F492872

General Info

Members Datasets Scaffolds Average Seq Length
1311 390 1310 220

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10020879|Ga0114129_100208791
Length 253
Sequence VVSFQSSSIPLNPGQKLIGICFPSEKETKMALRLGDIAPDFSAETTEGPINFHEWIGDSWAVLFSHPKDFTPVCTTELGYVAKCKPEFDQRGVKVIGLSVDPTDSHKRWAEDIRETQGTALNFPVIADPDHKIAELYDMIHPEISDVFTVRSVFVIGPDKKIKLYITYPASTGRNFDEILRVIDSLQLTAKYSVATPVNWKDGDDVIIVPSLSDEAAKEKFPAGWKAPKPYLRITPQPNKSAESSDTAAKSAS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
4 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
5 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
6 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
14 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
17 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
18 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
46 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
47 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
48 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
49 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
50 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
51 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
52 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
57 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
58 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
59 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
60 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
61 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
62 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
68 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
69 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
70 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
71 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
72 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
73 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
74 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
75 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
83 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
84 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
85 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
86 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
87 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
88 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
91 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
92 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
93 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
94 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
95 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
96 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
97 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
98 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
100 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
101 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
102 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
103 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
104 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
105 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
106 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
107 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
108 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
110 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
111 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
112 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
113 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
115 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
116 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
118 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
119 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
120 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
121 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
122 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
123 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
124 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
125 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
126 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
127 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
128 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
129 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
130 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
131 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
132 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
133 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
134 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
135 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
136 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
137 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
138 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
139 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
142 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
208 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
212 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
213 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
214 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
215 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
216 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
217 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
218 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
219 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
220 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
221 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
222 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
223 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
224 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
225 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
226 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
227 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
228 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
229 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
230 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
231 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
232 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
233 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
234 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
235 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
236 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
237 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
238 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
239 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
240 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
241 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
