F492883

General Info

Members Datasets Scaffolds Average Seq Length
1312 673 990 110

Family's Representative Sequence

Representative Sequence 3300005842|Ga0068858_100365714|Ga0068858_1003657143
Length 128
Sequence MAPDMLYFYNMSNPENVPPNAISEQQDRVFRALASHHRRAILDVLRDQPLTTGALCAQFLELDRCTVMQHLKVLEAADLIIAERKGRERWNHLNPLPIHAIHERWIGPHAERAVAMLARLKHDLEKSG

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
4 2509276019 Ensifer aridi TW10 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
7 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
8 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
9 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
10 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
11 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
12 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
13 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
14 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
15 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
16 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
17 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
18 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
19 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
20 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
21 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
22 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
23 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
24 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
25 2516143018 Ensifer sp. BR816 Isolate Nodule
26 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
27 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
28 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
29 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
30 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
31 2519899620 Rhizobium sp. Pop5 Isolate Nodule
32 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
33 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
34 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
35 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
36 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
37 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
38 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
39 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
40 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
41 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
42 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
43 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
44 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
45 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
46 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
47 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
48 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
49 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
50 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
51 2643221580 Devosia sp. Root635 Isolate Unclassified
52 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
53 2643221618 Ensifer sp. Root231 Isolate Unclassified
54 2643221626 Ensifer sp. Root31 Isolate Unclassified
55 2643221640 Caulobacter sp. Root342 Isolate Unclassified
56 2643221642 Caulobacter sp. Root343 Isolate Unclassified
57 2643221655 Ensifer sp. Root1252 Isolate Unclassified
58 2643221659 Ensifer sp. Root127 Isolate Unclassified
59 2643221688 Rhizobium sp. Root482 Isolate Unclassified
60 2643221698 Ensifer sp. Root142 Isolate Unclassified
61 2643221712 Ensifer sp. Root258 Isolate Unclassified
62 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
63 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
64 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
65 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
66 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
67 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
68 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
69 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
70 2791355260 Rhizobium sp. L9 Isolate Nodule
71 2791355261 Rhizobium sp. J15 Isolate Nodule
72 2791355266 Rhizobium sp. L43 Isolate Nodule
73 2791355267 Rhizobium sp. L18 Isolate Nodule
74 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
75 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
76 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
77 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
78 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
79 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
80 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
81 2802429633 Rhizobium anhuiense J3 Isolate Nodule
82 2802429634 Rhizobium anhuiense S10 Isolate Nodule
83 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
84 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
85 2802429637 Rhizobium anhuiense C15 Isolate Nodule
86 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
87 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
88 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
89 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
90 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
91 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
92 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
93 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
94 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
95 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
96 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
97 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
98 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
99 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
100 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
101 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
102 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
103 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
104 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
105 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
106 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
107 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
108 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
109 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
110 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
111 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
112 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
113 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
114 2844163670 Ensifer sp. 1H6 Isolate Unclassified
115 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
116 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
117 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
118 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
119 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
120 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
121 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
122 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
123 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
124 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
125 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
126 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
127 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
128 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
129 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
130 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
131 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
132 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
133 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
134 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
135 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
136 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
137 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
138 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
139 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
140 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
141 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
142 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
143 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
144 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
145 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
146 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
147 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
148 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
149 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
150 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
151 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
152 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
153 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
154 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
155 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
156 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
157 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
158 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
159 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
160 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
161 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
162 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
163 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
164 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
165 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
166 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
167 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
168 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
169 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
170 2932401849 Devosia sp. 2618 Isolate Rhizosphere
171 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
172 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
173 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
174 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
175 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
176 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
177 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
178 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
179 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
180 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
181 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
182 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
183 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
184 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
185 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
186 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
187 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
188 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
189 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
190 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
191 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
192 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
193 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
194 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
195 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
196 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
197 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
198 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
199 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
200 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
201 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
202 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
203 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
204 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
205 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
206 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
207 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
208 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
209 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
210 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
211 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
212 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
213 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
214 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
215 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
216 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
217 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
218 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
219 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
220 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
221 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
222 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
223 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
224 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
225 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
226 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
227 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
228 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
229 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
230 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
231 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
232 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
233 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
234 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
235 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
236 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
237 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
238 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
239 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
240 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
241 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
242 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
243 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
244 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
245 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
246 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
247 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
248 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
249 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
250 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
251 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
252 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
253 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
254 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
255 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
256 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
257 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
258 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
259 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
260 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
261 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
262 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
263 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
264 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
265 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
266 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
267 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
268 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
269 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
270 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
271 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
272 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
273 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
274 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
275 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
276 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
277 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
278 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
279 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
280 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
281 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
282 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
283 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
284 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
285 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
286 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
287 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
288 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
289 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
290 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
291 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
292 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
293 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
294 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
295 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
296 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
297 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
298 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
299 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
300 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
301 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
302 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
303 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
304 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
305 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
306 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
307 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
308 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
309 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
310 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
311 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
312 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
313 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
314 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
315 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
316 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
317 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
318 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
319 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
320 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
321 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
322 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
323 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
324 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
325 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
326 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
327 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
328 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
329 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
330 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
331 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
332 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
333 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
334 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
335 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
336 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
337 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
338 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
339 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
340 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
341 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
342 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
343 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
344 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
345 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
346 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
347 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
348 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
349 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
350 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
351 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
352 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
353 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
354 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
355 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
356 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
357 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
358 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
359 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
360 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
361 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
362 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
363 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
364 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
365 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
366 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
367 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
368 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
369 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
370 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
371 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
372 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
373 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
374 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
375 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
376 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
377 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
378 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
379 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
380 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
381 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
382 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
383 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
384 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
385 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
386 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
387 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
388 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
389 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
390 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
391 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
392 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
393 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
394 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
395 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
396 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
397 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
398 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
399 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
400 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
401 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
402 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
403 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
404 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
405 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
406 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
407 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
408 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
409 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
410 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
411 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
412 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
413 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
414 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
415 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
416 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
417 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
418 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
419 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
420 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
421 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
422 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
423 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
424 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
425 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
426 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
427 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
428 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
429 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
430 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
431 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
432 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
433 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
434 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
435 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
436 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
437 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
438 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
439 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
440 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
441 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
442 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
443 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
444 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
445 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
446 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
447 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
448 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
449 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
450 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
451 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
452 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
453 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
454 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
455 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
456 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
457 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
458 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
459 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
460 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
461 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
462 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
463 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
464 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
465 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
466 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
467 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
468 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
469 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
470 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
471 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
472 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
473 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
474 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
475 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
476 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
477 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
478 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
479 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
480 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
481 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
482 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
483 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
484 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
485 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
486 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
487 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
488 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
489 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
490 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
491 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
492 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
493 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
494 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
495 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
496 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
497 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
498 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
