3300026067 | Bacteria | 2856 |
| 650 | Ga0207678_10132918 | 3300026067 | Bacteria | 2123 |
| 651 | Ga0207678_10228037 | 3300026067 | Bacteria | 1595 |
| 652 | Ga0207678_10606526 | 3300026067 | Bacteria | 960 |
| 653 | Ga0207708_10036812 | 3300026075 | Bacteria | 3727 |
| 654 | Ga0207708_10860127 | 3300026075 | Bacteria | 783 |
| 655 | Ga0207702_10115752 | 3300026078 | Bacteria | 2391 |
| 656 | Ga0207702_10163693 | 3300026078 | Bacteria | 2033 |
| 657 | Ga0207702_10165497 | 3300026078 | Bacteria | 2022 |
| 658 | Ga0207702_10240067 | 3300026078 | Bacteria | 1697 |
| 659 | Ga0207702_10695115 | 3300026078 | Bacteria | 1002 |
| 660 | Ga0207641_10068950 | 3300026088 | Bacteria | 3034 |
| 661 | Ga0207641_10719009 | 3300026088 | Bacteria | 984 |
| 662 | Ga0207641_11632619 | 3300026088 | Bacteria | 647 |
| 663 | Ga0207648_10069067 | 3300026089 | Bacteria | 3079 |
| 664 | Ga0207648_10674575 | 3300026089 | Bacteria | 956 |
| 665 | Ga0207676_10520654 | 3300026095 | Bacteria | 1132 |
| 666 | Ga0207674_10175284 | 3300026116 | Bacteria | 2097 |
| 667 | Ga0207674_10284503 | 3300026116 | Bacteria | 1602 |
| 668 | Ga0207675_100043034 | 3300026118 | Bacteria | 4217 |
| 669 | Ga0207675_100069520 | 3300026118 | Bacteria | 3291 |
| 670 | Ga0207675_100088011 | 3300026118 | Bacteria | 2917 |
| 671 | Ga0207675_100099220 | 3300026118 | Bacteria | 2743 |
| 672 | Ga0207675_100823183 | 3300026118 | Bacteria | 942 |
| 673 | Ga0207675_101239980 | 3300026118 | Bacteria | 766 |
| 674 | Ga0207683_10038386 | 3300026121 | Bacteria | 4174 |
| 675 | Ga0207683_10063563 | 3300026121 | Bacteria | 3251 |
| 676 | Ga0207683_10192873 | 3300026121 | Bacteria | 1850 |
| 677 | Ga0207683_10209971 | 3300026121 | Bacteria | 1772 |
| 678 | Ga0207683_10322426 | 3300026121 | Bacteria | 1415 |
| 679 | Ga0207683_10752834 | 3300026121 | Bacteria | 904 |
| 680 | Ga0207683_11080219 | 3300026121 | Bacteria | 744 |
| 681 | Ga0207698_10039785 | 3300026142 | Bacteria | 3486 |
| 682 | Ga0207698_10231586 | 3300026142 | Bacteria | 1677 |
| 683 | Ga0207698_10277937 | 3300026142 | Bacteria | 1547 |
| 684 | Ga0207698_10345855 | 3300026142 | Bacteria | 1402 |
| 685 | Ga0207698_10429452 | 3300026142 | Bacteria | 1270 |
| 686 | Ga0207698_12408026 | 3300026142 | Bacteria | 537 |
| 687 | Ga0209589_1000015 | 3300027357 | Bacteria | 225913 |
| 688 | Ga0209489_100015 | 3300027361 | Bacteria | 225913 |
| 689 | Ga0209700_100025 | 3300027363 | Bacteria | 225913 |
| 690 | Ga0209179_1000903 | 3300027512 | Bacteria | 3335 |
| 691 | Ga0209813_10124429 | 3300027866 | Bacteria | 901 |
| 692 | Ga0207428_10875977 | 3300027907 | Bacteria | 635 |
| 693 | Ga0265356_1012512 | 3300028017 | Bacteria | 931 |
| 694 | Ga0268266_10003191 | 3300028379 | Bacteria | 16594 |
| 695 | Ga0268266_10018212 | 3300028379 | Bacteria | 5987 |
| 696 | Ga0268266_10047304 | 3300028379 | Bacteria | 3685 |
| 697 | Ga0268266_10115674 | 3300028379 | Bacteria | 2381 |
| 698 | Ga0268265_10077246 | 3300028380 | Bacteria | 2615 |
| 699 | Ga0268265_10719282 | 3300028380 | Bacteria | 966 |
| 700 | Ga0268265_11347926 | 3300028380 | Bacteria | 714 |
| 701 | Ga0268265_11384184 | 3300028380 | Bacteria | 705 |
| 702 | Ga0268265_11467784 | 3300028380 | Bacteria | 685 |
| 703 | Ga0268265_12440257 | 3300028380 | Bacteria | 529 |
| 704 | Ga0268264_10000356 | 3300028381 | Bacteria | 68810 |
| 705 | Ga0268264_10157667 | 3300028381 | Bacteria | 2041 |
| 706 | Ga0268264_10263290 | 3300028381 | Bacteria | 1607 |
| 707 | Ga0268264_10680756 | 3300028381 | Bacteria | 1020 |
| 708 | Ga0268264_11141684 | 3300028381 | Bacteria | 788 |
| 709 | Ga0307515_10045648 | 3300028794 | Bacteria | 6723 |
| 710 | Ga0307511_10132509 | 3300030521 | Bacteria | 1496 |
| 711 | Ga0307511_10194685 | 3300030521 | Bacteria | 1064 |
| 712 | Ga0307512_10423455 | 3300030522 | Bacteria | 549 |
| 713 | Ga0265330_10012848 | 3300031235 | Bacteria | 3909 |
| 714 | Ga0265330_10199581 | 3300031235 | Bacteria | 846 |
| 715 | Ga0307513_10168005 | 3300031456 | Bacteria | 2075 |
| 716 | Ga0307509_10009216 | 3300031507 | Bacteria | 12388 |
| 717 | Ga0307509_10376963 | 3300031507 | Bacteria | 1133 |
| 718 | Ga0307509_10640941 | 3300031507 | Bacteria | 732 |
| 719 | Ga0307408_100722853 | 3300031548 | Bacteria | 897 |
| 720 | Ga0307508_10000715 | 3300031616 | Bacteria | 39415 |
| 721 | Ga0307508_10073634 | 3300031616 | Bacteria | 2992 |
| 722 | Ga0307508_10667726 | 3300031616 | Bacteria | 646 |
| 723 | Ga0307508_10900221 | 3300031616 | Bacteria | 511 |
| 724 | Ga0265342_10186629 | 3300031712 | Bacteria | 1133 |
| 725 | Ga0307516_10005305 | 3300031730 | Bacteria | 15512 |
| 726 | Ga0307516_10009786 | 3300031730 | Bacteria | 10635 |
| 727 | Ga0307516_10099990 | 3300031730 | Bacteria | 2716 |
| 728 | Ga0307516_10102108 | 3300031730 | Bacteria | 2683 |
| 729 | Ga0307516_10142157 | 3300031730 | Bacteria | 2168 |
| 730 | Ga0307516_10233822 | 3300031730 | Bacteria | 1540 |
| 731 | Ga0307516_10245733 | 3300031730 | Bacteria | 1486 |
| 732 | Ga0307516_10495779 | 3300031730 | Bacteria | 876 |
| 733 | Ga0307405_10810442 | 3300031731 | Bacteria | 785 |
| 734 | Ga0326468_10008419 | 3300031889 | Bacteria | 998 |
| 735 | Ga0307406_10214720 | 3300031901 | Bacteria | 1426 |
| 736 | Ga0307407_10142512 | 3300031903 | Bacteria | 1548 |
| 737 | Ga0307412_10221792 | 3300031911 | Bacteria | 1450 |
| 738 | Ga0307412_10798454 | 3300031911 | Bacteria | 819 |
| 739 | Ga0307412_11864422 | 3300031911 | Bacteria | 554 |
| 740 | Ga0307409_101058608 | 3300031995 | Bacteria | 831 |
| 741 | Ga0307409_101068088 | 3300031995 | Bacteria | 828 |
| 742 | Ga0307409_101665964 | 3300031995 | Bacteria | 666 |
| 743 | Ga0307416_100370337 | 3300032002 | Bacteria | 1458 |
| 744 | Ga0307416_100827607 | 3300032002 | Bacteria | 1023 |
| 745 | Ga0307416_101523765 | 3300032002 | Bacteria | 774 |
| 746 | Ga0307416_102246675 | 3300032002 | Bacteria | 646 |
| 747 | Ga0307411_10271283 | 3300032005 | Bacteria | 1345 |
| 748 | Ga0307411_10537234 | 3300032005 | Bacteria | 995 |
| 749 | Ga0307415_100546883 | 3300032126 | Bacteria | 1021 |
| 750 | Ga0307415_100614463 | 3300032126 | Bacteria | 969 |
| 751 | Ga0307507_10190397 | 3300033179 | Bacteria | 1443 |
| 752 | Ga0307510_10049561 | 3300033180 | Bacteria | 4465 |
| 753 | Ga0307510_10078920 | 3300033180 | Bacteria | 3215 |
| 754 | Ga0307510_10129800 | 3300033180 | Bacteria | 2197 |
| 755 | Ga0307510_10179538 | 3300033180 | Bacteria | 1682 |
| 756 | Ga0307510_10574515 | 3300033180 | Bacteria | 576 |
| 757 | Ga0315911_1000021 | 3300033442 | Bacteria | 124874 |
| 758 | Ga0373950_0060189 | 3300034818 | Bacteria | 761 |
| 759 | Ga0373926_0245299 | 3300035083 | Bacteria | 694 |
| 760 | Ga0373928_0068305 | 3300035084 | Bacteria | 873 |
| 761 | Ga0373934_0005810 | 3300035086 | Bacteria | 4564 |
| 762 | Ga0373940_0365362 | 3300035088 | Bacteria | 509 |
| 763 | Ga0373952_0012727 | 3300035092 | Bacteria | 1660 |
| 764 | Ga0373923_0001264 | 3300035111 | Bacteria | 7120 |
| 765 | Ga0373932_0057673 | 3300035112 | Bacteria | 1171 |
| 766 | Ga0373936_0292141 | 3300035113 | Bacteria | 734 |
| 767 | Ga0373945_0578076 | 3300035116 | Bacteria | 506 |
| 768 | Ga0373953_0009689 | 3300035117 | Bacteria | 3324 |
| 769 | Ga0373953_0311352 | 3300035117 | Bacteria | 688 |
| 770 | Ga0373954_0001440 | 3300035118 | Bacteria | 9662 |
| 771 | Ga0373956_0000376 | 3300035119 | Bacteria | 18268 |
| 772 | Ga0373956_0267324 | 3300035119 | Bacteria | 813 |
| 773 | Ga0373957_0000575 | 3300035120 | Bacteria | 9302 |
| 774 | Ga0373943_0093790 | 3300035170 | Bacteria | 1559 |
| 775 | Ga0373943_0304847 | 3300035170 | Bacteria | 905 |
| 776 | Ga0373943_0666580 | 3300035170 | Bacteria | 615 |
| 777 | Ga0373955_0000325 | 3300035172 | Bacteria | 19823 |
| 778 | Ga0373955_0094862 | 3300035172 | Bacteria | 1705 |
| 779 | Ga0373924_0000567 | 3300035410 | Bacteria | 11368 |
| 780 | Ga0373931_0006104 | 3300035691 | Bacteria | 5614 |
| 781 | Ga0373935_0005959 | 3300035692 | Bacteria | 7231 |
| 782 | Ga0373935_0141667 | 3300035692 | Bacteria | 1625 |
| 783 | Ga0373935_0231401 | 3300035692 | Bacteria | 1287 |
| 784 | Ga0373935_0479249 | 3300035692 | Bacteria | 901 |
| 785 | Ga0373927_0005646 | 3300035695 | Bacteria | 8601 |
| 786 | Ga0373927_0051745 | 3300035695 | Bacteria | 2656 |
| 787 | Ga0373927_0056834 | 3300035695 | Bacteria | 2530 |
| 788 | Ga0373927_0074127 | 3300035695 | Bacteria | 2204 |
| 789 | Ga0373927_0139344 | 3300035695 | Bacteria | 1586 |
| 790 | Ga0373927_0151302 | 3300035695 | Bacteria | 1519 |
| 791 | Ga0373927_0622588 | 3300035695 | Bacteria | 713 |
| 792 | Ga0373933_0000108 | 3300035724 | Bacteria | 53024 |
| 793 | Ga0373933_0002337 | 3300035724 | Bacteria | 10758 |
| 794 | Ga0373947_0054194 | 3300035725 | Bacteria | 2420 |
| 795 | Ga0373947_0193833 | 3300035725 | Bacteria | 1327 |
| 796 | Ga0373947_0225024 | 3300035725 | Bacteria | 1234 |
| 797 | Ga0373937_0036844 | 3300036401 | Bacteria | 4456 |
| 798 | Ga0373937_0294717 | 3300036401 | Bacteria | 1533 |
| 799 | Ga0373937_0792342 | 3300036401 | Bacteria | 895 |
| 800 | Ga0373925_0175704 | 3300037068 | Bacteria | 1693 |
| 801 | Ga0373925_0218338 | 3300037068 | Bacteria | 1521 |
| 802 | Ga0373925_0282962 | 3300037068 | Bacteria | 1336 |
| 803 | Ga0373925_0288860 | 3300037068 | Bacteria | 1322 |
| 804 | Ga0373925_0670134 | 3300037068 | Bacteria | 855 |
| 805 | Ga0395899_0154932 | 3300037312 | Bacteria | 1622 |
| 806 | Ga0395899_0652635 | 3300037312 | Bacteria | 665 |
| 807 | Ga0395899_0797694 | 3300037312 | Bacteria | 584 |
| 808 | Ga0395900_0139090 | 3300037418 | Bacteria | 2487 |
| 809 | Ga0395900_0280928 | 3300037418 | Bacteria | 1657 |
| 810 | Ga0395898_0136250 | 3300037466 | Bacteria | 2351 |
| 811 | Ga0395898_0995894 | 3300037466 | Bacteria | 774 |
| 812 | Ga0395898_1709599 | 3300037466 | Bacteria | 552 |
| 813 | Ga0395905_0018632 | 3300037471 | Bacteria | 6584 |
| 814 | Ga0395905_0294700 | 3300037471 | Bacteria | 1509 |
| 815 | Ga0395905_1324186 | 3300037471 | Bacteria | 624 |
| 816 | Ga0395905_1851601 | 3300037471 | Bacteria | 509 |
| 817 | Ga0436364_0879350 | 3300037853 | Bacteria | 1041 |
| 818 | Ga0395901_0058033 | 3300038443 | Bacteria | 4026 |
| 819 | Ga0395901_0321389 | 3300038443 | Bacteria | 1601 |
| 820 | Ga0395901_0436961 | 3300038443 | Bacteria | 1340 |
| 821 | Ga0395901_1233128 | 3300038443 | Bacteria | 712 |
| 822 | Ga0395901_1854960 | 3300038443 | Bacteria | 551 |
| 823 | Ga0436365_0414572 | 3300039437 | Bacteria | 1032 |
| 824 | Ga0436365_0429696 | 3300039437 | Bacteria | 1300 |
| 825 | Ga0436365_1212947 | 3300039437 | Bacteria | 3094 |
| 826 | Ga0436361_0899129 | 3300039447 | Bacteria | 806 |
| 827 | Ga0439465_0058246 | 3300041413 | Bacteria | 1276 |
| 828 | Ga0439465_0064370 | 3300041413 | Bacteria | 1220 |
| 829 | Ga0451787_105515 | 3300041441 | Bacteria | 752 |
| 830 | Ga0451791_0677543 | 3300041451 | Bacteria | 514 |