242 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
243 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
244 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
245 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
246 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
247 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
248 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
249 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
250 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
251 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
252 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
253 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
254 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
255 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
256 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
257 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
258 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
259 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
260 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
261 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
262 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
263 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
264 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
265 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
266 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
267 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
268 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
269 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
270 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
271 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
272 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
273 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
274 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
275 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
276 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
277 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
278 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
279 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
280 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
281 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
282 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
283 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
284 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
285 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
286 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
288 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
289 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
290 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
291 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
292 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
293 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
294 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
295 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
296 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
301 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
302 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
303 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
304 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
305 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
306 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
307 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
308 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
309 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
310 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
311 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
312 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
313 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
314 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
315 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
316 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
317 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
318 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
319 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
320 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
321 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
322 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
323 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
324 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
325 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
326 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
327 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
328 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
329 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
330 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
331 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
332 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
333 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
334 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
335 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
336 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
337 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
338 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
339 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
340 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
343 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
344 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
345 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
346 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
347 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
348 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
349 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
350 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
351 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
352 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
353 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
354 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
355 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
356 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
357 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
358 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
359 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
360 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
361 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
362 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
363 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
364 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
365 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
366 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
367 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
368 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
369 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
370 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
371 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
372 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
373 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
374 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
375 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
376 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
377 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
378 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
379 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
380 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.48
Metatranscriptomes 2.44
Isolates 0.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.44
Nodule 0
Rhizoplane 2.14
Rhizosphere 94.43
Stem 0
Stem Tuber 0
Unclassified 0.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1876824 2162886007 Bacteria 915
2 SwRhRL2b_contig_333894 2162886007 Unclassified 2335
3 MRS1b_contig_7197761 2162886011 Bacteria 1076
4 CNBas_1000356 3300000531 Bacteria 1919
5 CNAas_1000262 3300000532 Bacteria 5019
6 LJQas_1000065 3300000549 Bacteria 17144
7 JGI24737J22298_10092677 3300001990 Bacteria 896
8 JGI24751J29686_10000003 3300002459 Bacteria 157815
9 JGI25406J46586_10006502 3300003203 Bacteria 5377
10 JGI25406J46586_10039049 3300003203 Bacteria 1695
11 rootH2_10056818 3300003320 Bacteria 2741
12 rootL2_10095937 3300003322 Bacteria 9779
13 Ga0055530_10017977 3300003791 Bacteria 2196
14 Ga0058859_10031964 3300004798 Bacteria 999
15 Ga0058859_11695945 3300004798 Bacteria 947
16 Ga0058863_11837207 3300004799 Bacteria 893
17 Ga0058861_11471527 3300004800 Bacteria 895
18 Ga0058860_10034522 3300004801 Bacteria 1053
19 Ga0058860_11737881 3300004801 Bacteria 768
20 Ga0058862_12589100 3300004803 Bacteria 760
21 Ga0058862_12800948 3300004803 Bacteria 826
22 Ga0058862_12821340 3300004803 Bacteria 963
23 Ga0065714_10064425 3300005288 Bacteria 189652
24 Ga0065704_10000829 3300005289 Bacteria 11903
25 Ga0065704_10080070 3300005289 Bacteria 4017
26 Ga0065704_10086130 3300005289 Bacteria 3151
27 Ga0065704_10129117 3300005289 Bacteria 1653
28 Ga0065712_10001262 3300005290 Bacteria 7150
29 Ga0065712_10003563 3300005290 Bacteria 4155
30 Ga0065712_10004631 3300005290 Bacteria 3312
31 Ga0065712_10013558 3300005290 Bacteria 2335
32 Ga0065712_10067727 3300005290 Bacteria 189643
33 Ga0065712_10079425 3300005290 Bacteria 3219
34 Ga0065712_10080397 3300005290 Bacteria 3109
35 Ga0065712_10103634 3300005290 Bacteria 1980
36 Ga0065712_10240815 3300005290 Bacteria 985
37 Ga0065715_10089978 3300005293 Bacteria 7973
38 Ga0065715_10104393 3300005293 Bacteria 2965
39 Ga0065715_10109592 3300005293 Bacteria 2654
40 Ga0065715_10115173 3300005293 Bacteria 2424
41 Ga0065715_10115373 3300005293 Bacteria 2416
42 Ga0065715_10124328 3300005293 Bacteria 2157
43 Ga0065715_10180616 3300005293 Bacteria 1479
44 Ga0065715_10180929 3300005293 Bacteria 1477
45 Ga0065715_10247701 3300005293 Bacteria 1178
46 Ga0065715_10290099 3300005293 Bacteria 1065
47 Ga0065715_10368326 3300005293 Bacteria 925
48 Ga0065715_10396899 3300005293 Bacteria 887
49 Ga0065715_10535185 3300005293 Bacteria 752
50 Ga0065707_10000738 3300005295 Bacteria 19433
51 Ga0065707_10008319 3300005295 Bacteria 2769
52 Ga0065707_10095460 3300005295 Bacteria 3361
53 Ga0065707_10102119 3300005295 Bacteria 2822
54 Ga0065707_10146111 3300005295 Bacteria 1712
55 Ga0065707_10161075 3300005295 Bacteria 1562
56 Ga0065707_10237779 3300005295 Bacteria 1166
57 Ga0070683_100006442 3300005329 Bacteria 9847
58 Ga0070683_100089060 3300005329 Bacteria 2896
59 Ga0070690_100000028 3300005330 Bacteria 67807
60 Ga0070690_100001595 3300005330 Bacteria 11914
61 Ga0070690_100003264 3300005330 Bacteria 8856
62 Ga0070690_100011190 3300005330 Bacteria 5242
63 Ga0070690_100016133 3300005330 Bacteria 4469
64 Ga0070690_100068515 3300005330 Bacteria 2301
65 Ga0070690_100424509 3300005330 Bacteria 981
66 Ga0070670_100002896 3300005331 Bacteria 14202
67 Ga0070670_100006256 3300005331 Bacteria 10077
68 Ga0070670_100047290 3300005331 Bacteria 3702
69 Ga0070670_100053153 3300005331 Bacteria 3478
70 Ga0070670_100070995 3300005331 Bacteria 2990
71 Ga0070670_100142071 3300005331 Bacteria 2076
72 Ga0070670_100167051 3300005331 Unclassified 1908
73 Ga0070670_100237756 3300005331 Bacteria 1586
74 Ga0070670_101132451 3300005331 Bacteria 714
75 Ga0068869_100019148 3300005334 Bacteria 4672
76 Ga0068869_100022876 3300005334 Bacteria 4311
77 Ga0068869_100052599 3300005334 Bacteria 2957
78 Ga0068869_100224008 3300005334 Bacteria 1492
79 Ga0068869_100250644 3300005334 Bacteria 1414
80 Ga0068869_100316991 3300005334 Bacteria 1263
81 Ga0068869_100623402 3300005334 Bacteria 913
82 Ga0070666_10002543 3300005335 Bacteria 11036
83 Ga0070666_10090310 3300005335 Bacteria 2104
84 Ga0070666_10335076 3300005335 Bacteria 1081
85 Ga0070680_100000421 3300005336 Bacteria 28897
86 Ga0070680_100287547 3300005336 Bacteria 1393
87 Ga0070680_100371458 3300005336 Bacteria 1217
88 Ga0070680_100469877 3300005336 Bacteria 1075
89 Ga0070680_100507557 3300005336 Bacteria 1032
90 Ga0070682_100000127 3300005337 Bacteria 65316
91 Ga0070682_100033339 3300005337 Bacteria 3129
92 Ga0070682_100190434 3300005337 Bacteria 1440
93 Ga0070660_100190261 3300005339 Bacteria 1662
94 Ga0070689_100000485 3300005340 Bacteria 23477
95 Ga0070689_100003971 3300005340 Bacteria 9930
96 Ga0070689_100006168 3300005340 Bacteria 8268
97 Ga0070689_100009680 3300005340 Bacteria 6837
98 Ga0070689_100014395 3300005340 Bacteria 5745
99 Ga0070689_100069171 3300005340 Bacteria 2754
100 Ga0070689_100204250 3300005340 Bacteria 1615
101 Ga0070689_100311965 3300005340 Bacteria 1311
102 Ga0070689_100324600 3300005340 Unclassified 1286
103 Ga0070689_100854734 3300005340 Bacteria 803
104 Ga0070691_10281698 3300005341 Bacteria 902
105 Ga0070687_100052966 3300005343 Bacteria 2108
106 Ga0070687_100143758 3300005343 Bacteria 1392
107 Ga0070687_100166240 3300005343 Bacteria 1309
108 Ga0070687_100295912 3300005343 Bacteria 1025
109 Ga0070687_100544416 3300005343 Bacteria 789
110 Ga0070661_100010978 3300005344 Bacteria 6313
111 Ga0070661_100563304 3300005344 Bacteria 918
112 Ga0070661_100732682 3300005344 Bacteria 807
113 Ga0070692_10011072 3300005345 Bacteria 4130
114 Ga0070692_10041057 3300005345 Bacteria 2368
115 Ga0070692_10091585 3300005345 Bacteria 1654
116 Ga0070692_10360363 3300005345 Bacteria 906
117 Ga0070668_100072791 3300005347 Bacteria 2678
118 Ga0070669_100005403 3300005353 Bacteria 9213
119 Ga0070669_100007778 3300005353 Bacteria 7657
120 Ga0070669_100020076 3300005353 Bacteria 4771