499 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
500 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
501 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
502 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
503 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
504 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
505 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
506 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
507 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
508 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
509 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
510 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
511 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
512 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
513 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
514 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
515 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
516 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
517 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
518 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
519 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
520 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
521 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
522 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
523 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
524 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
525 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
526 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
527 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
528 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
529 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
530 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
531 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
532 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
533 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
534 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
535 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
536 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
537 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
538 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
539 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
540 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
541 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
542 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
543 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
544 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
545 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
546 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
547 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
548 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
549 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
550 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
551 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
552 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
553 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
554 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
555 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
556 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
557 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
558 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
559 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
560 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
561 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
562 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
563 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
564 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
565 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
566 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
567 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
568 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
569 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
570 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
571 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
572 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
573 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
574 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
575 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
576 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
577 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
578 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
579 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
580 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
581 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
582 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
583 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
584 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
585 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
586 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
587 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
588 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
589 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
590 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
591 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
592 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
593 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
594 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
595 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
596 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
597 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
598 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
599 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
600 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
601 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
602 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
603 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
604 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
605 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
606 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
607 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
608 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
609 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
610 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
611 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
612 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
613 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
614 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
615 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
616 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
617 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
618 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
619 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
620 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
621 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
622 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
623 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
624 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
625 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
626 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
627 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
628 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
629 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
630 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
631 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
632 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
633 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
634 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
635 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
636 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
637 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
638 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
639 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
640 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
641 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
642 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
643 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
644 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
645 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
646 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
647 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
648 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
649 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
650 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
651 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
652 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
653 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
654 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
655 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
656 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
657 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
658 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
659 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
660 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
661 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
662 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
663 8005382845 Rhizobium sp. R634 Isolate Nodule
664 8005395548 Rhizobium sp. R339 Isolate Nodule
665 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
666 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
667 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
668 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
669 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
670 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
671 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
672 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
673 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 75.46
Metatranscriptomes 0
Isolates 24.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.82
Nodule 22.33
Rhizoplane 1.52
Rhizosphere 60.06
Stem 0
Stem Tuber 0
Unclassified 5.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_10712157 2162886012 Bacteria 939
2 LJQas_1038148 3300000549 Unclassified 567
3 JGI24740J21852_10001351 3300001979 Bacteria 11185
4 JGI24034J26672_10118856 3300002239 Unclassified 510
5 JGI24751J29686_10031269 3300002459 Bacteria 1104
6 JGI24751J29686_10090805 3300002459 Bacteria 635
7 JGI25159J45721_1000002 3300002987 Bacteria 289163
8 JGI25151J46595_10161566 3300003187 Bacteria 526
9 JGI25165J46597_1000947 3300003214 Bacteria 19871
10 JGI25153J46596_10100412 3300003215 Bacteria 681
11 rootL2_10188392 3300003322 Bacteria 2058
12 rootH1_10287281 3300003323 Bacteria 2386
13 JGI25160J50197_1000008 3300003354 Bacteria 289163
14 JGI25161J50226_1000380 3300003374 Bacteria 22370
15 Ga0055526_1001532 3300003771 Bacteria 16363
16 Ga0055526_1020128 3300003771 Bacteria 2393
17 Ga0055524_1012523 3300003775 Bacteria 3252
18 Ga0055536_1002254 3300003781 Bacteria 10976
19 Ga0055536_1006080 3300003781 Bacteria 5721
20 Ga0055536_1009138 3300003781 Bacteria 4149
21 Ga0055528_1000695 3300003790 Bacteria 23949
22 Ga0055530_10001655 3300003791 Bacteria 15864
23 Ga0055530_10028298 3300003791 Bacteria 1515
24 Ga0055540_1000752 3300003792 Bacteria 21989
25 Ga0055531_10000858 3300003794 Bacteria 24934
26 Ga0055531_10001722 3300003794 Bacteria 15672
27 Ga0055531_10021163 3300003794 Bacteria 2537
28 Ga0055531_10026168 3300003794 Bacteria 2090
29 Ga0055531_10042449 3300003794 Bacteria 1300
30 Ga0055543_1001421 3300004625 Bacteria 9510
31 Ga0065165_1000015 3300005262 Bacteria 289201
32 Ga0065704_10095207 3300005289 Unclassified 2500
33 Ga0065704_10290897 3300005289 Bacteria 904
34 Ga0065712_10072765 3300005290 Bacteria 4625
35 Ga0065715_10070852 3300005293 Bacteria 735
36 Ga0065715_10115519 3300005293 Bacteria 2412
37 Ga0065715_10233704 3300005293 Bacteria 1224
38 Ga0065715_10448940 3300005293 Bacteria 821
39 Ga0065707_10190157 3300005295 Bacteria 1366
40 Ga0070658_10024500 3300005327 Bacteria 4840
41 Ga0070658_10031287 3300005327 Bacteria 4273
42 Ga0070676_10064522 3300005328 Bacteria 2184
43 Ga0070676_10119508 3300005328 Bacteria 1652
44 Ga0070676_10748776 3300005328 Bacteria 717
45 Ga0070683_102442811 3300005329 Bacteria 501
46 Ga0070670_100000350 3300005331 Bacteria 38698
47 Ga0070670_100010030 3300005331 Bacteria 8084
48 Ga0070670_100021035 3300005331 Bacteria 5610
49 Ga0070670_100039511 3300005331 Bacteria 4057
50 Ga0070670_100087996 3300005331 Bacteria 2670
51 Ga0070670_100380736 3300005331 Bacteria 1243
52 Ga0070670_100508862 3300005331 Bacteria 1071
53 Ga0070677_10000600 3300005333 Bacteria 12160
54 Ga0070677_10037260 3300005333 Bacteria 1896
55 Ga0070677_10039893 3300005333 Bacteria 1845
56 Ga0070677_10333296 3300005333 Bacteria 781
57 Ga0070677_10788663 3300005333 Bacteria 542
58 Ga0068869_100300833 3300005334 Unclassified 1295
59 Ga0068869_100626883 3300005334 Bacteria 911
60 Ga0068869_100856082 3300005334 Bacteria 784
61 Ga0068869_100898790 3300005334 Bacteria 766
62 Ga0068869_101021888 3300005334 Bacteria 720
63 Ga0068868_100698703 3300005338 Bacteria 907
64 Ga0068868_101436812 3300005338 Bacteria 644
65 Ga0070660_100060990 3300005339 Bacteria 2928
66 Ga0070660_100121687 3300005339 Bacteria 2083
67 Ga0070660_100535787 3300005339 Bacteria 976
68 Ga0070660_100935085 3300005339 Bacteria 732
69 Ga0070660_101513291 3300005339 Bacteria 571
70 Ga0070689_101453634 3300005340 Bacteria 620
71 Ga0070689_101510986 3300005340 Bacteria 608
72 Ga0070691_10664597 3300005341 Bacteria 622
73 Ga0070687_100858606 3300005343 Bacteria 648
74 Ga0070661_100120387 3300005344 Bacteria 1966
75 Ga0070661_100123269 3300005344 Bacteria 1942
76 Ga0070668_100024369 3300005347 Bacteria 4584
77 Ga0070668_100027061 3300005347 Bacteria 4352
78 Ga0070668_100029010 3300005347 Bacteria 4200
79 Ga0070668_100038020 3300005347 Bacteria 3677
80 Ga0070669_100009774 3300005353 Bacteria 6832
81 Ga0070669_100044937 3300005353 Bacteria 3218
82 Ga0070669_100173670 3300005353 Bacteria 1682
83 Ga0070669_100307933 3300005353 Bacteria 1276
84 Ga0070675_100001857 3300005354 Bacteria 15581
85 Ga0070675_100002352 3300005354 Bacteria 14063
86 Ga0070675_100078800 3300005354 Bacteria 2744
87 Ga0070675_100107929 3300005354 Bacteria 2351
88 Ga0070671_100001032 3300005355 Bacteria 20490
89 Ga0070671_100164090 3300005355 Bacteria 1878
90 Ga0070671_100715480 3300005355 Bacteria 869
91 Ga0070671_100923306 3300005355 Bacteria 763
92 Ga0070674_100003913 3300005356 Bacteria 8432
93 Ga0070674_100020755 3300005356 Bacteria 4205
94 Ga0070674_100027251 3300005356 Bacteria 3743
95 Ga0070674_100073539 3300005356 Bacteria 2423
96 Ga0070674_100701752 3300005356 Bacteria 865
97 Ga0070673_100051731 3300005364 Bacteria 3219
98 Ga0070673_100517358 3300005364 Bacteria 1081
99 Ga0070673_101017085 3300005364 Bacteria 772
100 Ga0070659_100064992 3300005366 Bacteria 2889
101 Ga0070659_100071386 3300005366 Bacteria 2761
102 Ga0070659_100146835 3300005366 Bacteria 1922
103 Ga0070659_100607835 3300005366 Bacteria 940
104 Ga0070659_100849206 3300005366 Bacteria 796
105 Ga0070659_102143984 3300005366 Bacteria 503
106 Ga0070667_100065993 3300005367 Bacteria 3074
107 Ga0070667_100236010 3300005367 Bacteria 1632
108 Ga0070700_100088525 3300005441 Bacteria 2015
109 Ga0070663_100020031 3300005455 Bacteria 4421
110 Ga0070663_100224813 3300005455 Bacteria 1475
111 Ga0070663_100338937 3300005455 Bacteria 1214
112 Ga0070678_101486152 3300005456 Bacteria 634
113 Ga0070678_101636009 3300005456 Bacteria 605
114 Ga0070678_102173511 3300005456 Bacteria 526
115 Ga0070662_100002989 3300005457 Bacteria 10511
116 Ga0070662_100019821 3300005457 Bacteria 4573
117 Ga0070662_100027985 3300005457 Bacteria 3919
118 Ga0070662_100366589 3300005457 Bacteria 1183
119 Ga0070662_100374457 3300005457 Bacteria 1171
120 Ga0070662_100529236 3300005457 Bacteria 986
121 Ga0070662_100875549 3300005457 Bacteria 766
122 Ga0070662_101641616 3300005457 Bacteria 555
123 Ga0068867_100374909 3300005459 Bacteria 1194
124 Ga0068867_100433368 3300005459 Bacteria 1116
125 Ga0068867_101915762 3300005459 Bacteria 559
126 Ga0070685_11056339 3300005466 Bacteria 612
127 Ga0070679_100252500 3300005530 Bacteria 1719
128 Ga0070679_100981335 3300005530 Bacteria 789
129 Ga0068853_100046888 3300005539 Bacteria 3708
130 Ga0068853_100458275 3300005539 Bacteria 1200
131 Ga0068853_100851270 3300005539 Bacteria 875
132 Ga0070672_100005437 3300005543 Bacteria 8443
133 Ga0070672_100017512 3300005543 Bacteria 5160
134 Ga0070672_100098073 3300005543 Bacteria 2373
135 Ga0070672_100169097 3300005543 Bacteria 1817
136 Ga0070672_100371321 3300005543 Bacteria 1222
137 Ga0070672_101968869 3300005543 Bacteria 526
138 Ga0070696_101123912 3300005546 Bacteria 661
139 Ga0070665_100132453 3300005548 Bacteria 2495
140 Ga0068855_100103093 3300005563 Bacteria 3283
141 Ga0068855_100174964 3300005563 Bacteria 2429
142 Ga0068855_100270918 3300005563 Bacteria 1888
143 Ga0070664_100004435 3300005564 Bacteria 11273
144 Ga0070664_100094460 3300005564 Bacteria 2593
145 Ga0070664_101054141 3300005564 Bacteria 765
146 Ga0068857_100045180 3300005577 Bacteria 3907
147 Ga0068854_100199288 3300005578 Bacteria 1573
148 Ga0068854_100225001 3300005578 Bacteria 1486
149 Ga0068856_100103731 3300005614 Bacteria 2837
150 Ga0068859_100523410 3300005617 Bacteria 1281
151 Ga0068864_100035579 3300005618 Bacteria 4240
152 Ga0068864_100545028 3300005618 Bacteria 1120
153 Ga0068864_101211167 3300005618 Bacteria 754
154 Ga0068864_101612833 3300005618 Bacteria 653
155 Ga0068866_10391222 3300005718 Bacteria 894
156 Ga0068861_100231708 3300005719 Bacteria 1567
157 Ga0068861_100847870 3300005719 Bacteria 861
158 Ga0068851_10099229 3300005834 Bacteria 1543
159 Ga0068863_102369896 3300005841 Bacteria 540
160 Ga0068863_102433682 3300005841 Bacteria 533
161 Ga0068858_100365714 3300005842 Bacteria 1383
162 Ga0068858_100747326 3300005842 Bacteria 953
163 Ga0068862_100016627 3300005844 Bacteria 6125
164 Ga0068862_100092388 3300005844 Bacteria 2638
165 Ga0068862_100322624 3300005844 Bacteria 1426
166 Ga0068862_100978530 3300005844 Bacteria 836
167 Ga0068862_101064551 3300005844 Bacteria 802
168 Ga0081455_10244360 3300005937 Bacteria 1317
169 Ga0075365_10001615 3300006038 Bacteria 10391
170 Ga0075365_10006228 3300006038 Bacteria 6542
171 Ga0075365_11007149 3300006038 Bacteria 587
172 Ga0075368_10000318 3300006042 Bacteria 14124
173 Ga0075363_100004443 3300006048 Bacteria 6138
174 Ga0075363_100153476 3300006048 Bacteria 1301
175 Ga0075363_100562892 3300006048 Bacteria 681
176 Ga0075364_10015285 3300006051 Bacteria 4759
177 Ga0075362_10003383 3300006177 Bacteria 5563
178 Ga0075367_10002472 3300006178 Bacteria 8461
179 Ga0075369_10019278 3300006186 Bacteria 2784
180 Ga0075369_10196062 3300006186 Bacteria 931
181 Ga0075369_10389580 3300006186 Bacteria 656
182 Ga0075369_10390163 3300006186 Bacteria 656
183 Ga0075369_10391814 3300006186 Bacteria 654
184 Ga0075366_10153572 3300006195 Bacteria 1394
185 Ga0075366_10809815 3300006195 Bacteria 583
186 Ga0075370_10018867 3300006353 Bacteria 3746
187 Ga0075370_10048468 3300006353 Bacteria 2407
188 Ga0075370_10052920 3300006353 Bacteria 2304
189 Ga0075370_10272970 3300006353 Bacteria 1004
190 Ga0075370_10276764 3300006353 Bacteria 997
191 Ga0075370_10501920 3300006353 Bacteria 732
192 Ga0075428_100676383 3300006844 Bacteria 1100
193 Ga0075431_101097603 3300006847 Bacteria 760
194 Ga0075429_100705294 3300006880 Bacteria 884
195 Ga0075429_101612913 3300006880 Bacteria 564
196 Ga0068865_101821536 3300006881 Bacteria 550
197 Ga0097620_100523434 3300006931 Bacteria 1281
198 Ga0079104_1035919 3300006946 Bacteria 1193
199 Ga0079104_1061617 3300006946 Bacteria 807
200 Ga0111539_10176032 3300009094 Bacteria 2499
201 Ga0111539_10568661 3300009094 Bacteria 1320
202 Ga0111539_10870883 3300009094 Bacteria 1048
203 Ga0111539_11142217 3300009094 Unclassified 905
204 Ga0105245_11074055 3300009098 Bacteria 851
205 Ga0105245_12896207 3300009098 Bacteria 532
206 Ga0114129_12047192 3300009147 Bacteria 692
207 Ga0105243_10129286 3300009148 Bacteria 2141
208 Ga0105243_11069571 3300009148 Bacteria 813
209 Ga0105241_10437784 3300009174 Bacteria 1154
210 Ga0105248_10043271 3300009177 Bacteria 5050
211 Ga0105237_10141188 3300009545 Bacteria 2403
212 Ga0105237_10259227 3300009545 Bacteria 1741
213 Ga0105238_10022705 3300009551 Bacteria 6395
214 Ga0105238_10089554 3300009551 Bacteria 3064
215 Ga0105249_10073177 3300009553 Bacteria 3170
216 Ga0105239_10122221 3300010375 Bacteria 2893
217 Ga0105239_10257858 3300010375 Bacteria 1959
218 Ga0105239_10539227 3300010375 Bacteria 1328
219 Ga0105239_11332316 3300010375 Bacteria 828
220 Ga0105246_10794202 3300011119 Bacteria 839
221 Ga0105246_11870196 3300011119 Bacteria 575
222 Ga0157319_1000957 3300012497 Bacteria 1397
223 Ga0157371_10354253 3300013102 Bacteria 1069
224 Ga0157370_10124553 3300013104 Bacteria 2406
225 Ga0157370_10920463 3300013104 Bacteria 793
226 Ga0157369_10021987 3300013105 Bacteria 7128
227 Ga0171463_1001 3300013249 Bacteria 1406070
228 Ga0157374_10234791 3300013296 Bacteria 1802
229 Ga0157374_10382641 3300013296 Bacteria 1402
230 Ga0157378_10517297 3300013297 Bacteria 1194
231 Ga0157378_10668493 3300013297 Bacteria 1056
232 Ga0157378_11457143 3300013297 Bacteria 728
233 Ga0163162_10108677 3300013306 Bacteria 2870
234 Ga0163162_10413313 3300013306 Bacteria 1481
235 Ga0157372_10044754 3300013307 Bacteria 4906
236 Ga0157372_10154906 3300013307 Bacteria 2646
237 Ga0157375_10036695 3300013308 Bacteria 4690
238 Ga0157375_10067258 3300013308 Bacteria 3580
239 Ga0157375_10978857 3300013308 Bacteria 986
240 Ga0157375_11129954 3300013308 Bacteria 918
241 Ga0157375_11835192 3300013308 Bacteria 719
242 Ga0163163_10671575 3300014325 Bacteria 1100
243 Ga0163163_10795752 3300014325 Bacteria 1009
244 Ga0163163_10956203 3300014325 Bacteria 920
245 Ga0157380_10022038 3300014326 Bacteria 4787
246 Ga0157380_10033633 3300014326 Bacteria 3949
247 Ga0157380_10036570 3300014326 Bacteria 3800
248 Ga0157380_10568009 3300014326 Bacteria 1116
249 Ga0157380_10628741 3300014326 Bacteria 1067
250 Ga0157380_10632682 3300014326 Bacteria 1064
251 Ga0157380_11382439 3300014326 Bacteria 754
252 Ga0157380_11660983 3300014326 Bacteria 696
253 Ga0157380_12094252 3300014326 Bacteria 629
254 Ga0183365_12031 3300015684 Bacteria 729
255 Ga0183363_1371 3300015690 Bacteria 4706
256 Ga0163161_10049520 3300017792 Bacteria 3036
257 Ga0163161_10086971 3300017792 Bacteria 2308
258 Ga0163161_10120473 3300017792 Bacteria 1971
259 Ga0163161_11524446 3300017792 Bacteria 587
260 Ga0214544_1009397 3300021320 Bacteria 15366
261 Ga0214542_1000006 3300021321 Bacteria 345164
262 Ga0214542_1016019 3300021321 Bacteria 7491
263 Ga0214543_1000003 3300021327 Bacteria 692327
264 Ga0214543_1000014 3300021327 Bacteria 324986
265 Ga0228711_1000001 3300022739 Bacteria 357377
266 Ga0228710_1000001 3300022740 Bacteria 314328
267 Ga0209436_103040 3300025208 Bacteria 4638
268 Ga0207427_109513 3300025231 Bacteria 1042
269 Ga0209437_100197 3300025233 Bacteria 120813
270 Ga0209233_1000199 3300025261 Bacteria 123684
271 Ga0209673_1000060 3300025273 Bacteria 263602
272 Ga0209673_1001334 3300025273 Bacteria 24685
273 Ga0209130_1000007 3300025284 Bacteria 591584
274 Ga0209130_1020116 3300025284 Bacteria 1533
275 Ga0209675_1000196 3300025291 Bacteria 65422
276 Ga0209676_1000518 3300025292 Bacteria 60512
277 Ga0209676_1000554 3300025292 Bacteria 56925
278 Ga0209676_1000901 3300025292 Bacteria 37489
279 Ga0209676_1000929 3300025292 Bacteria 36184
280 Ga0209676_1020890 3300025292 Bacteria 2210
281 Ga0209676_1030163 3300025292 Bacteria 1662
282 Ga0209025_1000100 3300025294 Bacteria 229182
283 Ga0209025_1006572 3300025294 Bacteria 8964
284 Ga0209025_1030058 3300025294 Bacteria 2610
285 Ga0209025_1059964 3300025294 Bacteria 1432
286 Ga0209564_1000116 3300025295 Bacteria 207889
287 Ga0209564_1000439 3300025295 Bacteria 71637
288 Ga0209758_1002301 3300025297 Bacteria 19751
289 Ga0209758_1025297 3300025297 Bacteria 2609
290 Ga0209758_1033930 3300025297 Bacteria 2040
291 Ga0209050_1000017 3300025298 Bacteria 728928
292 Ga0209050_1001222 3300025298 Bacteria 29857
293 Ga0209050_1008085 3300025298 Bacteria 5710
294 Ga0209050_1009017 3300025298 Bacteria 5194
295 Ga0209050_1021935 3300025298 Bacteria 2307
296 Ga0209050_1029701 3300025298 Bacteria 1741
297 Ga0209050_1067080 3300025298 Bacteria 819
298 Ga0209256_1000302 3300025299 Bacteria 86634
299 Ga0209256_1001410 3300025299 Bacteria 24985
300 Ga0209256_1001505 3300025299 Bacteria 23627
301 Ga0207426_1000064 3300025302 Bacteria 358276
302 Ga0209051_1000217 3300025303 Bacteria 97218
303 Ga0209051_1001024 3300025303 Bacteria 26621
304 Ga0209051_1002714 3300025303 Bacteria 12314
305 Ga0209257_1001405 3300025304 Bacteria 28723
306 Ga0209257_1002894 3300025304 Bacteria 15934
307 Ga0209257_1004371 3300025304 Bacteria 10994
308 Ga0209257_1005509 3300025304 Bacteria 8841
309 Ga0209257_1006913 3300025304 Bacteria 7096
310 Ga0209257_1032597 3300025304 Bacteria 1649
311 Ga0209257_1069401 3300025304 Bacteria 933
312 Ga0209257_1104677 3300025304 Bacteria 684
313 Ga0207697_10003012 3300025315 Bacteria 8476
314 Ga0207697_10181534 3300025315 Bacteria 922
315 Ga0207697_10193631 3300025315 Bacteria 893
316 Ga0207682_10002530 3300025893 Bacteria 8177
317 Ga0207682_10059152 3300025893 Bacteria 1601
318 Ga0207682_10425647 3300025893 Bacteria 628
319 Ga0207688_10050599 3300025901 Bacteria 2326
320 Ga0207688_10372485 3300025901 Bacteria 882
321 Ga0207645_10005867 3300025907 Bacteria 8845
322 Ga0207645_10100033 3300025907 Bacteria 1870
323 Ga0207645_10381462 3300025907 Bacteria 946
324 Ga0207645_10896506 3300025907 Bacteria 602
325 Ga0207705_10001064 3300025909 Bacteria 22327
326 Ga0207705_10067557 3300025909 Bacteria 2587
327 Ga0207705_10073195 3300025909 Bacteria 2486
328 Ga0207695_10157189 3300025913 Bacteria 2208
329 Ga0207671_10589513 3300025914 Bacteria 886
330 Ga0207657_10015490 3300025919 Bacteria 7386
331 Ga0207657_10123293 3300025919 Bacteria 2130
332 Ga0207657_10237211 3300025919 Bacteria 1457
333 Ga0207657_10359041 3300025919 Bacteria 1149
334 Ga0207657_10580238 3300025919 Bacteria 876
335 Ga0207649_10007890 3300025920 Bacteria 5792
336 Ga0207649_10105896 3300025920 Bacteria 1870
337 Ga0207649_10631175 3300025920 Bacteria 826
338 Ga0207649_10854948 3300025920 Bacteria 712
339 Ga0207652_10006724 3300025921 Bacteria 9266
340 Ga0207652_10068552 3300025921 Bacteria 3078
341 Ga0207681_10005401 3300025923 Bacteria 7849
342 Ga0207681_10114929 3300025923 Bacteria 1964
343 Ga0207681_10191695 3300025923 Bacteria 1564
344 Ga0207681_10437430 3300025923 Bacteria 1062
345 Ga0207681_10475544 3300025923 Bacteria 1020
346 Ga0207681_10906585 3300025923 Bacteria 738
347 Ga0207681_11481303 3300025923 Bacteria 569
348 Ga0207650_10000916 3300025925 Bacteria 22264
349 Ga0207650_10004697 3300025925 Bacteria 9334
350 Ga0207650_10017569 3300025925 Bacteria 5009
351 Ga0207650_10041076 3300025925 Bacteria 3387
352 Ga0207650_10141041 3300025925 Bacteria 1894
353 Ga0207650_10164481 3300025925 Bacteria 1760
354 Ga0207650_10251599 3300025925 Bacteria 1431
355 Ga0207659_10002256 3300025926 Bacteria 11474
356 Ga0207659_10005898 3300025926 Bacteria 7478
357 Ga0207659_10049103 3300025926 Bacteria 2991
358 Ga0207659_10085347 3300025926 Bacteria 2345
359 Ga0207687_11196681 3300025927 Bacteria 653
360 Ga0207644_10009825 3300025931 Bacteria 6293
361 Ga0207644_10604869 3300025931 Bacteria 910
362 Ga0207644_11117396 3300025931 Bacteria 662
363 Ga0207644_11681229 3300025931 Bacteria 532
364 Ga0207690_10037801 3300025932 Bacteria 3137
365 Ga0207690_10198044 3300025932 Bacteria 1523
366 Ga0207690_10215011 3300025932 Bacteria 1468
367 Ga0207690_11229462 3300025932 Bacteria 626
368 Ga0207706_10045319 3300025933 Bacteria 3897
369 Ga0207706_10088024 3300025933 Bacteria 2731
370 Ga0207706_10247681 3300025933 Bacteria 1557
371 Ga0207706_10311009 3300025933 Bacteria 1372
372 Ga0207706_10323824 3300025933 Bacteria 1341
373 Ga0207706_10501988 3300025933 Bacteria 1047
374 Ga0207706_10599913 3300025933 Bacteria 946
375 Ga0207706_10746090 3300025933 Bacteria 834
376 Ga0207706_10776213 3300025933 Bacteria 815
377 Ga0207709_10154504 3300025935 Bacteria 1593
378 Ga0207669_10036896 3300025937 Bacteria 2798
379 Ga0207669_10037527 3300025937 Bacteria 2781
380 Ga0207669_10075641 3300025937 Bacteria 2134
381 Ga0207669_10344178 3300025937 Bacteria 1149
382 Ga0207669_10516271 3300025937 Bacteria 959
383 Ga0207669_10578841 3300025937 Bacteria 910
384 Ga0207669_10645267 3300025937 Bacteria 865
385 Ga0207691_10006503 3300025940 Bacteria 11284