| 831 | Ga0451791_1155178 | 3300041451 | Bacteria | 596 |
| 832 | Ga0451797_0053473 | 3300041453 | Bacteria | 835 |
| 833 | Ga0451797_1018948 | 3300041453 | Bacteria | 695 |
| 834 | Ga0451800_0728190 | 3300041459 | Bacteria | 636 |
| 835 | Ga0451800_1438690 | 3300041459 | Bacteria | 611 |
| 836 | Ga0451802_1426775 | 3300041460 | Bacteria | 845 |
| 837 | Ga0451804_0726654 | 3300041463 | Bacteria | 586 |
| 838 | Ga0451833_0126247 | 3300041491 | Bacteria | 795 |
| 839 | Ga0451837_1574521 | 3300041494 | Bacteria | 638 |
| 840 | Ga0451847_0379818 | 3300041503 | Bacteria | 1140 |
| 841 | Ga0451853_0473635 | 3300041512 | Bacteria | 720 |
| 842 | Ga0439445_0101008 | 3300042004 | Bacteria | 818 |
| 843 | Ga0439458_0210853 | 3300042157 | Bacteria | 533 |
| 844 | Ga0439459_0150446 | 3300042438 | Bacteria | 608 |
| 845 | Ga0466966_0000411 | 3300044684 | Bacteria | 27522 |
| 846 | Ga0466961_0000065 | 3300044693 | Bacteria | 63259 |
| 847 | Ga0466957_0149701 | 3300044842 | Bacteria | 1508 |
| 848 | Ga0466957_0220346 | 3300044842 | Bacteria | 1253 |
| 849 | Ga0466957_0769191 | 3300044842 | Bacteria | 683 |
| 850 | Ga0466959_0000634 | 3300045049 | Bacteria | 20407 |
| 851 | Ga0466959_0318213 | 3300045049 | Bacteria | 1064 |
| 852 | Ga0495617_033360 | 3300046452 | Bacteria | 1727 |
| 853 | Ga0495617_050127 | 3300046452 | Bacteria | 1389 |
| 854 | Ga0495617_061551 | 3300046452 | Bacteria | 1241 |
| 855 | Ga0495592_0000339 | 3300046454 | Bacteria | 38389 |
| 856 | Ga0495592_0716043 | 3300046454 | Bacteria | 601 |
| 857 | Ga0495592_0782603 | 3300046454 | Bacteria | 568 |
| 858 | Ga0495603_0004729 | 3300046455 | Bacteria | 8133 |
| 859 | Ga0495603_0053248 | 3300046455 | Bacteria | 2401 |
| 860 | Ga0495603_0209080 | 3300046455 | Bacteria | 1127 |
| 861 | Ga0495603_0323343 | 3300046455 | Bacteria | 885 |
| 862 | Ga0495629_0001483 | 3300046459 | Bacteria | 18494 |
| 863 | Ga0495629_0090157 | 3300046459 | Bacteria | 2139 |
| 864 | Ga0495629_0412836 | 3300046459 | Bacteria | 917 |
| 865 | Ga0495638_0050016 | 3300046460 | Bacteria | 2611 |
| 866 | Ga0495638_0104997 | 3300046460 | Bacteria | 1684 |
| 867 | Ga0495638_0174932 | 3300046460 | Bacteria | 1229 |
| 868 | Ga0495651_0028813 | 3300046462 | Bacteria | 4328 |
| 869 | Ga0495651_0044793 | 3300046462 | Bacteria | 3428 |
| 870 | Ga0495651_0528313 | 3300046462 | Bacteria | 752 |
| 871 | Ga0495653_0001063 | 3300046463 | Bacteria | 21155 |
| 872 | Ga0495653_0057062 | 3300046463 | Bacteria | 2975 |
| 873 | Ga0495650_0094542 | 3300046471 | Bacteria | 1131 |
| 874 | Ga0495580_0072493 | 3300046472 | Bacteria | 2405 |
| 875 | Ga0495580_0174340 | 3300046472 | Bacteria | 1486 |
| 876 | Ga0495580_0307451 | 3300046472 | Bacteria | 1079 |
| 877 | Ga0495582_0027690 | 3300046473 | Bacteria | 3108 |
| 878 | Ga0495582_0230584 | 3300046473 | Bacteria | 1060 |
| 879 | Ga0495582_0315786 | 3300046473 | Bacteria | 899 |
| 880 | Ga0495605_0075002 | 3300046474 | Bacteria | 1591 |
| 881 | Ga0495605_0092495 | 3300046474 | Bacteria | 1400 |
| 882 | Ga0495639_0131831 | 3300046475 | Bacteria | 1197 |
| 883 | Ga0495639_0490631 | 3300046475 | Bacteria | 626 |
| 884 | Ga0495664_0097922 | 3300046477 | Bacteria | 1766 |
| 885 | Ga0495664_0105741 | 3300046477 | Bacteria | 1697 |
| 886 | Ga0495664_0228271 | 3300046477 | Bacteria | 1127 |
| 887 | Ga0495584_0222648 | 3300046491 | Bacteria | 959 |
| 888 | Ga0495584_0273818 | 3300046491 | Bacteria | 858 |
| 889 | Ga0495585_0127932 | 3300046492 | Bacteria | 1339 |
| 890 | Ga0495585_0148924 | 3300046492 | Bacteria | 1221 |
| 891 | Ga0495585_0456162 | 3300046492 | Bacteria | 611 |
| 892 | Ga0495594_0067703 | 3300046499 | Bacteria | 1982 |
| 893 | Ga0495594_0134305 | 3300046499 | Bacteria | 1402 |
| 894 | Ga0495583_0109181 | 3300046506 | Bacteria | 1174 |
| 895 | Ga0495583_0215078 | 3300046506 | Bacteria | 778 |
| 896 | Ga0495606_0174896 | 3300046507 | Bacteria | 1242 |
| 897 | Ga0495606_0255921 | 3300046507 | Bacteria | 969 |
| 898 | Ga0495606_0475627 | 3300046507 | Bacteria | 635 |
| 899 | Ga0495608_0002749 | 3300046511 | Bacteria | 12636 |
| 900 | Ga0495610_0101824 | 3300046512 | Bacteria | 1285 |
| 901 | Ga0495616_0110849 | 3300046513 | Bacteria | 1275 |
| 902 | Ga0495616_0182993 | 3300046513 | Bacteria | 930 |
| 903 | Ga0495616_0315183 | 3300046513 | Bacteria | 658 |
| 904 | Ga0495618_0049103 | 3300046514 | Bacteria | 2665 |
| 905 | Ga0495620_0174465 | 3300046515 | Bacteria | 832 |
| 906 | Ga0495620_0183369 | 3300046515 | Bacteria | 809 |
| 907 | Ga0495628_0001554 | 3300046516 | Bacteria | 21033 |
| 908 | Ga0495628_0189804 | 3300046516 | Bacteria | 1552 |
| 909 | Ga0495628_0341361 | 3300046516 | Bacteria | 1102 |
| 910 | Ga0495630_0601118 | 3300046517 | Bacteria | 843 |
| 911 | Ga0495631_0036126 | 3300046518 | Bacteria | 2207 |
| 912 | Ga0495631_0130116 | 3300046518 | Bacteria | 1081 |
| 913 | Ga0495632_0109049 | 3300046519 | Bacteria | 1301 |
| 914 | Ga0495632_0125432 | 3300046519 | Bacteria | 1197 |
| 915 | Ga0495643_0185414 | 3300046522 | Bacteria | 1008 |
| 916 | Ga0495644_0108805 | 3300046523 | Bacteria | 1051 |
| 917 | Ga0495644_0137667 | 3300046523 | Bacteria | 932 |
| 918 | Ga0495648_0003177 | 3300046524 | Bacteria | 14623 |
| 919 | Ga0495648_0012566 | 3300046524 | Bacteria | 6304 |
| 920 | Ga0495648_0165396 | 3300046524 | Bacteria | 1139 |
| 921 | Ga0495648_0233855 | 3300046524 | Bacteria | 898 |
| 922 | Ga0495652_0007546 | 3300046529 | Bacteria | 10022 |
| 923 | Ga0495652_0222429 | 3300046529 | Bacteria | 1418 |
| 924 | Ga0495640_0050475 | 3300046533 | Bacteria | 2865 |
| 925 | Ga0495587_0006630 | 3300046536 | Bacteria | 7541 |
| 926 | Ga0495587_0330207 | 3300046536 | Bacteria | 851 |
| 927 | Ga0495587_0521198 | 3300046536 | Bacteria | 656 |
| 928 | Ga0495609_0110055 | 3300046538 | Bacteria | 1189 |
| 929 | Ga0495609_0159272 | 3300046538 | Bacteria | 958 |
| 930 | Ga0495621_0077638 | 3300046539 | Bacteria | 1233 |
| 931 | Ga0495621_0254890 | 3300046539 | Bacteria | 718 |
| 932 | Ga0495597_0135553 | 3300046542 | Bacteria | 1018 |
| 933 | Ga0495597_0270929 | 3300046542 | Bacteria | 663 |
| 934 | Ga0495597_0425992 | 3300046542 | Bacteria | 503 |
| 935 | Ga0495645_0003892 | 3300046543 | Bacteria | 10173 |
| 936 | Ga0495622_0046414 | 3300046557 | Bacteria | 2018 |
| 937 | Ga0495622_0049833 | 3300046557 | Bacteria | 1944 |
| 938 | Ga0495622_0122333 | 3300046557 | Bacteria | 1188 |
| 939 | Ga0495622_0210828 | 3300046557 | Bacteria | 863 |
| 940 | Ga0495633_0039798 | 3300046558 | Bacteria | 2242 |
| 941 | Ga0495633_0273372 | 3300046558 | Bacteria | 769 |
| 942 | Ga0495667_0021740 | 3300046559 | Bacteria | 4328 |
| 943 | Ga0495667_0435858 | 3300046559 | Bacteria | 824 |
| 944 | Ga0495656_0007133 | 3300046615 | Bacteria | 3943 |
| 945 | Ga0495656_0043638 | 3300046615 | Bacteria | 1884 |
| 946 | Ga0495656_0051008 | 3300046615 | Bacteria | 1769 |
| 947 | Ga0495668_0235698 | 3300046616 | Bacteria | 1002 |
| 948 | Ga0495668_0307684 | 3300046616 | Bacteria | 869 |
| 949 | Ga0495668_0547249 | 3300046616 | Bacteria | 639 |
| 950 | Ga0495634_0005678 | 3300046642 | Bacteria | 9546 |
| 951 | Ga0495611_0067301 | 3300046648 | Bacteria | 1634 |
| 952 | Ga0495611_0160048 | 3300046648 | Bacteria | 1052 |
| 953 | Ga0495611_0262332 | 3300046648 | Bacteria | 800 |
| 954 | Ga0495625_0128978 | 3300046660 | Bacteria | 1714 |
| 955 | Ga0495625_0144480 | 3300046660 | Bacteria | 1603 |
| 956 | Ga0495625_0372106 | 3300046660 | Bacteria | 898 |
| 957 | Ga0495625_0448718 | 3300046660 | Bacteria | 797 |
| 958 | Ga0495635_0000917 | 3300046663 | Bacteria | 19365 |
| 959 | Ga0495659_0026348 | 3300046664 | Bacteria | 1997 |
| 960 | Ga0495661_0191682 | 3300046665 | Bacteria | 1076 |
| 961 | Ga0495661_0420965 | 3300046665 | Bacteria | 647 |
| 962 | Ga0495588_0030267 | 3300046674 | Bacteria | 2720 |
| 963 | Ga0495588_0212180 | 3300046674 | Bacteria | 1022 |
| 964 | Ga0495657_0013656 | 3300046675 | Bacteria | 5983 |
| 965 | Ga0495599_0001780 | 3300046678 | Bacteria | 12490 |
| 966 | Ga0495599_0098299 | 3300046678 | Bacteria | 1824 |
| 967 | Ga0495623_0009830 | 3300046679 | Bacteria | 6197 |
| 968 | Ga0495646_0003865 | 3300046680 | Bacteria | 9362 |
| 969 | Ga0495647_0332583 | 3300046681 | Bacteria | 689 |
| 970 | Ga0495658_0076463 | 3300046683 | Bacteria | 1957 |
| 971 | Ga0495669_0031697 | 3300046684 | Bacteria | 2321 |
| 972 | Ga0495669_0153987 | 3300046684 | Bacteria | 1089 |
| 973 | Ga0495669_0199113 | 3300046684 | Bacteria | 957 |
| 974 | Ga0495613_0003569 | 3300046689 | Bacteria | 11661 |
| 975 | Ga0495613_0914857 | 3300046689 | Bacteria | 567 |
| 976 | Ga0495624_0426316 | 3300046690 | Bacteria | 795 |
| 977 | Ga0495670_0051410 | 3300046691 | Bacteria | 2062 |
| 978 | Ga0495670_0193047 | 3300046691 | Bacteria | 1077 |
| 979 | Ga0495671_0127927 | 3300046692 | Bacteria | 1239 |
| 980 | Ga0495671_0322461 | 3300046692 | Bacteria | 742 |
| 981 | Ga0495671_0580337 | 3300046692 | Bacteria | 533 |
| 982 | Ga0495649_0167739 | 3300046694 | Bacteria | 1150 |
| 983 | Ga0495649_0187677 | 3300046694 | Bacteria | 1077 |
| 984 | Ga0495649_0190004 | 3300046694 | Bacteria | 1069 |
| 985 | Ga0495649_0193306 | 3300046694 | Bacteria | 1059 |
| 986 | Ga0495649_0255972 | 3300046694 | Bacteria | 898 |
| 987 | Ga0495589_0047632 | 3300046794 | Bacteria | 2123 |
| 988 | Ga0495589_0051394 | 3300046794 | Bacteria | 2038 |
| 989 | Ga0495589_0133765 | 3300046794 | Bacteria | 1190 |
| 990 | Ga0495600_0005669 | 3300046809 | Bacteria | 7541 |
| 991 | Ga0495600_0129344 | 3300046809 | Bacteria | 1642 |
| 992 | Ga0495600_0367813 | 3300046809 | Bacteria | 899 |
| 993 | Ga0495660_0233322 | 3300046810 | Bacteria | 861 |
| 994 | Ga0495660_0451087 | 3300046810 | Bacteria | 556 |
| 995 | Ga0495581_0367953 | 3300047315 | Bacteria | 839 |
| 996 | Ga0495604_0031098 | 3300047317 | Bacteria | 4236 |
| 997 | Ga0495604_0127537 | 3300047317 | Bacteria | 1832 |
| 998 | Ga0495604_0134552 | 3300047317 | Bacteria | 1773 |
| 999 | Ga0495674_0037829 | 3300047319 | Bacteria | 4335 |
| 1000 | Ga0495674_0085898 | 3300047319 | Bacteria | 2695 |
| 1001 | Ga0495674_0571770 | 3300047319 | Bacteria | 898 |
| 1002 | Ga0495674_0809613 | 3300047319 | Bacteria | 728 |
| 1003 | Ga0495674_1320507 | 3300047319 | Bacteria | 540 |
| 1004 | Ga0495672_0068545 | 3300047320 | Bacteria | 2016 |
| 1005 | Ga0495672_0072262 | 3300047320 | Bacteria | 1949 |
| 1006 | Ga0495676_0259449 | 3300047321 | Bacteria | 1183 |
| 1007 | Ga0495676_0269578 | 3300047321 | Bacteria | 1156 |
| 1008 | Ga0495676_1079294 | 3300047321 | Bacteria | 511 |
| 1009 | Ga0495680_0001065 | 3300047322 | Bacteria | 30372 |
| 1010 | Ga0495683_0075406 | 3300047323 | Bacteria | 1652 |
| 1011 | Ga0495683_0091695 | 3300047323 | Bacteria | 1471 |
| 1012 | Ga0495683_0268973 | 3300047323 | Bacteria | 742 |