121 Ga0070669_100099423 3300005353 Bacteria 2192
122 Ga0070669_100121717 3300005353 Bacteria 1991
123 Ga0070675_100194739 3300005354 Bacteria 1757
124 Ga0070675_100225360 3300005354 Unclassified 1634
125 Ga0070675_100921389 3300005354 Bacteria 801
126 Ga0070671_100005882 3300005355 Bacteria 9774
127 Ga0070671_100011267 3300005355 Bacteria 7184
128 Ga0070671_100034368 3300005355 Bacteria 4196
129 Ga0070671_100037532 3300005355 Bacteria 4018
130 Ga0070671_100155239 3300005355 Bacteria 1933
131 Ga0070671_100759675 3300005355 Bacteria 843
132 Ga0070674_100134908 3300005356 Bacteria 1845
133 Ga0070674_100154249 3300005356 Bacteria 1736
134 Ga0070674_100365580 3300005356 Bacteria 1169
135 Ga0070673_100005533 3300005364 Bacteria 8098
136 Ga0070673_100017733 3300005364 Bacteria 5071
137 Ga0070673_100518389 3300005364 Bacteria 1080
138 Ga0070673_100809097 3300005364 Bacteria 866
139 Ga0070673_101015782 3300005364 Bacteria 773
140 Ga0070688_100032114 3300005365 Bacteria 3163
141 Ga0070688_100085882 3300005365 Unclassified 2046
142 Ga0070688_100279606 3300005365 Bacteria 1199
143 Ga0070688_100323249 3300005365 Bacteria 1122
144 Ga0070688_100325748 3300005365 Bacteria 1118
145 Ga0070688_100495661 3300005365 Bacteria 920
146 Ga0070659_100018596 3300005366 Bacteria 5245
147 Ga0070659_100058089 3300005366 Bacteria 3052
148 Ga0070659_100656431 3300005366 Bacteria 905
149 Ga0070667_100005724 3300005367 Bacteria 10381
150 Ga0070667_100060127 3300005367 Unclassified 3215
151 Ga0070667_100086358 3300005367 Bacteria 2691
152 Ga0070703_10000179 3300005406 Bacteria 30956
153 Ga0070703_10005734 3300005406 Bacteria 3476
154 Ga0070710_10695401 3300005437 Bacteria 717
155 Ga0070701_10007022 3300005438 Bacteria 4776
156 Ga0070701_10007157 3300005438 Bacteria 4745
157 Ga0070701_10279757 3300005438 Bacteria 1018
158 Ga0070701_10414871 3300005438 Bacteria 856
159 Ga0070711_100000013 3300005439 Bacteria 161148
160 Ga0070705_100000331 3300005440 Bacteria 27964
161 Ga0070705_100030966 3300005440 Bacteria 2958
162 Ga0070705_100050866 3300005440 Bacteria 2413
163 Ga0070705_100058014 3300005440 Bacteria 2286
164 Ga0070705_100063912 3300005440 Bacteria 2197
165 Ga0070705_100175116 3300005440 Bacteria 1448
166 Ga0070705_100223723 3300005440 Bacteria 1305
167 Ga0070705_100272796 3300005440 Bacteria 1199
168 Ga0070700_100000516 3300005441 Bacteria 19288
169 Ga0070700_100000645 3300005441 Bacteria 17252
170 Ga0070700_100028256 3300005441 Bacteria 3334
171 Ga0070700_100030528 3300005441 Bacteria 3222
172 Ga0070700_100180282 3300005441 Bacteria 1469
173 Ga0070700_100214079 3300005441 Bacteria 1361
174 Ga0070700_100231212 3300005441 Bacteria 1316
175 Ga0070700_100630265 3300005441 Bacteria 844
176 Ga0070694_100009355 3300005444 Bacteria 6014
177 Ga0070694_100009682 3300005444 Bacteria 5918
178 Ga0070694_100053984 3300005444 Bacteria 2721
179 Ga0070694_100074460 3300005444 Unclassified 2347
180 Ga0070694_100120848 3300005444 Bacteria 1879
181 Ga0070694_100133515 3300005444 Bacteria 1796
182 Ga0070694_100296935 3300005444 Bacteria 1237
183 Ga0070694_100368105 3300005444 Bacteria 1118
184 Ga0070694_100605886 3300005444 Bacteria 882
185 Ga0070708_100000042 3300005445 Bacteria 83511
186 Ga0070708_100079378 3300005445 Bacteria 2969
187 Ga0070708_100105618 3300005445 Bacteria 2584
188 Ga0070708_100122743 3300005445 Bacteria 2398
189 Ga0070708_100145761 3300005445 Bacteria 2199
190 Ga0070708_100215507 3300005445 Bacteria 1799
191 Ga0070708_100562120 3300005445 Bacteria 1076
192 Ga0070663_100034311 3300005455 Bacteria 3514
193 Ga0070663_100164421 3300005455 Bacteria 1710
194 Ga0070678_100043493 3300005456 Bacteria 3200
195 Ga0070678_100337886 3300005456 Bacteria 1291
196 Ga0070678_100403624 3300005456 Bacteria 1188
197 Ga0070678_100643863 3300005456 Bacteria 950
198 Ga0070662_100046742 3300005457 Bacteria 3110
199 Ga0070662_100066872 3300005457 Bacteria 2638
200 Ga0070662_100212555 3300005457 Bacteria 1540
201 Ga0070662_100253708 3300005457 Bacteria 1415
202 Ga0070681_10000053 3300005458 Bacteria 81387
203 Ga0070681_10014275 3300005458 Bacteria 7905
204 Ga0070681_10021041 3300005458 Bacteria 6536
205 Ga0070681_10145352 3300005458 Bacteria 2300
206 Ga0070681_10742147 3300005458 Bacteria 898
207 Ga0068867_100033387 3300005459 Bacteria 3726
208 Ga0068867_100053425 3300005459 Bacteria 2984
209 Ga0068867_100065549 3300005459 Bacteria 2703
210 Ga0068867_100105891 3300005459 Bacteria 2154
211 Ga0068867_100195872 3300005459 Bacteria 1615
212 Ga0068867_100430948 3300005459 Bacteria 1119
213 Ga0068867_100437594 3300005459 Bacteria 1111
214 Ga0068867_100667281 3300005459 Bacteria 914
215 Ga0070685_10006057 3300005466 Bacteria 6165
216 Ga0070685_10032431 3300005466 Bacteria 2925
217 Ga0070685_10103209 3300005466 Bacteria 1744
218 Ga0070685_10126084 3300005466 Bacteria 1595
219 Ga0070685_10180482 3300005466 Bacteria 1359
220 Ga0070685_10225090 3300005466 Bacteria 1231
221 Ga0070685_10288130 3300005466 Bacteria 1102
222 Ga0070685_10288357 3300005466 Bacteria 1102
223 Ga0070706_100000305 3300005467 Bacteria 59523
224 Ga0070706_100001365 3300005467 Bacteria 25959
225 Ga0070706_100011232 3300005467 Bacteria 8317
226 Ga0070706_100140347 3300005467 Bacteria 2256
227 Ga0070706_100161902 3300005467 Bacteria 2090
228 Ga0070706_100289769 3300005467 Unclassified 1528
229 Ga0070706_100308505 3300005467 Bacteria 1476
230 Ga0070706_101044167 3300005467 Bacteria 753
231 Ga0070707_100000015 3300005468 Bacteria 144611
232 Ga0070707_100000108 3300005468 Bacteria 76022
233 Ga0070707_100052168 3300005468 Bacteria 3921
234 Ga0070707_100059545 3300005468 Bacteria 3663
235 Ga0070707_100135619 3300005468 Bacteria 2394
236 Ga0070707_100265533 3300005468 Bacteria 1669
237 Ga0070707_100286846 3300005468 Bacteria 1600
238 Ga0070707_100336895 3300005468 Bacteria 1466
239 Ga0070707_100730905 3300005468 Bacteria 953
240 Ga0070698_100000179 3300005471 Bacteria 59634
241 Ga0070698_100004484 3300005471 Bacteria 15352
242 Ga0070698_100004813 3300005471 Bacteria 14816
243 Ga0070698_100033500 3300005471 Bacteria 5320
244 Ga0070698_100048626 3300005471 Bacteria 4333
245 Ga0070698_100068371 3300005471 Bacteria 3570
246 Ga0070698_100123779 3300005471 Bacteria 2544
247 Ga0070698_100235375 3300005471 Bacteria 1764
248 Ga0070698_100351722 3300005471 Bacteria 1405
249 Ga0070699_100000062 3300005518 Bacteria 101909
250 Ga0070699_100018147 3300005518 Bacteria 6045
251 Ga0070699_100027829 3300005518 Bacteria 4876
252 Ga0070699_100053154 3300005518 Bacteria 3506
253 Ga0070699_100120465 3300005518 Bacteria 2307
254 Ga0070699_100334442 3300005518 Bacteria 1363
255 Ga0070699_100413370 3300005518 Bacteria 1221
256 Ga0070699_100415358 3300005518 Bacteria 1217
257 Ga0070699_100480877 3300005518 Bacteria 1127
258 Ga0070699_100535454 3300005518 Bacteria 1065
259 Ga0070679_100000030 3300005530 Bacteria 108148