386 Ga0207691_10015470 3300025940 Bacteria 7253
387 Ga0207691_10146413 3300025940 Bacteria 2079
388 Ga0207691_11546050 3300025940 Bacteria 541
389 Ga0207711_10101908 3300025941 Bacteria 2541
390 Ga0207661_11566308 3300025944 Bacteria 603
391 Ga0207679_10015840 3300025945 Bacteria 4995
392 Ga0207679_10047566 3300025945 Bacteria 3117
393 Ga0207679_10137679 3300025945 Bacteria 1968
394 Ga0207679_10257464 3300025945 Bacteria 1487
395 Ga0207679_10916415 3300025945 Bacteria 802
396 Ga0207667_10004509 3300025949 Bacteria 17062
397 Ga0207667_10068990 3300025949 Bacteria 3680
398 Ga0207651_10040548 3300025960 Bacteria 3082
399 Ga0207651_10372654 3300025960 Bacteria 1208
400 Ga0207651_10706277 3300025960 Bacteria 889
401 Ga0207651_10782897 3300025960 Bacteria 845
402 Ga0207712_10026570 3300025961 Bacteria 3858
403 Ga0207712_10317656 3300025961 Bacteria 1284
404 Ga0207668_10019850 3300025972 Bacteria 4258
405 Ga0207668_10051999 3300025972 Bacteria 2833
406 Ga0207668_10053537 3300025972 Bacteria 2797
407 Ga0207668_10126134 3300025972 Bacteria 1947
408 Ga0207640_10130945 3300025981 Bacteria 1813
409 Ga0207640_10216336 3300025981 Bacteria 1464
410 Ga0207658_10065281 3300025986 Bacteria 2733
411 Ga0207658_10082351 3300025986 Bacteria 2471
412 Ga0207658_10088112 3300025986 Bacteria 2399
413 Ga0207639_10228607 3300026041 Bacteria 1611
414 Ga0207639_10326200 3300026041 Bacteria 1364
415 Ga0207639_11254500 3300026041 Bacteria 696
416 Ga0207678_10080942 3300026067 Bacteria 2780
417 Ga0207678_10112545 3300026067 Bacteria 2322
418 Ga0207678_10164279 3300026067 Bacteria 1896
419 Ga0207678_10298226 3300026067 Bacteria 1385
420 Ga0207678_10598340 3300026067 Bacteria 967
421 Ga0207678_10616878 3300026067 Bacteria 951
422 Ga0207708_10149073 3300026075 Bacteria 1840
423 Ga0207708_10494553 3300026075 Bacteria 1024
424 Ga0207702_10489169 3300026078 Bacteria 1198
425 Ga0207702_11310573 3300026078 Bacteria 718
426 Ga0207648_10223064 3300026089 Bacteria 1675
427 Ga0207676_10037982 3300026095 Bacteria 3674
428 Ga0207676_10084122 3300026095 Bacteria 2593
429 Ga0207676_10909574 3300026095 Bacteria 863
430 Ga0207674_10155258 3300026116 Bacteria 2244
431 Ga0207674_10317937 3300026116 Bacteria 1506
432 Ga0207674_10354615 3300026116 Bacteria 1418
433 Ga0207675_100036255 3300026118 Bacteria 4601
434 Ga0207675_100913085 3300026118 Bacteria 895
435 Ga0207698_10172821 3300026142 Bacteria 1905
436 Ga0207698_11035642 3300026142 Bacteria 832
437 Ga0209281_1000164 3300027111 Bacteria 157372
438 Ga0209281_1000332 3300027111 Bacteria 81534
439 Ga0209281_1026144 3300027111 Bacteria 1082
440 Ga0209282_1000007 3300027666 Bacteria 254917
441 Ga0209813_10000060 3300027866 Bacteria 44068
442 Ga0207428_10893559 3300027907 Bacteria 628
443 Ga0268266_10137298 3300028379 Bacteria 2191
444 Ga0268266_10291785 3300028379 Bacteria 1519
445 Ga0268266_10615116 3300028379 Bacteria 1044
446 Ga0268265_10003419 3300028380 Bacteria 11426
447 Ga0268265_10029713 3300028380 Bacteria 3928
448 Ga0268265_10088850 3300028380 Bacteria 2463
449 Ga0268265_10211716 3300028380 Bacteria 1689
450 Ga0268265_10337359 3300028380 Bacteria 1371
451 Ga0268265_10988257 3300028380 Bacteria 831
452 Ga0268265_11027405 3300028380 Bacteria 815
453 Ga0307517_10663691 3300028786 Bacteria 506
454 Ga0316183_1130216 3300030742 Bacteria 1152
455 Ga0316182_1057985 3300030745 Bacteria 1542
456 Ga0316182_1346917 3300030745 Bacteria 545
457 Ga0265327_10205876 3300031251 Bacteria 889
458 Ga0307408_100014062 3300031548 Bacteria 5316
459 Ga0307408_100014343 3300031548 Bacteria 5264
460 Ga0307408_100051353 3300031548 Bacteria 2970
461 Ga0307408_100205582 3300031548 Bacteria 1597
462 Ga0307408_100284185 3300031548 Bacteria 1379
463 Ga0307408_100506918 3300031548 Bacteria 1057
464 Ga0307408_100940828 3300031548 Bacteria 793
465 Ga0307408_100978124 3300031548 Bacteria 779
466 Ga0307408_101310604 3300031548 Unclassified 679
467 Ga0307508_10617556 3300031616 Bacteria 687
468 Ga0307405_10028431 3300031731 Bacteria 3256
469 Ga0307405_10150063 3300031731 Bacteria 1637
470 Ga0307405_10171440 3300031731 Bacteria 1548
471 Ga0307405_10175716 3300031731 Bacteria 1532
472 Ga0307405_10218556 3300031731 Bacteria 1396
473 Ga0307405_10237047 3300031731 Bacteria 1349
474 Ga0307405_10450756 3300031731 Bacteria 1020
475 Ga0307405_10478248 3300031731 Bacteria 994
476 Ga0307405_10532523 3300031731 Bacteria 947
477 Ga0307405_10552705 3300031731 Bacteria 932
478 Ga0307405_10654518 3300031731 Bacteria 864
479 Ga0307405_10991783 3300031731 Bacteria 716
480 Ga0307405_11077023 3300031731 Bacteria 690
481 Ga0307405_11159996 3300031731 Bacteria 666
482 Ga0307405_11937040 3300031731 Bacteria 526
483 Ga0307405_11973666 3300031731 Bacteria 522
484 Ga0307413_10007256 3300031824 Bacteria 5130
485 Ga0307413_10008368 3300031824 Bacteria 4880
486 Ga0307413_10010474 3300031824 Bacteria 4500
487 Ga0307413_10019834 3300031824 Bacteria 3562
488 Ga0307413_10022551 3300031824 Bacteria 3395
489 Ga0307413_10027919 3300031824 Bacteria 3135
490 Ga0307413_10043051 3300031824 Bacteria 2658
491 Ga0307413_10098545 3300031824 Bacteria 1925
492 Ga0307413_10111022 3300031824 Bacteria 1835
493 Ga0307413_10138431 3300031824 Bacteria 1678
494 Ga0307413_10178685 3300031824 Bacteria 1510
495 Ga0307413_10286121 3300031824 Bacteria 1242
496 Ga0307413_10316911 3300031824 Bacteria 1190
497 Ga0307413_10329468 3300031824 Bacteria 1170
498 Ga0307413_10370861 3300031824 Bacteria 1112
499 Ga0307413_10560691 3300031824 Bacteria 928
500 Ga0307413_10728860 3300031824 Bacteria 826
501 Ga0307413_11162028 3300031824 Bacteria 669
502 Ga0307413_11438799 3300031824 Bacteria 607
503 Ga0307413_11877905 3300031824 Bacteria 538
504 Ga0307410_10001306 3300031852 Bacteria 11134
505 Ga0307410_10002517 3300031852 Bacteria 8864
506 Ga0307410_10006279 3300031852 Bacteria 6401
507 Ga0307410_10016162 3300031852 Bacteria 4444
508 Ga0307410_10023487 3300031852 Bacteria 3834
509 Ga0307410_10025207 3300031852 Bacteria 3727
510 Ga0307410_10026018 3300031852 Bacteria 3678
511 Ga0307410_10073764 3300031852 Bacteria 2374
512 Ga0307410_10074789 3300031852 Bacteria 2360
513 Ga0307410_10075397 3300031852 Bacteria 2351
514 Ga0307410_10084136 3300031852 Bacteria 2242
515 Ga0307410_10085590 3300031852 Bacteria 2225
516 Ga0307410_10096733 3300031852 Bacteria 2108
517 Ga0307410_10127116 3300031852 Bacteria 1867
518 Ga0307410_10140780 3300031852 Bacteria 1784
519 Ga0307410_10187292 3300031852 Bacteria 1571
520 Ga0307410_10392738 3300031852 Bacteria 1119
521 Ga0307410_10422442 3300031852 Bacteria 1081
522 Ga0307410_10499925 3300031852 Bacteria 1000
523 Ga0307410_10557598 3300031852 Bacteria 950
524 Ga0307410_10672132 3300031852 Bacteria 870
525 Ga0307410_10710187 3300031852 Bacteria 848
526 Ga0307410_10781805 3300031852 Bacteria 810
527 Ga0307410_11357223 3300031852 Bacteria 623
528 Ga0307410_11860803 3300031852 Bacteria 535
529 Ga0307406_10042227 3300031901 Bacteria 2846
530 Ga0307406_10042588 3300031901 Bacteria 2835
531 Ga0307406_10056261 3300031901 Bacteria 2518
532 Ga0307406_10099950 3300031901 Bacteria 1973
533 Ga0307406_10198552 3300031901 Bacteria 1474
534 Ga0307406_10284792 3300031901 Bacteria 1262
535 Ga0307406_10310536 3300031901 Unclassified 1215
536 Ga0307406_10359750 3300031901 Bacteria 1140
537 Ga0307406_10404327 3300031901 Bacteria 1083
538 Ga0307406_10405980 3300031901 Bacteria 1081
539 Ga0307406_10451414 3300031901 Bacteria 1031
540 Ga0307406_10544977 3300031901 Bacteria 948
541 Ga0307406_10793946 3300031901 Bacteria 798
542 Ga0307406_10951626 3300031901 Bacteria 734
543 Ga0307406_11047220 3300031901 Bacteria 702
544 Ga0307406_11144917 3300031901 Bacteria 673
545 Ga0307406_11200408 3300031901 Bacteria 659
546 Ga0307406_11201478 3300031901 Bacteria 658
547 Ga0307407_10002403 3300031903 Bacteria 7314
548 Ga0307407_10030175 3300031903 Bacteria 2922
549 Ga0307407_10284270 3300031903 Bacteria 1147
550 Ga0307407_10329137 3300031903 Bacteria 1075
551 Ga0307407_10333136 3300031903 Bacteria 1069
552 Ga0307407_10339967 3300031903 Bacteria 1059
553 Ga0307407_10342885 3300031903 Bacteria 1055
554 Ga0307407_10384831 3300031903 Bacteria 1002
555 Ga0307407_10557376 3300031903 Bacteria 848
556 Ga0307407_10594231 3300031903 Bacteria 823
557 Ga0307407_10758836 3300031903 Bacteria 735
558 Ga0307407_10923648 3300031903 Bacteria 671
559 Ga0307407_10948066 3300031903 Bacteria 662
560 Ga0307412_10019162 3300031911 Bacteria 4136
561 Ga0307412_10030284 3300031911 Bacteria 3406
562 Ga0307412_10046470 3300031911 Bacteria 2845
563 Ga0307412_10046997 3300031911 Bacteria 2832
564 Ga0307412_10053016 3300031911 Bacteria 2688
565 Ga0307412_10159729 3300031911 Bacteria 1673
566 Ga0307412_10308610 3300031911 Bacteria 1253
567 Ga0307412_10342024 3300031911 Bacteria 1198
568 Ga0307412_10382225 3300031911 Bacteria 1140
569 Ga0307412_10434754 3300031911 Bacteria 1077
570 Ga0307412_10483313 3300031911 Bacteria 1027
571 Ga0307412_10580729 3300031911 Bacteria 946
572 Ga0307412_10771205 3300031911 Bacteria 832
573 Ga0307412_10863175 3300031911 Bacteria 790
574 Ga0307412_11060993 3300031911 Bacteria 719
575 Ga0307412_11220739 3300031911 Bacteria 674
576 Ga0307412_11442023 3300031911 Bacteria 624
577 Ga0307412_11501969 3300031911 Unclassified 612
578 Ga0307412_11557808 3300031911 Bacteria 602
579 Ga0315914_1000006 3300031967 Bacteria 239817
580 Ga0307409_100000217 3300031995 Bacteria 22986
581 Ga0307409_100004848 3300031995 Bacteria 7639
582 Ga0307409_100035151 3300031995 Bacteria 3668
583 Ga0307409_100036117 3300031995 Bacteria 3628
584 Ga0307409_100082523 3300031995 Bacteria 2602
585 Ga0307409_100108162 3300031995 Bacteria 2325
586 Ga0307409_100135464 3300031995 Bacteria 2113
587 Ga0307409_100154764 3300031995 Bacteria 1996
588 Ga0307409_100154851 3300031995 Bacteria 1995
589 Ga0307409_100191360 3300031995 Bacteria 1821
590 Ga0307409_100224574 3300031995 Bacteria 1698
591 Ga0307409_100281961 3300031995 Bacteria 1536
592 Ga0307409_100405469 3300031995 Bacteria 1303
593 Ga0307409_100453122 3300031995 Bacteria 1239
594 Ga0307409_100454096 3300031995 Bacteria 1237
595 Ga0307409_100524748 3300031995 Bacteria 1157
596 Ga0307409_100569832 3300031995 Bacteria 1114
597 Ga0307409_100650992 3300031995 Bacteria 1047
598 Ga0307409_100656591 3300031995 Bacteria 1043
599 Ga0307409_100693902 3300031995 Bacteria 1016
600 Ga0307409_100823870 3300031995 Bacteria 937
601 Ga0307409_100888193 3300031995 Bacteria 904
602 Ga0307409_101019133 3300031995 Bacteria 846
603 Ga0307409_101619202 3300031995 Unclassified 676
604 Ga0307409_102702423 3300031995 Bacteria 524
605 Ga0307416_100008213 3300032002 Bacteria 6713
606 Ga0307416_100014578 3300032002 Bacteria 5395
607 Ga0307416_100027573 3300032002 Bacteria 4209
608 Ga0307416_100053742 3300032002 Bacteria 3233
609 Ga0307416_100136130 3300032002 Bacteria 2222
610 Ga0307416_100278501 3300032002 Bacteria 1647
611 Ga0307416_100321447 3300032002 Bacteria 1550
612 Ga0307416_100342349 3300032002 Bacteria 1509
613 Ga0307416_100359682 3300032002 Bacteria 1477
614 Ga0307416_100431452 3300032002 Bacteria 1365
615 Ga0307416_100432819 3300032002 Bacteria 1363
616 Ga0307416_100458297 3300032002 Bacteria 1329
617 Ga0307416_100460002 3300032002 Bacteria 1327
618 Ga0307416_100739987 3300032002 Bacteria 1075
619 Ga0307416_100755504 3300032002 Unclassified 1065
620 Ga0307416_100895295 3300032002 Bacteria 987
621 Ga0307416_100960212 3300032002 Bacteria 957
622 Ga0307416_101623611 3300032002 Bacteria 752
623 Ga0307416_101918966 3300032002 Unclassified 695
624 Ga0307416_102131873 3300032002 Bacteria 662
625 Ga0307416_102508581 3300032002 Bacteria 614
626 Ga0307416_103151597 3300032002 Bacteria 552
627 Ga0307416_103752870 3300032002 Bacteria 508
628 Ga0307414_10000346 3300032004 Bacteria 26022
629 Ga0307414_10000797 3300032004 Bacteria 16139
630 Ga0307414_10001040 3300032004 Bacteria 14198
631 Ga0307414_10006477 3300032004 Bacteria 6528
632 Ga0307414_10009428 3300032004 Bacteria 5608
633 Ga0307414_10012420 3300032004 Bacteria 5034
634 Ga0307414_10036346 3300032004 Bacteria 3288
635 Ga0307414_10055229 3300032004 Bacteria 2780
636 Ga0307414_10058244 3300032004 Bacteria 2721
637 Ga0307414_10085171 3300032004 Bacteria 2327
638 Ga0307414_10133550 3300032004 Bacteria 1931
639 Ga0307414_10190603 3300032004 Bacteria 1658
640 Ga0307414_10194198 3300032004 Bacteria 1645
641 Ga0307414_10224063 3300032004 Bacteria 1545
642 Ga0307414_10544913 3300032004 Bacteria 1033
643 Ga0307414_10605597 3300032004 Unclassified 983
644 Ga0307414_10829788 3300032004 Bacteria 844
645 Ga0307414_10998148 3300032004 Bacteria 770
646 Ga0307414_11092276 3300032004 Bacteria 736
647 Ga0307414_11232535 3300032004 Bacteria 693
648 Ga0307414_12134026 3300032004 Bacteria 523
649 Ga0307414_12168157 3300032004 Bacteria 519
650 Ga0307411_10000748 3300032005 Bacteria 11981
651 Ga0307411_10001464 3300032005 Bacteria 9682
652 Ga0307411_10003067 3300032005 Bacteria 7633
653 Ga0307411_10006109 3300032005 Bacteria 5991
654 Ga0307411_10009598 3300032005 Bacteria 5102
655 Ga0307411_10027126 3300032005 Bacteria 3460
656 Ga0307411_10029138 3300032005 Bacteria 3367
657 Ga0307411_10044982 3300032005 Bacteria 2836
658 Ga0307411_10108630 3300032005 Bacteria 1979
659 Ga0307411_10135937 3300032005 Bacteria 1805
660 Ga0307411_10138660 3300032005 Bacteria 1790
661 Ga0307411_10191879 3300032005 Bacteria 1561
662 Ga0307411_10222851 3300032005 Bacteria 1464
663 Ga0307411_10244720 3300032005 Bacteria 1406
664 Ga0307411_10256430 3300032005 Bacteria 1378
665 Ga0307411_10409819 3300032005 Bacteria 1123
666 Ga0307411_10480958 3300032005 Bacteria 1046
667 Ga0307411_10484507 3300032005 Bacteria 1042
668 Ga0307411_10500253 3300032005 Bacteria 1027
669 Ga0307411_10536708 3300032005 Bacteria 996
670 Ga0307411_10560322 3300032005 Bacteria 976
671 Ga0307411_10578869 3300032005 Bacteria 962
672 Ga0307411_10671252 3300032005 Bacteria 899
673 Ga0307411_10991978 3300032005 Bacteria 751
674 Ga0307411_11187869 3300032005 Bacteria 691
675 Ga0307411_11263107 3300032005 Bacteria 671
676 Ga0307411_11331501 3300032005 Unclassified 655
677 Ga0307411_11593361 3300032005 Bacteria 602
678 Ga0307411_11645092 3300032005 Bacteria 593
679 Ga0307411_11878271 3300032005 Bacteria 557
680 Ga0307415_100002106 3300032126 Bacteria 9844
681 Ga0307415_100006836 3300032126 Bacteria 6191
682 Ga0307415_100064731 3300032126 Bacteria 2545
683 Ga0307415_100067602 3300032126 Bacteria 2498
684 Ga0307415_100107648 3300032126 Bacteria 2060
685 Ga0307415_100163828 3300032126 Bacteria 1727
686 Ga0307415_100164200 3300032126 Unclassified 1725
687 Ga0307415_100211123 3300032126 Bacteria 1549
688 Ga0307415_100299510 3300032126 Bacteria 1331
689 Ga0307415_100600128 3300032126 Bacteria 980
690 Ga0307415_101131026 3300032126 Bacteria 734
691 Ga0307415_101624711 3300032126 Bacteria 621
692 Ga0307415_101686709 3300032126 Bacteria 611
693 Ga0315913_1000002 3300033430 Bacteria 241452
694 Ga0315915_1000001 3300033464 Bacteria 481518
695 Ga0373941_0270863 3300035115 Bacteria 669
696 Ga0373931_0370185 3300035691 Bacteria 901
697 Ga0395899_0000124 3300037312 Bacteria 122011
698 Ga0395900_0000086 3300037418 Bacteria 171749
699 Ga0395900_0542594 3300037418 Bacteria 1108
700 Ga0395898_0000285 3300037466 Bacteria 122279
701 Ga0395905_0000133 3300037471 Bacteria 123500
702 Ga0395905_0357035 3300037471 Bacteria 1354
703 Ga0395905_0448397 3300037471 Bacteria 1188
704 Ga0395905_0734928 3300037471 Bacteria 889
705 Ga0395905_0738849 3300037471 Bacteria 886
706 Ga0395905_0844519 3300037471 Bacteria 819
707 Ga0395905_0966085 3300037471 Bacteria 755
708 Ga0395901_0000092 3300038443 Bacteria 121976
709 Ga0395901_0623049 3300038443 Bacteria 1085
710 Ga0395901_0996682 3300038443 Bacteria 814
711 Ga0436365_0105016 3300039437 Bacteria 679
712 Ga0439436_0030162 3300041404 Bacteria 1576
713 Ga0439438_024814 3300041405 Bacteria 1639
714 Ga0439465_0011348 3300041413 Bacteria 2796
715 Ga0439465_0053742 3300041413 Bacteria 1324
716 Ga0451791_0343439 3300041451 Bacteria 630
717 Ga0451791_0456541 3300041451 Bacteria 554
718 Ga0451793_0443755 3300041452 Bacteria 517
719 Ga0451807_0663369 3300041486 Bacteria 647
720 Ga0451807_2638188 3300041486 Bacteria 896
721 Ga0451807_2716419 3300041486 Bacteria 593
722 Ga0451835_0321473 3300041492 Bacteria 637
723 Ga0451837_0281783 3300041494 Bacteria 788
724 Ga0451837_0877181 3300041494 Bacteria 589
725 Ga0451837_1015036 3300041494 Bacteria 579
726 Ga0451839_1273499 3300041496 Bacteria 637
727 Ga0451841_0095796 3300041498 Bacteria 908
728 Ga0451841_0230948 3300041498 Bacteria 703
729 Ga0451845_0468910 3300041501 Bacteria 823
730 Ga0451853_3825811 3300041512 Bacteria 1551
731 Ga0439431_0272600 3300041997 Bacteria 505
732 Ga0439445_0000389 3300042004 Bacteria 8864
733 Ga0439432_098194 3300042006 Bacteria 877
734 Ga0439432_204285 3300042006 Bacteria 572
735 Ga0439449_0004505 3300042007 Bacteria 5381
736 Ga0439449_0078415 3300042007 Bacteria 1218
737 Ga0439449_0124791 3300042007 Bacteria 956
738 Ga0439449_0125927 3300042007 Bacteria 951
739 Ga0439449_0161858 3300042007 Bacteria 836
740 Ga0439452_055554 3300042010 Bacteria 897
741 Ga0439457_039816 3300042014 Bacteria 1047
742 Ga0439462_0071060 3300042015 Bacteria 945
743 Ga0439462_0074065 3300042015 Bacteria 926
744 Ga0439462_0242360 3300042015 Bacteria 518
745 Ga0450912_024682 3300042116 Bacteria 599
746 Ga0450920_029182 3300042122 Bacteria 1082
747 Ga0450894_079262 3300042131 Bacteria 510
748 Ga0450907_020776 3300042146 Bacteria 1103
749 Ga0439446_0038165 3300042156 Bacteria 1408
750 Ga0439434_0033026 3300042435 Bacteria 1576
751 Ga0439434_0220219 3300042435 Bacteria 644
752 Ga0439434_0266696 3300042435 Bacteria 588
753 Ga0439464_0315881 3300042439 Bacteria 512
754 Ga0450918_077345 3300042531 Unclassified 631
755 Ga0450901_011938 3300042533 Bacteria 904
756 Ga0451577_0507762 3300042876 Bacteria 1095
757 Ga0453684_0203560 3300044712 Bacteria 2306
758 Ga0466967_1187677 3300045976 Bacteria 760
759 Ga0495617_129242 3300046452 Bacteria 811
760 Ga0495638_0010960 3300046460 Bacteria 6270
761 Ga0495638_0014449 3300046460 Bacteria 5335
762 Ga0495638_0034944 3300046460 Bacteria 3206
763 Ga0495638_0549108 3300046460 Bacteria 575
764 Ga0495596_0264005 3300046500 Bacteria 668
765 Ga0495607_0009645 3300046501 Bacteria 6523
766 Ga0495583_0046142 3300046506 Bacteria 2011
767 Ga0495606_0080835 3300046507 Bacteria 2021
768 Ga0495606_0566136 3300046507 Bacteria 563
769 Ga0495606_0589518 3300046507 Bacteria 547
770 Ga0495610_0084939 3300046512 Bacteria 1445
771 Ga0495610_0209922 3300046512 Bacteria 792
772 Ga0495620_0300627 3300046515 Bacteria 610
773 Ga0495632_0012798 3300046519 Bacteria 4816
774 Ga0495643_0019902 3300046522 Bacteria 3879
775 Ga0495648_0103025 3300046524 Bacteria 1571
776 Ga0495663_0001773 3300046525 Bacteria 6687
777 Ga0495663_0022610 3300046525 Bacteria 1817
778 Ga0495663_0035591 3300046525 Bacteria 1496
779 Ga0495663_0102981 3300046525 Bacteria 942
780 Ga0495663_0270116 3300046525 Bacteria 607
781 Ga0495642_0182352 3300046528 Bacteria 914
782 Ga0495654_0010554 3300046530 Bacteria 5025
783 Ga0495654_0360229 3300046530 Bacteria 583
784 Ga0495598_0016102 3300046537 Bacteria 1901
785 Ga0495598_0081258 3300046537 Unclassified 1040
786 Ga0495598_0084910 3300046537 Bacteria 1022
787 Ga0495621_0001191 3300046539 Bacteria 6715
788 Ga0495621_0001733 3300046539 Bacteria 5718
789 Ga0495621_0039729 3300046539 Bacteria 1646
790 Ga0495597_0037563 3300046542 Bacteria 2174
791 Ga0495622_0220692 3300046557 Bacteria 840
792 Ga0495633_0359128 3300046558 Bacteria 660
793 Ga0495668_0000004 3300046616 Bacteria 574236
794 Ga0495668_0648659 3300046616 Bacteria 583
795 Ga0495625_0000553 3300046660 Bacteria 54796
796 Ga0495625_0016088 3300046660 Bacteria 5895
797 Ga0495625_0035484 3300046660 Bacteria 3675
798 Ga0495625_0159861 3300046660 Bacteria 1510
799 Ga0495625_0382484 3300046660 Bacteria 883
800 Ga0495659_0086772 3300046664 Bacteria 1196
801 Ga0495659_0156568 3300046664 Bacteria 918
802 Ga0495659_0528271 3300046664 Bacteria 519
803 Ga0495588_0101380 3300046674 Bacteria 1513
804 Ga0495669_0000602 3300046684 Bacteria 15746
805 Ga0495669_0077318 3300046684 Bacteria 1524
806 Ga0495670_0004937 3300046691 Bacteria 6551
807 Ga0495670_0009300 3300046691 Bacteria 4836
808 Ga0495670_0052728 3300046691 Bacteria 2037
809 Ga0495670_0123687 3300046691 Bacteria 1345
810 Ga0495670_0248402 3300046691 Bacteria 948
811 Ga0495670_0349574 3300046691 Bacteria 796
812 Ga0495670_0501266 3300046691 Bacteria 659
813 Ga0495671_0017144 3300046692 Bacteria 3855
814 Ga0495671_0030512 3300046692 Bacteria 2761
815 Ga0495671_0038954 3300046692 Bacteria 2401
816 Ga0495589_0276032 3300046794 Bacteria 782
817 Ga0495660_0023484 3300046810 Bacteria 3516
818 Ga0495677_0024775 3300047445 Bacteria 2177
819 Ga0495677_0027004 3300047445 Bacteria 2083
820 Ga0495677_0208479 3300047445 Bacteria 760
821 Ga0495681_0082006 3300047470 Bacteria 1438
822 Ga0495681_0118381 3300047470 Bacteria 1139
823 Ga0495686_0012540 3300047472 Bacteria 5925
824 Ga0495686_0067518 3300047472 Bacteria 2207
825 Ga0495686_0259720 3300047472 Bacteria 973
826 Ga0496100_0613825 3300048903 Bacteria 845
827 Ga0496101_0748635 3300048904 Bacteria 771
828 Ga0496102_0250891 3300048905 Bacteria 1669
829 Ga0496106_0973151 3300048909 Bacteria 668
830 Ga0496107_0386275 3300048910 Bacteria 1041
831 Ga0496108_0067853 3300048911 Bacteria 3008
832 Ga0496109_0485983 3300048912 Bacteria 1166
833 Ga0496109_0513593 3300048912 Bacteria 1131
834 Ga0496109_0528814 3300048912 Bacteria 1113
835 Ga0496110_0001413 3300048913 Bacteria 17353
836 Ga0496111_0368954 3300048914 Bacteria 1062
837 Ga0496114_0391067 3300048917 Bacteria 1231
838 Ga0496115_0010329 3300048918 Bacteria 6971
839 Ga0496115_1372783 3300048918 Bacteria 523
840 Ga0496117_0205089 3300048920 Bacteria 1111
841 Ga0496118_0019743 3300048921 Bacteria 6009
842 Ga0496119_0088685 3300048922 Bacteria 1763
843 Ga0496120_0366153 3300048923 Bacteria 644
844 Ga0496121_0220606 3300048924 Bacteria 1336
845 Ga0496121_0448158 3300048924 Bacteria 832
846 Ga0496122_0000416 3300048925 Bacteria 90497
847 Ga0496123_0000460 3300048926 Bacteria 71476
848 Ga0496123_0002043 3300048926 Bacteria 26051
849 Ga0496124_0066588 3300048927 Bacteria 2999
850 Ga0496124_0125990 3300048927 Bacteria 2040
851 Ga0496124_0212210 3300048927 Bacteria 1464
852 Ga0496125_0006717 3300048928 Bacteria 12370
853 Ga0496125_0222569 3300048928 Bacteria 1214
854 Ga0496126_0310346 3300048929 Bacteria 1299
855 Ga0496126_0316405 3300048929 Bacteria 1284
856 Ga0496126_0618377 3300048929 Bacteria 851
857 Ga0496126_0635387 3300048929 Bacteria 837
858 Ga0496126_1149026 3300048929 Bacteria 574
859 Ga0501031_0000016 3300049568 Bacteria 110858
860 Ga0501031_0027499 3300049568 Bacteria 3708
861 Ga0501031_0099578 3300049568 Bacteria 1897
862 Ga0501031_0102979 3300049568 Bacteria 1863
863 Ga0501032_0000044 3300049569 Bacteria 110899
864 Ga0501032_0094726 3300049569 Bacteria 1979
865 Ga0501032_0182038 3300049569 Bacteria 1375
866 Ga0501032_0326164 3300049569 Bacteria 990
867 Ga0501033_0000052 3300049570 Bacteria 110545
868 Ga0501033_0050698 3300049570 Bacteria 3078
869 Ga0501033_0081474 3300049570 Bacteria 2373
870 Ga0501033_0336342 3300049570 Bacteria 1059
871 Ga0501033_0435063 3300049570 Bacteria 912
872 Ga0501034_0000212 3300049571 Bacteria 110795
873 Ga0501034_0069338 3300049571 Bacteria 3537
874 Ga0501034_0106196 3300049571 Bacteria 2801
875 Ga0501034_0488781 3300049571 Bacteria 1145
876 Ga0501034_0827334 3300049571 Bacteria 817
877 Ga0501036_0000022 3300049572 Bacteria 111251
878 Ga0501036_0025253 3300049572 Bacteria 5013
879 Ga0501036_0153146 3300049572 Bacteria 1944
880 Ga0501036_0859510 3300049572 Bacteria 745
881 Ga0501037_0000052 3300049573 Bacteria 110932
882 Ga0501037_0045871 3300049573 Bacteria 3207
883 Ga0501037_0238039 3300049573 Bacteria 1276
884 Ga0501037_0301995 3300049573 Bacteria 1111
885 Ga0501037_0392552 3300049573 Bacteria 952
886 Ga0501037_0564047 3300049573 Bacteria 767
887 Ga0501038_0000044 3300049574 Bacteria 110876
888 Ga0501038_0030959 3300049574 Bacteria 4731
889 Ga0501038_0155608 3300049574 Bacteria 1861
890 Ga0501038_0276789 3300049574 Bacteria 1322
891 Ga0501039_0000042 3300049575 Bacteria 113008
892 Ga0501039_0007777 3300049575 Bacteria 8176
893 Ga0501039_0323905 3300049575 Bacteria 1211
894 Ga0501040_0057517 3300049576 Bacteria 2670
895 Ga0501040_0118622 3300049576 Bacteria 1855
896 Ga0501043_0000054 3300049579 Bacteria 105924
897 Ga0501043_0016295 3300049579 Bacteria 5828
898 Ga0501043_0137547 3300049579 Bacteria 1913
899 Ga0501046_0147468 3300049580 Bacteria 1776
900 Ga0501046_0519621 3300049580 Bacteria 851
901 Ga0501047_0000247 3300049581 Bacteria 64318
902 Ga0501047_0172411 3300049581 Bacteria 2032
903 Ga0501068_0189543 3300049584 Bacteria 1302
904 Ga0501068_0629984 3300049584 Bacteria 700
905 Ga0501070_0363765 3300049586 Bacteria 1173
906 Ga0501072_0015756 3300049588 Bacteria 5795
907 Ga0501072_0108654 3300049588 Bacteria 2207
908 Ga0501073_0216155 3300049589 Unclassified 1325
909 Ga0501073_0496014 3300049589 Bacteria 844
910 Ga0501074_0385756 3300049590 Bacteria 994
911 Ga0501074_1311875 3300049590 Bacteria 507
912 Ga0501075_0194058 3300049591 Bacteria 1549
913 Ga0501202_113772 3300049652 Bacteria 673
914 Ga0501224_005346 3300049664 Bacteria 1837
915 Ga0501238_027115 3300049671 Bacteria 823
916 Ga0501249_038320 3300049679 Bacteria 1082
917 Ga0501079_0724422 3300049741 Bacteria 783
918 Ga0501081_0012442 3300049743 Bacteria 5593
919 Ga0501262_013742 3300049759 Bacteria 1047
920 Ga0501262_065171 3300049759 Bacteria 588
921 Ga0501268_086003 3300049765 Bacteria 656
922 Ga0501269_005517 3300049766 Bacteria 1521
923 Ga0501279_066484 3300049775 Bacteria 599
924 Ga0501035_0000095 3300049822 Bacteria 110735
925 Ga0501035_0023615 3300049822 Bacteria 5641
926 Ga0501035_0297143 3300049822 Bacteria 1361
927 Ga0501035_0363431 3300049822 Bacteria 1209
928 Ga0501044_0000091 3300049823 Bacteria 111251
929 Ga0501044_0000280 3300049823 Bacteria 64928
930 Ga0501044_0027138 3300049823 Bacteria 6056
931 Ga0501044_0172718 3300049823 Bacteria 2131
932 Ga0501045_0024385 3300049824 Bacteria 4343
933 Ga0501045_0651172 3300049824 Bacteria 779
934 nmdc:mga03683_721_c1 3300050489 Bacteria 9466
935 nmdc:mga03n38_59950_c1 3300050490 Bacteria 1729
936 nmdc:mga0yw44_31385_c1 3300050492 Bacteria 3089
937 nmdc:mga0yw44_81252_c1 3300050492 Bacteria 2032
938 nmdc:mga0k408_104336_c1 3300050493 Bacteria 1673
939 nmdc:mga0k408_323284_c1 3300050493 Bacteria 920
940 nmdc:mga0k408_492351_c1 3300050493 Bacteria 727
941 nmdc:mga06z11_388_c1 3300050494 Bacteria 16612
942 nmdc:mga04h51_73_c1 3300050495 Bacteria 32039
943 nmdc:mga07m45_251251_c1 3300050496 Bacteria 1029
944 nmdc:mga07m45_330852_c1 3300050496 Bacteria 885
945 nmdc:mga07m45_47316_c1 3300050496 Bacteria 2418
946 nmdc:mga07m45_5_c2 3300050496 Bacteria 297012
947 nmdc:mga07m45_979_c1 3300050496 Bacteria 11290
948 nmdc:mga09592_1279878_c1 3300050508 Bacteria 603
949 nmdc:mga08y16_1245842_c1 3300050511 Bacteria 713
950 nmdc:mga08y16_406877_c1 3300050511 Bacteria 1392
951 nmdc:mga0sz30_209_c1 3300050516 Bacteria 21984
952 nmdc:mga0sz30_351964_c1 3300050516 Bacteria 658
953 nmdc:mga0sz30_382860_c1 3300050516 Bacteria 630
954 nmdc:mga0sz30_9804_c1 3300050516 Bacteria 3653
955 Ga0500643_002982 3300053087 Bacteria 8386
956 Ga0500643_030835 3300053087 Bacteria 1639
957 Ga0500643_218016 3300053087 Bacteria 512
958 Ga0500651_0336984 3300053093 Bacteria 858
959 Ga0500650_0054600 3300053098 Bacteria 1860
960 Ga0500555_059803 3300053103 Bacteria 1027
961 Ga0500556_0000339 3300053104 Bacteria 34934
962 Ga0500562_025902 3300053108 Bacteria 1536
963 Ga0500569_009439 3300053109 Bacteria 2267
964 Ga0500592_020911 3300053116 Bacteria 1053
965 Ga0500592_027000 3300053116 Bacteria 926
966 Ga0500595_023762 3300053119 Bacteria 2150
967 Ga0500608_000105 3300053122 Bacteria 34366
968 Ga0500608_000764 3300053122 Bacteria 11718
969 Ga0500642_0000001 3300053130 Bacteria 1468402
970 Ga0500658_0000769 3300053134 Bacteria 13202
971 Ga0500658_0358583 3300053134 Bacteria 669
972 Ga0500559_0312546 3300053136 Bacteria 737
973 Ga0500568_0001734 3300053139 Bacteria 13523
974 Ga0500568_0051944 3300053139 Bacteria 1611
975 Ga0500568_0081725 3300053139 Bacteria 1226
976 Ga0500573_0006606 3300053140 Bacteria 6291
977 Ga0500573_0285408 3300053140 Bacteria 833
978 Ga0500616_0000421 3300053153 Bacteria 56739
979 Ga0500616_0039441 3300053153 Bacteria 2546
980 Ga0500616_0318064 3300053153 Bacteria 641
981 Ga0500622_0030266 3300053156 Bacteria 2843
982 Ga0500627_0000049 3300053158 Bacteria 58947
983 Ga0500627_0479965 3300053158 Bacteria 520
984 Ga0500636_0000156 3300053177 Bacteria 35625
985 Ga0500645_000312 3300053730 Bacteria 34754
986 Ga0501084_0819463 3300054114 Bacteria 784
987 Ga0501084_1141472 3300054114 Bacteria 654
988 Ga0501082_0275088 3300060353 Bacteria 1466
989 Ga0501082_1747598 3300060353 Bacteria 543
990 Ga0501082_2037177 3300060353 Bacteria 500