| 1013 | Ga0495675_0000901 | 3300047444 | Bacteria | 18140 |
| 1014 | Ga0495679_175126 | 3300047446 | Bacteria | 570 |
| 1015 | Ga0495685_119706 | 3300047447 | Bacteria | 864 |
| 1016 | Ga0495685_142129 | 3300047447 | Bacteria | 782 |
| 1017 | Ga0495673_0006914 | 3300047469 | Bacteria | 6607 |
| 1018 | Ga0495673_0192652 | 3300047469 | Bacteria | 766 |
| 1019 | Ga0495673_0204152 | 3300047469 | Bacteria | 738 |
| 1020 | Ga0495673_0329218 | 3300047469 | Bacteria | 542 |
| 1021 | Ga0495681_0218515 | 3300047470 | Bacteria | 765 |
| 1022 | Ga0495684_0000721 | 3300047471 | Bacteria | 26637 |
| 1023 | Ga0495686_0053138 | 3300047472 | Bacteria | 2539 |
| 1024 | Ga0495686_0104159 | 3300047472 | Bacteria | 1709 |
| 1025 | Ga0495593_0003054 | 3300047673 | Bacteria | 10089 |
| 1026 | Ga0495593_0237678 | 3300047673 | Bacteria | 913 |
| 1027 | Ga0495602_0043034 | 3300048088 | Bacteria | 4109 |
| 1028 | Ga0495602_0812247 | 3300048088 | Bacteria | 627 |
| 1029 | Ga0495615_0162652 | 3300048090 | Bacteria | 671 |
| 1030 | Ga0496100_0064188 | 3300048903 | Bacteria | 2429 |
| 1031 | Ga0496100_0127505 | 3300048903 | Bacteria | 1788 |
| 1032 | Ga0496100_0390952 | 3300048903 | Bacteria | 1058 |
| 1033 | Ga0496100_0430424 | 3300048903 | Bacteria | 1009 |
| 1034 | Ga0496100_1270213 | 3300048903 | Bacteria | 581 |
| 1035 | Ga0496101_0033066 | 3300048904 | Bacteria | 3645 |
| 1036 | Ga0496101_0092525 | 3300048904 | Bacteria | 2251 |
| 1037 | Ga0496101_0097010 | 3300048904 | Bacteria | 2201 |
| 1038 | Ga0496101_0432468 | 3300048904 | Bacteria | 1038 |
| 1039 | Ga0496101_1145420 | 3300048904 | Bacteria | 610 |
| 1040 | Ga0496102_0263478 | 3300048905 | Bacteria | 1625 |
| 1041 | Ga0496102_0373178 | 3300048905 | Bacteria | 1342 |
| 1042 | Ga0496102_0508738 | 3300048905 | Bacteria | 1127 |
| 1043 | Ga0496102_0705585 | 3300048905 | Bacteria | 932 |
| 1044 | Ga0496102_0775549 | 3300048905 | Bacteria | 881 |
| 1045 | Ga0496102_0787488 | 3300048905 | Bacteria | 873 |
| 1046 | Ga0496102_1633552 | 3300048905 | Bacteria | 563 |
| 1047 | Ga0496103_0130391 | 3300048906 | Bacteria | 1605 |
| 1048 | Ga0496103_0214391 | 3300048906 | Bacteria | 1238 |
| 1049 | Ga0496103_0292461 | 3300048906 | Bacteria | 1048 |
| 1050 | Ga0496104_0076570 | 3300048907 | Bacteria | 3186 |
| 1051 | Ga0496104_0444521 | 3300048907 | Bacteria | 1208 |
| 1052 | Ga0496104_0977471 | 3300048907 | Bacteria | 751 |
| 1053 | Ga0496104_1057353 | 3300048907 | Bacteria | 715 |
| 1054 | Ga0496105_0078902 | 3300048908 | Bacteria | 2718 |
| 1055 | Ga0496105_0190363 | 3300048908 | Bacteria | 1678 |
| 1056 | Ga0496105_0431547 | 3300048908 | Bacteria | 1042 |
| 1057 | Ga0496106_0001953 | 3300048909 | Bacteria | 15491 |
| 1058 | Ga0496106_0005142 | 3300048909 | Bacteria | 9697 |
| 1059 | Ga0496106_0013044 | 3300048909 | Bacteria | 6132 |
| 1060 | Ga0496106_0118296 | 3300048909 | Bacteria | 2069 |
| 1061 | Ga0496106_0181218 | 3300048909 | Bacteria | 1672 |
| 1062 | Ga0496106_0238959 | 3300048909 | Bacteria | 1451 |
| 1063 | Ga0496106_0353282 | 3300048909 | Bacteria | 1181 |
| 1064 | Ga0496107_0107732 | 3300048910 | Bacteria | 2046 |
| 1065 | Ga0496107_0152462 | 3300048910 | Bacteria | 1710 |
| 1066 | Ga0496107_0212262 | 3300048910 | Bacteria | 1439 |
| 1067 | Ga0496107_0329489 | 3300048910 | Bacteria | 1136 |
| 1068 | Ga0496107_0659024 | 3300048910 | Bacteria | 771 |
| 1069 | Ga0496107_0894723 | 3300048910 | Bacteria | 647 |
| 1070 | Ga0496107_1054493 | 3300048910 | Bacteria | 588 |
| 1071 | Ga0496108_0029882 | 3300048911 | Bacteria | 4516 |
| 1072 | Ga0496108_0042630 | 3300048911 | Bacteria | 3788 |
| 1073 | Ga0496108_0047665 | 3300048911 | Bacteria | 3582 |
| 1074 | Ga0496108_0692190 | 3300048911 | Bacteria | 884 |
| 1075 | Ga0496109_0019726 | 3300048912 | Bacteria | 5948 |
| 1076 | Ga0496109_0058661 | 3300048912 | Bacteria | 3516 |
| 1077 | Ga0496109_0153066 | 3300048912 | Bacteria | 2160 |
| 1078 | Ga0496109_0803475 | 3300048912 | Bacteria | 879 |
| 1079 | Ga0496110_0029199 | 3300048913 | Bacteria | 4743 |
| 1080 | Ga0496110_0043444 | 3300048913 | Bacteria | 3924 |
| 1081 | Ga0496110_0099562 | 3300048913 | Bacteria | 2606 |
| 1082 | Ga0496110_0303371 | 3300048913 | Bacteria | 1455 |
| 1083 | Ga0496110_0317462 | 3300048913 | Bacteria | 1419 |
| 1084 | Ga0496111_0175089 | 3300048914 | Bacteria | 1595 |
| 1085 | Ga0496111_0185766 | 3300048914 | Bacteria | 1545 |
| 1086 | Ga0496111_0754909 | 3300048914 | Bacteria | 705 |
| 1087 | Ga0496112_0035435 | 3300048915 | Bacteria | 4862 |
| 1088 | Ga0496112_0036732 | 3300048915 | Bacteria | 4780 |
| 1089 | Ga0496112_0072004 | 3300048915 | Bacteria | 3416 |
| 1090 | Ga0496112_0097007 | 3300048915 | Bacteria | 2918 |
| 1091 | Ga0496112_0769085 | 3300048915 | Bacteria | 889 |
| 1092 | Ga0496113_0051127 | 3300048916 | Bacteria | 3083 |
| 1093 | Ga0496113_0112428 | 3300048916 | Bacteria | 2121 |
| 1094 | Ga0496113_0192923 | 3300048916 | Bacteria | 1617 |
| 1095 | Ga0496113_0365944 | 3300048916 | Bacteria | 1157 |
| 1096 | Ga0496113_0410881 | 3300048916 | Bacteria | 1087 |
| 1097 | Ga0496114_0053462 | 3300048917 | Bacteria | 3366 |
| 1098 | Ga0496114_0158287 | 3300048917 | Bacteria | 1968 |
| 1099 | Ga0496114_0204861 | 3300048917 | Bacteria | 1729 |
| 1100 | Ga0496114_0293754 | 3300048917 | Bacteria | 1434 |
| 1101 | Ga0496114_0891956 | 3300048917 | Bacteria | 770 |
| 1102 | Ga0496114_0992713 | 3300048917 | Bacteria | 723 |
| 1103 | Ga0496115_0004493 | 3300048918 | Bacteria | 10094 |
| 1104 | Ga0496115_0060281 | 3300048918 | Bacteria | 3057 |
| 1105 | Ga0496115_0113069 | 3300048918 | Bacteria | 2231 |
| 1106 | Ga0496115_0226455 | 3300048918 | Bacteria | 1542 |
| 1107 | Ga0496115_0289910 | 3300048918 | Bacteria | 1343 |
| 1108 | Ga0496115_0494018 | 3300048918 | Bacteria | 984 |
| 1109 | Ga0496115_0572113 | 3300048918 | Bacteria | 901 |
| 1110 | Ga0496115_1267033 | 3300048918 | Bacteria | 551 |
| 1111 | Ga0496117_0014058 | 3300048920 | Bacteria | 6924 |
| 1112 | Ga0496117_0057259 | 3300048920 | Bacteria | 2709 |
| 1113 | Ga0496118_0003027 | 3300048921 | Bacteria | 21693 |
| 1114 | Ga0496118_0066793 | 3300048921 | Bacteria | 2623 |
| 1115 | Ga0496118_0157901 | 3300048921 | Bacteria | 1408 |
| 1116 | Ga0496118_0339093 | 3300048921 | Bacteria | 807 |
| 1117 | Ga0496118_0497724 | 3300048921 | Bacteria | 607 |
| 1118 | Ga0496119_0427137 | 3300048922 | Bacteria | 628 |
| 1119 | Ga0496120_0213708 | 3300048923 | Bacteria | 926 |
| 1120 | Ga0496121_0001622 | 3300048924 | Bacteria | 37285 |
| 1121 | Ga0496121_0002689 | 3300048924 | Bacteria | 26584 |
| 1122 | Ga0496121_0080207 | 3300048924 | Bacteria | 2588 |
| 1123 | Ga0496121_0162356 | 3300048924 | Bacteria | 1632 |
| 1124 | Ga0496121_0197492 | 3300048924 | Bacteria | 1437 |
| 1125 | Ga0496121_0650170 | 3300048924 | Bacteria | 642 |
| 1126 | Ga0496124_0002957 | 3300048927 | Bacteria | 21339 |
| 1127 | Ga0496124_0199622 | 3300048927 | Bacteria | 1522 |
| 1128 | Ga0496125_0009386 | 3300048928 | Bacteria | 10066 |
| 1129 | Ga0496125_0070558 | 3300048928 | Bacteria | 2735 |
| 1130 | Ga0496125_0094685 | 3300048928 | Bacteria | 2224 |
| 1131 | Ga0496125_0179978 | 3300048928 | Bacteria | 1410 |
| 1132 | Ga0496125_0249255 | 3300048928 | Bacteria | 1122 |
| 1133 | Ga0496126_0003472 | 3300048929 | Bacteria | 19892 |
| 1134 | Ga0496126_0003803 | 3300048929 | Bacteria | 18741 |
| 1135 | Ga0496126_0228574 | 3300048929 | Bacteria | 1559 |
| 1136 | Ga0496126_0303209 | 3300048929 | Bacteria | 1317 |
| 1137 | Ga0496126_0314173 | 3300048929 | Bacteria | 1289 |
| 1138 | Ga0496126_0431003 | 3300048929 | Bacteria | 1064 |
| 1139 | Ga0496126_1178508 | 3300048929 | Bacteria | 564 |
| 1140 | Ga0496126_1300247 | 3300048929 | Bacteria | 530 |
| 1141 | Ga0495682_0026858 | 3300049460 | Bacteria | 2136 |
| 1142 | Ga0495682_0167279 | 3300049460 | Bacteria | 783 |
| 1143 | Ga0495682_0213961 | 3300049460 | Bacteria | 683 |
| 1144 | Ga0501067_0070383 | 3300049583 | Bacteria | 1937 |
| 1145 | Ga0501069_0866252 | 3300049585 | Bacteria | 549 |
| 1146 | Ga0501071_0266307 | 3300049587 | Bacteria | 1295 |
| 1147 | Ga0501074_0687003 | 3300049590 | Bacteria | 723 |
| 1148 | Ga0501074_0838631 | 3300049590 | Bacteria | 647 |
| 1149 | Ga0501080_0207467 | 3300049742 | Bacteria | 1796 |
| 1150 | nmdc:mga03n38_20242_c1 | 3300050490 | Bacteria | 2658 |
| 1151 | nmdc:mga03n38_35336_c1 | 3300050490 | Bacteria | 2140 |
| 1152 | nmdc:mga03n38_528963_c1 | 3300050490 | Bacteria | 665 |
| 1153 | nmdc:mga03n38_71183_c1 | 3300050490 | Bacteria | 1610 |
| 1154 | nmdc:mga00v17_391001_c1 | 3300050491 | Bacteria | 904 |
| 1155 | nmdc:mga00v17_75479_c1 | 3300050491 | Bacteria | 2096 |
| 1156 | nmdc:mga0yw44_177417_c1 | 3300050492 | Bacteria | 1401 |
| 1157 | nmdc:mga0yw44_198255_c1 | 3300050492 | Bacteria | 1325 |
| 1158 | nmdc:mga0yw44_523416_c1 | 3300050492 | Bacteria | 805 |
| 1159 | nmdc:mga0yw44_63381_c1 | 3300050492 | Bacteria | 2273 |
| 1160 | nmdc:mga0yw44_872379_c1 | 3300050492 | Bacteria | 611 |
| 1161 | nmdc:mga0k408_100972_c1 | 3300050493 | Bacteria | 1701 |
| 1162 | nmdc:mga0k408_111125_c1 | 3300050493 | Bacteria | 1620 |
| 1163 | nmdc:mga0k408_22789_c2 | 3300050493 | Bacteria | 2224 |
| 1164 | nmdc:mga0k408_551798_c1 | 3300050493 | Bacteria | 681 |
| 1165 | nmdc:mga06z11_203006_c1 | 3300050494 | Bacteria | 1152 |
| 1166 | nmdc:mga06z11_252947_c1 | 3300050494 | Bacteria | 1038 |
| 1167 | nmdc:mga06z11_303406_c1 | 3300050494 | Bacteria | 950 |
| 1168 | nmdc:mga06z11_319602_c1 | 3300050494 | Bacteria | 926 |
| 1169 | nmdc:mga06z11_366065_c1 | 3300050494 | Bacteria | 865 |
| 1170 | nmdc:mga06z11_627_c1 | 3300050494 | Bacteria | 12858 |
| 1171 | nmdc:mga06z11_771993_c1 | 3300050494 | Bacteria | 586 |
| 1172 | nmdc:mga04h51_127125_c1 | 3300050495 | Bacteria | 955 |
| 1173 | nmdc:mga04h51_45473_c1 | 3300050495 | Bacteria | 1452 |
| 1174 | nmdc:mga07m45_270338_c1 | 3300050496 | Bacteria | 989 |
| 1175 | nmdc:mga07m45_376983_c1 | 3300050496 | Bacteria | 824 |
| 1176 | nmdc:mga07m45_57150_c1 | 3300050496 | Bacteria | 2206 |
| 1177 | nmdc:mga07m45_601019_c1 | 3300050496 | Bacteria | 635 |
| 1178 | nmdc:mga05p37_408930_c1 | 3300050507 | Bacteria | 1582 |
| 1179 | nmdc:mga06r32_756603_c1 | 3300050510 | Bacteria | 934 |
| 1180 | nmdc:mga08y16_1758664_c1 | 3300050511 | Bacteria | 574 |
| 1181 | nmdc:mga08y16_406484_c1 | 3300050511 | Bacteria | 1393 |
| 1182 | nmdc:mga0n895_1354839_c1 | 3300050512 | Bacteria | 681 |
| 1183 | nmdc:mga0n895_1860804_c1 | 3300050512 | Bacteria | 561 |
| 1184 | nmdc:mga0n895_225827_c1 | 3300050512 | Bacteria | 1901 |
| 1185 | nmdc:mga0rr50_281033_c1 | 3300050513 | Bacteria | 1389 |
| 1186 | nmdc:mga0rr50_593145_c1 | 3300050513 | Bacteria | 944 |
| 1187 | nmdc:mga0a205_341599_c1 | 3300050515 | Bacteria | 1365 |
| 1188 | nmdc:mga0a205_985218_c1 | 3300050515 | Bacteria | 690 |
| 1189 | nmdc:mga0sz30_164624_c1 | 3300050516 | Bacteria | 983 |