260 Ga0070679_100057191 3300005530 Bacteria 3887
261 Ga0070679_100389431 3300005530 Bacteria 1340
262 Ga0070684_100002281 3300005535 Bacteria 14131
263 Ga0070684_100110192 3300005535 Bacteria 2468
264 Ga0070684_100530474 3300005535 Bacteria 1092
265 Ga0070697_100000377 3300005536 Bacteria 34909
266 Ga0070697_100005855 3300005536 Bacteria 9485
267 Ga0070697_100013784 3300005536 Bacteria 6341
268 Ga0070697_100024665 3300005536 Bacteria 4789
269 Ga0070697_100089740 3300005536 Bacteria 2540
270 Ga0070697_100151728 3300005536 Bacteria 1953
271 Ga0070697_100207006 3300005536 Bacteria 1669
272 Ga0068853_100005648 3300005539 Bacteria 9831
273 Ga0068853_100020508 3300005539 Bacteria 5496
274 Ga0068853_101222362 3300005539 Bacteria 726
275 Ga0070672_100038051 3300005543 Bacteria 3674
276 Ga0070672_100068037 3300005543 Bacteria 2824
277 Ga0070672_100078866 3300005543 Bacteria 2635
278 Ga0070672_100209464 3300005543 Bacteria 1632
279 Ga0070672_100271091 3300005543 Bacteria 1433
280 Ga0070672_100558483 3300005543 Bacteria 994
281 Ga0070672_100873614 3300005543 Bacteria 793
282 Ga0070686_100006775 3300005544 Bacteria 6379
283 Ga0070686_100026324 3300005544 Bacteria 3510
284 Ga0070686_100109277 3300005544 Bacteria 1881
285 Ga0070686_100153256 3300005544 Bacteria 1616
286 Ga0070695_100055964 3300005545 Bacteria 2544
287 Ga0070695_100096559 3300005545 Bacteria 1983
288 Ga0070695_100190685 3300005545 Bacteria 1459
289 Ga0070695_100199684 3300005545 Bacteria 1428
290 Ga0070695_100259266 3300005545 Bacteria 1269
291 Ga0070695_100329478 3300005545 Bacteria 1138
292 Ga0070695_100390353 3300005545 Bacteria 1053
293 Ga0070695_100408168 3300005545 Bacteria 1031
294 Ga0070695_100941854 3300005545 Bacteria 699
295 Ga0070696_100000407 3300005546 Bacteria 26749
296 Ga0070696_100006330 3300005546 Bacteria 7924
297 Ga0070696_100008878 3300005546 Bacteria 6724
298 Ga0070696_100021118 3300005546 Bacteria 4413
299 Ga0070696_100037377 3300005546 Unclassified 3350
300 Ga0070696_100050813 3300005546 Bacteria 2882
301 Ga0070696_100053597 3300005546 Bacteria 2808
302 Ga0070696_100099026 3300005546 Bacteria 2086
303 Ga0070696_100105037 3300005546 Bacteria 2029
304 Ga0070696_100113071 3300005546 Bacteria 1957
305 Ga0070696_100118292 3300005546 Bacteria 1916
306 Ga0070696_100165866 3300005546 Bacteria 1630
307 Ga0070696_100185767 3300005546 Bacteria 1544
308 Ga0070696_100395008 3300005546 Bacteria 1081
309 Ga0070696_100509242 3300005546 Bacteria 959
310 Ga0070693_100005168 3300005547 Bacteria 6241
311 Ga0070693_100009962 3300005547 Bacteria 4745
312 Ga0070693_100037897 3300005547 Bacteria 2691
313 Ga0070693_100048883 3300005547 Bacteria 2410
314 Ga0070693_100055714 3300005547 Bacteria 2279
315 Ga0070693_100583624 3300005547 Bacteria 805
316 Ga0070665_100037083 3300005548 Bacteria 4903
317 Ga0070704_100007453 3300005549 Bacteria 6517
318 Ga0070704_100053350 3300005549 Bacteria 2857
319 Ga0070704_100056220 3300005549 Bacteria 2793
320 Ga0070704_100097836 3300005549 Bacteria 2203
321 Ga0070704_100108344 3300005549 Bacteria 2109
322 Ga0070704_100130851 3300005549 Bacteria 1945
323 Ga0070704_100555425 3300005549 Bacteria 1004
324 Ga0070704_100951353 3300005549 Bacteria 775
325 Ga0068855_100087221 3300005563 Bacteria 3607
326 Ga0068855_100227266 3300005563 Bacteria 2091
327 Ga0068855_101237986 3300005563 Bacteria 775
328 Ga0070664_100000148 3300005564 Bacteria 48402
329 Ga0070664_100003302 3300005564 Bacteria 13031
330 Ga0070664_100038091 3300005564 Bacteria 4046
331 Ga0070664_100084436 3300005564 Bacteria 2741
332 Ga0070664_100176420 3300005564 Bacteria 1897
333 Ga0070664_100199155 3300005564 Bacteria 1787
334 Ga0070664_100213759 3300005564 Bacteria 1724
335 Ga0070664_100343651 3300005564 Bacteria 1356
336 Ga0068857_100012788 3300005577 Bacteria 7317
337 Ga0068857_100041888 3300005577 Bacteria 4061
338 Ga0068857_100084816 3300005577 Bacteria 2831
339 Ga0068857_100183617 3300005577 Bacteria 1904
340 Ga0068857_100597863 3300005577 Bacteria 1043
341 Ga0068857_100751979 3300005577 Bacteria 929
342 Ga0068857_100832009 3300005577 Bacteria 883
343 Ga0068857_100904173 3300005577 Unclassified 847
344 Ga0068854_100134409 3300005578 Bacteria 1892
345 Ga0068854_100223781 3300005578 Bacteria 1490
346 Ga0068854_100252718 3300005578 Bacteria 1408
347 Ga0068854_100349640 3300005578 Bacteria 1210
348 Ga0068854_100392104 3300005578 Bacteria 1147
349 Ga0068854_100469401 3300005578 Bacteria 1054
350 Ga0068854_100637353 3300005578 Bacteria 914
351 Ga0068856_100015456 3300005614 Bacteria 7375
352 Ga0068856_100124725 3300005614 Unclassified 2578
353 Ga0068856_100646778 3300005614 Bacteria 1078
354 Ga0070702_100013276 3300005615 Bacteria 4155
355 Ga0070702_100016181 3300005615 Bacteria 3823
356 Ga0070702_100016247 3300005615 Bacteria 3815
357 Ga0070702_100032184 3300005615 Bacteria 2876
358 Ga0068852_100040345 3300005616 Bacteria 3937
359 Ga0068852_100093840 3300005616 Bacteria 2690
360 Ga0068852_100551494 3300005616 Bacteria 1153
361 Ga0068852_101018401 3300005616 Bacteria 847
362 Ga0068859_100001575 3300005617 Bacteria 23246
363 Ga0068859_100002187 3300005617 Bacteria 19854
364 Ga0068859_100011747 3300005617 Bacteria 8797
365 Ga0068859_100011920 3300005617 Bacteria 8734
366 Ga0068859_100041995 3300005617 Bacteria 4593
367 Ga0068859_100069624 3300005617 Bacteria 3553
368 Ga0068859_100079254 3300005617 Bacteria 3324
369 Ga0068859_100105209 3300005617 Bacteria 2881
370 Ga0068859_100280881 3300005617 Bacteria 1758
371 Ga0068859_100371609 3300005617 Bacteria 1525
372 Ga0068859_100445092 3300005617 Bacteria 1392
373 Ga0068859_100468556 3300005617 Bacteria 1355
374 Ga0068859_100886998 3300005617 Bacteria 977
375 Ga0068859_101513349 3300005617 Bacteria 741
376 Ga0068864_100015996 3300005618 Bacteria 6241
377 Ga0068864_100023701 3300005618 Bacteria 5156
378 Ga0068864_100023785 3300005618 Bacteria 5147
379 Ga0068864_100109841 3300005618 Unclassified 2455
380 Ga0068864_100130971 3300005618 Bacteria 2253
381 Ga0068864_100156985 3300005618 Bacteria 2065
382 Ga0068864_100157461 3300005618 Bacteria 2062
383 Ga0068864_100384660 3300005618 Bacteria 1330
384 Ga0068864_100463708 3300005618 Bacteria 1213
385 Ga0068864_100598590 3300005618 Unclassified 1070
386 Ga0068864_100700074 3300005618 Bacteria 990
387 Ga0068864_100833200 3300005618 Bacteria 908
388 Ga0068866_10010335 3300005718 Bacteria 3998
389 Ga0068866_10013317 3300005718 Bacteria 3606
390 Ga0068866_10278879 3300005718 Bacteria 1035
391 Ga0068861_100018221 3300005719 Bacteria 4998
392 Ga0068861_100030549 3300005719 Bacteria 3949
393 Ga0068861_100126534 3300005719 Bacteria 2068
394 Ga0068861_100139933 3300005719 Bacteria 1974
395 Ga0068861_100196547 3300005719 Bacteria 1690
396 Ga0068861_100295759 3300005719 Bacteria 1400
397 Ga0068861_100348704 3300005719 Bacteria 1298
398 Ga0068861_100361312 3300005719 Bacteria 1277