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006186 Ga0075369_10390163 Ga0075369_103901631 103
2 3300060353 Ga0501082_1747598 Ga0501082_1747598_16_438 103
3 iso_pu_bacteria 2643221560 2643820086 104
4 iso_pu_bacteria 2852653556 2852653987 104
5 iso_pu_bacteria 3005409236 3005415621 104
6 3300031995 Ga0307409_100108162 Ga0307409_1001081622 105
7 3300041452 Ga0451793_0443755 Ga0451793_0443755_153_473 105
8 3300041494 Ga0451837_0281783 Ga0451837_0281783_279_599 105
9 3300041498 Ga0451841_0095796 Ga0451841_0095796_369_689 105
10 3300041498 Ga0451841_0230948 Ga0451841_0230948_119_439 105
11 3300041501 Ga0451845_0468910 Ga0451845_0468910_146_466 105
12 3300041512 Ga0451853_3825811 Ga0451853_3825811_523_843 105
13 iso_pu_bacteria 2508501114 2509079156 105
14 iso_pu_bacteria 2508501122 2509108476 105
15 iso_pu_bacteria 2509276019 2509374497 105
16 iso_pu_bacteria 2510065019 2510134718 105
17 iso_pu_bacteria 2510065057 2510306608 105
18 iso_pu_bacteria 2510461076 2510896067 105
19 iso_pu_bacteria 2511231052 2511500971 105
20 iso_pu_bacteria 2512875026 2512972287 105
21 iso_pu_bacteria 2513237086 2513583491 105
22 iso_pu_bacteria 2513237089 2513603366 105
23 iso_pu_bacteria 2513237091 2513620774 105
24 iso_pu_bacteria 2513237093 2513631444 105
25 iso_pu_bacteria 2513237103 2513710622 105
26 iso_pu_bacteria 2513237140 2513881140 105
27 iso_pu_bacteria 2513237143 2513907125 105
28 iso_pu_bacteria 2513237156 2513983971 105
29 iso_pu_bacteria 2513237160 2514004821 105
30 iso_pu_bacteria 2513237162 2514023732 105
31 iso_pu_bacteria 2515154107 2515608086 105
32 iso_pu_bacteria 2515154113 2515634671 105
33 iso_pu_bacteria 2515154114 2515646027 105
34 iso_pu_bacteria 2515154116 2515656906 105
35 iso_pu_bacteria 2515154134 2515743529 105
36 iso_pu_bacteria 2516143018 2516208840 105
37 iso_pu_bacteria 2516653046 2516892252 105
38 iso_pu_bacteria 2516653077 2517037420 105
39 iso_pu_bacteria 2516653085 2517077717 105
40 iso_pu_bacteria 2517287029 2517410616 105
41 iso_pu_bacteria 2517487022 2517569048 105
42 iso_pu_bacteria 2519899620 2520377860 105
43 iso_pu_bacteria 2524023207 2524451186 105
44 iso_pu_bacteria 2551306084 2551676431 105
45 iso_pu_bacteria 2551306085 2551687212 105
46 iso_pu_bacteria 2551306086 2551692941 105
47 iso_pu_bacteria 2551306087 2551703186 105
48 iso_pu_bacteria 2551306089 2551712353 105
49 iso_pu_bacteria 2551306090 2551720674 105
50 iso_pu_bacteria 2551306091 2551731098 105
51 iso_pu_bacteria 2551306092 2551731976 105
52 iso_pu_bacteria 2551306093 2551740402 105
53 iso_pu_bacteria 2558860100 2558863524 105
54 iso_pu_bacteria 2582581306 2585270292 105
55 iso_pu_bacteria 2582581865 2585388731 105
56 iso_pu_bacteria 2585427528 2585541139 105
57 iso_pu_bacteria 2585427593 2585839902 105
58 iso_pu_bacteria 2585428106 2587919815 105
59 iso_pu_bacteria 2615840624 2616295438 105
60 iso_pu_bacteria 2643221580 2643910490 105
61 iso_pu_bacteria 2643221618 2644109039 105
62 iso_pu_bacteria 2643221626 2644151560 105
63 iso_pu_bacteria 2643221640 2644223557 105
64 iso_pu_bacteria 2643221642 2644236353 105
65 iso_pu_bacteria 2643221655 2644311695 105
66 iso_pu_bacteria 2643221659 2644329952 105
67 iso_pu_bacteria 2643221688 2644494368 105
68 iso_pu_bacteria 2643221698 2644546626 105
69 iso_pu_bacteria 2643221712 2644617494 105
70 iso_pu_bacteria 2657244999 2657683308 105
71 iso_pu_bacteria 2690316117 2692316866 105
72 iso_pu_bacteria 2738541333 2739035691 105
73 iso_pu_bacteria 2751185821 2753460768 105
74 iso_pu_bacteria 2765235942 2766065449 105
75 iso_pu_bacteria 2791355091 2792622724 105
76 iso_pu_bacteria 2791355092 2792628355 105
77 iso_pu_bacteria 2791355260 2793319840 105
78 iso_pu_bacteria 2791355261 2793328156 105
79 iso_pu_bacteria 2791355266 2793362933 105
80 iso_pu_bacteria 2791355267 2793370041 105
81 iso_pu_bacteria 2802428858 2802717691 105
82 iso_pu_bacteria 2802428859 2802723381 105
83 iso_pu_bacteria 2802428860 2802731168 105
84 iso_pu_bacteria 2802428861 2802736175 105
85 iso_pu_bacteria 2802428862 2802743615 105
86 iso_pu_bacteria 2802428863 2802750673 105
87 iso_pu_bacteria 2802429268 2804751302 105
88 iso_pu_bacteria 2802429633 2806044678 105
89 iso_pu_bacteria 2802429634 2806052878 105
90 iso_pu_bacteria 2802429635 2806059178 105
91 iso_pu_bacteria 2802429636 2806068159 105
92 iso_pu_bacteria 2802429637 2806074279 105
93 iso_pu_bacteria 2838042994 2838046371 105
94 iso_pu_bacteria 2838074704 2838076400 105
95 iso_pu_bacteria 2838680041 2838685079 105
96 iso_pu_bacteria 2838686498 2838691449 105
97 iso_pu_bacteria 2838694306 2838699084 105
98 iso_pu_bacteria 2838707686 2838712565 105
99 iso_pu_bacteria 2838729681 2838733408 105
100 iso_pu_bacteria 2838742623 2838746020 105
101 iso_pu_bacteria 2841851746 2841853732 105
102 iso_pu_bacteria 2842077413 2842082042 105
103 iso_pu_bacteria 2842110456 2842113565 105
104 iso_pu_bacteria 2842118031 2842122964 105
105 iso_pu_bacteria 2842156927 2842162261 105
106 iso_pu_bacteria 2842163707 2842169816 105
107 iso_pu_bacteria 2842180545 2842185187 105
108 iso_pu_bacteria 2842205361 2842208184 105
109 iso_pu_bacteria 2842217011 2842220204 105
110 iso_pu_bacteria 2842229732 2842233674 105
111 iso_pu_bacteria 2842237096 2842242133 105
112 iso_pu_bacteria 2842243621 2842247718 105
113 iso_pu_bacteria 2842257432 2842262014 105
114 iso_pu_bacteria 2842271015 2842275923 105
115 iso_pu_bacteria 2842278818 2842281807 105
116 iso_pu_bacteria 2842291075 2842296042 105
117 iso_pu_bacteria 2842304105 2842308093 105
118 iso_pu_bacteria 2842370503 2842375757 105
119 iso_pu_bacteria 2842377471 2842382441 105
120 iso_pu_bacteria 2842384541 2842389842 105
121 iso_pu_bacteria 2844163670 2844168563 105
122 iso_pu_bacteria 2844454524 2844457623 105
123 iso_pu_bacteria 2847417321 2847418068 105
124 iso_pu_bacteria 2848992105 2848993042 105
125 iso_pu_bacteria 2850079185 2850080437 105
126 iso_pu_bacteria 2855825444 2855831322 105
127 iso_pu_bacteria 2855839649 2855840447 105
128 iso_pu_bacteria 2855872281 2855879180 105
129 iso_pu_bacteria 2857504554 2857505938 105
130 iso_pu_bacteria 2857516855 2857519032 105
131 iso_pu_bacteria 2858800743 2858800976 105
132 iso_pu_bacteria 2896384573 2896386601 105
133 iso_pu_bacteria 2913295892 2913297483 105
134 iso_pu_bacteria 2915980308 2915986171 105
135 iso_pu_bacteria 2915986958 2915990591 105
136 iso_pu_bacteria 2915993759 2915996261 105
137 iso_pu_bacteria 2916000859 2916005739 105
138 iso_pu_bacteria 2916007675 2916010926 105
139 iso_pu_bacteria 2916014648 2916016563 105
140 iso_pu_bacteria 2916021584 2916024762 105
141 iso_pu_bacteria 2916028427 2916032181 105
142 iso_pu_bacteria 2916035215 2916038164 105
143 iso_pu_bacteria 2916041962 2916047184 105
144 iso_pu_bacteria 2916048683 2916053212 105
145 iso_pu_bacteria 2916055098 2916055358 105
146 iso_pu_bacteria 2916061851 2916062822 105
147 iso_pu_bacteria 2916068649 2916074961 105
148 iso_pu_bacteria 2916076590 2916079315 105
149 iso_pu_bacteria 2920760137 2920762914 105
150 iso_pu_bacteria 2921201388 2921205724 105
151 iso_pu_bacteria 2921208531 2921213530 105
152 iso_pu_bacteria 2921237296 2921241622 105
153 iso_pu_bacteria 2921244191 2921247516 105
154 iso_pu_bacteria 2921250672 2921250953 105
155 iso_pu_bacteria 2921257292 2921260005 105
156 iso_pu_bacteria 2921263974 2921264235 105
157 iso_pu_bacteria 2921282425 2921282768 105
158 iso_pu_bacteria 2921289301 2921290130 105
159 iso_pu_bacteria 2921296804 2921299967 105
160 iso_pu_bacteria 2924144063 2924145600 105
161 iso_pu_bacteria 2924150972 2924155881 105
162 iso_pu_bacteria 2924158325 2924160573 105
163 iso_pu_bacteria 2924165586 2924168151 105
164 iso_pu_bacteria 2924172951 2924177847 105
165 iso_pu_bacteria 2924179722 2924186314 105
166 iso_pu_bacteria 2924186466 2924189512 105
167 iso_pu_bacteria 2924193448 2924198248 105
168 iso_pu_bacteria 2924200457 2924204059 105
169 iso_pu_bacteria 2924207177 2924209909 105
170 iso_pu_bacteria 2924214083 2924215176 105
171 iso_pu_bacteria 2924221636 2924226229 105
172 iso_pu_bacteria 2924228884 2924234934 105
173 iso_pu_bacteria 2928531327 2928531957 105
174 iso_pu_bacteria 2929199973 2929202040 105
175 iso_pu_bacteria 2932401849 2932402362 105
176 iso_pu_bacteria 2933570622 2933574542 105
177 iso_pu_bacteria 2933586486 2933589145 105
178 iso_pu_bacteria 2935894831 2935899854 105
179 iso_pu_bacteria 2935901341 2935907025 105
180 iso_pu_bacteria 2936367885 2936374993 105
181 iso_pu_bacteria 2936375103 2936380684 105
182 iso_pu_bacteria 2937002841 2937009514 105
183 iso_pu_bacteria 2937009748 2937010886 105
184 iso_pu_bacteria 2937016420 2937018984 105
185 iso_pu_bacteria 2937023124 2937027925 105
186 iso_pu_bacteria 2937029754 2937029868 105
187 iso_pu_bacteria 2937036028 2937036894 105
188 iso_pu_bacteria 2937042894 2937048989 105
189 iso_pu_bacteria 2937049772 2937056284 105
190 iso_pu_bacteria 2937056579 2937061298 105
191 iso_pu_bacteria 2937063883 2937064388 105
192 iso_pu_bacteria 2937071275 2937072868 105
193 iso_pu_bacteria 2937078374 2937082975 105
194 iso_pu_bacteria 2937084907 2937091253 105
195 iso_pu_bacteria 2937091812 2937095589 105
196 iso_pu_bacteria 2937098957 2937103635 105
197 iso_pu_bacteria 2937106411 2937109776 105
198 iso_pu_bacteria 2937113482 2937118318 105
199 iso_pu_bacteria 2937119839 2937121185 105
200 iso_pu_bacteria 2937126314 2937129819 105
201 iso_pu_bacteria 2941499720 2941500262 105
202 iso_pu_bacteria 2957375807 2957380027 105
203 iso_pu_bacteria 2957382221 2957385069 105
204 iso_pu_bacteria 2957388812 2957389132 105
205 iso_pu_bacteria 2957395598 2957396752 105
206 iso_pu_bacteria 2957402308 2957405448 105
207 iso_pu_bacteria 2957408893 2957413251 105
208 iso_pu_bacteria 2957415311 2957419199 105
209 iso_pu_bacteria 2957422303 2957427733 105
210 iso_pu_bacteria 2957430029 2957431091 105
211 iso_pu_bacteria 2957437181 2957441965 105
212 iso_pu_bacteria 2957443900 2957446653 105
213 iso_pu_bacteria 2957450854 2957454190 105
214 iso_pu_bacteria 2957457609 2957462450 105
215 iso_pu_bacteria 2957464669 2957467748 105
216 iso_pu_bacteria 2957471148 2957477790 105
217 iso_pu_bacteria 2957478035 2957480628 105
218 iso_pu_bacteria 2957484790 2957485790 105
219 iso_pu_bacteria 2957491536 2957495994 105
220 iso_pu_bacteria 2957498199 2957501036 105
221 iso_pu_bacteria 2957505466 2957509592 105
222 iso_pu_bacteria 2960584000 2960586644 105
223 iso_pu_bacteria 2960591022 2960595571 105
224 iso_pu_bacteria 2960597568 2960600575 105
225 iso_pu_bacteria 2960603979 2960609475 105
226 iso_pu_bacteria 2960610863 2960616786 105
227 iso_pu_bacteria 2960617483 2960617704 105
228 iso_pu_bacteria 2960624210 2960625692 105
229 iso_pu_bacteria 2960631154 2960633228 105
230 iso_pu_bacteria 2960637947 2960640207 105
231 iso_pu_bacteria 2960645483 2960648728 105
232 iso_pu_bacteria 2960652885 2960653707 105
233 iso_pu_bacteria 2960660292 2960666405 105
234 iso_pu_bacteria 2960667422 2960673925 105
235 iso_pu_bacteria 2960674078 2960678832 105
236 iso_pu_bacteria 2960680706 2960684160 105
237 iso_pu_bacteria 2960687367 2960692024 105
238 iso_pu_bacteria 2960693952 2960696371 105
239 iso_pu_bacteria 2964607997 2964610231 105
240 iso_pu_bacteria 2964615318 2964620008 105
241 iso_pu_bacteria 2964621998 2964627807 105
242 iso_pu_bacteria 2964628898 2964633117 105
243 iso_pu_bacteria 2964636051 2964641282 105
244 iso_pu_bacteria 2964643177 2964646161 105
245 iso_pu_bacteria 2964649959 2964653103 105
246 iso_pu_bacteria 2964656573 2964661884 105
247 iso_pu_bacteria 2964663802 2964665972 105
248 iso_pu_bacteria 2964670856 2964671686 105
249 iso_pu_bacteria 2964678106 2964681098 105
250 iso_pu_bacteria 2964685014 2964688108 105
251 iso_pu_bacteria 2964691889 2964695841 105
252 iso_pu_bacteria 2964698721 2964703595 105
253 iso_pu_bacteria 2964705432 2964708094 105
254 iso_pu_bacteria 2964712639 2964716299 105
255 iso_pu_bacteria 2964719344 2964726457 105
256 iso_pu_bacteria 2967664464 2967667371 105
257 iso_pu_bacteria 2967671571 2967672144 105
258 iso_pu_bacteria 2967678726 2967681043 105
259 iso_pu_bacteria 2967686174 2967686413 105
260 iso_pu_bacteria 2967693043 2967693246 105
261 iso_pu_bacteria 2967699805 2967704240 105
262 iso_pu_bacteria 2967706974 2967712948 105
263 iso_pu_bacteria 2967714385 2967716529 105
264 iso_pu_bacteria 2967721400 2967724587 105
265 iso_pu_bacteria 2967728569 2967734737 105
266 iso_pu_bacteria 2967735183 2967737580 105
267 iso_pu_bacteria 2967742019 2967747873 105
268 iso_pu_bacteria 2967748971 2967752105 105
269 iso_pu_bacteria 2967755722 2967756314 105
270 iso_pu_bacteria 2967762386 2967764431 105
271 iso_pu_bacteria 2967769361 2967770792 105
272 iso_pu_bacteria 2967775926 2967782177 105
273 iso_pu_bacteria 2970019648 2970026071 105
274 iso_pu_bacteria 2970026789 2970031791 105
275 iso_pu_bacteria 2970033650 2970037802 105
276 iso_pu_bacteria 2970040964 2970043285 105
277 iso_pu_bacteria 2970047711 2970052887 105
278 iso_pu_bacteria 2970054988 2970059608 105
279 iso_pu_bacteria 2970061556 2970065294 105
280 iso_pu_bacteria 2970068827 2970069514 105
281 iso_pu_bacteria 2970076120 2970076969 105
282 iso_pu_bacteria 2970082768 2970085648 105
283 iso_pu_bacteria 2970088815 2970093308 105
284 iso_pu_bacteria 2970095765 2970096866 105
285 iso_pu_bacteria 2970102677 2970106929 105
286 iso_pu_bacteria 2970109326 2970109819 105
287 iso_pu_bacteria 2970116247 2970117968 105
288 iso_pu_bacteria 2970122695 2970124461 105
289 iso_pu_bacteria 2970129317 2970129518 105
290 iso_pu_bacteria 2970136068 2970143150 105
291 iso_pu_bacteria 2970149975 2970153814 105
292 iso_pu_bacteria 2970156795 2970163692 105
293 iso_pu_bacteria 2970164137 2970167504 105
294 iso_pu_bacteria 2970170962 2970171794 105
295 iso_pu_bacteria 2970177841 2970182814 105
296 iso_pu_bacteria 2970184632 2970188255 105
297 iso_pu_bacteria 2970191845 2970198324 105
298 iso_pu_bacteria 2977516862 2977518434 105
299 iso_pu_bacteria 2977523885 2977527656 105
300 iso_pu_bacteria 2977530762 2977531897 105
301 iso_pu_bacteria 2977537788 2977537989 105
302 iso_pu_bacteria 2977544691 2977544930 105
303 iso_pu_bacteria 2977551784 2977551987 105
304 iso_pu_bacteria 2977558990 2977561672 105
305 iso_pu_bacteria 2977565890 2977568982 105
306 iso_pu_bacteria 2977572785 2977578961 105
307 iso_pu_bacteria 2977579622 2977581494 105
308 iso_pu_bacteria 639633055 639649880 105
309 iso_pu_bacteria 643692032 643825045 105
310 iso_pu_bacteria 648276728 648736366 105
311 iso_pu_bacteria 8003992118 8003992945 105
312 iso_pu_bacteria 8003999396 8004000181 105
313 iso_pu_bacteria 8005289223 8005294413 105
314 iso_pu_bacteria 8005307578 8005310832 105
315 iso_pu_bacteria 8005376324 8005378316 105
316 iso_pu_bacteria 8005382845 8005383961 105
317 iso_pu_bacteria 8005395548 8005401289 105
318 iso_pu_bacteria 8005556819 8005558509 105
319 iso_pu_bacteria 8005563573 8005566647 105
320 iso_pu_bacteria 8005570704 8005575064 105
321 iso_pu_bacteria 8018127388 8018133735 105
322 iso_pu_bacteria 8018163183 8018170091 105
323 iso_pu_bacteria 8024479707 8024481658 105
324 iso_pu_bacteria 8055909800 8055911039 105
325 iso_pu_bacteria 8056375014 8056381461 105
326 iso_pu_bacteria 8057874678 8057876697 105
327 3300003214 JGI25165J46597_1000947 JGI25165J46597_10009476 106
328 3300005327 Ga0070658_10031287 Ga0070658_100312875 106
329 3300005339 Ga0070660_100060990 Ga0070660_1000609904 106
330 3300005341 Ga0070691_10664597 Ga0070691_106645972 106
331 3300005344 Ga0070661_100120387 Ga0070661_1001203872 106
332 3300005366 Ga0070659_100064992 Ga0070659_1000649922 106
333 3300005366 Ga0070659_100146835 Ga0070659_1001468354 106
334 3300005457 Ga0070662_100374457 Ga0070662_1003744572 106
335 3300005539 Ga0068853_100046888 Ga0068853_1000468883 106
336 3300005539 Ga0068853_100851270 Ga0068853_1008512702 106
337 3300005548 Ga0070665_100132453 Ga0070665_1001324533 106
338 3300005563 Ga0068855_100174964 Ga0068855_1001749642 106
339 3300005563 Ga0068855_100270918 Ga0068855_1002709182 106
340 3300005578 Ga0068854_100225001 Ga0068854_1002250012 106
341 3300005614 Ga0068856_100103731 Ga0068856_1001037314 106
342 3300005841 Ga0068863_102433682 Ga0068863_1024336822 106
343 3300005842 Ga0068858_100747326 Ga0068858_1007473262 106
344 3300006038 Ga0075365_10006228 Ga0075365_100062286 106
345 3300006042 Ga0075368_10000318 Ga0075368_100003189 106
346 3300006048 Ga0075363_100004443 Ga0075363_1000044433 106
347 3300006051 Ga0075364_10015285 Ga0075364_100152855 106
348 3300006177 Ga0075362_10003383 Ga0075362_100033835 106
349 3300006178 Ga0075367_10002472 Ga0075367_100024725 106
350 3300006186 Ga0075369_10019278 Ga0075369_100192783 106
351 3300006186 Ga0075369_10391814 Ga0075369_103918141 106
352 3300006195 Ga0075366_10153572 Ga0075366_101535723 106
353 3300006353 Ga0075370_10018867 Ga0075370_100188674 106
354 3300006353 Ga0075370_10052920 Ga0075370_100529204 106
355 3300006946 Ga0079104_1035919 Ga0079104_10359192 106
356 3300006946 Ga0079104_1061617 Ga0079104_10616172 106
357 3300009098 Ga0105245_12896207 Ga0105245_128962071 106
358 3300009545 Ga0105237_10259227 Ga0105237_102592274 106
359 3300009551 Ga0105238_10022705 Ga0105238_100227055 106
360 3300009551 Ga0105238_10089554 Ga0105238_100895541 106
361 3300010375 Ga0105239_10122221 Ga0105239_101222211 106
362 3300010375 Ga0105239_10257858 Ga0105239_102578583 106
363 3300011119 Ga0105246_10794202 Ga0105246_107942022 106
364 3300013102 Ga0157371_10354253 Ga0157371_103542532 106
365 3300013104 Ga0157370_10124553 Ga0157370_101245534 106
366 3300013104 Ga0157370_10920463 Ga0157370_109204632 106
367 3300013105 Ga0157369_10021987 Ga0157369_100219875 106
368 3300013296 Ga0157374_10382641 Ga0157374_103826412 106
369 3300013297 Ga0157378_10668493 Ga0157378_106684932 106
370 3300013307 Ga0157372_10044754 Ga0157372_100447545 106
371 3300013308 Ga0157375_11129954 Ga0157375_111299541 106
372 3300014325 Ga0163163_10795752 Ga0163163_107957522 106
373 3300025231 Ga0207427_109513 Ga0207427_1095132 106
374 3300025233 Ga0209437_100197 Ga0209437_10019790 106
375 3300025261 Ga0209233_1000199 Ga0209233_100019922 106
376 3300025909 Ga0207705_10001064 Ga0207705_1000106410 106
377 3300025909 Ga0207705_10067557 Ga0207705_100675574 106
378 3300025913 Ga0207695_10157189 Ga0207695_101571892 106
379 3300025914 Ga0207671_10589513 Ga0207671_105895132 106
380 3300025919 Ga0207657_10015490 Ga0207657_100154908 106
381 3300025919 Ga0207657_10237211 Ga0207657_102372112 106
382 3300025919 Ga0207657_10580238 Ga0207657_105802382 106
383 3300025920 Ga0207649_10631175 Ga0207649_106311752 106
384 3300025921 Ga0207652_10068552 Ga0207652_100685523 106
385 3300025932 Ga0207690_10198044 Ga0207690_101980442 106
386 3300025932 Ga0207690_10215011 Ga0207690_102150112 106
387 3300025949 Ga0207667_10004509 Ga0207667_100045099 106
388 3300025981 Ga0207640_10216336 Ga0207640_102163362 106