| 1190 | nmdc:mga0sz30_29112_c1 | 3300050516 | Bacteria | 2275 |
| 1191 | nmdc:mga0sz30_9035_c2 | 3300050516 | Bacteria | 3438 |
| 1192 | Ga0495601_0029491 | 3300053077 | Bacteria | 3403 |
| 1193 | Ga0495601_0053486 | 3300053077 | Bacteria | 2552 |
| 1194 | Ga0495601_0417342 | 3300053077 | Bacteria | 869 |
| 1195 | Ga0495612_0416343 | 3300053078 | Bacteria | 612 |
| 1196 | Ga0500610_0278880 | 3300053079 | Bacteria | 751 |
| 1197 | Ga0500635_0009001 | 3300053080 | Bacteria | 2756 |
| 1198 | Ga0500635_0055437 | 3300053080 | Bacteria | 1369 |
| 1199 | Ga0500635_0160809 | 3300053080 | Bacteria | 861 |
| 1200 | Ga0495655_0316876 | 3300053083 | Bacteria | 539 |
| 1201 | Ga0495595_0001490 | 3300053084 | Bacteria | 9146 |
| 1202 | Ga0495619_0000912 | 3300053085 | Bacteria | 19381 |
| 1203 | Ga0495619_0083152 | 3300053085 | Bacteria | 2159 |
| 1204 | Ga0495619_0126939 | 3300053085 | Bacteria | 1751 |
| 1205 | Ga0495619_0149163 | 3300053085 | Bacteria | 1613 |
| 1206 | Ga0495619_0179641 | 3300053085 | Bacteria | 1464 |
| 1207 | Ga0500578_0040493 | 3300053086 | Bacteria | 2994 |
| 1208 | Ga0500578_0132286 | 3300053086 | Bacteria | 1564 |
| 1209 | Ga0500578_0164064 | 3300053086 | Bacteria | 1377 |
| 1210 | Ga0500578_0370913 | 3300053086 | Bacteria | 832 |
| 1211 | Ga0500644_0314103 | 3300053088 | Bacteria | 673 |
| 1212 | Ga0500646_0117506 | 3300053090 | Bacteria | 852 |
| 1213 | Ga0500646_0395972 | 3300053090 | Bacteria | 510 |
| 1214 | Ga0500647_0155616 | 3300053091 | Bacteria | 1064 |
| 1215 | Ga0500583_0260589 | 3300053092 | Bacteria | 854 |
| 1216 | Ga0500583_0529834 | 3300053092 | Bacteria | 550 |
| 1217 | Ga0500566_0032785 | 3300053094 | Bacteria | 3029 |
| 1218 | Ga0500566_0498272 | 3300053094 | Bacteria | 525 |
| 1219 | Ga0500640_187383 | 3300053095 | Bacteria | 741 |
| 1220 | Ga0500641_0005231 | 3300053096 | Bacteria | 4598 |
| 1221 | Ga0500641_0045528 | 3300053096 | Bacteria | 1787 |
| 1222 | Ga0500650_0091755 | 3300053098 | Bacteria | 1422 |
| 1223 | Ga0500556_0196097 | 3300053104 | Bacteria | 798 |
| 1224 | Ga0500594_0045421 | 3300053118 | Bacteria | 1219 |
| 1225 | Ga0500595_006657 | 3300053119 | Bacteria | 4874 |
| 1226 | Ga0500595_020165 | 3300053119 | Bacteria | 2405 |
| 1227 | Ga0500595_167868 | 3300053119 | Bacteria | 610 |
| 1228 | Ga0500607_114426 | 3300053121 | Bacteria | 1316 |
| 1229 | Ga0500608_060438 | 3300053122 | Bacteria | 1812 |
| 1230 | Ga0500614_039754 | 3300053123 | Bacteria | 1190 |
| 1231 | Ga0500614_066652 | 3300053123 | Bacteria | 979 |
| 1232 | Ga0500655_009439 | 3300053133 | Bacteria | 1760 |
| 1233 | Ga0500655_010286 | 3300053133 | Bacteria | 1689 |
| 1234 | Ga0500658_0177111 | 3300053134 | Bacteria | 970 |
| 1235 | Ga0500658_0224572 | 3300053134 | Bacteria | 861 |
| 1236 | Ga0500559_0004946 | 3300053136 | Bacteria | 6197 |
| 1237 | Ga0500559_0076358 | 3300053136 | Bacteria | 1516 |
| 1238 | Ga0500561_0117032 | 3300053137 | Bacteria | 811 |
| 1239 | Ga0500561_0140407 | 3300053137 | Bacteria | 748 |
| 1240 | Ga0500564_079106 | 3300053138 | Bacteria | 1475 |
| 1241 | Ga0500573_0316081 | 3300053140 | Bacteria | 773 |
| 1242 | Ga0500577_0338541 | 3300053142 | Bacteria | 657 |
| 1243 | Ga0500589_102370 | 3300053147 | Bacteria | 1242 |
| 1244 | Ga0500589_155133 | 3300053147 | Bacteria | 927 |
| 1245 | Ga0500590_059698 | 3300053148 | Bacteria | 1919 |
| 1246 | Ga0500590_129150 | 3300053148 | Bacteria | 1172 |
| 1247 | Ga0500590_136178 | 3300053148 | Bacteria | 1129 |
| 1248 | Ga0500603_000540 | 3300053150 | Bacteria | 9573 |
| 1249 | Ga0500603_048844 | 3300053150 | Bacteria | 1152 |
| 1250 | Ga0500604_0018740 | 3300053151 | Bacteria | 1932 |
| 1251 | Ga0500604_0138253 | 3300053151 | Bacteria | 822 |
| 1252 | Ga0500620_039200 | 3300053155 | Bacteria | 1546 |
| 1253 | Ga0500622_0387210 | 3300053156 | Bacteria | 571 |
| 1254 | Ga0500633_0050319 | 3300053160 | Bacteria | 1436 |
| 1255 | Ga0500633_0229240 | 3300053160 | Bacteria | 693 |
| 1256 | Ga0500634_0089899 | 3300053161 | Bacteria | 1561 |
| 1257 | Ga0500634_0159268 | 3300053161 | Bacteria | 1044 |
| 1258 | Ga0500638_027293 | 3300053162 | Bacteria | 2740 |
| 1259 | Ga0500638_263500 | 3300053162 | Bacteria | 686 |
| 1260 | Ga0500639_295253 | 3300053163 | Bacteria | 613 |
| 1261 | Ga0500636_0014674 | 3300053177 | Bacteria | 4608 |
| 1262 | Ga0500636_0033475 | 3300053177 | Bacteria | 3042 |
| 1263 | Ga0500636_0065119 | 3300053177 | Bacteria | 2121 |
| 1264 | Ga0500636_0303953 | 3300053177 | Bacteria | 784 |
| 1265 | Ga0500636_0342243 | 3300053177 | Bacteria | 717 |
| 1266 | Ga0500637_0000131 | 3300053178 | Bacteria | 27270 |
| 1267 | Ga0500649_068841 | 3300053722 | Bacteria | 1464 |
| 1268 | Ga0500611_161427 | 3300053727 | Bacteria | 620 |
| 1269 | Ga0500645_025184 | 3300053730 | Bacteria | 1816 |
| 1270 | Ga0500609_006345 | 3300053731 | Bacteria | 1611 |
| 1271 | Ga0500609_017029 | 3300053731 | Bacteria | 987 |
| 1272 | Ga0500609_025521 | 3300053731 | Bacteria | 810 |
| 1273 | Ga0500552_000562 | 3300053733 | Bacteria | 3474 |
| 1274 | Ga0500596_002600 | 3300053735 | Bacteria | 3545 |
| 1275 | Ga0500599_000712 | 3300053736 | Bacteria | 3597 |
| 1276 | Ga0500601_003192 | 3300053737 | Bacteria | 1773 |
| 1277 | Ga0500661_026136 | 3300055283 | Bacteria | 1032 |
| 1278 | Ga0466962_0445465 | 3300061719 | Bacteria | 652 |
| 1279 | Ga0466962_0566392 | 3300061719 | Bacteria | 578 |
| 1280 | Ga0530510_0518858 | 3300061734 | Bacteria | 904 |
| 1281 | Ga0530510_0553150 | 3300061734 | Bacteria | 874 |
| 1282 | 2513638775 | 2513237094 | Bacteria | 8789602 |
| 1283 | 2513659789 | 2513237096 | Bacteria | 8722461 |
| 1284 | 2513676923 | 2513237098 | Bacteria | 9902361 |
| 1285 | 2513718674 | 2513237104 | Bacteria | 10034502 |
| 1286 | 2513720144 | 2513237104 | Bacteria | 10034502 |
| 1287 | 2513857250 | 2513237137 | Bacteria | 9558895 |
| 1288 | 2513918865 | 2513237145 | Bacteria | 8979722 |
| 1289 | 2517888190 | 2517572143 | Bacteria | 9484767 |
| 1290 | 2524533366 | 2524023228 | Bacteria | 10118060 |
| 1291 | 2671119351 | 2667528175 | Bacteria | 7532676 |
| 1292 | 2728753847 | 2728368998 | Bacteria | 8720350 |
| 1293 | 2793073869 | 2791355197 | Bacteria | 8420563 |
| 1294 | 2885380651 | 2885374607 | Bacteria | 8927485 |
| 1295 | 2885391422 | 2885383462 | Bacteria | 9473874 |
| 1296 | 2903752678 | 2903748898 | Bacteria | 9972761 |
| 1297 | 2903772252 | 2903768456 | Bacteria | 9749579 |
| 1298 | 2904695765 | 2904690495 | Bacteria | 9412302 |
| 1299 | 2904709893 | |||
| 1300 | 2906614453 | |||
| 1301 | 2906643424 | 2906635258 | Bacteria | 8601019 |
| 1302 | 2906666616 | 2906660503 | Bacteria | 8595048 |
| 1303 | 2908746718 | 2908739725 | Bacteria | 8628932 |
| 1304 | 2908764281 | 2908756301 | Bacteria | 8864324 |
| 1305 | 2922389347 | 2922386360 | Bacteria | 7017218 |
| 1306 | 2922426287 | |||
| 1307 | 2935632672 | 2935630451 | Bacteria | 8169952 |
| 1308 | 2941508664 | 2941507105 | Bacteria | 8166816 |
| 1309 | 2941516494 | 2941515067 | Bacteria | 8166720 |
| 1310 | 2941524490 | 2941523033 | Bacteria | 8169134 |
| 1311 | 3005475651 | 3005474847 | Bacteria | 9259049 |
| 1312 | 8006936985 | 8006933436 | Bacteria | 10410654 |
| 1313 | 8006976953 | 8006973647 | Bacteria | 10679141 |
| 1314 | 8019561687 | 8019555841 | Bacteria | 9642137 |
| 1315 | 8019571760 | 8019565922 | Bacteria | 9639779 |
| 1316 | 8019651706 | 8019648815 | Bacteria | 10014479 |
| 1317 | 8056683450 | 8056681323 | Bacteria | 8472857 |
| 1318 | 8056690827 | 8056689827 | Bacteria | 6712655 |
| 1319 | Ga0500648_071668 | |||
| 1320 | JGI24744J21845_10038047 | |||
| 1321 | JGI25165J46597_1006290 | |||
| 1322 | JGI25165J46597_1028343 | |||
| 1323 | JGI25153J46596_10032912 | |||
| 1324 | rootH2_10000947 | |||
| 1325 | JGI25160J50197_1002717 | |||
| 1326 | JGI25160J50197_1047327 | |||
| 1327 | JGI25404J52841_10101509 | |||
| 1328 | Ga0055539_1002207 | |||
| 1329 | Ga0055529_1004345 | |||
| 1330 | Ga0055529_1034042 | |||
| 1331 | Ga0055526_1031085 | |||
| 1332 | Ga0055531_10005040 | |||
| 1333 | Ga0055543_1006115 | |||
| 1334 | Ga0065165_1002365 | |||
| 1335 | Ga0065165_1009969 | |||
| 1336 | Ga0070658_10103008 | |||
| 1337 | Ga0070658_10182122 | |||
| 1338 | Ga0070658_10292635 | |||
| 1339 | Ga0070658_11280166 | |||
| 1340 | Ga0070676_10865643 | |||
| 1341 | Ga0070676_10918115 | |||
| 1342 | Ga0070690_100071372 | |||
| 1343 | Ga0070690_100071567 | |||
| 1344 | Ga0070670_101064560 | |||
| 1345 | Ga0070670_101372890 | |||
| 1346 | Ga0068869_100113815 | |||
| 1347 | Ga0068869_100175542 | |||
| 1348 | Ga0068869_100592412 | |||
| 1349 | Ga0068869_100644735 | |||
| 1350 | Ga0068869_101039746 | |||
| 1351 | Ga0068869_101372215 | |||
| 1352 | Ga0070666_10421153 | |||
| 1353 | Ga0070666_10539424 | |||
| 1354 | Ga0070680_100013830 | |||
| 1355 | Ga0070680_100032348 | |||
| 1356 | Ga0070680_100065382 | |||
| 1357 | Ga0070680_100221429 | |||
| 1358 | Ga0070682_100027255 | |||
| 1359 | Ga0070682_100513577 | |||
| 1360 | Ga0070682_100909222 | |||
| 1361 | Ga0070682_101359303 | |||
| 1362 | Ga0070682_101461079 | |||
| 1363 | Ga0068868_100050101 | |||
| 1364 | Ga0068868_100208887 | |||
| 1365 | Ga0068868_100468311 | |||
| 1366 | Ga0068868_100937391 | |||
| 1367 | Ga0068868_100955070 | |||
| 1368 | Ga0068868_101345856 | |||
| 1369 | Ga0068868_101369740 | |||
| 1370 | Ga0070660_100053169 | |||
| 1371 | Ga0070660_100200218 | |||
| 1372 | Ga0070660_100420662 | |||
| 1373 | Ga0070660_101058602 | |||
| 1374 | Ga0070660_101083313 | |||
| 1375 | Ga0070691_10340603 | |||
| 1376 | Ga0070691_10464654 | |||
| 1377 | Ga0070661_100739301 | |||
| 1378 | Ga0070661_100784881 | |||
| 1379 | Ga0070661_101387666 | |||
| 1380 | Ga0070668_100024341 | |||
| 1381 | Ga0070668_100059725 | |||
| 1382 | Ga0070668_100091702 | |||
| 1383 | Ga0070668_100211016 | |||
| 1384 | Ga0070668_100241381 | |||
| 1385 | Ga0070668_100244840 | |||
| 1386 | Ga0070668_100355770 | |||
| 1387 | Ga0070668_100693725 | |||
| 1388 | Ga0070668_100724415 | |||
| 1389 | Ga0070668_100928861 | |||
| 1390 | Ga0070669_100115968 | |||
| 1391 | Ga0070669_100122830 | |||
| 1392 | Ga0070669_100396359 | |||
| 1393 | Ga0070669_101131874 | |||
| 1394 | Ga0070675_100302007 | |||
| 1395 | Ga0070675_100340784 | |||
| 1396 | Ga0070675_100573817 | |||
| 1397 | Ga0070671_100360218 | |||
| 1398 | Ga0070671_100491034 | |||
| 1399 | Ga0070671_100868957 | |||
| 1400 | Ga0070671_101203392 | |||
| 1401 | Ga0070674_100007000 | |||
| 1402 | Ga0070674_101103076 | |||
| 1403 | Ga0070673_100295924 | |||
| 1404 | Ga0070688_100042378 | |||
| 1405 | Ga0070688_100104508 | |||
| 1406 | Ga0070659_100107453 | |||
| 1407 | Ga0070659_100174441 | |||
| 1408 | Ga0070667_100348731 | |||
| 1409 | Ga0070667_100485286 | |||
| 1410 | Ga0070667_100501518 | |||
| 1411 | Ga0070667_100986208 | |||
| 1412 | Ga0070709_10001773 | |||