399 Ga0068861_100405022 3300005719 Bacteria 1211
400 Ga0068861_100464308 3300005719 Bacteria 1137
401 Ga0068861_100584100 3300005719 Bacteria 1023
402 Ga0068861_100648079 3300005719 Bacteria 975
403 Ga0068861_100809996 3300005719 Bacteria 880
404 Ga0068861_101247413 3300005719 Bacteria 721
405 Ga0068851_10001281 3300005834 Bacteria 10969
406 Ga0068870_10039482 3300005840 Bacteria 2443
407 Ga0068870_10115444 3300005840 Bacteria 1539
408 Ga0068870_10132383 3300005840 Bacteria 1450
409 Ga0068863_100010284 3300005841 Bacteria 9092
410 Ga0068863_100052392 3300005841 Bacteria 3868
411 Ga0068863_100116953 3300005841 Bacteria 2541
412 Ga0068863_100143325 3300005841 Bacteria 2284
413 Ga0068863_100564628 3300005841 Bacteria 1124
414 Ga0068863_100847915 3300005841 Bacteria 913
415 Ga0068863_100934441 3300005841 Bacteria 868
416 Ga0068858_100003653 3300005842 Bacteria 15227
417 Ga0068858_100093232 3300005842 Bacteria 2803
418 Ga0068858_100096439 3300005842 Bacteria 2755
419 Ga0068858_100193503 3300005842 Unclassified 1922
420 Ga0068858_100207727 3300005842 Bacteria 1853
421 Ga0068858_100226002 3300005842 Bacteria 1773
422 Ga0068858_100228502 3300005842 Bacteria 1763
423 Ga0068858_100255704 3300005842 Bacteria 1664
424 Ga0068858_100516340 3300005842 Bacteria 1155
425 Ga0068858_100766825 3300005842 Bacteria 940
426 Ga0068860_100003890 3300005843 Bacteria 15346
427 Ga0068860_100033226 3300005843 Bacteria 4952
428 Ga0068860_100042101 3300005843 Bacteria 4364
429 Ga0068860_100134777 3300005843 Bacteria 2371
430 Ga0068860_100500877 3300005843 Bacteria 1212
431 Ga0068860_100972775 3300005843 Unclassified 866
432 Ga0068862_100003050 3300005844 Bacteria 14593
433 Ga0068862_100007256 3300005844 Bacteria 9200
434 Ga0068862_100041205 3300005844 Unclassified 3929
435 Ga0068862_100041894 3300005844 Bacteria 3898
436 Ga0068862_100066785 3300005844 Bacteria 3099
437 Ga0068862_100085899 3300005844 Bacteria 2734
438 Ga0068862_100691194 3300005844 Bacteria 987
439 Ga0068862_100841479 3300005844 Bacteria 899
440 Ga0081455_10001687 3300005937 Bacteria 26766
441 Ga0081455_10020179 3300005937 Bacteria 6285
442 Ga0081540_1124227 3300005983 Eukaryota 1065
443 Ga0081539_10000481 3300005985 Bacteria 84382
444 Ga0081539_10000894 3300005985 Bacteria 56997
445 Ga0081539_10015632 3300005985 Bacteria 5501
446 Ga0081539_10092100 3300005985 Bacteria 1564
447 Ga0070717_10073256 3300006028 Bacteria 2862
448 Ga0070716_100000003 3300006173 Bacteria 312721
449 Ga0070716_100099154 3300006173 Bacteria 1782
450 Ga0075367_10262618 3300006178 Bacteria 1084
451 Ga0075366_10241062 3300006195 Bacteria 1102
452 Ga0097621_100016538 3300006237 Bacteria 5579
453 Ga0097621_100018262 3300006237 Bacteria 5352
454 Ga0097621_100021474 3300006237 Bacteria 4995
455 Ga0097621_100052203 3300006237 Bacteria 3330
456 Ga0097621_100060254 3300006237 Bacteria 3111
457 Ga0097621_100488756 3300006237 Bacteria 1114
458 Ga0068871_100004853 3300006358 Bacteria 9397
459 Ga0068871_100006785 3300006358 Bacteria 8136
460 Ga0068871_100037219 3300006358 Bacteria 3880
461 Ga0068871_100142271 3300006358 Bacteria 2040
462 Ga0068871_100171045 3300006358 Bacteria 1862
463 Ga0068871_100230448 3300006358 Bacteria 1607
464 Ga0068871_100276808 3300006358 Bacteria 1467
465 Ga0068871_100965479 3300006358 Bacteria 792
466 Ga0075428_100359200 3300006844 Bacteria 1563
467 Ga0075428_100497178 3300006844 Bacteria 1305
468 Ga0075428_100536921 3300006844 Bacteria 1250
469 Ga0075428_101134591 3300006844 Bacteria 825
470 Ga0075430_100008630 3300006846 Bacteria 8595
471 Ga0075430_100017968 3300006846 Bacteria 6019
472 Ga0075430_100085326 3300006846 Bacteria 2644
473 Ga0075430_100435889 3300006846 Bacteria 1082
474 Ga0075430_100577975 3300006846 Bacteria 927
475 Ga0075431_100035439 3300006847 Bacteria 5138
476 Ga0075431_100037575 3300006847 Bacteria 4987
477 Ga0075431_100057804 3300006847 Bacteria 4000
478 Ga0075431_100066610 3300006847 Bacteria 3718
479 Ga0075431_100100445 3300006847 Bacteria 2985
480 Ga0075431_100155084 3300006847 Bacteria 2356
481 Ga0075431_100602523 3300006847 Bacteria 1082
482 Ga0075431_101100799 3300006847 Bacteria 759
483 Ga0075431_101282056 3300006847 Bacteria 694
484 Ga0075433_10032185 3300006852 Bacteria 4491
485 Ga0075433_10037648 3300006852 Bacteria 4174
486 Ga0075433_10042324 3300006852 Bacteria 3951
487 Ga0075433_10080265 3300006852 Bacteria 2875
488 Ga0075433_10110253 3300006852 Bacteria 2441
489 Ga0075433_10114189 3300006852 Bacteria 2396
490 Ga0075433_10126487 3300006852 Bacteria 2270
491 Ga0075433_10139143 3300006852 Bacteria 2158
492 Ga0075433_10218449 3300006852 Bacteria 1693
493 Ga0075433_10233543 3300006852 Bacteria 1633
494 Ga0075433_10299122 3300006852 Bacteria 1425
495 Ga0075433_10638665 3300006852 Bacteria 934
496 Ga0075434_100012109 3300006871 Bacteria 8166
497 Ga0075434_100026758 3300006871 Bacteria 5656
498 Ga0075434_100088868 3300006871 Bacteria 3091
499 Ga0075434_100158930 3300006871 Bacteria 2279
500 Ga0075434_100261117 3300006871 Bacteria 1751
501 Ga0075434_100417650 3300006871 Bacteria 1362
502 Ga0075434_100616942 3300006871 Bacteria 1103
503 Ga0075434_100652644 3300006871 Bacteria 1070
504 Ga0075429_100022418 3300006880 Bacteria 5477
505 Ga0075429_100127297 3300006880 Unclassified 2227
506 Ga0075429_100132862 3300006880 Bacteria 2178
507 Ga0075429_100212982 3300006880 Unclassified 1692
508 Ga0075429_100492724 3300006880 Bacteria 1074
509 Ga0068865_100018879 3300006881 Bacteria 4456
510 Ga0068865_100076284 3300006881 Bacteria 2392
511 Ga0068865_100388368 3300006881 Unclassified 1140
512 Ga0075436_100001040 3300006914 Bacteria 18697
513 Ga0075436_100105479 3300006914 Bacteria 1965
514 Ga0097620_100001575 3300006931 Bacteria 23246
515 Ga0097620_100002186 3300006931 Bacteria 19854
516 Ga0097620_100011747 3300006931 Bacteria 8797
517 Ga0097620_100011920 3300006931 Bacteria 8734
518 Ga0097620_100041994 3300006931 Bacteria 4593
519 Ga0097620_100069624 3300006931 Bacteria 3553
520 Ga0097620_100079256 3300006931 Bacteria 3324
521 Ga0097620_100105213 3300006931 Bacteria 2881
522 Ga0097620_100185788 3300006931 Bacteria 2162
523 Ga0097620_100280879 3300006931 Bacteria 1758
524 Ga0097620_100371600 3300006931 Bacteria 1525
525 Ga0097620_100445123 3300006931 Bacteria 1392
526 Ga0097620_100468582 3300006931 Bacteria 1355
527 Ga0097620_100886815 3300006931 Bacteria 977
528 Ga0097620_101513497 3300006931 Bacteria 741
529 Ga0075435_100000658 3300007076 Bacteria 21278
530 Ga0075435_100081544 3300007076 Bacteria 2658
531 Ga0075435_100280424 3300007076 Bacteria 1422
532 Ga0075435_100290935 3300007076 Bacteria 1396
533 Ga0075435_100382440 3300007076 Bacteria 1209
534 Ga0075435_100557056 3300007076 Bacteria 993
535 Ga0099794_10012526 3300007265 Bacteria 3662
536 Ga0099794_10178415 3300007265 Bacteria 1084
537 Ga0105251_10073124 3300009011 Bacteria 1593