389 3300026041 Ga0207639_10326200 Ga0207639_103262004 106
390 3300026041 Ga0207639_11254500 Ga0207639_112545001 106
391 3300026067 Ga0207678_10080942 Ga0207678_100809422 106
392 3300026067 Ga0207678_10164279 Ga0207678_101642791 106
393 3300026078 Ga0207702_10489169 Ga0207702_104891692 106
394 3300026116 Ga0207674_10317937 Ga0207674_103179372 106
395 3300026142 Ga0207698_11035642 Ga0207698_110356422 106
396 3300027111 Ga0209281_1026144 Ga0209281_10261442 106
397 3300027866 Ga0209813_10000060 Ga0209813_1000006015 106
398 3300028379 Ga0268266_10291785 Ga0268266_102917853 106
399 3300035115 Ga0373941_0270863 Ga0373941_0270863_213_536 106
400 3300035691 Ga0373931_0370185 Ga0373931_0370185_344_667 106
401 3300037471 Ga0395905_0448397 Ga0395905_0448397_740_1063 106
402 3300041496 Ga0451839_1273499 Ga0451839_1273499_212_553 106
403 3300042131 Ga0450894_079262 Ga0450894_079262_175_495 106
404 3300046512 Ga0495610_0209922 Ga0495610_0209922_169_510 106
405 3300046660 Ga0495625_0159861 Ga0495625_0159861_52_393 106
406 3300046691 Ga0495670_0052728 Ga0495670_0052728_1391_1732 106
407 3300048925 Ga0496122_0000416 Ga0496122_0000416_16103_16426 106
408 3300048926 Ga0496123_0002043 Ga0496123_0002043_16099_16422 106
409 3300049568 Ga0501031_0099578 Ga0501031_0099578_152_493 106
410 3300049569 Ga0501032_0182038 Ga0501032_0182038_676_1017 106
411 3300049570 Ga0501033_0336342 Ga0501033_0336342_360_701 106
412 3300049571 Ga0501034_0069338 Ga0501034_0069338_2891_3214 106
413 3300049572 Ga0501036_0025253 Ga0501036_0025253_2857_3198 106
414 3300049573 Ga0501037_0301995 Ga0501037_0301995_248_589 106
415 3300049574 Ga0501038_0030959 Ga0501038_0030959_4167_4508 106
416 3300049575 Ga0501039_0007777 Ga0501039_0007777_830_1153 106
417 3300049579 Ga0501043_0137547 Ga0501043_0137547_807_1148 106
418 3300049584 Ga0501068_0189543 Ga0501068_0189543_566_907 106
419 3300049586 Ga0501070_0363765 Ga0501070_0363765_474_815 106
420 3300049589 Ga0501073_0216155 Ga0501073_0216155_32_373 106
421 3300049589 Ga0501073_0496014 Ga0501073_0496014_78_401 106
422 3300049822 Ga0501035_0297143 Ga0501035_0297143_168_509 106
423 3300050489 nmdc:mga03683_721_c1 nmdc:mga03683_721_c1_5117_5482 106
424 3300050490 nmdc:mga03n38_59950_c1 nmdc:mga03n38_59950_c1_318_683 106
425 3300050492 nmdc:mga0yw44_81252_c1 nmdc:mga0yw44_81252_c1_1454_1819 106
426 3300050493 nmdc:mga0k408_104336_c1 nmdc:mga0k408_104336_c1_598_963 106
427 3300050493 nmdc:mga0k408_323284_c1 nmdc:mga0k408_323284_c1_342_689 106
428 3300050494 nmdc:mga06z11_388_c1 nmdc:mga06z11_388_c1_3286_3651 106
429 3300050495 nmdc:mga04h51_73_c1 nmdc:mga04h51_73_c1_14305_14670 106
430 3300050496 nmdc:mga07m45_47316_c1 nmdc:mga07m45_47316_c1_1770_2102 106
431 3300050496 nmdc:mga07m45_5_c2 nmdc:mga07m45_5_c2_244843_245208 106
432 3300050496 nmdc:mga07m45_979_c1 nmdc:mga07m45_979_c1_5608_5949 106
433 3300050516 nmdc:mga0sz30_209_c1 nmdc:mga0sz30_209_c1_15370_15735 106
434 3300050516 nmdc:mga0sz30_351964_c1 nmdc:mga0sz30_351964_c1_67_414 106
435 3300053087 Ga0500643_030835 Ga0500643_030835_1175_1516 106
436 3300053116 Ga0500592_020911 Ga0500592_020911_183_533 106
437 3300053119 Ga0500595_023762 Ga0500595_023762_1187_1525 106
438 3300053139 Ga0500568_0051944 Ga0500568_0051944_1039_1389 106
439 3300053139 Ga0500568_0081725 Ga0500568_0081725_645_968 106
440 3300053153 Ga0500616_0039441 Ga0500616_0039441_411_731 106
441 3300060353 Ga0501082_2037177 Ga0501082_2037177_68_391 106
442 iso_pu_bacteria 2724679232 2725947705 106
443 3300001979 JGI24740J21852_10001351 JGI24740J21852_100013518 107
444 3300003215 JGI25153J46596_10100412 JGI25153J46596_101004122 107
445 3300003781 Ga0055536_1009138 Ga0055536_10091382 107
446 3300003794 Ga0055531_10000858 Ga0055531_1000085813 107
447 3300005331 Ga0070670_100021035 Ga0070670_1000210352 107
448 3300005331 Ga0070670_100508862 Ga0070670_1005088621 107
449 3300005333 Ga0070677_10788663 Ga0070677_107886631 107
450 3300005334 Ga0068869_100626883 Ga0068869_1006268832 107
451 3300005334 Ga0068869_100898790 Ga0068869_1008987902 107
452 3300005338 Ga0068868_101436812 Ga0068868_1014368121 107
453 3300005340 Ga0070689_101510986 Ga0070689_1015109861 107
454 3300005347 Ga0070668_100024369 Ga0070668_1000243693 107
455 3300005354 Ga0070675_100107929 Ga0070675_1001079292 107
456 3300005355 Ga0070671_100923306 Ga0070671_1009233062 107
457 3300005356 Ga0070674_100027251 Ga0070674_1000272514 107
458 3300005364 Ga0070673_100051731 Ga0070673_1000517313 107
459 3300005455 Ga0070663_100224813 Ga0070663_1002248133 107
460 3300005456 Ga0070678_101486152 Ga0070678_1014861521 107
461 3300005457 Ga0070662_100875549 Ga0070662_1008755492 107
462 3300005466 Ga0070685_11056339 Ga0070685_110563392 107
463 3300005543 Ga0070672_100017512 Ga0070672_1000175125 107
464 3300005718 Ga0068866_10391222 Ga0068866_103912221 107
465 3300005841 Ga0068863_102369896 Ga0068863_1023698961 107
466 3300005844 Ga0068862_100016627 Ga0068862_1000166273 107
467 3300006038 Ga0075365_10001615 Ga0075365_100016159 107
468 3300006353 Ga0075370_10501920 Ga0075370_105019201 107
469 3300006847 Ga0075431_101097603 Ga0075431_1010976032 107
470 3300009094 Ga0111539_10870883 Ga0111539_108708832 107
471 3300009094 Ga0111539_11142217 Ga0111539_111422172 107
472 3300010375 Ga0105239_10539227 Ga0105239_105392272 107
473 3300013296 Ga0157374_10234791 Ga0157374_102347912 107
474 3300013297 Ga0157378_11457143 Ga0157378_114571432 107
475 3300013306 Ga0163162_10108677 Ga0163162_101086775 107
476 3300013308 Ga0157375_10067258 Ga0157375_100672584 107
477 3300014325 Ga0163163_10671575 Ga0163163_106715752 107
478 3300014326 Ga0157380_10033633 Ga0157380_100336332 107
479 3300014326 Ga0157380_10628741 Ga0157380_106287412 107
480 3300017792 Ga0163161_10049520 Ga0163161_100495204 107
481 3300025284 Ga0209130_1020116 Ga0209130_10201162 107
482 3300025292 Ga0209676_1030163 Ga0209676_10301633 107
483 3300025294 Ga0209025_1059964 Ga0209025_10599642 107
484 3300025297 Ga0209758_1002301 Ga0209758_100230112 107
485 3300025297 Ga0209758_1033930 Ga0209758_10339303 107
486 3300025298 Ga0209050_1009017 Ga0209050_10090171 107
487 3300025299 Ga0209256_1001505 Ga0209256_10015053 107
488 3300025303 Ga0209051_1002714 Ga0209051_10027144 107
489 3300025304 Ga0209257_1032597 Ga0209257_10325972 107
490 3300025304 Ga0209257_1069401 Ga0209257_10694012 107
491 3300025304 Ga0209257_1104677 Ga0209257_11046772 107
492 3300025925 Ga0207650_10041076 Ga0207650_100410765 107
493 3300025926 Ga0207659_10085347 Ga0207659_100853472 107
494 3300025931 Ga0207644_11681229 Ga0207644_116812292 107
495 3300025933 Ga0207706_10746090 Ga0207706_107460902 107
496 3300025937 Ga0207669_10036896 Ga0207669_100368962 107
497 3300025940 Ga0207691_10015470 Ga0207691_100154704 107
498 3300025960 Ga0207651_10040548 Ga0207651_100405485 107
499 3300026075 Ga0207708_10494553 Ga0207708_104945532 107
500 3300027907 Ga0207428_10893559 Ga0207428_108935592 107
501 3300028380 Ga0268265_10003419 Ga0268265_100034198 107
502 3300031251 Ga0265327_10205876 Ga0265327_102058762 107
503 3300031548 Ga0307408_100506918 Ga0307408_1005069182 107
504 3300031548 Ga0307408_100978124 Ga0307408_1009781242 107
505 3300031616 Ga0307508_10617556 Ga0307508_106175562 107
506 3300031731 Ga0307405_10218556 Ga0307405_102185562 107
507 3300031731 Ga0307405_10654518 Ga0307405_106545182 107
508 3300031731 Ga0307405_11937040 Ga0307405_119370401 107
509 3300031824 Ga0307413_10022551 Ga0307413_100225516 107
510 3300031824 Ga0307413_10111022 Ga0307413_101110222 107
511 3300031824 Ga0307413_10329468 Ga0307413_103294682 107
512 3300031824 Ga0307413_10728860 Ga0307413_107288602 107
513 3300031824 Ga0307413_11438799 Ga0307413_114387991 107
514 3300031852 Ga0307410_10023487 Ga0307410_100234872 107
515 3300031852 Ga0307410_10074789 Ga0307410_100747895 107
516 3300031852 Ga0307410_10075397 Ga0307410_100753972 107
517 3300031852 Ga0307410_10127116 Ga0307410_101271163 107
518 3300031852 Ga0307410_10140780 Ga0307410_101407802 107
519 3300031852 Ga0307410_10422442 Ga0307410_104224422 107
520 3300031852 Ga0307410_10672132 Ga0307410_106721322 107
521 3300031852 Ga0307410_11860803 Ga0307410_118608031 107
522 3300031901 Ga0307406_10042227 Ga0307406_100422273 107
523 3300031901 Ga0307406_10099950 Ga0307406_100999502 107
524 3300031901 Ga0307406_10404327 Ga0307406_104043272 107
525 3300031901 Ga0307406_11047220 Ga0307406_110472201 107
526 3300031903 Ga0307407_10030175 Ga0307407_100301754 107
527 3300031903 Ga0307407_10329137 Ga0307407_103291372 107
528 3300031903 Ga0307407_10339967 Ga0307407_103399672 107
529 3300031903 Ga0307407_10342885 Ga0307407_103428852 107
530 3300031911 Ga0307412_10159729 Ga0307412_101597292 107
531 3300031911 Ga0307412_10342024 Ga0307412_103420242 107
532 3300031911 Ga0307412_10483313 Ga0307412_104833132 107
533 3300031911 Ga0307412_10863175 Ga0307412_108631752 107
534 3300031911 Ga0307412_11220739 Ga0307412_112207392 107
535 3300031911 Ga0307412_11442023 Ga0307412_114420231 107
536 3300031995 Ga0307409_100135464 Ga0307409_1001354642 107
537 3300031995 Ga0307409_100191360 Ga0307409_1001913603 107
538 3300031995 Ga0307409_100453122 Ga0307409_1004531222 107
539 3300031995 Ga0307409_100524748 Ga0307409_1005247482 107
540 3300031995 Ga0307409_100650992 Ga0307409_1006509922 107
541 3300031995 Ga0307409_100656591 Ga0307409_1006565912 107
542 3300031995 Ga0307409_100888193 Ga0307409_1008881932 107
543 3300031995 Ga0307409_101019133 Ga0307409_1010191332 107
544 3300031995 Ga0307409_102702423 Ga0307409_1027024232 107
545 3300032002 Ga0307416_100053742 Ga0307416_1000537423 107
546 3300032002 Ga0307416_100278501 Ga0307416_1002785012 107
547 3300032002 Ga0307416_100342349 Ga0307416_1003423492 107
548 3300032002 Ga0307416_100432819 Ga0307416_1004328192 107
549 3300032002 Ga0307416_100895295 Ga0307416_1008952952 107
550 3300032002 Ga0307416_101623611 Ga0307416_1016236112 107
551 3300032002 Ga0307416_102131873 Ga0307416_1021318731 107
552 3300032004 Ga0307414_10006477 Ga0307414_100064779 107
553 3300032004 Ga0307414_10036346 Ga0307414_100363466 107
554 3300032004 Ga0307414_10085171 Ga0307414_100851713 107
555 3300032004 Ga0307414_10190603 Ga0307414_101906032 107
556 3300032004 Ga0307414_10544913 Ga0307414_105449131 107
557 3300032005 Ga0307411_10044982 Ga0307411_100449823 107
558 3300032005 Ga0307411_10108630 Ga0307411_101086302 107
559 3300032005 Ga0307411_10256430 Ga0307411_102564302 107
560 3300032005 Ga0307411_10409819 Ga0307411_104098191 107
561 3300032005 Ga0307411_10500253 Ga0307411_105002532 107
562 3300032005 Ga0307411_10536708 Ga0307411_105367082 107
563 3300032005 Ga0307411_10991978 Ga0307411_109919782 107
564 3300032005 Ga0307411_11187869 Ga0307411_111878692 107
565 3300032005 Ga0307411_11263107 Ga0307411_112631072 107
566 3300032126 Ga0307415_100600128 Ga0307415_1006001282 107
567 3300032126 Ga0307415_101131026 Ga0307415_1011310261 107
568 3300032126 Ga0307415_101624711 Ga0307415_1016247111 107
569 3300037312 Ga0395899_0000124 Ga0395899_0000124_4461_4784 107
570 3300037418 Ga0395900_0000086 Ga0395900_0000086_166966_167289 107
571 3300037418 Ga0395900_0542594 Ga0395900_0542594_579_902 107
572 3300037466 Ga0395898_0000285 Ga0395898_0000285_4461_4784 107
573 3300037471 Ga0395905_0000133 Ga0395905_0000133_118717_119040 107
574 3300038443 Ga0395901_0000092 Ga0395901_0000092_117193_117516 107
575 3300038443 Ga0395901_0623049 Ga0395901_0623049_503_826 107
576 3300039437 Ga0436365_0105016 Ga0436365_0105016_209_541 107
577 3300041404 Ga0439436_0030162 Ga0439436_0030162_190_513 107
578 3300041405 Ga0439438_024814 Ga0439438_024814_549_872 107
579 3300041413 Ga0439465_0011348 Ga0439465_0011348_872_1195 107
580 3300041492 Ga0451835_0321473 Ga0451835_0321473_26_358 107
581 3300041494 Ga0451837_0877181 Ga0451837_0877181_173_499 107
582 3300041997 Ga0439431_0272600 Ga0439431_0272600_26_349 107
583 3300042007 Ga0439449_0125927 Ga0439449_0125927_280_603 107
584 3300042014 Ga0439457_039816 Ga0439457_039816_62_385 107
585 3300042015 Ga0439462_0071060 Ga0439462_0071060_415_738 107
586 3300042116 Ga0450912_024682 Ga0450912_024682_122_448 107
587 3300042122 Ga0450920_029182 Ga0450920_029182_734_1057 107
588 3300042146 Ga0450907_020776 Ga0450907_020776_86_409 107
589 3300042156 Ga0439446_0038165 Ga0439446_0038165_503_829 107
590 3300042435 Ga0439434_0033026 Ga0439434_0033026_1149_1472 107
591 3300042533 Ga0450901_011938 Ga0450901_011938_22_345 107
592 3300046452 Ga0495617_129242 Ga0495617_129242_88_411 107
593 3300046525 Ga0495663_0001773 Ga0495663_0001773_3913_4257 107
594 3300046537 Ga0495598_0084910 Ga0495598_0084910_504_848 107
595 3300046539 Ga0495621_0001191 Ga0495621_0001191_4896_5240 107
596 3300046557 Ga0495622_0220692 Ga0495622_0220692_393_716 107
597 3300046674 Ga0495588_0101380 Ga0495588_0101380_810_1133 107
598 3300046691 Ga0495670_0123687 Ga0495670_0123687_934_1278 107
599 3300046691 Ga0495670_0248402 Ga0495670_0248402_163_507 107
600 3300046692 Ga0495671_0038954 Ga0495671_0038954_26_349 107
601 3300047445 Ga0495677_0208479 Ga0495677_0208479_64_408 107
602 3300047472 Ga0495686_0259720 Ga0495686_0259720_619_942 107
603 3300048918 Ga0496115_0010329 Ga0496115_0010329_380_703 107
604 3300048922 Ga0496119_0088685 Ga0496119_0088685_1401_1724 107
605 3300048923 Ga0496120_0366153 Ga0496120_0366153_182_505 107
606 3300048924 Ga0496121_0220606 Ga0496121_0220606_205_528 107
607 3300048926 Ga0496123_0000460 Ga0496123_0000460_49220_49543 107
608 3300048927 Ga0496124_0066588 Ga0496124_0066588_2658_2981 107
609 3300048927 Ga0496124_0125990 Ga0496124_0125990_361_684 107
610 3300048928 Ga0496125_0006717 Ga0496125_0006717_10920_11243 107
611 3300048929 Ga0496126_0310346 Ga0496126_0310346_396_719 107
612 3300048929 Ga0496126_0618377 Ga0496126_0618377_481_804 107
613 3300048929 Ga0496126_0635387 Ga0496126_0635387_263_586 107
614 3300049568 Ga0501031_0000016 Ga0501031_0000016_106651_106974 107
615 3300049568 Ga0501031_0027499 Ga0501031_0027499_1067_1390 107
616 3300049568 Ga0501031_0102979 Ga0501031_0102979_835_1158 107
617 3300049569 Ga0501032_0000044 Ga0501032_0000044_106651_106974 107
618 3300049569 Ga0501032_0326164 Ga0501032_0326164_408_731 107
619 3300049570 Ga0501033_0000052 Ga0501033_0000052_106325_106648 107
620 3300049570 Ga0501033_0050698 Ga0501033_0050698_878_1201 107
621 3300049570 Ga0501033_0435063 Ga0501033_0435063_41_364 107
622 3300049571 Ga0501034_0000212 Ga0501034_0000212_106651_106974 107
623 3300049571 Ga0501034_0106196 Ga0501034_0106196_1385_1708 107
624 3300049572 Ga0501036_0000022 Ga0501036_0000022_3823_4146 107
625 3300049572 Ga0501036_0859510 Ga0501036_0859510_383_706 107
626 3300049573 Ga0501037_0000052 Ga0501037_0000052_106651_106974 107
627 3300049573 Ga0501037_0392552 Ga0501037_0392552_103_426 107
628 3300049574 Ga0501038_0000044 Ga0501038_0000044_3959_4282 107
629 3300049575 Ga0501039_0000042 Ga0501039_0000042_108863_109186 107
630 3300049576 Ga0501040_0118622 Ga0501040_0118622_1440_1763 107
631 3300049579 Ga0501043_0000054 Ga0501043_0000054_101643_101966 107
632 3300049579 Ga0501043_0016295 Ga0501043_0016295_4861_5184 107
633 3300049580 Ga0501046_0147468 Ga0501046_0147468_510_833 107
634 3300049581 Ga0501047_0000247 Ga0501047_0000247_3782_4105 107
635 3300049588 Ga0501072_0015756 Ga0501072_0015756_299_622 107
636 3300049671 Ga0501238_027115 Ga0501238_027115_109_432 107
637 3300049822 Ga0501035_0000095 Ga0501035_0000095_3805_4128 107
638 3300049822 Ga0501035_0363431 Ga0501035_0363431_321_644 107
639 3300049823 Ga0501044_0000091 Ga0501044_0000091_107106_107429 107
640 3300049823 Ga0501044_0172718 Ga0501044_0172718_1330_1653 107
641 3300050492 nmdc:mga0yw44_31385_c1 nmdc:mga0yw44_31385_c1_2058_2381 107
642 3300050496 nmdc:mga07m45_330852_c1 nmdc:mga07m45_330852_c1_468_791 107
643 3300050511 nmdc:mga08y16_1245842_c1 nmdc:mga08y16_1245842_c1_336_680 107
644 3300053103 Ga0500555_059803 Ga0500555_059803_531_857 107
645 3300053134 Ga0500658_0358583 Ga0500658_0358583_210_533 107
646 3300053140 Ga0500573_0006606 Ga0500573_0006606_292_615 107
647 3300053153 Ga0500616_0000421 Ga0500616_0000421_628_951 107
648 3300053158 Ga0500627_0479965 Ga0500627_0479965_124_447 107
649 3300053177 Ga0500636_0000156 Ga0500636_0000156_22095_22418 107
650 3300002459 JGI24751J29686_10031269 JGI24751J29686_100312692 108
651 3300002459 JGI24751J29686_10090805 JGI24751J29686_100908052 108
652 3300003187 JGI25151J46595_10161566 JGI25151J46595_101615661 108
653 3300003781 Ga0055536_1002254 Ga0055536_100225411 108
654 3300003781 Ga0055536_1006080 Ga0055536_10060808 108
655 3300003791 Ga0055530_10001655 Ga0055530_100016557 108
656 3300003794 Ga0055531_10001722 Ga0055531_1000172214 108
657 3300003794 Ga0055531_10021163 Ga0055531_100211633 108
658 3300005289 Ga0065704_10095207 Ga0065704_100952073 108
659 3300005289 Ga0065704_10290897 Ga0065704_102908972 108
660 3300005293 Ga0065715_10233704 Ga0065715_102337042 108
661 3300005293 Ga0065715_10448940 Ga0065715_104489402 108
662 3300005295 Ga0065707_10190157 Ga0065707_101901573 108
663 3300005328 Ga0070676_10119508 Ga0070676_101195082 108
664 3300005328 Ga0070676_10748776 Ga0070676_107487761 108
665 3300005329 Ga0070683_102442811 Ga0070683_1024428111 108
666 3300005331 Ga0070670_100039511 Ga0070670_1000395112 108
667 3300005333 Ga0070677_10039893 Ga0070677_100398931 108
668 3300005334 Ga0068869_100300833 Ga0068869_1003008333 108
669 3300005334 Ga0068869_100856082 Ga0068869_1008560821 108
670 3300005339 Ga0070660_101513291 Ga0070660_1015132911 108
671 3300005340 Ga0070689_101453634 Ga0070689_1014536341 108
672 3300005347 Ga0070668_100027061 Ga0070668_1000270614 108
673 3300005347 Ga0070668_100029010 Ga0070668_1000290103 108
674 3300005353 Ga0070669_100173670 Ga0070669_1001736702 108
675 3300005353 Ga0070669_100307933 Ga0070669_1003079333 108
676 3300005355 Ga0070671_100715480 Ga0070671_1007154802 108
677 3300005356 Ga0070674_100003913 Ga0070674_10000391313 108
678 3300005356 Ga0070674_100701752 Ga0070674_1007017522 108
679 3300005364 Ga0070673_101017085 Ga0070673_1010170851 108
680 3300005366 Ga0070659_100607835 Ga0070659_1006078352 108
681 3300005456 Ga0070678_101636009 Ga0070678_1016360091 108
682 3300005457 Ga0070662_100019821 Ga0070662_1000198213 108
683 3300005457 Ga0070662_100529236 Ga0070662_1005292362 108
684 3300005459 Ga0068867_100374909 Ga0068867_1003749092 108
685 3300005459 Ga0068867_100433368 Ga0068867_1004333682 108
686 3300005530 Ga0070679_100252500 Ga0070679_1002525002 108
687 3300005530 Ga0070679_100981335 Ga0070679_1009813351 108
688 3300005543 Ga0070672_100371321 Ga0070672_1003713212 108
689 3300005543 Ga0070672_101968869 Ga0070672_1019688691 108
690 3300005546 Ga0070696_101123912 Ga0070696_1011239122 108
691 3300005617 Ga0068859_100523410 Ga0068859_1005234102 108
692 3300005719 Ga0068861_100231708 Ga0068861_1002317082 108