| 1413 | Ga0070714_100005907 | |||
| 1414 | Ga0070714_100551144 | |||
| 1415 | Ga0070714_101434259 | |||
| 1416 | Ga0070713_100053086 | |||
| 1417 | Ga0070713_100225914 | |||
| 1418 | Ga0070710_10000733 | |||
| 1419 | Ga0070710_10018624 | |||
| 1420 | Ga0070710_11068529 | |||
| 1421 | Ga0070701_10232593 | |||
| 1422 | Ga0070701_10726150 | |||
| 1423 | Ga0070711_100005722 | |||
| 1424 | Ga0070711_100310649 | |||
| 1425 | Ga0070711_101033773 | |||
| 1426 | Ga0070705_100484487 | |||
| 1427 | Ga0070700_100293027 | |||
| 1428 | Ga0070694_101485840 | |||
| 1429 | Ga0070708_101953017 | |||
| 1430 | Ga0070663_100032985 | |||
| 1431 | Ga0070663_100052860 | |||
| 1432 | Ga0070663_100120480 | |||
| 1433 | Ga0070663_100166574 | |||
| 1434 | Ga0070663_100177156 | |||
| 1435 | Ga0070663_100180931 | |||
| 1436 | Ga0070663_101403445 | |||
| 1437 | Ga0070678_100059864 | |||
| 1438 | Ga0070678_100105195 | |||
| 1439 | Ga0070678_100133310 | |||
| 1440 | Ga0070678_100146766 | |||
| 1441 | Ga0070678_100335365 | |||
| 1442 | Ga0070678_100351547 | |||
| 1443 | Ga0070678_100543393 | |||
| 1444 | Ga0070678_100730967 | |||
| 1445 | Ga0070678_101334487 | |||
| 1446 | Ga0070662_100141228 | |||
| 1447 | Ga0070662_101159435 | |||
| 1448 | Ga0070662_101482603 | |||
| 1449 | Ga0070681_10006411 | |||
| 1450 | Ga0070681_10014525 | |||
| 1451 | Ga0070681_10173382 | |||
| 1452 | Ga0070681_10316432 | |||
| 1453 | Ga0068867_100227394 | |||
| 1454 | Ga0068867_100318977 | |||
| 1455 | Ga0068867_100559410 | |||
| 1456 | Ga0070685_10065354 | |||
| 1457 | Ga0070685_10758507 | |||
| 1458 | Ga0070699_101130510 | |||
| 1459 | Ga0070679_100013787 | |||
| 1460 | Ga0070679_100015371 | |||
| 1461 | Ga0070679_100018490 | |||
| 1462 | Ga0070684_100038107 | |||
| 1463 | Ga0070684_100355186 | |||
| 1464 | Ga0070684_101053956 | |||
| 1465 | Ga0070697_100591225 | |||
| 1466 | Ga0068853_100148054 | |||
| 1467 | Ga0068853_100721262 | |||
| 1468 | Ga0068853_100795427 | |||
| 1469 | Ga0068853_101833490 | |||
| 1470 | Ga0070672_100053512 | |||
| 1471 | Ga0070672_100135006 | |||
| 1472 | Ga0070672_100232844 | |||
| 1473 | Ga0070686_100141921 | |||
| 1474 | Ga0070693_100062734 | |||
| 1475 | Ga0070693_100110273 | |||
| 1476 | Ga0070693_100143578 | |||
| 1477 | Ga0070693_100229771 | |||
| 1478 | Ga0070693_100384930 | |||
| 1479 | Ga0070693_100877263 | |||
| 1480 | Ga0070693_101104579 | |||
| 1481 | Ga0070665_100038699 | |||
| 1482 | Ga0070665_100039004 | |||
| 1483 | Ga0070665_100060150 | |||
| 1484 | Ga0070665_100062787 | |||
| 1485 | Ga0070665_100122817 | |||
| 1486 | Ga0070665_100502647 | |||
| 1487 | Ga0070665_100629922 | |||
| 1488 | Ga0070665_100645084 | |||
| 1489 | Ga0070665_101402522 | |||
| 1490 | Ga0070665_101689334 | |||
| 1491 | Ga0070704_100830695 | |||
| 1492 | Ga0068855_100027307 | |||
| 1493 | Ga0068855_100096562 | |||
| 1494 | Ga0068855_100160273 | |||
| 1495 | Ga0068855_100621766 | |||
| 1496 | Ga0068855_100765320 | |||
| 1497 | Ga0068855_100940564 | |||
| 1498 | Ga0070664_100170152 | |||
| 1499 | Ga0070664_100182911 | |||
| 1500 | Ga0070664_101287003 | |||
| 1501 | Ga0070664_101328258 | |||
| 1502 | Ga0068857_100160318 | |||
| 1503 | Ga0068857_100271642 | |||
| 1504 | Ga0068857_100483314 | |||
| 1505 | Ga0068854_100647908 | |||
| 1506 | Ga0068854_101306410 | |||
| 1507 | Ga0068856_100037566 | |||
| 1508 | Ga0068856_100101906 | |||
| 1509 | Ga0068856_100202019 | |||
| 1510 | Ga0068856_100327317 | |||
| 1511 | Ga0070702_100037919 | |||
| 1512 | Ga0070702_100771055 | |||
| 1513 | Ga0068852_100070895 | |||
| 1514 | Ga0068852_100084397 | |||
| 1515 | Ga0068852_100193465 | |||
| 1516 | Ga0068852_100350839 | |||
| 1517 | Ga0068852_101999120 | |||
| 1518 | Ga0068859_100133974 | |||
| 1519 | Ga0068859_100379271 | |||
| 1520 | Ga0068859_100518138 | |||
| 1521 | Ga0068859_102220546 | |||
| 1522 | Ga0068864_100386511 | |||
| 1523 | Ga0068864_100544940 | |||
| 1524 | Ga0068864_100977991 | |||
| 1525 | Ga0068864_101296246 | |||
| 1526 | Ga0068864_101321049 | |||
| 1527 | Ga0068866_10036437 | |||
| 1528 | Ga0068866_10360428 | |||
| 1529 | Ga0068866_10656744 | |||
| 1530 | Ga0068861_100112343 | |||
| 1531 | Ga0068861_100266273 | |||
| 1532 | Ga0068851_10040575 | |||
| 1533 | Ga0068851_10093102 | |||
| 1534 | Ga0068851_10480322 | |||
| 1535 | Ga0068870_10119581 | |||
| 1536 | Ga0068870_10772218 | |||
| 1537 | Ga0068863_100279928 | |||
| 1538 | Ga0068863_100796162 | |||
| 1539 | Ga0068863_101055557 | |||
| 1540 | Ga0068863_101928836 | |||
| 1541 | Ga0068858_100150877 | |||
| 1542 | Ga0068858_100184242 | |||
| 1543 | Ga0068858_100284128 | |||
| 1544 | Ga0068858_100440736 | |||
| 1545 | Ga0068858_100573225 | |||
| 1546 | Ga0068858_100785126 | |||
| 1547 | Ga0068858_100897084 | |||
| 1548 | Ga0068858_101751567 | |||
| 1549 | Ga0068858_102368535 | |||
| 1550 | Ga0068860_100000313 | |||
| 1551 | Ga0068860_100108777 | |||
| 1552 | Ga0068860_100222614 | |||
| 1553 | Ga0068860_100232285 | |||
| 1554 | Ga0068860_100329950 | |||
| 1555 | Ga0068862_100065140 | |||
| 1556 | Ga0068862_100398886 | |||
| 1557 | Ga0068862_101367367 | |||
| 1558 | Ga0081455_10006340 | |||
| 1559 | Ga0081455_10029773 | |||
| 1560 | Ga0081455_10090122 | |||
| 1561 | Ga0081455_10364194 | |||
| 1562 | Ga0081538_10112325 | |||
| 1563 | Ga0081540_1002866 | |||
| 1564 | Ga0081540_1008557 | |||
| 1565 | Ga0081540_1012286 | |||
| 1566 | Ga0081540_1015992 | |||
| 1567 | Ga0081540_1095572 | |||
| 1568 | Ga0081540_1140862 | |||
| 1569 | Ga0070717_10034976 | |||
| 1570 | Ga0070717_10065227 | |||
| 1571 | Ga0070717_10081829 | |||
| 1572 | Ga0070717_10556685 | |||
| 1573 | Ga0075365_10060159 | |||
| 1574 | Ga0075365_10120189 | |||
| 1575 | Ga0075365_10120491 | |||
| 1576 | Ga0075365_10238705 | |||
| 1577 | Ga0075365_10366829 | |||
| 1578 | Ga0075365_10698467 | |||
| 1579 | Ga0075365_10812657 | |||
| 1580 | Ga0075368_10002578 | |||
| 1581 | Ga0075368_10094681 | |||
| 1582 | Ga0075368_10116137 | |||
| 1583 | Ga0075363_100003641 | |||
| 1584 | Ga0075363_100012959 | |||
| 1585 | Ga0075363_100522246 | |||
| 1586 | Ga0075363_100838329 | |||
| 1587 | Ga0075364_10148444 | |||
| 1588 | Ga0075364_10226694 | |||
| 1589 | Ga0075432_10030829 | |||
| 1590 | Ga0070715_10973969 | |||
| 1591 | Ga0070716_100008438 | |||
| 1592 | Ga0070716_100353041 | |||
| 1593 | Ga0070716_100511245 | |||
| 1594 | Ga0070716_101198403 | |||
| 1595 | Ga0070712_100009263 | |||
| 1596 | Ga0070712_100112642 | |||
| 1597 | Ga0070712_100320151 | |||
| 1598 | Ga0070712_100881676 | |||
| 1599 | Ga0070712_100963777 | |||
| 1600 | Ga0075367_10095272 | |||
| 1601 | Ga0075367_10107681 | |||
| 1602 | Ga0075367_10110818 | |||
| 1603 | Ga0075367_10129327 | |||
| 1604 | Ga0075367_10180577 | |||
| 1605 | Ga0075367_10380841 | |||
| 1606 | Ga0075367_10498548 | |||
| 1607 | Ga0075367_10787041 | |||
| 1608 | Ga0075369_10039844 | |||
| 1609 | Ga0075369_10042198 | |||
| 1610 | Ga0075369_10142739 | |||
| 1611 | Ga0075369_10581603 | |||
| 1612 | Ga0075366_10026120 | |||
| 1613 | Ga0075366_10529080 | |||
| 1614 | Ga0075366_10595369 | |||
| 1615 | Ga0097621_100311052 | |||
| 1616 | Ga0097621_100344412 | |||
| 1617 | Ga0097621_101178311 | |||
| 1618 | Ga0097621_101799642 | |||
| 1619 | Ga0075370_10084808 | |||
| 1620 | Ga0075370_10143111 | |||
| 1621 | Ga0075370_10201685 | |||
| 1622 | Ga0068871_100147970 | |||
| 1623 | Ga0068871_100239668 | |||
| 1624 | Ga0068871_100656134 | |||
| 1625 | Ga0068871_100857917 | |||
| 1626 | Ga0068871_102222520 | |||
| 1627 | Ga0075428_100210354 | |||
| 1628 | Ga0075431_101637427 | |||
| 1629 | Ga0075433_10654776 | |||
| 1630 | Ga0075433_10941443 | |||
| 1631 | Ga0075433_11371333 | |||
| 1632 | Ga0075434_100738263 | |||
| 1633 | Ga0075434_101320281 | |||
| 1634 | Ga0075434_101427718 | |||
| 1635 | Ga0075434_101643424 | |||
| 1636 | Ga0068865_100044082 | |||
| 1637 | Ga0068865_100087977 | |||
| 1638 | Ga0068865_100227390 | |||
| 1639 | Ga0068865_100548291 | |||
| 1640 | Ga0075436_100613809 | |||
| 1641 | Ga0097620_100133980 | |||
| 1642 | Ga0097620_100379283 | |||
| 1643 | Ga0097620_100518107 | |||
| 1644 | Ga0097620_102220600 | |||
| 1645 | Ga0099824_1023299 | |||
| 1646 | Ga0099822_1000541 | |||
| 1647 | Ga0075435_100678376 | |||
| 1648 | Ga0075435_100751095 | |||
| 1649 | Ga0099794_10413957 | |||
| 1650 | Ga0099795_10009533 | |||
| 1651 | Ga0099795_10043172 | |||
| 1652 | Ga0099795_10126162 | |||
| 1653 | Ga0105250_10421506 | |||
| 1654 | Ga0105240_10013303 | |||
| 1655 | Ga0105240_10033307 | |||
| 1656 | Ga0105240_10143904 | |||
| 1657 | Ga0105240_10533120 | |||
| 1658 | Ga0111539_10284392 | |||
| 1659 | Ga0111539_12021495 | |||
| 1660 | Ga0105245_10332453 | |||
| 1661 | Ga0105245_11709597 | |||
| 1662 | Ga0105245_11730132 | |||
| 1663 | Ga0105245_12060319 | |||
| 1664 | Ga0105247_10196398 | |||
| 1665 | Ga0105247_10216033 | |||
| 1666 | Ga0105247_10327871 | |||
| 1667 | Ga0105247_10681775 | |||
| 1668 | Ga0105247_11028037 | |||
| 1669 | Ga0114129_10759367 | |||
| 1670 | Ga0105243_10036778 | |||
| 1671 | Ga0105243_10037774 | |||
| 1672 | Ga0105243_10466393 | |||
| 1673 | Ga0105243_12711526 | |||
| 1674 | Ga0105243_12940348 | |||
| 1675 | Ga0105241_10038277 | |||
| 1676 | Ga0105241_10075194 | |||
| 1677 | Ga0105241_10184164 | |||
| 1678 | Ga0105241_10235173 | |||
| 1679 | Ga0105241_10254163 | |||
| 1680 | Ga0105241_10723271 | |||
| 1681 | Ga0105241_11509653 | |||
| 1682 | Ga0105241_11700082 | |||
| 1683 | Ga0105242_10094350 | |||
| 1684 | Ga0105242_10194312 | |||
| 1685 | Ga0105242_10320081 | |||
| 1686 | Ga0105242_10500984 | |||
| 1687 | Ga0105242_10758218 | |||
| 1688 | Ga0105242_10954961 | |||
| 1689 | Ga0105248_10118079 | |||
| 1690 | Ga0105248_10219712 | |||
| 1691 | Ga0105248_10270435 | |||
| 1692 | Ga0105248_10790504 | |||
| 1693 | Ga0105248_10933935 | |||
| 1694 | Ga0105237_10002301 | |||
| 1695 | Ga0105237_10066311 | |||
| 1696 | Ga0105237_10083853 | |||
| 1697 | Ga0105237_10106054 | |||
| 1698 | Ga0105237_10144169 | |||
| 1699 | Ga0105237_10199553 | |||
| 1700 | Ga0105237_10838032 | |||
| 1701 | Ga0105237_10992353 | |||
| 1702 | Ga0105237_11133613 | |||
| 1703 | Ga0105237_11180523 | |||
| 1704 | Ga0105237_11807952 | |||
| 1705 | Ga0105238_10085459 | |||
| 1706 | Ga0105238_10331061 | |||
| 1707 | Ga0105238_10407218 | |||
| 1708 | Ga0105238_10692882 | |||
| 1709 | Ga0105238_10799859 | |||
| 1710 | Ga0105238_10867024 | |||
| 1711 | Ga0105238_12370575 | |||
| 1712 | Ga0105249_10079381 | |||
| 1713 | Ga0105249_10279317 | |||
| 1714 | Ga0105249_10426279 | |||
| 1715 | Ga0105249_10511956 | |||
| 1716 | Ga0105249_11122948 | |||
| 1717 | Ga0105249_12838852 | |||
| 1718 | Ga0099796_10043454 | |||
| 1719 | Ga0099796_10077483 | |||
| 1720 | Ga0099796_10131497 | |||
| 1721 | Ga0099796_10134138 | |||
| 1722 | Ga0099796_10432845 | |||
| 1723 | Ga0105239_10035625 | |||
| 1724 | Ga0105239_10131830 | |||