538 Ga0105251_10098085 3300009011 Bacteria 1341
539 Ga0105240_10044998 3300009093 Bacteria 5602
540 Ga0105240_10926597 3300009093 Bacteria 936
541 Ga0111539_10000867 3300009094 Bacteria 39497
542 Ga0111539_10001279 3300009094 Bacteria 33592
543 Ga0111539_10001564 3300009094 Bacteria 30474
544 Ga0111539_10101746 3300009094 Bacteria 3373
545 Ga0111539_10114115 3300009094 Bacteria 3168
546 Ga0111539_10185305 3300009094 Bacteria 2431
547 Ga0111539_10329136 3300009094 Bacteria 1778
548 Ga0111539_10380291 3300009094 Bacteria 1644
549 Ga0111539_10535552 3300009094 Bacteria 1364
550 Ga0111539_11342789 3300009094 Bacteria 830
551 Ga0105245_10075299 3300009098 Bacteria 3073
552 Ga0105245_10665849 3300009098 Bacteria 1072
553 Ga0105247_10000601 3300009101 Bacteria 29159
554 Ga0105247_10013198 3300009101 Bacteria 4957
555 Ga0105247_10386084 3300009101 Bacteria 994
556 Ga0105247_10469462 3300009101 Bacteria 911
557 Ga0114129_10020879 3300009147 Bacteria 9303
558 Ga0114129_10030274 3300009147 Bacteria 7662
559 Ga0114129_10033689 3300009147 Bacteria 7237
560 Ga0114129_10176276 3300009147 Bacteria 2912
561 Ga0114129_10196672 3300009147 Bacteria 2734
562 Ga0114129_10402416 3300009147 Bacteria 1804
563 Ga0114129_10404414 3300009147 Bacteria 1799
564 Ga0114129_10428106 3300009147 Bacteria 1739
565 Ga0114129_10471567 3300009147 Bacteria 1644
566 Ga0114129_10610320 3300009147 Bacteria 1412
567 Ga0114129_10785360 3300009147 Bacteria 1216
568 Ga0114129_10954828 3300009147 Unclassified 1083
569 Ga0114129_11555243 3300009147 Bacteria 811
570 Ga0105243_10000050 3300009148 Bacteria 142670
571 Ga0105243_10032206 3300009148 Bacteria 4049
572 Ga0105243_10064428 3300009148 Bacteria 2941
573 Ga0105243_10094542 3300009148 Bacteria 2468
574 Ga0105243_10126505 3300009148 Bacteria 2163
575 Ga0105243_10305632 3300009148 Bacteria 1443
576 Ga0105243_10466201 3300009148 Bacteria 1189
577 Ga0105243_10611854 3300009148 Bacteria 1050
578 Ga0105243_10666894 3300009148 Bacteria 1010
579 Ga0105243_10814878 3300009148 Unclassified 921
580 Ga0105241_10015189 3300009174 Bacteria 5639
581 Ga0105241_10033309 3300009174 Bacteria 3867
582 Ga0105241_10037269 3300009174 Bacteria 3662
583 Ga0105241_10070312 3300009174 Bacteria 2716
584 Ga0105241_10112857 3300009174 Bacteria 2178
585 Ga0105241_10171604 3300009174 Bacteria 1792
586 Ga0105241_10907214 3300009174 Bacteria 819
587 Ga0105242_10000654 3300009176 Bacteria 27117
588 Ga0105242_10010374 3300009176 Bacteria 7144
589 Ga0105242_10025344 3300009176 Bacteria 4693
590 Ga0105242_10025874 3300009176 Bacteria 4648
591 Ga0105242_10236901 3300009176 Bacteria 1639
592 Ga0105242_10265737 3300009176 Bacteria 1552
593 Ga0105242_10411429 3300009176 Bacteria 1265
594 Ga0105242_10820359 3300009176 Bacteria 923
595 Ga0105248_10006741 3300009177 Bacteria 12597
596 Ga0105248_10006862 3300009177 Bacteria 12485
597 Ga0105248_10010650 3300009177 Bacteria 10142
598 Ga0105248_10040098 3300009177 Bacteria 5249
599 Ga0105248_10062483 3300009177 Bacteria 4181
600 Ga0105248_10093536 3300009177 Bacteria 3385
601 Ga0105248_10257786 3300009177 Bacteria 1963
602 Ga0105248_10331654 3300009177 Bacteria 1713
603 Ga0105248_10380153 3300009177 Bacteria 1590
604 Ga0105248_10449588 3300009177 Bacteria 1452
605 Ga0105248_10536831 3300009177 Bacteria 1319
606 Ga0105248_10997338 3300009177 Bacteria 946
607 Ga0105237_10000521 3300009545 Bacteria 54240
608 Ga0105237_10008814 3300009545 Bacteria 10877
609 Ga0105237_10547031 3300009545 Bacteria 1164
610 Ga0105238_10018282 3300009551 Bacteria 7132
611 Ga0105238_10157869 3300009551 Bacteria 2243
612 Ga0105249_10000201 3300009553 Bacteria 68199
613 Ga0105249_10016243 3300009553 Bacteria 6601
614 Ga0105249_10042539 3300009553 Bacteria 4132
615 Ga0105249_10097360 3300009553 Bacteria 2762
616 Ga0105249_10116041 3300009553 Bacteria 2537
617 Ga0105249_10129962 3300009553 Bacteria 2403
618 Ga0105249_10151407 3300009553 Bacteria 2234
619 Ga0105249_11073559 3300009553 Bacteria 875
620 Ga0105239_10061392 3300010375 Bacteria 4125
621 Ga0105239_10102964 3300010375 Bacteria 3160
622 Ga0105239_10316117 3300010375 Bacteria 1760
623 Ga0105246_10069181 3300011119 Unclassified 2478
624 Ga0105246_10400750 3300011119 Bacteria 1139
625 Ga0105246_10433483 3300011119 Bacteria 1100
626 Ga0157373_10025718 3300013100 Bacteria 4255
627 Ga0157373_10093645 3300013100 Bacteria 2116
628 Ga0157373_10118581 3300013100 Bacteria 1860
629 Ga0157373_10187574 3300013100 Bacteria 1457
630 Ga0157373_10270450 3300013100 Bacteria 1203
631 Ga0157370_10460798 3300013104 Bacteria 1168
632 Ga0157374_10030105 3300013296 Bacteria 4925
633 Ga0157374_10385416 3300013296 Bacteria 1397
634 Ga0157374_10585484 3300013296 Bacteria 1125
635 Ga0157374_10591243 3300013296 Bacteria 1119
636 Ga0157374_10612465 3300013296 Bacteria 1099
637 Ga0157374_11081381 3300013296 Bacteria 822
638 Ga0157378_10007523 3300013297 Bacteria 9509
639 Ga0157378_10021331 3300013297 Bacteria 5695
640 Ga0157378_10050101 3300013297 Bacteria 3716
641 Ga0157378_10213866 3300013297 Bacteria 1829
642 Ga0157378_10272538 3300013297 Bacteria 1628
643 Ga0157378_10537086 3300013297 Unclassified 1173
644 Ga0157378_10591790 3300013297 Bacteria 1119
645 Ga0163162_10000128 3300013306 Bacteria 68199
646 Ga0163162_10005642 3300013306 Bacteria 12089
647 Ga0163162_10024045 3300013306 Bacteria 6012
648 Ga0163162_10030447 3300013306 Bacteria 5347
649 Ga0163162_10040876 3300013306 Bacteria 4638
650 Ga0163162_10070323 3300013306 Bacteria 3551
651 Ga0163162_10154748 3300013306 Bacteria 2412
652 Ga0163162_10155290 3300013306 Bacteria 2408
653 Ga0163162_10196754 3300013306 Bacteria 2144
654 Ga0163162_10440443 3300013306 Bacteria 1435
655 Ga0163162_10445127 3300013306 Bacteria 1427
656 Ga0163162_10463258 3300013306 Bacteria 1399
657 Ga0163162_10613848 3300013306 Bacteria 1213
658 Ga0163162_10698304 3300013306 Bacteria 1136
659 Ga0157372_10001998 3300013307 Bacteria 22149
660 Ga0157372_10061967 3300013307 Bacteria 4189
661 Ga0157372_10411643 3300013307 Bacteria 1576
662 Ga0157372_10674811 3300013307 Bacteria 1203
663 Ga0157372_10732184 3300013307 Bacteria 1150
664 Ga0157375_10003408 3300013308 Bacteria 13777
665 Ga0157375_10008099 3300013308 Bacteria 9195
666 Ga0157375_10011344 3300013308 Bacteria 7868
667 Ga0157375_10022414 3300013308 Bacteria 5814
668 Ga0157375_10045937 3300013308 Bacteria 4254
669 Ga0157375_10356104 3300013308 Bacteria 1630
670 Ga0157375_10379817 3300013308 Bacteria 1579
671 Ga0157375_10614678 3300013308 Bacteria 1245
672 Ga0157375_10735555 3300013308 Bacteria 1138
673 Ga0157375_10806804 3300013308 Bacteria 1087
674 Ga0157375_10826115 3300013308 Bacteria 1074
675 Ga0163163_10001582 3300014325 Bacteria 19173
676 Ga0163163_10002592 3300014325 Bacteria 15319
677 Ga0163163_10002688 3300014325 Bacteria 15025
678 Ga0163163_10005967 3300014325 Bacteria 10596
679 Ga0163163_10036230 3300014325 Bacteria 4792