693 3300005719 Ga0068861_100847870 Ga0068861_1008478701 108
694 3300005844 Ga0068862_100092388 Ga0068862_1000923883 108
695 3300005844 Ga0068862_100322624 Ga0068862_1003226242 108
696 3300005844 Ga0068862_100978530 Ga0068862_1009785301 108
697 3300006880 Ga0075429_101612913 Ga0075429_1016129132 108
698 3300006931 Ga0097620_100523434 Ga0097620_1005234342 108
699 3300009094 Ga0111539_10176032 Ga0111539_101760321 108
700 3300009098 Ga0105245_11074055 Ga0105245_110740552 108
701 3300009147 Ga0114129_12047192 Ga0114129_120471922 108
702 3300009148 Ga0105243_10129286 Ga0105243_101292864 108
703 3300009148 Ga0105243_11069571 Ga0105243_110695712 108
704 3300010375 Ga0105239_11332316 Ga0105239_113323162 108
705 3300013297 Ga0157378_10517297 Ga0157378_105172972 108
706 3300013308 Ga0157375_11835192 Ga0157375_118351922 108
707 3300014326 Ga0157380_10022038 Ga0157380_100220383 108
708 3300014326 Ga0157380_10036570 Ga0157380_100365705 108
709 3300014326 Ga0157380_10568009 Ga0157380_105680092 108
710 3300014326 Ga0157380_12094252 Ga0157380_120942522 108
711 3300017792 Ga0163161_11524446 Ga0163161_115244462 108
712 3300025291 Ga0209675_1000196 Ga0209675_10001962 108
713 3300025292 Ga0209676_1000518 Ga0209676_100051814 108
714 3300025292 Ga0209676_1000554 Ga0209676_100055455 108
715 3300025292 Ga0209676_1000929 Ga0209676_100092912 108
716 3300025292 Ga0209676_1020890 Ga0209676_10208904 108
717 3300025294 Ga0209025_1006572 Ga0209025_10065722 108
718 3300025294 Ga0209025_1030058 Ga0209025_10300582 108
719 3300025297 Ga0209758_1025297 Ga0209758_10252975 108
720 3300025298 Ga0209050_1000017 Ga0209050_100001788 108
721 3300025298 Ga0209050_1008085 Ga0209050_10080854 108
722 3300025298 Ga0209050_1029701 Ga0209050_10297011 108
723 3300025304 Ga0209257_1001405 Ga0209257_100140510 108
724 3300025304 Ga0209257_1002894 Ga0209257_100289414 108
725 3300025304 Ga0209257_1005509 Ga0209257_10055097 108
726 3300025893 Ga0207682_10425647 Ga0207682_104256472 108
727 3300025901 Ga0207688_10372485 Ga0207688_103724852 108
728 3300025907 Ga0207645_10100033 Ga0207645_101000333 108
729 3300025907 Ga0207645_10381462 Ga0207645_103814622 108
730 3300025907 Ga0207645_10896506 Ga0207645_108965062 108
731 3300025919 Ga0207657_10359041 Ga0207657_103590413 108
732 3300025920 Ga0207649_10854948 Ga0207649_108549481 108
733 3300025923 Ga0207681_10114929 Ga0207681_101149292 108
734 3300025923 Ga0207681_10437430 Ga0207681_104374302 108
735 3300025925 Ga0207650_10164481 Ga0207650_101644814 108
736 3300025927 Ga0207687_11196681 Ga0207687_111966811 108
737 3300025931 Ga0207644_10604869 Ga0207644_106048692 108
738 3300025931 Ga0207644_11117396 Ga0207644_111173962 108
739 3300025933 Ga0207706_10311009 Ga0207706_103110093 108
740 3300025935 Ga0207709_10154504 Ga0207709_101545042 108
741 3300025937 Ga0207669_10344178 Ga0207669_103441782 108
742 3300025937 Ga0207669_10578841 Ga0207669_105788412 108
743 3300025937 Ga0207669_10645267 Ga0207669_106452672 108
744 3300025940 Ga0207691_11546050 Ga0207691_115460502 108
745 3300025944 Ga0207661_11566308 Ga0207661_115663082 108
746 3300025960 Ga0207651_10782897 Ga0207651_107828972 108
747 3300025972 Ga0207668_10019850 Ga0207668_100198502 108
748 3300025972 Ga0207668_10053537 Ga0207668_100535372 108
749 3300025981 Ga0207640_10130945 Ga0207640_101309451 108
750 3300026078 Ga0207702_11310573 Ga0207702_113105731 108
751 3300026118 Ga0207675_100913085 Ga0207675_1009130852 108
752 3300028380 Ga0268265_10029713 Ga0268265_100297132 108
753 3300028380 Ga0268265_10088850 Ga0268265_100888504 108
754 3300028380 Ga0268265_10211716 Ga0268265_102117162 108
755 3300028380 Ga0268265_10337359 Ga0268265_103373592 108
756 3300030742 Ga0316183_1130216 Ga0316183_11302162 108
757 3300030745 Ga0316182_1346917 Ga0316182_13469171 108
758 3300031548 Ga0307408_100014062 Ga0307408_1000140622 108
759 3300031548 Ga0307408_100014343 Ga0307408_1000143434 108
760 3300031548 Ga0307408_100205582 Ga0307408_1002055822 108
761 3300031548 Ga0307408_100284185 Ga0307408_1002841853 108
762 3300031548 Ga0307408_100940828 Ga0307408_1009408282 108
763 3300031731 Ga0307405_10175716 Ga0307405_101757162 108
764 3300031731 Ga0307405_10237047 Ga0307405_102370472 108
765 3300031731 Ga0307405_10450756 Ga0307405_104507562 108
766 3300031731 Ga0307405_10478248 Ga0307405_104782482 108
767 3300031731 Ga0307405_10532523 Ga0307405_105325232 108
768 3300031731 Ga0307405_10991783 Ga0307405_109917831 108
769 3300031731 Ga0307405_11159996 Ga0307405_111599961 108
770 3300031824 Ga0307413_10010474 Ga0307413_100104743 108
771 3300031824 Ga0307413_10027919 Ga0307413_100279193 108
772 3300031824 Ga0307413_10138431 Ga0307413_101384312 108
773 3300031824 Ga0307413_10178685 Ga0307413_101786852 108
774 3300031824 Ga0307413_10370861 Ga0307413_103708612 108
775 3300031824 Ga0307413_11162028 Ga0307413_111620282 108
776 3300031824 Ga0307413_11877905 Ga0307413_118779052 108
777 3300031852 Ga0307410_10002517 Ga0307410_100025173 108
778 3300031852 Ga0307410_10006279 Ga0307410_100062794 108
779 3300031852 Ga0307410_10016162 Ga0307410_100161625 108
780 3300031852 Ga0307410_10073764 Ga0307410_100737644 108
781 3300031852 Ga0307410_10096733 Ga0307410_100967332 108
782 3300031852 Ga0307410_10392738 Ga0307410_103927382 108
783 3300031852 Ga0307410_10499925 Ga0307410_104999253 108
784 3300031852 Ga0307410_10710187 Ga0307410_107101872 108
785 3300031852 Ga0307410_10781805 Ga0307410_107818052 108
786 3300031901 Ga0307406_10042588 Ga0307406_100425883 108
787 3300031901 Ga0307406_10056261 Ga0307406_100562613 108
788 3300031901 Ga0307406_10359750 Ga0307406_103597502 108
789 3300031901 Ga0307406_10451414 Ga0307406_104514143 108
790 3300031901 Ga0307406_10544977 Ga0307406_105449772 108
791 3300031901 Ga0307406_11144917 Ga0307406_111449172 108
792 3300031903 Ga0307407_10002403 Ga0307407_100024032 108
793 3300031903 Ga0307407_10284270 Ga0307407_102842702 108
794 3300031903 Ga0307407_10557376 Ga0307407_105573762 108
795 3300031903 Ga0307407_10594231 Ga0307407_105942311 108
796 3300031903 Ga0307407_10758836 Ga0307407_107588362 108
797 3300031911 Ga0307412_10030284 Ga0307412_100302842 108
798 3300031911 Ga0307412_10046470 Ga0307412_100464703 108
799 3300031911 Ga0307412_10308610 Ga0307412_103086102 108
800 3300031911 Ga0307412_10382225 Ga0307412_103822252 108
801 3300031911 Ga0307412_10434754 Ga0307412_104347541 108
802 3300031911 Ga0307412_11501969 Ga0307412_115019691 108
803 3300031911 Ga0307412_11557808 Ga0307412_115578081 108
804 3300031995 Ga0307409_100000217 Ga0307409_10000021713 108
805 3300031995 Ga0307409_100036117 Ga0307409_1000361172 108
806 3300031995 Ga0307409_100154764 Ga0307409_1001547642 108
807 3300031995 Ga0307409_100281961 Ga0307409_1002819612 108
808 3300031995 Ga0307409_100405469 Ga0307409_1004054692 108
809 3300031995 Ga0307409_100454096 Ga0307409_1004540962 108
810 3300031995 Ga0307409_100569832 Ga0307409_1005698322 108
811 3300031995 Ga0307409_100693902 Ga0307409_1006939022 108
812 3300031995 Ga0307409_100823870 Ga0307409_1008238702 108
813 3300031995 Ga0307409_101619202 Ga0307409_1016192022 108
814 3300032002 Ga0307416_100136130 Ga0307416_1001361302 108
815 3300032002 Ga0307416_100739987 Ga0307416_1007399872 108
816 3300032002 Ga0307416_100755504 Ga0307416_1007555041 108
817 3300032002 Ga0307416_100960212 Ga0307416_1009602122 108
818 3300032002 Ga0307416_101918966 Ga0307416_1019189662 108
819 3300032002 Ga0307416_103151597 Ga0307416_1031515971 108
820 3300032002 Ga0307416_103752870 Ga0307416_1037528702 108
821 3300032004 Ga0307414_10000346 Ga0307414_100003468 108
822 3300032004 Ga0307414_10009428 Ga0307414_100094282 108
823 3300032004 Ga0307414_10012420 Ga0307414_100124202 108
824 3300032004 Ga0307414_10055229 Ga0307414_100552292 108
825 3300032004 Ga0307414_10058244 Ga0307414_100582443 108
826 3300032004 Ga0307414_10133550 Ga0307414_101335503 108
827 3300032004 Ga0307414_10605597 Ga0307414_106055972 108
828 3300032004 Ga0307414_10829788 Ga0307414_108297881 108
829 3300032004 Ga0307414_10998148 Ga0307414_109981482 108
830 3300032004 Ga0307414_11092276 Ga0307414_110922762 108
831 3300032004 Ga0307414_11232535 Ga0307414_112325351 108
832 3300032004 Ga0307414_12134026 Ga0307414_121340261 108
833 3300032004 Ga0307414_12168157 Ga0307414_121681571 108
834 3300032005 Ga0307411_10003067 Ga0307411_100030674 108
835 3300032005 Ga0307411_10009598 Ga0307411_100095983 108
836 3300032005 Ga0307411_10027126 Ga0307411_100271261 108
837 3300032005 Ga0307411_10135937 Ga0307411_101359371 108
838 3300032005 Ga0307411_10138660 Ga0307411_101386604 108
839 3300032005 Ga0307411_10191879 Ga0307411_101918793 108
840 3300032005 Ga0307411_10222851 Ga0307411_102228511 108
841 3300032005 Ga0307411_10484507 Ga0307411_104845072 108
842 3300032005 Ga0307411_10560322 Ga0307411_105603221 108
843 3300032005 Ga0307411_10578869 Ga0307411_105788692 108
844 3300032005 Ga0307411_11331501 Ga0307411_113315012 108
845 3300032005 Ga0307411_11645092 Ga0307411_116450921 108
846 3300032126 Ga0307415_100006836 Ga0307415_1000068363 108
847 3300032126 Ga0307415_100064731 Ga0307415_1000647312 108
848 3300032126 Ga0307415_100067602 Ga0307415_1000676022 108
849 3300032126 Ga0307415_100107648 Ga0307415_1001076483 108
850 3300032126 Ga0307415_100164200 Ga0307415_1001642002 108
851 3300037471 Ga0395905_0357035 Ga0395905_0357035_447_773 108
852 3300037471 Ga0395905_0844519 Ga0395905_0844519_466_792 108
853 3300038443 Ga0395901_0996682 Ga0395901_0996682_393_719 108
854 3300041451 Ga0451791_0343439 Ga0451791_0343439_101_427 108
855 3300041486 Ga0451807_0663369 Ga0451807_0663369_18_344 108
856 3300041486 Ga0451807_2638188 Ga0451807_2638188_318_644 108
857 3300041486 Ga0451807_2716419 Ga0451807_2716419_246_572 108
858 3300042007 Ga0439449_0124791 Ga0439449_0124791_29_364 108
859 3300042439 Ga0439464_0315881 Ga0439464_0315881_13_360 108
860 3300042531 Ga0450918_077345 Ga0450918_077345_166_531 108
861 3300045976 Ga0466967_1187677 Ga0466967_1187677_350_709 108
862 3300046515 Ga0495620_0300627 Ga0495620_0300627_138_485 108
863 3300046522 Ga0495643_0019902 Ga0495643_0019902_2588_2914 108
864 3300046525 Ga0495663_0022610 Ga0495663_0022610_770_1096 108
865 3300046525 Ga0495663_0035591 Ga0495663_0035591_1115_1462 108
866 3300046525 Ga0495663_0270116 Ga0495663_0270116_41_388 108
867 3300046528 Ga0495642_0182352 Ga0495642_0182352_420_767 108
868 3300046530 Ga0495654_0360229 Ga0495654_0360229_66_392 108
869 3300046537 Ga0495598_0081258 Ga0495598_0081258_24_371 108
870 3300046539 Ga0495621_0039729 Ga0495621_0039729_1236_1583 108
871 3300046558 Ga0495633_0359128 Ga0495633_0359128_16_363 108
872 3300046616 Ga0495668_0000004 Ga0495668_0000004_453837_454163 108
873 3300046660 Ga0495625_0000553 Ga0495625_0000553_15838_16164 108
874 3300046660 Ga0495625_0382484 Ga0495625_0382484_369_695 108
875 3300046664 Ga0495659_0086772 Ga0495659_0086772_241_588 108
876 3300046664 Ga0495659_0156568 Ga0495659_0156568_69_416 108
877 3300046664 Ga0495659_0528271 Ga0495659_0528271_62_409 108
878 3300046684 Ga0495669_0077318 Ga0495669_0077318_191_538 108
879 3300046691 Ga0495670_0009300 Ga0495670_0009300_3512_3859 108
880 3300046691 Ga0495670_0349574 Ga0495670_0349574_419_766 108
881 3300046794 Ga0495589_0276032 Ga0495589_0276032_135_482 108
882 3300047445 Ga0495677_0024775 Ga0495677_0024775_720_1067 108
883 3300047470 Ga0495681_0082006 Ga0495681_0082006_66_392 108
884 3300047470 Ga0495681_0118381 Ga0495681_0118381_527_853 108
885 3300048911 Ga0496108_0067853 Ga0496108_0067853_2416_2751 108
886 3300048927 Ga0496124_0212210 Ga0496124_0212210_767_1093 108
887 3300048929 Ga0496126_1149026 Ga0496126_1149026_31_357 108
888 3300049569 Ga0501032_0094726 Ga0501032_0094726_1476_1802 108
889 3300049570 Ga0501033_0081474 Ga0501033_0081474_572_898 108
890 3300049571 Ga0501034_0488781 Ga0501034_0488781_331_657 108
891 3300049571 Ga0501034_0827334 Ga0501034_0827334_120_452 108
892 3300049572 Ga0501036_0153146 Ga0501036_0153146_1403_1729 108
893 3300049573 Ga0501037_0238039 Ga0501037_0238039_342_668 108
894 3300049573 Ga0501037_0564047 Ga0501037_0564047_362_688 108
895 3300049574 Ga0501038_0155608 Ga0501038_0155608_92_418 108
896 3300049575 Ga0501039_0323905 Ga0501039_0323905_259_585 108
897 3300049576 Ga0501040_0057517 Ga0501040_0057517_1892_2260 108
898 3300049580 Ga0501046_0519621 Ga0501046_0519621_62_388 108
899 3300049581 Ga0501047_0172411 Ga0501047_0172411_648_974 108
900 3300049588 Ga0501072_0108654 Ga0501072_0108654_1635_2003 108
901 3300049652 Ga0501202_113772 Ga0501202_113772_184_510 108
902 3300049759 Ga0501262_013742 Ga0501262_013742_10_336 108
903 3300049822 Ga0501035_0023615 Ga0501035_0023615_2640_2966 108
904 3300049823 Ga0501044_0027138 Ga0501044_0027138_3473_3799 108
905 3300049824 Ga0501045_0024385 Ga0501045_0024385_99_467 108
906 3300050508 nmdc:mga09592_1279878_c1 nmdc:mga09592_1279878_c1_43_390 108
907 3300053093 Ga0500651_0336984 Ga0500651_0336984_86_412 108
908 3300053116 Ga0500592_027000 Ga0500592_027000_372_698 108
909 3300053139 Ga0500568_0001734 Ga0500568_0001734_9454_9780 108
910 3300053158 Ga0500627_0000049 Ga0500627_0000049_54077_54403 108
911 iso_pu_bacteria 2643221563 2643836387 108
912 iso_pu_bacteria 2643221608 2644052863 108
913 iso_pu_bacteria 2970143518 2970148648 108
914 2162886012 MBSR1b_contig_10712157 MBSR1b_0249.00003890 109
915 3300000549 LJQas_1038148 LJQas_10381481 109
916 3300002239 JGI24034J26672_10118856 JGI24034J26672_101188562 109
917 3300002987 JGI25159J45721_1000002 JGI25159J45721_1000002279 109
918 3300003322 rootL2_10188392 rootL2_101883922 109
919 3300003323 rootH1_10287281 rootH1_102872814 109
920 3300003354 JGI25160J50197_1000008 JGI25160J50197_1000008279 109
921 3300003374 JGI25161J50226_1000380 JGI25161J50226_100038021 109
922 3300003771 Ga0055526_1001532 Ga0055526_100153213 109
923 3300003771 Ga0055526_1020128 Ga0055526_10201282 109
924 3300003775 Ga0055524_1012523 Ga0055524_10125234 109
925 3300003790 Ga0055528_1000695 Ga0055528_100069521 109
926 3300003791 Ga0055530_10028298 Ga0055530_100282983 109
927 3300003792 Ga0055540_1000752 Ga0055540_100075218 109
928 3300003794 Ga0055531_10026168 Ga0055531_100261682 109
929 3300003794 Ga0055531_10042449 Ga0055531_100424492 109
930 3300004625 Ga0055543_1001421 Ga0055543_10014218 109
931 3300005262 Ga0065165_1000015 Ga0065165_1000015280 109
932 3300005290 Ga0065712_10072765 Ga0065712_100727655 109
933 3300005293 Ga0065715_10070852 Ga0065715_100708521 109
934 3300005293 Ga0065715_10115519 Ga0065715_101155194 109
935 3300005327 Ga0070658_10024500 Ga0070658_100245006 109
936 3300005328 Ga0070676_10064522 Ga0070676_100645222 109
937 3300005331 Ga0070670_100000350 Ga0070670_10000035019 109
938 3300005331 Ga0070670_100010030 Ga0070670_1000100305 109
939 3300005331 Ga0070670_100087996 Ga0070670_1000879962 109
940 3300005331 Ga0070670_100380736 Ga0070670_1003807362 109
941 3300005333 Ga0070677_10000600 Ga0070677_100006007 109
942 3300005333 Ga0070677_10037260 Ga0070677_100372602 109
943 3300005333 Ga0070677_10333296 Ga0070677_103332961 109
944 3300005334 Ga0068869_101021888 Ga0068869_1010218882 109
945 3300005338 Ga0068868_100698703 Ga0068868_1006987031 109
946 3300005339 Ga0070660_100121687 Ga0070660_1001216872 109
947 3300005339 Ga0070660_100535787 Ga0070660_1005357872 109
948 3300005339 Ga0070660_100935085 Ga0070660_1009350852 109
949 3300005343 Ga0070687_100858606 Ga0070687_1008586062 109
950 3300005344 Ga0070661_100123269 Ga0070661_1001232692 109
951 3300005347 Ga0070668_100038020 Ga0070668_1000380204 109
952 3300005353 Ga0070669_100009774 Ga0070669_1000097742 109
953 3300005353 Ga0070669_100044937 Ga0070669_1000449373 109
954 3300005354 Ga0070675_100001857 Ga0070675_1000018576 109
955 3300005354 Ga0070675_100002352 Ga0070675_10000235212 109
956 3300005354 Ga0070675_100078800 Ga0070675_1000788002 109
957 3300005355 Ga0070671_100001032 Ga0070671_1000010326 109
958 3300005355 Ga0070671_100164090 Ga0070671_1001640902 109
959 3300005356 Ga0070674_100020755 Ga0070674_1000207554 109
960 3300005356 Ga0070674_100073539 Ga0070674_1000735392 109
961 3300005364 Ga0070673_100517358 Ga0070673_1005173582 109
962 3300005366 Ga0070659_100071386 Ga0070659_1000713861 109
963 3300005366 Ga0070659_100849206 Ga0070659_1008492062 109
964 3300005366 Ga0070659_102143984 Ga0070659_1021439841 109
965 3300005367 Ga0070667_100065993 Ga0070667_1000659933 109
966 3300005367 Ga0070667_100236010 Ga0070667_1002360103 109
967 3300005441 Ga0070700_100088525 Ga0070700_1000885251 109
968 3300005455 Ga0070663_100020031 Ga0070663_1000200315 109
969 3300005455 Ga0070663_100338937 Ga0070663_1003389371 109
970 3300005456 Ga0070678_102173511 Ga0070678_1021735111 109
971 3300005457 Ga0070662_100002989 Ga0070662_1000029894 109
972 3300005457 Ga0070662_100027985 Ga0070662_1000279854 109
973 3300005457 Ga0070662_100366589 Ga0070662_1003665891 109
974 3300005457 Ga0070662_101641616 Ga0070662_1016416162 109
975 3300005459 Ga0068867_101915762 Ga0068867_1019157621 109
976 3300005539 Ga0068853_100458275 Ga0068853_1004582751 109
977 3300005543 Ga0070672_100005437 Ga0070672_1000054375 109
978 3300005543 Ga0070672_100098073 Ga0070672_1000980732 109
979 3300005543 Ga0070672_100169097 Ga0070672_1001690972 109
980 3300005563 Ga0068855_100103093 Ga0068855_1001030935 109
981 3300005564 Ga0070664_100004435 Ga0070664_10000443515 109
982 3300005564 Ga0070664_100094460 Ga0070664_1000944604 109
983 3300005564 Ga0070664_101054141 Ga0070664_1010541412 109
984 3300005577 Ga0068857_100045180 Ga0068857_1000451802 109
985 3300005578 Ga0068854_100199288 Ga0068854_1001992883 109
986 3300005618 Ga0068864_100035579 Ga0068864_1000355793 109
987 3300005618 Ga0068864_100545028 Ga0068864_1005450282 109
988 3300005618 Ga0068864_101211167 Ga0068864_1012111671 109
989 3300005618 Ga0068864_101612833 Ga0068864_1016128331 109
990 3300005834 Ga0068851_10099229 Ga0068851_100992292 109
991 3300005842 Ga0068858_100365714 Ga0068858_1003657143 109
992 3300005844 Ga0068862_101064551 Ga0068862_1010645512 109
993 3300005937 Ga0081455_10244360 Ga0081455_102443602 109
994 3300006038 Ga0075365_11007149 Ga0075365_110071492 109
995 3300006048 Ga0075363_100153476 Ga0075363_1001534762 109
996 3300006048 Ga0075363_100562892 Ga0075363_1005628922 109
997 3300006186 Ga0075369_10196062 Ga0075369_101960622 109
998 3300006186 Ga0075369_10389580 Ga0075369_103895802 109
999 3300006195 Ga0075366_10809815 Ga0075366_108098152 109
1000 3300006353 Ga0075370_10048468 Ga0075370_100484686 109
1001 3300006353 Ga0075370_10272970 Ga0075370_102729702 109
1002 3300006353 Ga0075370_10276764 Ga0075370_102767642 109
1003 3300006844 Ga0075428_100676383 Ga0075428_1006763832 109
1004 3300006880 Ga0075429_100705294 Ga0075429_1007052942 109
1005 3300006881 Ga0068865_101821536 Ga0068865_1018215361 109
1006 3300009094 Ga0111539_10568661 Ga0111539_105686612 109