| 1725 | Ga0105239_10140782 | |||
| 1726 | Ga0105239_10305305 | |||
| 1727 | Ga0105239_10409787 | |||
| 1728 | Ga0105239_10410225 | |||
| 1729 | Ga0105239_10570694 | |||
| 1730 | Ga0105239_10647769 | |||
| 1731 | Ga0105239_10655442 | |||
| 1732 | Ga0105239_11058262 | |||
| 1733 | Ga0105239_11182910 | |||
| 1734 | Ga0105239_11679802 | |||
| 1735 | Ga0105239_12483383 | |||
| 1736 | Ga0105239_13232696 | |||
| 1737 | Ga0105246_10011987 | |||
| 1738 | Ga0105246_10035946 | |||
| 1739 | Ga0105246_10097071 | |||
| 1740 | Ga0105246_10541703 | |||
| 1741 | Ga0105246_10863156 | |||
| 1742 | Ga0105246_11228098 | |||
| 1743 | Ga0105246_11573969 | |||
| 1744 | Ga0105246_11843621 | |||
| 1745 | Ga0105246_12019615 | |||
| 1746 | Ga0157373_10293719 | |||
| 1747 | Ga0157373_10758846 | |||
| 1748 | Ga0157370_10035301 | |||
| 1749 | Ga0157370_10141009 | |||
| 1750 | Ga0157369_10018692 | |||
| 1751 | Ga0157369_10094646 | |||
| 1752 | Ga0157369_10282633 | |||
| 1753 | Ga0157369_10601392 | |||
| 1754 | Ga0157374_10030777 | |||
| 1755 | Ga0157374_10357940 | |||
| 1756 | Ga0157374_10561190 | |||
| 1757 | Ga0157374_11207787 | |||
| 1758 | Ga0157374_11947040 | |||
| 1759 | Ga0157378_10155205 | |||
| 1760 | Ga0157378_10219928 | |||
| 1761 | Ga0157378_10710510 | |||
| 1762 | Ga0157378_12058940 | |||
| 1763 | Ga0157378_13244901 | |||
| 1764 | Ga0163162_10026136 | |||
| 1765 | Ga0163162_10031643 | |||
| 1766 | Ga0163162_10183057 | |||
| 1767 | Ga0163162_10242953 | |||
| 1768 | Ga0163162_10272397 | |||
| 1769 | Ga0163162_10591125 | |||
| 1770 | Ga0163162_10741575 | |||
| 1771 | Ga0163162_11419048 | |||
| 1772 | Ga0163162_11770137 | |||
| 1773 | Ga0157372_10030290 | |||
| 1774 | Ga0157372_10075935 | |||
| 1775 | Ga0157372_10148606 | |||
| 1776 | Ga0157375_10046484 | |||
| 1777 | Ga0157375_10149571 | |||
| 1778 | Ga0157375_10267498 | |||
| 1779 | Ga0157375_10391815 | |||
| 1780 | Ga0157375_10487036 | |||
| 1781 | Ga0157375_11018709 | |||
| 1782 | Ga0157375_12882274 | |||
| 1783 | Ga0163163_10007500 | |||
| 1784 | Ga0163163_10050743 | |||
| 1785 | Ga0163163_10078610 | |||
| 1786 | Ga0163163_10092490 | |||
| 1787 | Ga0163163_10342092 | |||
| 1788 | Ga0163163_10447602 | |||
| 1789 | Ga0163163_10489450 | |||
| 1790 | Ga0163163_10892774 | |||
| 1791 | Ga0163163_11654517 | |||
| 1792 | Ga0157380_10047597 | |||
| 1793 | Ga0157380_10315015 | |||
| 1794 | Ga0157380_10424194 | |||
| 1795 | Ga0157380_11114370 | |||
| 1796 | Ga0157380_11570670 | |||
| 1797 | Ga0157380_13050852 | |||
| 1798 | Ga0182008_10106991 | |||
| 1799 | Ga0157377_10034041 | |||
| 1800 | Ga0157377_10082310 | |||
| 1801 | Ga0157377_10292193 | |||
| 1802 | Ga0157377_10505589 | |||
| 1803 | Ga0157377_11009761 | |||
| 1804 | Ga0157379_10092557 | |||
| 1805 | Ga0157379_10202799 | |||
| 1806 | Ga0157379_10204212 | |||
| 1807 | Ga0157379_10209807 | |||
| 1808 | Ga0157379_10255138 | |||
| 1809 | Ga0157379_12345560 | |||
| 1810 | Ga0157376_10007382 | |||
| 1811 | Ga0157376_10146405 | |||
| 1812 | Ga0157376_10323650 | |||
| 1813 | Ga0157376_10510367 | |||
| 1814 | Ga0157376_10723427 | |||
| 1815 | Ga0157376_11085604 | |||
| 1816 | Ga0157376_11329341 | |||
| 1817 | Ga0157376_11388012 | |||
| 1818 | Ga0157376_11627103 | |||
| 1819 | Ga0157376_11708976 | |||
| 1820 | Ga0182005_1124178 | |||
| 1821 | Ga0163161_10025323 | |||
| 1822 | Ga0163161_10260401 | |||
| 1823 | Ga0163161_10440455 | |||
| 1824 | Ga0163161_10722028 | |||
| 1825 | Ga0213876_10080161 | |||
| 1826 | Ga0213876_10194281 | |||
| 1827 | Ga0213876_10377566 | |||
| 1828 | Ga0209677_102422 | |||
| 1829 | Ga0209148_1010927 | |||
| 1830 | Ga0209148_1019214 | |||
| 1831 | Ga0209233_1002344 | |||
| 1832 | Ga0209233_1023913 | |||
| 1833 | Ga0209455_1002785 | |||
| 1834 | Ga0209455_1006260 | |||
| 1835 | Ga0209758_1031951 | |||
| 1836 | Ga0207697_10016037 | |||
| 1837 | Ga0207656_10057503 | |||
| 1838 | Ga0207656_10252237 | |||
| 1839 | Ga0207696_1069607 | |||
| 1840 | Ga0207653_10309239 | |||
| 1841 | Ga0207682_10206804 | |||
| 1842 | Ga0207692_10097341 | |||
| 1843 | Ga0207642_10007135 | |||
| 1844 | Ga0207642_10084942 | |||
| 1845 | Ga0207642_10352017 | |||
| 1846 | Ga0207710_10365367 | |||
| 1847 | Ga0207688_10022442 | |||
| 1848 | Ga0207688_10054745 | |||
| 1849 | Ga0207688_10074637 | |||
| 1850 | Ga0207688_10197409 | |||
| 1851 | Ga0207688_10204797 | |||
| 1852 | Ga0207680_10177409 | |||
| 1853 | Ga0207647_10281401 | |||
| 1854 | Ga0207647_10300873 | |||
| 1855 | Ga0207647_10451834 | |||
| 1856 | Ga0207699_10274178 | |||
| 1857 | Ga0207699_10553267 | |||
| 1858 | Ga0207645_10100384 | |||
| 1859 | Ga0207645_10360065 | |||
| 1860 | Ga0207645_10598951 | |||
| 1861 | Ga0207643_10023049 | |||
| 1862 | Ga0207643_10176063 | |||
| 1863 | Ga0207643_10421309 | |||
| 1864 | Ga0207705_10723542 | |||
| 1865 | Ga0207684_11245498 | |||
| 1866 | Ga0207654_10011023 | |||
| 1867 | Ga0207707_10000143 | |||
| 1868 | Ga0207707_10064118 | |||
| 1869 | Ga0207695_10000059 | |||
| 1870 | Ga0207695_10059849 | |||
| 1871 | Ga0207695_10093922 | |||
| 1872 | Ga0207695_10103267 | |||
| 1873 | Ga0207671_10001109 | |||
| 1874 | Ga0207671_10044193 | |||
| 1875 | Ga0207671_10190306 | |||
| 1876 | Ga0207671_10291378 | |||
| 1877 | Ga0207671_10353320 | |||
| 1878 | Ga0207693_10699614 | |||
| 1879 | Ga0207663_10051956 | |||
| 1880 | Ga0207660_10017202 | |||
| 1881 | Ga0207660_10079923 | |||
| 1882 | Ga0207660_10233402 | |||
| 1883 | Ga0207660_10365126 | |||
| 1884 | Ga0207662_10072536 | |||
| 1885 | Ga0207657_10087843 | |||
| 1886 | Ga0207657_10323832 | |||
| 1887 | Ga0207657_10391102 | |||
| 1888 | Ga0207649_10346624 | |||
| 1889 | Ga0207649_10645440 | |||
| 1890 | Ga0207649_10977608 | |||
| 1891 | Ga0207652_10011338 | |||
| 1892 | Ga0207652_10609593 | |||
| 1893 | Ga0207694_10118714 | |||
| 1894 | Ga0207694_10796339 | |||
| 1895 | Ga0207650_10204856 | |||
| 1896 | Ga0207650_10908580 | |||
| 1897 | Ga0207659_10090791 | |||
| 1898 | Ga0207659_10939719 | |||
| 1899 | Ga0207664_11193314 | |||
| 1900 | Ga0207690_10464135 | |||
| 1901 | Ga0207690_10484324 | |||
| 1902 | Ga0207690_10685337 | |||
| 1903 | Ga0207706_10032508 | |||
| 1904 | Ga0207706_10153740 | |||
| 1905 | Ga0207706_10514060 | |||
| 1906 | Ga0207706_11586832 | |||
| 1907 | Ga0207686_10147999 | |||
| 1908 | Ga0207686_10387458 | |||
| 1909 | Ga0207709_10042251 | |||
| 1910 | Ga0207709_10241584 | |||
| 1911 | Ga0207670_10457592 | |||
| 1912 | Ga0207669_10256569 | |||
| 1913 | Ga0207669_10574961 | |||
| 1914 | Ga0207669_11420761 | |||
| 1915 | Ga0207704_10014406 | |||
| 1916 | Ga0207704_10430400 | |||
| 1917 | Ga0207665_10023996 | |||
| 1918 | Ga0207665_10634684 | |||
| 1919 | Ga0207691_10047055 | |||
| 1920 | Ga0207691_10210315 | |||
| 1921 | Ga0207691_10772306 | |||
| 1922 | Ga0207711_10199624 | |||
| 1923 | Ga0207711_10220496 | |||
| 1924 | Ga0207711_10275951 | |||
| 1925 | Ga0207711_11268444 | |||
| 1926 | Ga0207689_10052561 | |||
| 1927 | Ga0207689_10059101 | |||
| 1928 | Ga0207689_10180415 | |||
| 1929 | Ga0207689_10331490 | |||
| 1930 | Ga0207689_10505949 | |||
| 1931 | Ga0207661_10044679 | |||
| 1932 | Ga0207661_10355144 | |||
| 1933 | Ga0207679_10290602 | |||
| 1934 | Ga0207679_10452616 | |||
| 1935 | Ga0207679_11039177 | |||
| 1936 | Ga0207679_11501058 | |||
| 1937 | Ga0207667_10145811 | |||
| 1938 | Ga0207667_10154463 | |||
| 1939 | Ga0207651_10161862 | |||
| 1940 | Ga0207712_10102838 | |||
| 1941 | Ga0207712_10166274 | |||
| 1942 | Ga0207712_10194653 | |||
| 1943 | Ga0207712_10247656 | |||
| 1944 | Ga0207668_10122811 | |||
| 1945 | Ga0207668_10134695 | |||
| 1946 | Ga0207668_10207302 | |||
| 1947 | Ga0207668_10263666 | |||
| 1948 | Ga0207668_10438935 | |||
| 1949 | Ga0207668_10438946 | |||
| 1950 | Ga0207640_10089901 | |||
| 1951 | Ga0207640_10361292 | |||
| 1952 | Ga0207640_10386336 | |||
| 1953 | Ga0207640_10909477 | |||
| 1954 | Ga0207658_10647475 | |||
| 1955 | Ga0207658_10763870 | |||
| 1956 | Ga0207677_10202638 | |||
| 1957 | Ga0207677_10860456 | |||
| 1958 | Ga0207703_11200462 | |||
| 1959 | Ga0207703_11210308 | |||
| 1960 | Ga0207639_10160455 | |||
| 1961 | Ga0207639_10506472 | |||
| 1962 | Ga0207639_10992244 | |||
| 1963 | Ga0207639_11397853 | |||
| 1964 | Ga0207678_10015293 | |||
| 1965 | Ga0207678_10030059 | |||
| 1966 | Ga0207678_10067196 | |||
| 1967 | Ga0207678_10077044 | |||
| 1968 | Ga0207678_10132918 | |||
| 1969 | Ga0207678_10228037 | |||
| 1970 | Ga0207678_10606526 | |||
| 1971 | Ga0207708_10036812 | |||
| 1972 | Ga0207708_10860127 | |||
| 1973 | Ga0207702_10115752 | |||
| 1974 | Ga0207702_10163693 | |||
| 1975 | Ga0207702_10165497 | |||
| 1976 | Ga0207702_10240067 | |||
| 1977 | Ga0207702_10695115 | |||
| 1978 | Ga0207641_10068950 | |||
| 1979 | Ga0207641_10719009 | |||
| 1980 | Ga0207641_11632619 | |||
| 1981 | Ga0207648_10069067 | |||
| 1982 | Ga0207648_10674575 | |||
| 1983 | Ga0207676_10520654 | |||
| 1984 | Ga0207674_10175284 | |||
| 1985 | Ga0207674_10284503 | |||
| 1986 | Ga0207675_100043034 | |||
| 1987 | Ga0207675_100069520 | |||
| 1988 | Ga0207675_100088011 | |||
| 1989 | Ga0207675_100099220 | |||
| 1990 | Ga0207675_100823183 | |||
| 1991 | Ga0207675_101239980 | |||
| 1992 | Ga0207683_10038386 | |||
| 1993 | Ga0207683_10063563 | |||
| 1994 | Ga0207683_10192873 | |||
| 1995 | Ga0207683_10209971 | |||
| 1996 | Ga0207683_10322426 | |||
| 1997 | Ga0207683_10752834 | |||
| 1998 | Ga0207683_11080219 | |||
| 1999 | Ga0207698_10039785 | |||
| 2000 | Ga0207698_10231586 | |||
| 2001 | Ga0207698_10277937 | |||
| 2002 | Ga0207698_10345855 | |||
| 2003 | Ga0207698_10429452 | |||
| 2004 | Ga0207698_12408026 | |||
| 2005 | Ga0209589_1000015 | |||
| 2006 | Ga0209489_100015 | |||
| 2007 | Ga0209700_100025 | |||
| 2008 | Ga0209179_1000903 | |||
| 2009 | Ga0209813_10124429 | |||
| 2010 | Ga0207428_10875977 | |||
| 2011 | Ga0265356_1012512 | |||
| 2012 | Ga0268266_10003191 | |||
| 2013 | Ga0268266_10018212 | |||
| 2014 | Ga0268266_10047304 | |||
| 2015 | Ga0268266_10115674 | |||
| 2016 | Ga0268265_10077246 | |||
| 2017 | Ga0268265_10719282 | |||
| 2018 | Ga0268265_11347926 | |||
| 2019 | Ga0268265_11384184 | |||
| 2020 | Ga0268265_11467784 | |||
| 2021 | Ga0268265_12440257 | |||
| 2022 | Ga0268264_10000356 | |||
| 2023 | Ga0268264_10157667 | |||
| 2024 | Ga0268264_10263290 | |||
| 2025 | Ga0268264_10680756 | |||
| 2026 | Ga0268264_11141684 | |||
| 2027 | Ga0307515_10045648 | |||
| 2028 | Ga0307511_10132509 | |||
| 2029 | Ga0307511_10194685 | |||
| 2030 | Ga0307512_10423455 | |||
| 2031 | Ga0265330_10012848 | |||
| 2032 | Ga0265330_10199581 | |||
| 2033 | Ga0307513_10168005 | |||
| 2034 | Ga0307509_10009216 | |||
| 2035 | Ga0307509_10376963 | |||
| 2036 | Ga0307509_10640941 | |||
| 2037 | Ga0307408_100722853 | |||
| 2038 | Ga0307508_10000715 | |||
| 2039 | Ga0307508_10073634 | |||
| 2040 | Ga0307508_10667726 | |||
| 2041 | Ga0307508_10900221 | |||
| 2042 | Ga0265342_10186629 | |||
| 2043 | Ga0307516_10005305 | |||
| 2044 | Ga0307516_10009786 | |||
| 2045 | Ga0307516_10099990 | |||
| 2046 | Ga0307516_10102108 | |||
| 2047 | Ga0307516_10142157 | |||
| 2048 | Ga0307516_10233822 | |||
| 2049 | Ga0307516_10245733 | |||
| 2050 | Ga0307516_10495779 | |||
| 2051 | Ga0307405_10810442 | |||
| 2052 | Ga0326468_10008419 | |||
| 2053 | Ga0307406_10214720 | |||
| 2054 | Ga0307407_10142512 | |||
| 2055 | Ga0307412_10221792 | |||
| 2056 | Ga0307412_10798454 | |||
| 2057 | Ga0307412_11864422 | |||
| 2058 | Ga0307409_101058608 | |||
| 2059 | Ga0307409_101068088 | |||
| 2060 | Ga0307409_101665964 | |||
| 2061 | Ga0307416_100370337 | |||
| 2062 | Ga0307416_100827607 | |||
| 2063 | Ga0307416_101523765 | |||
| 2064 | Ga0307416_102246675 | |||
| 2065 | Ga0307411_10271283 | |||
| 2066 | Ga0307411_10537234 | |||
| 2067 | Ga0307415_100546883 | |||
| 2068 | Ga0307415_100614463 | |||
| 2069 | Ga0307507_10190397 | |||
| 2070 | Ga0307510_10049561 | |||
| 2071 | Ga0307510_10078920 | |||
| 2072 | Ga0307510_10129800 | |||
| 2073 | Ga0307510_10179538 | |||
| 2074 | Ga0307510_10574515 | |||
| 2075 | Ga0315911_1000021 | |||
| 2076 | Ga0373950_0060189 | |||
| 2077 | Ga0373926_0245299 | |||
| 2078 | Ga0373928_0068305 | |||
| 2079 | Ga0373934_0005810 | |||
| 2080 | Ga0373940_0365362 | |||
| 2081 | Ga0373952_0012727 | |||
| 2082 | Ga0373923_0001264 | |||
| 2083 | Ga0373932_0057673 | |||
| 2084 | Ga0373936_0292141 | |||
| 2085 | Ga0373945_0578076 | |||
| 2086 | Ga0373953_0009689 | |||
| 2087 | Ga0373953_0311352 | |||
| 2088 | Ga0373954_0001440 | |||
| 2089 | Ga0373956_0000376 | |||
| 2090 | Ga0373956_0267324 | |||
| 2091 | Ga0373957_0000575 | |||
| 2092 | Ga0373943_0093790 | |||
| 2093 | Ga0373943_0304847 | |||
| 2094 | Ga0373943_0666580 | |||
| 2095 | Ga0373955_0000325 | |||
| 2096 | Ga0373955_0094862 | |||
| 2097 | Ga0373924_0000567 | |||
| 2098 | Ga0373931_0006104 | |||
| 2099 | Ga0373935_0005959 | |||
| 2100 | Ga0373935_0141667 | |||
| 2101 | Ga0373935_0231401 | |||
| 2102 | Ga0373935_0479249 | |||
| 2103 | Ga0373927_0005646 | |||
| 2104 | Ga0373927_0051745 | |||
| 2105 | Ga0373927_0056834 | |||
| 2106 | Ga0373927_0074127 | |||
| 2107 | Ga0373927_0139344 | |||
| 2108 | Ga0373927_0151302 | |||
| 2109 | Ga0373927_0622588 | |||
| 2110 | Ga0373933_0000108 | |||
| 2111 | Ga0373933_0002337 | |||
| 2112 | Ga0373947_0054194 | |||
| 2113 | Ga0373947_0193833 | |||
| 2114 | Ga0373947_0225024 | |||
| 2115 | Ga0373937_0036844 | |||
| 2116 | Ga0373937_0294717 | |||
| 2117 | Ga0373937_0792342 | |||
| 2118 | Ga0373925_0175704 | |||
| 2119 | Ga0373925_0218338 | |||
| 2120 | Ga0373925_0282962 | |||
| 2121 | Ga0373925_0288860 | |||
| 2122 | Ga0373925_0670134 | |||
| 2123 | Ga0395899_0154932 | |||
| 2124 | Ga0395899_0652635 | |||
| 2125 | Ga0395899_0797694 | |||
| 2126 | Ga0395900_0139090 | |||
| 2127 | Ga0395900_0280928 | |||
| 2128 | Ga0395898_0136250 | |||
| 2129 | Ga0395898_0995894 | |||
| 2130 | Ga0395898_1709599 | |||
| 2131 | Ga0395905_0018632 | |||
| 2132 | Ga0395905_0294700 | |||
| 2133 | Ga0395905_1324186 | |||
| 2134 | Ga0395905_1851601 | |||
| 2135 | Ga0436364_0879350 | |||
| 2136 | Ga0395901_0058033 | |||
| 2137 | Ga0395901_0321389 | |||
| 2138 | Ga0395901_0436961 | |||
| 2139 | Ga0395901_1233128 | |||
| 2140 | Ga0395901_1854960 | |||
| 2141 | Ga0436365_0414572 | |||
| 2142 | Ga0436365_0429696 | |||
| 2143 | Ga0436365_1212947 | |||
| 2144 | Ga0436361_0899129 | |||
| 2145 | Ga0439465_0058246 | |||
| 2146 | Ga0439465_0064370 | |||
| 2147 | Ga0451787_105515 | |||
| 2148 | Ga0451791_0677543 | |||
| 2149 | Ga0451791_1155178 | |||
| 2150 | Ga0451797_0053473 | |||
| 2151 | Ga0451797_1018948 | |||
| 2152 | Ga0451800_0728190 | |||
| 2153 | Ga0451800_1438690 | |||
| 2154 | Ga0451802_1426775 | |||
| 2155 | Ga0451804_0726654 | |||
| 2156 | Ga0451833_0126247 | |||
| 2157 | Ga0451837_1574521 | |||
| 2158 | Ga0451847_0379818 | |||
| 2159 | Ga0451853_0473635 | |||
| 2160 | Ga0439445_0101008 | |||
| 2161 | Ga0439458_0210853 | |||
| 2162 | Ga0439459_0150446 | |||
| 2163 | Ga0466966_0000411 | |||
| 2164 | Ga0466961_0000065 | |||
| 2165 | Ga0466957_0149701 | |||
| 2166 | Ga0466957_0220346 | |||
| 2167 | Ga0466957_0769191 | |||
| 2168 | Ga0466959_0000634 | |||
| 2169 | Ga0466959_0318213 | |||
| 2170 | Ga0495617_033360 | |||
| 2171 | Ga0495617_050127 | |||
| 2172 | Ga0495617_061551 | |||
| 2173 | Ga0495592_0000339 | |||
| 2174 | Ga0495592_0716043 | |||
| 2175 | Ga0495592_0782603 | |||
| 2176 | Ga0495603_0004729 | |||
| 2177 | Ga0495603_0053248 | |||
| 2178 | Ga0495603_0209080 | |||
| 2179 | Ga0495603_0323343 | |||
| 2180 | Ga0495629_0001483 | |||
| 2181 | Ga0495629_0090157 | |||
| 2182 | Ga0495629_0412836 | |||
| 2183 | Ga0495638_0050016 | |||
| 2184 | Ga0495638_0104997 | |||
| 2185 | Ga0495638_0174932 | |||
| 2186 | Ga0495651_0028813 | |||
| 2187 | Ga0495651_0044793 | |||
| 2188 | Ga0495651_0528313 | |||
| 2189 | Ga0495653_0001063 | |||
| 2190 | Ga0495653_0057062 | |||
| 2191 | Ga0495650_0094542 | |||
| 2192 | Ga0495580_0072493 | |||
| 2193 | Ga0495580_0174340 | |||
| 2194 | Ga0495580_0307451 | |||
| 2195 | Ga0495582_0027690 | |||
| 2196 | Ga0495582_0230584 | |||
| 2197 | Ga0495582_0315786 | |||
| 2198 | Ga0495605_0075002 | |||
| 2199 | Ga0495605_0092495 | |||
| 2200 | Ga0495639_0131831 | |||
| 2201 | Ga0495639_0490631 | |||
| 2202 | Ga0495664_0097922 | |||
| 2203 | Ga0495664_0105741 | |||
| 2204 | Ga0495664_0228271 | |||
| 2205 | Ga0495584_0222648 | |||
| 2206 | Ga0495584_0273818 | |||
| 2207 | Ga0495585_0127932 | |||
| 2208 | Ga0495585_0148924 | |||
| 2209 | Ga0495585_0456162 | |||
| 2210 | Ga0495594_0067703 | |||
| 2211 | Ga0495594_0134305 | |||
| 2212 | Ga0495583_0109181 | |||
| 2213 | Ga0495583_0215078 | |||
| 2214 | Ga0495606_0174896 | |||
| 2215 | Ga0495606_0255921 | |||
| 2216 | Ga0495606_0475627 | |||
| 2217 | Ga0495608_0002749 | |||
| 2218 | Ga0495610_0101824 | |||
| 2219 | Ga0495616_0110849 | |||
| 2220 | Ga0495616_0182993 | |||
| 2221 | Ga0495616_0315183 | |||
| 2222 | Ga0495618_0049103 | |||
| 2223 | Ga0495620_0174465 | |||
| 2224 | Ga0495620_0183369 | |||
| 2225 | Ga0495628_0001554 | |||
| 2226 | Ga0495628_0189804 | |||
| 2227 | Ga0495628_0341361 | |||
| 2228 | Ga0495630_0601118 | |||
| 2229 | Ga0495631_0036126 | |||
| 2230 | Ga0495631_0130116 | |||
| 2231 | Ga0495632_0109049 | |||
| 2232 | Ga0495632_0125432 | |||
| 2233 | Ga0495643_0185414 | |||
| 2234 | Ga0495644_0108805 | |||
| 2235 | Ga0495644_0137667 | |||
| 2236 | Ga0495648_0003177 | |||
| 2237 | Ga0495648_0012566 | |||
| 2238 | Ga0495648_0165396 | |||
| 2239 | Ga0495648_0233855 | |||
| 2240 | Ga0495652_0007546 | |||
| 2241 | Ga0495652_0222429 | |||
| 2242 | Ga0495640_0050475 | |||
| 2243 | Ga0495587_0006630 | |||
| 2244 | Ga0495587_0330207 | |||
| 2245 | Ga0495587_0521198 | |||
| 2246 | Ga0495609_0110055 | |||
| 2247 | Ga0495609_0159272 | |||
| 2248 | Ga0495621_0077638 | |||
| 2249 | Ga0495621_0254890 | |||
| 2250 | Ga0495597_0135553 | |||
| 2251 | Ga0495597_0270929 | |||
| 2252 | Ga0495597_0425992 | |||
| 2253 | Ga0495645_0003892 | |||
| 2254 | Ga0495622_0046414 | |||
| 2255 | Ga0495622_0049833 | |||
| 2256 | Ga0495622_0122333 | |||
| 2257 | Ga0495622_0210828 | |||
| 2258 | Ga0495633_0039798 | |||
| 2259 | Ga0495633_0273372 | |||
| 2260 | Ga0495667_0021740 | |||
| 2261 | Ga0495667_0435858 | |||
| 2262 | Ga0495656_0007133 | |||
| 2263 | Ga0495656_0043638 | |||
| 2264 | Ga0495656_0051008 | |||
| 2265 | Ga0495668_0235698 | |||
| 2266 | Ga0495668_0307684 | |||
| 2267 | Ga0495668_0547249 | |||
| 2268 | Ga0495634_0005678 | |||
| 2269 | Ga0495611_0067301 | |||
| 2270 | Ga0495611_0160048 | |||
| 2271 | Ga0495611_0262332 | |||
| 2272 | Ga0495625_0128978 | |||
| 2273 | Ga0495625_0144480 | |||
| 2274 | Ga0495625_0372106 | |||
| 2275 | Ga0495625_0448718 | |||
| 2276 | Ga0495635_0000917 | |||
| 2277 | Ga0495659_0026348 | |||
| 2278 | Ga0495661_0191682 | |||
| 2279 | Ga0495661_0420965 | |||
| 2280 | Ga0495588_0030267 | |||
| 2281 | Ga0495588_0212180 | |||
| 2282 | Ga0495657_0013656 | |||
| 2283 | Ga0495599_0001780 | |||
| 2284 | Ga0495599_0098299 | |||
| 2285 | Ga0495623_0009830 | |||
| 2286 | Ga0495646_0003865 | |||
| 2287 | Ga0495647_0332583 | |||
| 2288 | Ga0495658_0076463 | |||
| 2289 | Ga0495669_0031697 | |||
| 2290 | Ga0495669_0153987 | |||
| 2291 | Ga0495669_0199113 | |||
| 2292 | Ga0495613_0003569 | |||
| 2293 | Ga0495613_0914857 | |||
| 2294 | Ga0495624_0426316 | |||
| 2295 | Ga0495670_0051410 | |||
| 2296 | Ga0495670_0193047 | |||
| 2297 | Ga0495671_0127927 | |||
| 2298 | Ga0495671_0322461 | |||
| 2299 | Ga0495671_0580337 | |||
| 2300 | Ga0495649_0167739 | |||
| 2301 | Ga0495649_0187677 | |||
| 2302 | Ga0495649_0190004 | |||
| 2303 | Ga0495649_0193306 | |||
| 2304 | Ga0495649_0255972 | |||
| 2305 | Ga0495589_0047632 | |||
| 2306 | Ga0495589_0051394 | |||
| 2307 | Ga0495589_0133765 | |||
| 2308 | Ga0495600_0005669 | |||
| 2309 | Ga0495600_0129344 | |||
| 2310 | Ga0495600_0367813 | |||
| 2311 | Ga0495660_0233322 | |||
| 2312 | Ga0495660_0451087 | |||
| 2313 | Ga0495581_0367953 | |||
| 2314 | Ga0495604_0031098 | |||
| 2315 | Ga0495604_0127537 | |||
| 2316 | Ga0495604_0134552 | |||
| 2317 | Ga0495674_0037829 | |||
| 2318 | Ga0495674_0085898 | |||
| 2319 | Ga0495674_0571770 | |||
| 2320 | Ga0495674_0809613 | |||
| 2321 | Ga0495674_1320507 | |||
| 2322 | Ga0495672_0068545 | |||
| 2323 | Ga0495672_0072262 | |||
| 2324 | Ga0495676_0259449 | |||
| 2325 | Ga0495676_0269578 | |||
| 2326 | Ga0495676_1079294 | |||
| 2327 | Ga0495680_0001065 | |||
| 2328 | Ga0495683_0075406 | |||
| 2329 | Ga0495683_0091695 | |||
| 2330 | Ga0495683_0268973 | |||
| 2331 | Ga0495675_0000901 | |||
| 2332 | Ga0495679_175126 | |||
| 2333 | Ga0495685_119706 | |||
| 2334 | Ga0495685_142129 | |||
| 2335 | Ga0495673_0006914 | |||
| 2336 | Ga0495673_0192652 | |||
| 2337 | Ga0495673_0204152 | |||
| 2338 | Ga0495673_0329218 | |||
| 2339 | Ga0495681_0218515 | |||
| 2340 | Ga0495684_0000721 | |||
| 2341 | Ga0495686_0053138 | |||
| 2342 | Ga0495686_0104159 | |||
| 2343 | Ga0495593_0003054 | |||
| 2344 | Ga0495593_0237678 | |||
| 2345 | Ga0495602_0043034 | |||
| 2346 | Ga0495602_0812247 | |||
| 2347 | Ga0495615_0162652 | |||
| 2348 | Ga0496100_0064188 | |||
| 2349 | Ga0496100_0127505 | |||
| 2350 | Ga0496100_0390952 | |||
| 2351 | Ga0496100_0430424 | |||
| 2352 | Ga0496100_1270213 | |||
| 2353 | Ga0496101_0033066 | |||
| 2354 | Ga0496101_0092525 | |||
| 2355 | Ga0496101_0097010 | |||
| 2356 | Ga0496101_0432468 | |||
| 2357 | Ga0496101_1145420 | |||
| 2358 | Ga0496102_0263478 | |||
| 2359 | Ga0496102_0373178 | |||
| 2360 | Ga0496102_0508738 | |||
| 2361 | Ga0496102_0705585 | |||
| 2362 | Ga0496102_0775549 | |||
| 2363 | Ga0496102_0787488 | |||
| 2364 | Ga0496102_1633552 | |||
| 2365 | Ga0496103_0130391 | |||