1007 3300009174 Ga0105241_10437784 Ga0105241_104377842 109
1008 3300009177 Ga0105248_10043271 Ga0105248_100432714 109
1009 3300009545 Ga0105237_10141188 Ga0105237_101411883 109
1010 3300009553 Ga0105249_10073177 Ga0105249_100731775 109
1011 3300011119 Ga0105246_11870196 Ga0105246_118701961 109
1012 3300012497 Ga0157319_1000957 Ga0157319_10009573 109
1013 3300013249 Ga0171463_1001 Ga0171463_1001269 109
1014 3300013306 Ga0163162_10413313 Ga0163162_104133132 109
1015 3300013307 Ga0157372_10154906 Ga0157372_101549062 109
1016 3300013308 Ga0157375_10036695 Ga0157375_100366952 109
1017 3300013308 Ga0157375_10978857 Ga0157375_109788572 109
1018 3300014325 Ga0163163_10956203 Ga0163163_109562032 109
1019 3300014326 Ga0157380_10632682 Ga0157380_106326821 109
1020 3300014326 Ga0157380_11382439 Ga0157380_113824392 109
1021 3300014326 Ga0157380_11660983 Ga0157380_116609832 109
1022 3300015684 Ga0183365_12031 Ga0183365_120312 109
1023 3300015690 Ga0183363_1371 Ga0183363_13715 109
1024 3300017792 Ga0163161_10086971 Ga0163161_100869713 109
1025 3300017792 Ga0163161_10120473 Ga0163161_101204732 109
1026 3300021320 Ga0214544_1009397 Ga0214544_100939712 109
1027 3300021321 Ga0214542_1000006 Ga0214542_10000063 109
1028 3300021321 Ga0214542_1016019 Ga0214542_10160195 109
1029 3300021327 Ga0214543_1000003 Ga0214543_1000003436 109
1030 3300021327 Ga0214543_1000014 Ga0214543_1000014320 109
1031 3300022739 Ga0228711_1000001 Ga0228711_1000001115 109
1032 3300022740 Ga0228710_1000001 Ga0228710_1000001210 109
1033 3300025208 Ga0209436_103040 Ga0209436_1030405 109
1034 3300025273 Ga0209673_1000060 Ga0209673_100006087 109
1035 3300025273 Ga0209673_1001334 Ga0209673_100133415 109
1036 3300025284 Ga0209130_1000007 Ga0209130_100000723 109
1037 3300025292 Ga0209676_1000901 Ga0209676_100090125 109
1038 3300025294 Ga0209025_1000100 Ga0209025_1000100168 109
1039 3300025295 Ga0209564_1000116 Ga0209564_100011687 109
1040 3300025295 Ga0209564_1000439 Ga0209564_100043970 109
1041 3300025298 Ga0209050_1001222 Ga0209050_100122233 109
1042 3300025298 Ga0209050_1021935 Ga0209050_10219353 109
1043 3300025298 Ga0209050_1067080 Ga0209050_10670802 109
1044 3300025299 Ga0209256_1000302 Ga0209256_100030215 109
1045 3300025299 Ga0209256_1001410 Ga0209256_100141023 109
1046 3300025302 Ga0207426_1000064 Ga0207426_100006423 109
1047 3300025303 Ga0209051_1000217 Ga0209051_100021786 109
1048 3300025303 Ga0209051_1001024 Ga0209051_10010245 109
1049 3300025304 Ga0209257_1004371 Ga0209257_10043719 109
1050 3300025304 Ga0209257_1006913 Ga0209257_10069133 109
1051 3300025315 Ga0207697_10003012 Ga0207697_100030125 109
1052 3300025315 Ga0207697_10181534 Ga0207697_101815342 109
1053 3300025315 Ga0207697_10193631 Ga0207697_101936312 109
1054 3300025893 Ga0207682_10002530 Ga0207682_100025304 109
1055 3300025893 Ga0207682_10059152 Ga0207682_100591522 109
1056 3300025901 Ga0207688_10050599 Ga0207688_100505992 109
1057 3300025907 Ga0207645_10005867 Ga0207645_1000586714 109
1058 3300025909 Ga0207705_10073195 Ga0207705_100731952 109
1059 3300025919 Ga0207657_10123293 Ga0207657_101232932 109
1060 3300025920 Ga0207649_10007890 Ga0207649_100078903 109
1061 3300025920 Ga0207649_10105896 Ga0207649_101058962 109
1062 3300025921 Ga0207652_10006724 Ga0207652_100067249 109
1063 3300025923 Ga0207681_10005401 Ga0207681_100054012 109
1064 3300025923 Ga0207681_10191695 Ga0207681_101916954 109
1065 3300025923 Ga0207681_10475544 Ga0207681_104755441 109
1066 3300025923 Ga0207681_10906585 Ga0207681_109065852 109
1067 3300025923 Ga0207681_11481303 Ga0207681_114813032 109
1068 3300025925 Ga0207650_10000916 Ga0207650_1000091624 109
1069 3300025925 Ga0207650_10004697 Ga0207650_1000469710 109
1070 3300025925 Ga0207650_10017569 Ga0207650_100175692 109
1071 3300025925 Ga0207650_10141041 Ga0207650_101410412 109
1072 3300025925 Ga0207650_10251599 Ga0207650_102515992 109
1073 3300025926 Ga0207659_10002256 Ga0207659_100022563 109
1074 3300025926 Ga0207659_10005898 Ga0207659_1000589810 109
1075 3300025926 Ga0207659_10049103 Ga0207659_100491032 109
1076 3300025931 Ga0207644_10009825 Ga0207644_100098253 109
1077 3300025932 Ga0207690_10037801 Ga0207690_100378013 109
1078 3300025932 Ga0207690_11229462 Ga0207690_112294622 109
1079 3300025933 Ga0207706_10045319 Ga0207706_100453194 109
1080 3300025933 Ga0207706_10088024 Ga0207706_100880243 109
1081 3300025933 Ga0207706_10247681 Ga0207706_102476812 109
1082 3300025933 Ga0207706_10323824 Ga0207706_103238243 109
1083 3300025933 Ga0207706_10501988 Ga0207706_105019882 109
1084 3300025933 Ga0207706_10599913 Ga0207706_105999132 109
1085 3300025933 Ga0207706_10776213 Ga0207706_107762132 109
1086 3300025937 Ga0207669_10037527 Ga0207669_100375273 109
1087 3300025937 Ga0207669_10075641 Ga0207669_100756414 109
1088 3300025937 Ga0207669_10516271 Ga0207669_105162712 109
1089 3300025940 Ga0207691_10006503 Ga0207691_100065039 109
1090 3300025940 Ga0207691_10146413 Ga0207691_101464133 109
1091 3300025941 Ga0207711_10101908 Ga0207711_101019083 109
1092 3300025945 Ga0207679_10015840 Ga0207679_100158404 109
1093 3300025945 Ga0207679_10047566 Ga0207679_100475664 109
1094 3300025945 Ga0207679_10137679 Ga0207679_101376793 109
1095 3300025945 Ga0207679_10257464 Ga0207679_102574642 109
1096 3300025945 Ga0207679_10916415 Ga0207679_109164152 109
1097 3300025949 Ga0207667_10068990 Ga0207667_100689902 109
1098 3300025960 Ga0207651_10372654 Ga0207651_103726542 109
1099 3300025960 Ga0207651_10706277 Ga0207651_107062772 109
1100 3300025961 Ga0207712_10026570 Ga0207712_100265702 109
1101 3300025961 Ga0207712_10317656 Ga0207712_103176563 109
1102 3300025972 Ga0207668_10051999 Ga0207668_100519994 109
1103 3300025972 Ga0207668_10126134 Ga0207668_101261343 109
1104 3300025986 Ga0207658_10065281 Ga0207658_100652813 109
1105 3300025986 Ga0207658_10082351 Ga0207658_100823512 109
1106 3300025986 Ga0207658_10088112 Ga0207658_100881123 109
1107 3300026041 Ga0207639_10228607 Ga0207639_102286073 109
1108 3300026067 Ga0207678_10112545 Ga0207678_101125452 109
1109 3300026067 Ga0207678_10298226 Ga0207678_102982262 109
1110 3300026067 Ga0207678_10598340 Ga0207678_105983402 109
1111 3300026067 Ga0207678_10616878 Ga0207678_106168782 109
1112 3300026075 Ga0207708_10149073 Ga0207708_101490732 109
1113 3300026089 Ga0207648_10223064 Ga0207648_102230642 109
1114 3300026095 Ga0207676_10037982 Ga0207676_100379823 109
1115 3300026095 Ga0207676_10084122 Ga0207676_100841222 109
1116 3300026095 Ga0207676_10909574 Ga0207676_109095742 109
1117 3300026116 Ga0207674_10155258 Ga0207674_101552583 109
1118 3300026116 Ga0207674_10354615 Ga0207674_103546152 109
1119 3300026118 Ga0207675_100036255 Ga0207675_1000362556 109
1120 3300026142 Ga0207698_10172821 Ga0207698_101728213 109
1121 3300027111 Ga0209281_1000164 Ga0209281_100016420 109
1122 3300027111 Ga0209281_1000332 Ga0209281_100033223 109
1123 3300027666 Ga0209282_1000007 Ga0209282_1000007137 109
1124 3300028379 Ga0268266_10137298 Ga0268266_101372983 109
1125 3300028379 Ga0268266_10615116 Ga0268266_106151162 109
1126 3300028380 Ga0268265_10988257 Ga0268265_109882572 109
1127 3300028380 Ga0268265_11027405 Ga0268265_110274052 109
1128 3300028786 Ga0307517_10663691 Ga0307517_106636911 109
1129 3300030745 Ga0316182_1057985 Ga0316182_10579852 109
1130 3300031548 Ga0307408_100051353 Ga0307408_1000513534 109
1131 3300031548 Ga0307408_101310604 Ga0307408_1013106042 109
1132 3300031731 Ga0307405_10028431 Ga0307405_100284314 109
1133 3300031731 Ga0307405_10150063 Ga0307405_101500632 109
1134 3300031731 Ga0307405_10171440 Ga0307405_101714402 109
1135 3300031731 Ga0307405_10552705 Ga0307405_105527051 109
1136 3300031731 Ga0307405_11077023 Ga0307405_110770232 109
1137 3300031731 Ga0307405_11973666 Ga0307405_119736661 109
1138 3300031824 Ga0307413_10007256 Ga0307413_100072563 109
1139 3300031824 Ga0307413_10008368 Ga0307413_100083685 109
1140 3300031824 Ga0307413_10019834 Ga0307413_100198343 109
1141 3300031824 Ga0307413_10043051 Ga0307413_100430513 109
1142 3300031824 Ga0307413_10098545 Ga0307413_100985453 109
1143 3300031824 Ga0307413_10286121 Ga0307413_102861212 109
1144 3300031824 Ga0307413_10316911 Ga0307413_103169112 109
1145 3300031824 Ga0307413_10560691 Ga0307413_105606912 109
1146 3300031852 Ga0307410_10001306 Ga0307410_1000130613 109
1147 3300031852 Ga0307410_10025207 Ga0307410_100252074 109
1148 3300031852 Ga0307410_10026018 Ga0307410_100260184 109
1149 3300031852 Ga0307410_10084136 Ga0307410_100841363 109
1150 3300031852 Ga0307410_10085590 Ga0307410_100855903 109
1151 3300031852 Ga0307410_10187292 Ga0307410_101872923 109
1152 3300031852 Ga0307410_10557598 Ga0307410_105575982 109
1153 3300031852 Ga0307410_11357223 Ga0307410_113572232 109
1154 3300031901 Ga0307406_10198552 Ga0307406_101985522 109
1155 3300031901 Ga0307406_10284792 Ga0307406_102847922 109
1156 3300031901 Ga0307406_10310536 Ga0307406_103105362 109
1157 3300031901 Ga0307406_10405980 Ga0307406_104059802 109
1158 3300031901 Ga0307406_10793946 Ga0307406_107939462 109
1159 3300031901 Ga0307406_10951626 Ga0307406_109516261 109
1160 3300031901 Ga0307406_11200408 Ga0307406_112004082 109
1161 3300031901 Ga0307406_11201478 Ga0307406_112014781 109
1162 3300031903 Ga0307407_10333136 Ga0307407_103331361 109
1163 3300031903 Ga0307407_10384831 Ga0307407_103848312 109
1164 3300031903 Ga0307407_10923648 Ga0307407_109236481 109
1165 3300031903 Ga0307407_10948066 Ga0307407_109480662 109
1166 3300031911 Ga0307412_10019162 Ga0307412_100191623 109
1167 3300031911 Ga0307412_10046997 Ga0307412_100469973 109
1168 3300031911 Ga0307412_10053016 Ga0307412_100530163 109
1169 3300031911 Ga0307412_10580729 Ga0307412_105807291 109
1170 3300031911 Ga0307412_10771205 Ga0307412_107712052 109
1171 3300031911 Ga0307412_11060993 Ga0307412_110609932 109
1172 3300031967 Ga0315914_1000006 Ga0315914_1000006106 109
1173 3300031995 Ga0307409_100004848 Ga0307409_1000048483 109
1174 3300031995 Ga0307409_100035151 Ga0307409_1000351516 109
1175 3300031995 Ga0307409_100082523 Ga0307409_1000825234 109
1176 3300031995 Ga0307409_100154851 Ga0307409_1001548512 109
1177 3300031995 Ga0307409_100224574 Ga0307409_1002245742 109
1178 3300032002 Ga0307416_100008213 Ga0307416_1000082136 109
1179 3300032002 Ga0307416_100014578 Ga0307416_1000145786 109
1180 3300032002 Ga0307416_100027573 Ga0307416_1000275734 109
1181 3300032002 Ga0307416_100321447 Ga0307416_1003214472 109
1182 3300032002 Ga0307416_100359682 Ga0307416_1003596822 109
1183 3300032002 Ga0307416_100431452 Ga0307416_1004314521 109
1184 3300032002 Ga0307416_100458297 Ga0307416_1004582972 109
1185 3300032002 Ga0307416_100460002 Ga0307416_1004600021 109
1186 3300032002 Ga0307416_102508581 Ga0307416_1025085812 109
1187 3300032004 Ga0307414_10000797 Ga0307414_100007979 109
1188 3300032004 Ga0307414_10001040 Ga0307414_100010406 109
1189 3300032004 Ga0307414_10194198 Ga0307414_101941982 109
1190 3300032004 Ga0307414_10224063 Ga0307414_102240632 109
1191 3300032005 Ga0307411_10000748 Ga0307411_100007485 109
1192 3300032005 Ga0307411_10001464 Ga0307411_100014646 109
1193 3300032005 Ga0307411_10006109 Ga0307411_100061092 109
1194 3300032005 Ga0307411_10029138 Ga0307411_100291382 109
1195 3300032005 Ga0307411_10244720 Ga0307411_102447202 109
1196 3300032005 Ga0307411_10480958 Ga0307411_104809581 109
1197 3300032005 Ga0307411_10671252 Ga0307411_106712522 109
1198 3300032005 Ga0307411_11593361 Ga0307411_115933611 109
1199 3300032005 Ga0307411_11878271 Ga0307411_118782712 109
1200 3300032126 Ga0307415_100002106 Ga0307415_1000021064 109
1201 3300032126 Ga0307415_100163828 Ga0307415_1001638282 109
1202 3300032126 Ga0307415_100211123 Ga0307415_1002111232 109
1203 3300032126 Ga0307415_100299510 Ga0307415_1002995103 109
1204 3300032126 Ga0307415_101686709 Ga0307415_1016867092 109
1205 3300033430 Ga0315913_1000002 Ga0315913_1000002137 109
1206 3300033464 Ga0315915_1000001 Ga0315915_1000001350 109
1207 3300037471 Ga0395905_0734928 Ga0395905_0734928_321_650 109
1208 3300037471 Ga0395905_0738849 Ga0395905_0738849_530_859 109
1209 3300037471 Ga0395905_0966085 Ga0395905_0966085_110_475 109
1210 3300041413 Ga0439465_0053742 Ga0439465_0053742_730_1059 109
1211 3300041451 Ga0451791_0456541 Ga0451791_0456541_39_368 109
1212 3300041494 Ga0451837_1015036 Ga0451837_1015036_32_373 109
1213 3300042004 Ga0439445_0000389 Ga0439445_0000389_507_863 109
1214 3300042006 Ga0439432_098194 Ga0439432_098194_108_440 109
1215 3300042006 Ga0439432_204285 Ga0439432_204285_198_530 109
1216 3300042007 Ga0439449_0004505 Ga0439449_0004505_1744_2076 109
1217 3300042007 Ga0439449_0078415 Ga0439449_0078415_225_554 109
1218 3300042007 Ga0439449_0161858 Ga0439449_0161858_388_717 109
1219 3300042010 Ga0439452_055554 Ga0439452_055554_274_624 109
1220 3300042015 Ga0439462_0074065 Ga0439462_0074065_70_402 109
1221 3300042015 Ga0439462_0242360 Ga0439462_0242360_131_481 109
1222 3300042435 Ga0439434_0220219 Ga0439434_0220219_266_616 109
1223 3300042435 Ga0439434_0266696 Ga0439434_0266696_88_438 109
1224 3300042876 Ga0451577_0507762 Ga0451577_0507762_721_1050 109
1225 3300044712 Ga0453684_0203560 Ga0453684_0203560_59_394 109
1226 3300046460 Ga0495638_0010960 Ga0495638_0010960_4387_4719 109
1227 3300046460 Ga0495638_0014449 Ga0495638_0014449_3997_4332 109
1228 3300046460 Ga0495638_0034944 Ga0495638_0034944_2231_2560 109
1229 3300046460 Ga0495638_0549108 Ga0495638_0549108_41_370 109
1230 3300046500 Ga0495596_0264005 Ga0495596_0264005_54_386 109
1231 3300046501 Ga0495607_0009645 Ga0495607_0009645_1671_2003 109
1232 3300046506 Ga0495583_0046142 Ga0495583_0046142_1669_2001 109
1233 3300046507 Ga0495606_0080835 Ga0495606_0080835_1676_2008 109
1234 3300046507 Ga0495606_0566136 Ga0495606_0566136_208_537 109
1235 3300046507 Ga0495606_0589518 Ga0495606_0589518_72_401 109
1236 3300046512 Ga0495610_0084939 Ga0495610_0084939_955_1287 109
1237 3300046519 Ga0495632_0012798 Ga0495632_0012798_1431_1763 109
1238 3300046524 Ga0495648_0103025 Ga0495648_0103025_843_1172 109
1239 3300046525 Ga0495663_0102981 Ga0495663_0102981_346_708 109
1240 3300046530 Ga0495654_0010554 Ga0495654_0010554_1711_2043 109
1241 3300046537 Ga0495598_0016102 Ga0495598_0016102_1282_1623 109
1242 3300046539 Ga0495621_0001733 Ga0495621_0001733_4757_5119 109
1243 3300046542 Ga0495597_0037563 Ga0495597_0037563_458_790 109
1244 3300046616 Ga0495668_0648659 Ga0495668_0648659_196_531 109
1245 3300046660 Ga0495625_0016088 Ga0495625_0016088_955_1290 109
1246 3300046660 Ga0495625_0035484 Ga0495625_0035484_2573_2905 109
1247 3300046684 Ga0495669_0000602 Ga0495669_0000602_6000_6329 109
1248 3300046691 Ga0495670_0004937 Ga0495670_0004937_2398_2760 109
1249 3300046691 Ga0495670_0501266 Ga0495670_0501266_170_499 109
1250 3300046692 Ga0495671_0017144 Ga0495671_0017144_3255_3587 109
1251 3300046692 Ga0495671_0030512 Ga0495671_0030512_2212_2544 109
1252 3300046810 Ga0495660_0023484 Ga0495660_0023484_3034_3366 109
1253 3300047445 Ga0495677_0027004 Ga0495677_0027004_853_1182 109
1254 3300047472 Ga0495686_0012540 Ga0495686_0012540_3678_4010 109
1255 3300047472 Ga0495686_0067518 Ga0495686_0067518_1090_1419 109
1256 3300048903 Ga0496100_0613825 Ga0496100_0613825_394_726 109
1257 3300048904 Ga0496101_0748635 Ga0496101_0748635_310_639 109
1258 3300048905 Ga0496102_0250891 Ga0496102_0250891_467_802 109
1259 3300048909 Ga0496106_0973151 Ga0496106_0973151_10_339 109
1260 3300048910 Ga0496107_0386275 Ga0496107_0386275_693_1022 109
1261 3300048912 Ga0496109_0485983 Ga0496109_0485983_92_421 109
1262 3300048912 Ga0496109_0513593 Ga0496109_0513593_577_933 109
1263 3300048912 Ga0496109_0528814 Ga0496109_0528814_757_1086 109
1264 3300048913 Ga0496110_0001413 Ga0496110_0001413_4908_5237 109
1265 3300048914 Ga0496111_0368954 Ga0496111_0368954_289_618 109
1266 3300048917 Ga0496114_0391067 Ga0496114_0391067_544_873 109
1267 3300048918 Ga0496115_1372783 Ga0496115_1372783_85_414 109
1268 3300048920 Ga0496117_0205089 Ga0496117_0205089_109_441 109
1269 3300048921 Ga0496118_0019743 Ga0496118_0019743_466_798 109
1270 3300048924 Ga0496121_0448158 Ga0496121_0448158_45_374 109
1271 3300048928 Ga0496125_0222569 Ga0496125_0222569_669_998 109
1272 3300048929 Ga0496126_0316405 Ga0496126_0316405_446_775 109
1273 3300049573 Ga0501037_0045871 Ga0501037_0045871_13_366 109
1274 3300049574 Ga0501038_0276789 Ga0501038_0276789_164_517 109
1275 3300049584 Ga0501068_0629984 Ga0501068_0629984_99_470 109
1276 3300049590 Ga0501074_0385756 Ga0501074_0385756_136_465 109
1277 3300049590 Ga0501074_1311875 Ga0501074_1311875_43_414 109
1278 3300049591 Ga0501075_0194058 Ga0501075_0194058_535_906 109
1279 3300049664 Ga0501224_005346 Ga0501224_005346_472_813 109
1280 3300049679 Ga0501249_038320 Ga0501249_038320_96_437 109
1281 3300049741 Ga0501079_0724422 Ga0501079_0724422_57_395 109
1282 3300049743 Ga0501081_0012442 Ga0501081_0012442_3561_3932 109
1283 3300049759 Ga0501262_065171 Ga0501262_065171_205_540 109
1284 3300049765 Ga0501268_086003 Ga0501268_086003_279_617 109
1285 3300049766 Ga0501269_005517 Ga0501269_005517_745_1080 109
1286 3300049775 Ga0501279_066484 Ga0501279_066484_89_421 109
1287 3300049823 Ga0501044_0000280 Ga0501044_0000280_60521_60874 109
1288 3300049824 Ga0501045_0651172 Ga0501045_0651172_328_675 109
1289 3300050493 nmdc:mga0k408_492351_c1 nmdc:mga0k408_492351_c1_211_546 109
1290 3300050496 nmdc:mga07m45_251251_c1 nmdc:mga07m45_251251_c1_331_666 109
1291 3300050511 nmdc:mga08y16_406877_c1 nmdc:mga08y16_406877_c1_76_432 109
1292 3300050516 nmdc:mga0sz30_382860_c1 nmdc:mga0sz30_382860_c1_173_508 109
1293 3300050516 nmdc:mga0sz30_9804_c1 nmdc:mga0sz30_9804_c1_1100_1429 109
1294 3300053087 Ga0500643_002982 Ga0500643_002982_6610_6945 109
1295 3300053087 Ga0500643_218016 Ga0500643_218016_165_494 109
1296 3300053098 Ga0500650_0054600 Ga0500650_0054600_572_907 109
1297 3300053104 Ga0500556_0000339 Ga0500556_0000339_27142_27477 109
1298 3300053108 Ga0500562_025902 Ga0500562_025902_599_934 109
1299 3300053109 Ga0500569_009439 Ga0500569_009439_43_375 109
1300 3300053122 Ga0500608_000105 Ga0500608_000105_17325_17657 109
1301 3300053122 Ga0500608_000764 Ga0500608_000764_9763_10098 109
1302 3300053130 Ga0500642_0000001 Ga0500642_0000001_889014_889349 109
1303 3300053134 Ga0500658_0000769 Ga0500658_0000769_4411_4743 109
1304 3300053136 Ga0500559_0312546 Ga0500559_0312546_143_481 109
1305 3300053140 Ga0500573_0285408 Ga0500573_0285408_387_725 109
1306 3300053153 Ga0500616_0318064 Ga0500616_0318064_151_483 109
1307 3300053156 Ga0500622_0030266 Ga0500622_0030266_1489_1818 109
1308 3300053730 Ga0500645_000312 Ga0500645_000312_8779_9114 109
1309 3300054114 Ga0501084_0819463 Ga0501084_0819463_359_700 109
1310 3300054114 Ga0501084_1141472 Ga0501084_1141472_240_611 109
1311 3300060353 Ga0501082_0275088 Ga0501082_0275088_662_1033 109
1312 iso_pu_bacteria 2867507094 2867512749 109