| 2366 | Ga0496103_0214391 | |||
| 2367 | Ga0496103_0292461 | |||
| 2368 | Ga0496104_0076570 | |||
| 2369 | Ga0496104_0444521 | |||
| 2370 | Ga0496104_0977471 | |||
| 2371 | Ga0496104_1057353 | |||
| 2372 | Ga0496105_0078902 | |||
| 2373 | Ga0496105_0190363 | |||
| 2374 | Ga0496105_0431547 | |||
| 2375 | Ga0496106_0001953 | |||
| 2376 | Ga0496106_0005142 | |||
| 2377 | Ga0496106_0013044 | |||
| 2378 | Ga0496106_0118296 | |||
| 2379 | Ga0496106_0181218 | |||
| 2380 | Ga0496106_0238959 | |||
| 2381 | Ga0496106_0353282 | |||
| 2382 | Ga0496107_0107732 | |||
| 2383 | Ga0496107_0152462 | |||
| 2384 | Ga0496107_0212262 | |||
| 2385 | Ga0496107_0329489 | |||
| 2386 | Ga0496107_0659024 | |||
| 2387 | Ga0496107_0894723 | |||
| 2388 | Ga0496107_1054493 | |||
| 2389 | Ga0496108_0029882 | |||
| 2390 | Ga0496108_0042630 | |||
| 2391 | Ga0496108_0047665 | |||
| 2392 | Ga0496108_0692190 | |||
| 2393 | Ga0496109_0019726 | |||
| 2394 | Ga0496109_0058661 | |||
| 2395 | Ga0496109_0153066 | |||
| 2396 | Ga0496109_0803475 | |||
| 2397 | Ga0496110_0029199 | |||
| 2398 | Ga0496110_0043444 | |||
| 2399 | Ga0496110_0099562 | |||
| 2400 | Ga0496110_0303371 | |||
| 2401 | Ga0496110_0317462 | |||
| 2402 | Ga0496111_0175089 | |||
| 2403 | Ga0496111_0185766 | |||
| 2404 | Ga0496111_0754909 | |||
| 2405 | Ga0496112_0035435 | |||
| 2406 | Ga0496112_0036732 | |||
| 2407 | Ga0496112_0072004 | |||
| 2408 | Ga0496112_0097007 | |||
| 2409 | Ga0496112_0769085 | |||
| 2410 | Ga0496113_0051127 | |||
| 2411 | Ga0496113_0112428 | |||
| 2412 | Ga0496113_0192923 | |||
| 2413 | Ga0496113_0365944 | |||
| 2414 | Ga0496113_0410881 | |||
| 2415 | Ga0496114_0053462 | |||
| 2416 | Ga0496114_0158287 | |||
| 2417 | Ga0496114_0204861 | |||
| 2418 | Ga0496114_0293754 | |||
| 2419 | Ga0496114_0891956 | |||
| 2420 | Ga0496114_0992713 | |||
| 2421 | Ga0496115_0004493 | |||
| 2422 | Ga0496115_0060281 | |||
| 2423 | Ga0496115_0113069 | |||
| 2424 | Ga0496115_0226455 | |||
| 2425 | Ga0496115_0289910 | |||
| 2426 | Ga0496115_0494018 | |||
| 2427 | Ga0496115_0572113 | |||
| 2428 | Ga0496115_1267033 | |||
| 2429 | Ga0496117_0014058 | |||
| 2430 | Ga0496117_0057259 | |||
| 2431 | Ga0496118_0003027 | |||
| 2432 | Ga0496118_0066793 | |||
| 2433 | Ga0496118_0157901 | |||
| 2434 | Ga0496118_0339093 | |||
| 2435 | Ga0496118_0497724 | |||
| 2436 | Ga0496119_0427137 | |||
| 2437 | Ga0496120_0213708 | |||
| 2438 | Ga0496121_0001622 | |||
| 2439 | Ga0496121_0002689 | |||
| 2440 | Ga0496121_0080207 | |||
| 2441 | Ga0496121_0162356 | |||
| 2442 | Ga0496121_0197492 | |||
| 2443 | Ga0496121_0650170 | |||
| 2444 | Ga0496124_0002957 | |||
| 2445 | Ga0496124_0199622 | |||
| 2446 | Ga0496125_0009386 | |||
| 2447 | Ga0496125_0070558 | |||
| 2448 | Ga0496125_0094685 | |||
| 2449 | Ga0496125_0179978 | |||
| 2450 | Ga0496125_0249255 | |||
| 2451 | Ga0496126_0003472 | |||
| 2452 | Ga0496126_0003803 | |||
| 2453 | Ga0496126_0228574 | |||
| 2454 | Ga0496126_0303209 | |||
| 2455 | Ga0496126_0314173 | |||
| 2456 | Ga0496126_0431003 | |||
| 2457 | Ga0496126_1178508 | |||
| 2458 | Ga0496126_1300247 | |||
| 2459 | Ga0495682_0026858 | |||
| 2460 | Ga0495682_0167279 | |||
| 2461 | Ga0495682_0213961 | |||
| 2462 | Ga0501067_0070383 | |||
| 2463 | Ga0501069_0866252 | |||
| 2464 | Ga0501071_0266307 | |||
| 2465 | Ga0501074_0687003 | |||
| 2466 | Ga0501074_0838631 | |||
| 2467 | Ga0501080_0207467 | |||
| 2468 | nmdc:mga03n38_20242_c1 | |||
| 2469 | nmdc:mga03n38_35336_c1 | |||
| 2470 | nmdc:mga03n38_528963_c1 | |||
| 2471 | nmdc:mga03n38_71183_c1 | |||
| 2472 | nmdc:mga00v17_391001_c1 | |||
| 2473 | nmdc:mga00v17_75479_c1 | |||
| 2474 | nmdc:mga0yw44_177417_c1 | |||
| 2475 | nmdc:mga0yw44_198255_c1 | |||
| 2476 | nmdc:mga0yw44_523416_c1 | |||
| 2477 | nmdc:mga0yw44_63381_c1 | |||
| 2478 | nmdc:mga0yw44_872379_c1 | |||
| 2479 | nmdc:mga0k408_100972_c1 | |||
| 2480 | nmdc:mga0k408_111125_c1 | |||
| 2481 | nmdc:mga0k408_22789_c2 | |||
| 2482 | nmdc:mga0k408_551798_c1 | |||
| 2483 | nmdc:mga06z11_203006_c1 | |||
| 2484 | nmdc:mga06z11_252947_c1 | |||
| 2485 | nmdc:mga06z11_303406_c1 | |||
| 2486 | nmdc:mga06z11_319602_c1 | |||
| 2487 | nmdc:mga06z11_366065_c1 | |||
| 2488 | nmdc:mga06z11_627_c1 | |||
| 2489 | nmdc:mga06z11_771993_c1 | |||
| 2490 | nmdc:mga04h51_127125_c1 | |||
| 2491 | nmdc:mga04h51_45473_c1 | |||
| 2492 | nmdc:mga07m45_270338_c1 | |||
| 2493 | nmdc:mga07m45_376983_c1 | |||
| 2494 | nmdc:mga07m45_57150_c1 | |||
| 2495 | nmdc:mga07m45_601019_c1 | |||
| 2496 | nmdc:mga05p37_408930_c1 | |||
| 2497 | nmdc:mga06r32_756603_c1 | |||
| 2498 | nmdc:mga08y16_1758664_c1 | |||
| 2499 | nmdc:mga08y16_406484_c1 | |||
| 2500 | nmdc:mga0n895_1354839_c1 | |||
| 2501 | nmdc:mga0n895_1860804_c1 | |||
| 2502 | nmdc:mga0n895_225827_c1 | |||
| 2503 | nmdc:mga0rr50_281033_c1 | |||
| 2504 | nmdc:mga0rr50_593145_c1 | |||
| 2505 | nmdc:mga0a205_341599_c1 | |||
| 2506 | nmdc:mga0a205_985218_c1 | |||
| 2507 | nmdc:mga0sz30_164624_c1 | |||
| 2508 | nmdc:mga0sz30_29112_c1 | |||
| 2509 | nmdc:mga0sz30_9035_c2 | |||
| 2510 | Ga0495601_0029491 | |||
| 2511 | Ga0495601_0053486 | |||
| 2512 | Ga0495601_0417342 | |||
| 2513 | Ga0495612_0416343 | |||
| 2514 | Ga0500610_0278880 | |||
| 2515 | Ga0500635_0009001 | |||
| 2516 | Ga0500635_0055437 | |||
| 2517 | Ga0500635_0160809 | |||
| 2518 | Ga0495655_0316876 | |||
| 2519 | Ga0495595_0001490 | |||
| 2520 | Ga0495619_0000912 | |||
| 2521 | Ga0495619_0083152 | |||
| 2522 | Ga0495619_0126939 | |||
| 2523 | Ga0495619_0149163 | |||
| 2524 | Ga0495619_0179641 | |||
| 2525 | Ga0500578_0040493 | |||
| 2526 | Ga0500578_0132286 | |||
| 2527 | Ga0500578_0164064 | |||
| 2528 | Ga0500578_0370913 | |||
| 2529 | Ga0500644_0314103 | |||
| 2530 | Ga0500646_0117506 | |||
| 2531 | Ga0500646_0395972 | |||
| 2532 | Ga0500647_0155616 | |||
| 2533 | Ga0500583_0260589 | |||
| 2534 | Ga0500583_0529834 | |||
| 2535 | Ga0500566_0032785 | |||
| 2536 | Ga0500566_0498272 | |||
| 2537 | Ga0500640_187383 | |||
| 2538 | Ga0500641_0005231 | |||
| 2539 | Ga0500641_0045528 | |||
| 2540 | Ga0500650_0091755 | |||
| 2541 | Ga0500556_0196097 | |||
| 2542 | Ga0500594_0045421 | |||
| 2543 | Ga0500595_006657 | |||
| 2544 | Ga0500595_020165 | |||
| 2545 | Ga0500595_167868 | |||
| 2546 | Ga0500607_114426 | |||
| 2547 | Ga0500608_060438 | |||
| 2548 | Ga0500614_039754 | |||
| 2549 | Ga0500614_066652 | |||
| 2550 | Ga0500655_009439 | |||
| 2551 | Ga0500655_010286 | |||
| 2552 | Ga0500658_0177111 | |||
| 2553 | Ga0500658_0224572 | |||
| 2554 | Ga0500559_0004946 | |||
| 2555 | Ga0500559_0076358 | |||
| 2556 | Ga0500561_0117032 | |||
| 2557 | Ga0500561_0140407 | |||
| 2558 | Ga0500564_079106 | |||
| 2559 | Ga0500573_0316081 | |||
| 2560 | Ga0500577_0338541 | |||
| 2561 | Ga0500589_102370 | |||
| 2562 | Ga0500589_155133 | |||
| 2563 | Ga0500590_059698 | |||
| 2564 | Ga0500590_129150 | |||
| 2565 | Ga0500590_136178 | |||
| 2566 | Ga0500603_000540 | |||
| 2567 | Ga0500603_048844 | |||
| 2568 | Ga0500604_0018740 | |||
| 2569 | Ga0500604_0138253 | |||
| 2570 | Ga0500620_039200 | |||
| 2571 | Ga0500622_0387210 | |||
| 2572 | Ga0500633_0050319 | |||
| 2573 | Ga0500633_0229240 | |||
| 2574 | Ga0500634_0089899 | |||
| 2575 | Ga0500634_0159268 | |||
| 2576 | Ga0500638_027293 | |||
| 2577 | Ga0500638_263500 | |||
| 2578 | Ga0500639_295253 | |||
| 2579 | Ga0500636_0014674 | |||
| 2580 | Ga0500636_0033475 | |||
| 2581 | Ga0500636_0065119 | |||
| 2582 | Ga0500636_0303953 | |||
| 2583 | Ga0500636_0342243 | |||
| 2584 | Ga0500637_0000131 | |||
| 2585 | Ga0500649_068841 | |||
| 2586 | Ga0500611_161427 | |||
| 2587 | Ga0500645_025184 | |||
| 2588 | Ga0500609_006345 | |||
| 2589 | Ga0500609_017029 | |||
| 2590 | Ga0500609_025521 | |||
| 2591 | Ga0500552_000562 | |||
| 2592 | Ga0500596_002600 | |||
| 2593 | Ga0500599_000712 | |||
| 2594 | Ga0500601_003192 | |||
| 2595 | Ga0500661_026136 | |||
| 2596 | Ga0466962_0445465 | |||
| 2597 | Ga0466962_0566392 | |||
| 2598 | Ga0530510_0518858 | |||
| 2599 | Ga0530510_0553150 | |||
| 2600 | 2513638775 | |||
| 2601 | 2513659789 | |||
| 2602 | 2513676923 | |||
| 2603 | 2513718674 | |||
| 2604 | 2513720144 | |||
| 2605 | 2513857250 | |||
| 2606 | 2513918865 | |||
| 2607 | 2517888190 | |||
| 2608 | 2524533366 | |||
| 2609 | 2671119351 | |||
| 2610 | 2728753847 | |||
| 2611 | 2793073869 | |||
| 2612 | 2885380651 | |||
| 2613 | 2885391422 | |||
| 2614 | 2903752678 | |||
| 2615 | 2903772252 | |||
| 2616 | 2904695765 | |||
| 2617 | 2904709893 | |||
| 2618 | 2906614453 | |||
| 2619 | 2906643424 | |||
| 2620 | 2906666616 | |||
| 2621 | 2908746718 | |||
| 2622 | 2908764281 | |||
| 2623 | 2922389347 | |||
| 2624 | 2922426287 | |||
| 2625 | 2935632672 | |||
| 2626 | 2941508664 | |||
| 2627 | 2941516494 | |||
| 2628 | 2941524490 | |||
| 2629 | 3005475651 | |||
| 2630 | 8006936985 | |||
| 2631 | 8006976953 | |||
| 2632 | 8019561687 | |||
| 2633 | 8019571760 | |||
| 2634 | 8019651706 | |||
| 2635 | 8056683450 | |||
| 2636 | 8056690827 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3nwz-assembly3.cif.gz_D | crystal structure of bh2602 protein from bacillus halodurans with coa, northeast structural genomics consortium target bhr199 | 0.9285 | 37 | 135 |
| 2h4u-assembly1.cif.gz_D | crystal structure of human thioesterase superfamily member 2 | 0.9232 | 26 | 134 |
| 3nwz-assembly2.cif.gz_C | crystal structure of bh2602 protein from bacillus halodurans with coa, northeast structural genomics consortium target bhr199 | 0.9224 | 36 | 135 |
| 3dkz-assembly1.cif.gz_A | crystal structure of the q7w9w5_borpa protein from bordetella parapertussis. northeast structural genomics consortium target bpr208c. | 0.9175 | 26 | 135 |
| 5ep5-assembly1.cif.gz_B | the crystal structure of the hypothetical protein sav0944 mutant (glu47ala) from staphylococcus aureus. | 0.9157 | 30 | 137 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P34419_18_155_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9295 | 26 | 135 | 3.10.129.10 |
| af_Q9M2E4_49_183_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9261 | 26 | 134 | 3.10.129.10 |
| af_Q54GL4_70_197_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9248 | 26 | 138 | 3.10.129.10 |
| 2h4uD00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9232 | 26 | 134 | 3.10.129.10 |
| af_Q9FI76_3_136_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9173 | 26 | 133 | 3.10.129.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-Q6N8X2-F1-model_v4 | Phenylacetic acid degradation-related protein | 0.9843 | 2 | 139 |
GO:0047617
|
| AF-H1SD47-F1-model_v4 | Phenylacetic acid degradation-related protein | 0.98 | 27 | 135 |
GO:0047617
|
| AF-A0A125Q6S1-F1-model_v4 | Thioesterase | 0.9773 | 2 | 142 |
GO:0047617
|
| AF-A0A257JKX7-F1-model_v4 | Thioesterase | 0.9762 | 3 | 138 |
GO:0016289
|
| AF-A0A495RQ26-F1-model_v4 | deleted | 0.9684 | 3 | 142 |
|