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12840

HTH_20

Helix-turn-helix domain

33

82

0.97

PF01022

HTH_5

Bacterial regulatory protein, arsR family

35

82

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p6f-assembly1.cif.gz_BBB 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9328 5 92
1wq2-assembly1.cif.gz_A neutron crystal structure of dissimilatory sulfite reductase d (dsrd) 0.9266 16 74
8iuh-assembly1.cif.gz_P rna polymerase iii pre-initiation complex open complex 1 0.9228 17 74
7p6f-assembly2.cif.gz_CCC-2 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9212 1 93
3f6o-assembly1.cif.gz_B crystal structure of arsr family transcriptional regulator, rha00566 0.9164 6 92
ID Description Score Start End Superfamily
1wq2A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9266 16 74 1.10.10.10
af_D3ZQ56_68_132_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9254 17 75 1.10.10.10
3f6oB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9164 6 92 1.10.10.10
1sd6A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9153 16 75 1.10.10.10
af_Q9VD25_2_64_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9126 17 75 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A532DH07-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9871 1 83 GO:0003700
AF-A0A3S1TWI8-F1-model_v4 deleted 0.9776 1 91
AF-A0A4Q5ZG98-F1-model_v4 deleted 0.9712 1 81
AF-A0A7C3DR54-F1-model_v4 ArsR family transcriptional regulator 0.9676 5 84 GO:0003700
AF-M6KC98-F1-model_v4 DNA-binding helix-turn-helix protein 0.9664 1 75 GO:0003677
GO:0003700

Feature Viewer

pLDDT pTM Quality
93.23 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map