680 Ga0163163_10040071 3300014325 Bacteria 4573
681 Ga0163163_10152729 3300014325 Bacteria 2352
682 Ga0163163_10180742 3300014325 Bacteria 2156
683 Ga0163163_10192995 3300014325 Bacteria 2085
684 Ga0163163_10658402 3300014325 Bacteria 1111
685 Ga0163163_10782687 3300014325 Bacteria 1017
686 Ga0163163_10850039 3300014325 Bacteria 976
687 Ga0157380_10007349 3300014326 Bacteria 7821
688 Ga0157380_10011362 3300014326 Bacteria 6434
689 Ga0157380_10013224 3300014326 Bacteria 6012
690 Ga0157380_10065258 3300014326 Bacteria 2925
691 Ga0157380_10195025 3300014326 Bacteria 1792
692 Ga0157380_10270562 3300014326 Bacteria 1549
693 Ga0157380_10346948 3300014326 Bacteria 1387
694 Ga0157380_10428036 3300014326 Bacteria 1264
695 Ga0157380_10671782 3300014326 Unclassified 1037
696 Ga0157377_10037345 3300014745 Bacteria 2676
697 Ga0157377_10062306 3300014745 Bacteria 2134
698 Ga0157377_10455467 3300014745 Bacteria 884
699 Ga0157379_10000882 3300014968 Bacteria 24310
700 Ga0157379_10424302 3300014968 Bacteria 1225
701 Ga0157379_10695194 3300014968 Bacteria 954
702 Ga0157376_10020328 3300014969 Bacteria 5135
703 Ga0157376_10034180 3300014969 Bacteria 4103
704 Ga0157376_10425225 3300014969 Bacteria 1290
705 Ga0157376_10435733 3300014969 Bacteria 1275
706 Ga0163161_10021410 3300017792 Bacteria 4544
707 Ga0163161_10073173 3300017792 Bacteria 2511
708 Ga0163161_10243730 3300017792 Bacteria 1399
709 Ga0197907_10083167 3300020069 Bacteria 886
710 Ga0206356_10897421 3300020070 Bacteria 893
711 Ga0206355_1431193 3300020076 Bacteria 712
712 Ga0206352_10038393 3300020078 Bacteria 1080
713 Ga0206352_10615686 3300020078 Bacteria 788
714 Ga0206350_10210031 3300020080 Bacteria 1308
715 Ga0206354_10204332 3300020081 Bacteria 819
716 Ga0206353_11344678 3300020082 Bacteria 1332
717 Ga0224712_10213915 3300022467 Bacteria 880
718 Ga0224712_10316952 3300022467 Bacteria 732
719 Ga0209050_1001878 3300025298 Bacteria 20179
720 Ga0209050_1008381 3300025298 Bacteria 5540
721 Ga0207697_10023951 3300025315 Bacteria 2500
722 Ga0207697_10025069 3300025315 Bacteria 2439
723 Ga0207656_10001382 3300025321 Bacteria 8008
724 Ga0207653_10000011 3300025885 Bacteria 160949
725 Ga0207653_10000132 3300025885 Bacteria 53266
726 Ga0207653_10007178 3300025885 Bacteria 3477
727 Ga0207642_10077971 3300025899 Bacteria 1600
728 Ga0207642_10328703 3300025899 Bacteria 895
729 Ga0207642_10469085 3300025899 Bacteria 766
730 Ga0207710_10000522 3300025900 Bacteria 23556
731 Ga0207680_10001635 3300025903 Bacteria 10591
732 Ga0207680_10079682 3300025903 Bacteria 2054
733 Ga0207680_10608006 3300025903 Bacteria 782
734 Ga0207647_10055134 3300025904 Bacteria 2443
735 Ga0207647_10093861 3300025904 Bacteria 1788
736 Ga0207647_10275455 3300025904 Bacteria 961
737 Ga0207643_10048352 3300025908 Bacteria 2409
738 Ga0207643_10162141 3300025908 Bacteria 1345
739 Ga0207643_10173009 3300025908 Bacteria 1304
740 Ga0207643_10336099 3300025908 Unclassified 946
741 Ga0207643_10341906 3300025908 Bacteria 938
742 Ga0207684_10000053 3300025910 Bacteria 225260
743 Ga0207684_10000230 3300025910 Bacteria 85141
744 Ga0207684_10015726 3300025910 Bacteria 6511
745 Ga0207684_10022593 3300025910 Bacteria 5369
746 Ga0207684_10022979 3300025910 Bacteria 5326
747 Ga0207684_10119197 3300025910 Bacteria 2262
748 Ga0207684_10218397 3300025910 Bacteria 1645
749 Ga0207684_10231086 3300025910 Bacteria 1596
750 Ga0207684_10447986 3300025910 Bacteria 1108
751 Ga0207684_10605798 3300025910 Unclassified 935
752 Ga0207654_10064473 3300025911 Bacteria 2154
753 Ga0207654_10137857 3300025911 Bacteria 1552
754 Ga0207654_10344022 3300025911 Bacteria 1025
755 Ga0207654_10489516 3300025911 Bacteria 867
756 Ga0207654_10497384 3300025911 Bacteria 860
757 Ga0207707_10000063 3300025912 Bacteria 108163
758 Ga0207707_10029405 3300025912 Bacteria 4803
759 Ga0207707_10630736 3300025912 Bacteria 905
760 Ga0207695_10287760 3300025913 Bacteria 1536
761 Ga0207695_10823402 3300025913 Bacteria 808
762 Ga0207671_10003001 3300025914 Bacteria 17302
763 Ga0207671_10082769 3300025914 Bacteria 2409
764 Ga0207671_10212068 3300025914 Bacteria 1515
765 Ga0207663_10000020 3300025916 Bacteria 137200
766 Ga0207663_10095303 3300025916 Bacteria 1985
767 Ga0207660_10000454 3300025917 Bacteria 26985
768 Ga0207660_10083497 3300025917 Bacteria 2352
769 Ga0207660_10186137 3300025917 Bacteria 1615
770 Ga0207662_10251875 3300025918 Bacteria 1159
771 Ga0207662_10570445 3300025918 Bacteria 785
772 Ga0207657_10369908 3300025919 Bacteria 1129
773 Ga0207649_10005241 3300025920 Bacteria 7005
774 Ga0207649_10244374 3300025920 Bacteria 1290
775 Ga0207649_10320455 3300025920 Bacteria 1139
776 Ga0207649_10688876 3300025920 Bacteria 792
777 Ga0207652_10000091 3300025921 Bacteria 98787
778 Ga0207652_10072777 3300025921 Bacteria 2989
779 Ga0207646_10000025 3300025922 Bacteria 248680
780 Ga0207646_10000495 3300025922 Bacteria 52781
781 Ga0207646_10141056 3300025922 Bacteria 2170
782 Ga0207646_10186559 3300025922 Bacteria 1873
783 Ga0207681_10023540 3300025923 Bacteria 3941
784 Ga0207681_10053894 3300025923 Bacteria 2732
785 Ga0207681_10086189 3300025923 Bacteria 2231
786 Ga0207694_10008388 3300025924 Bacteria 7802
787 Ga0207694_10446625 3300025924 Bacteria 1079
788 Ga0207694_10457153 3300025924 Bacteria 1066
789 Ga0207694_10633251 3300025924 Bacteria 900
790 Ga0207650_10000007 3300025925 Bacteria 530810
791 Ga0207650_10001364 3300025925 Bacteria 17619
792 Ga0207650_10012071 3300025925 Bacteria 5955
793 Ga0207650_10105444 3300025925 Bacteria 2176
794 Ga0207650_10141749 3300025925 Bacteria 1890
795 Ga0207650_10142531 3300025925 Bacteria 1885
796 Ga0207650_10148766 3300025925 Bacteria 1846
797 Ga0207650_10174994 3300025925 Bacteria 1708
798 Ga0207650_10213152 3300025925 Bacteria 1551
799 Ga0207659_10184186 3300025926 Unclassified 1657
800 Ga0207659_10513725 3300025926 Bacteria 1015
801 Ga0207644_10028593 3300025931 Unclassified 3861
802 Ga0207644_10029527 3300025931 Bacteria 3805
803 Ga0207644_10050927 3300025931 Bacteria 2970
804 Ga0207644_10219614 3300025931 Bacteria 1506
805 Ga0207690_10054165 3300025932 Bacteria 2696
806 Ga0207690_10128318 3300025932 Bacteria 1852
807 Ga0207690_10698449 3300025932 Bacteria 834
808 Ga0207706_10029411 3300025933 Bacteria 4904
809 Ga0207706_10067984 3300025933 Bacteria 3136
810 Ga0207706_10114455 3300025933 Bacteria 2372
811 Ga0207706_10416175 3300025933 Bacteria 1164
812 Ga0207686_10000028 3300025934 Bacteria 163090
813 Ga0207686_10012011 3300025934 Bacteria 4755
814 Ga0207686_10192931 3300025934 Bacteria 1453
815 Ga0207686_10272249 3300025934 Bacteria 1246
816 Ga0207686_10306685 3300025934 Bacteria 1181
817 Ga0207686_10573663 3300025934 Bacteria 885
818 Ga0207709_10000082 3300025935 Bacteria 163123
819 Ga0207709_10008758 3300025935 Bacteria 5580
820 Ga0207709_10301372 3300025935 Bacteria 1192
821 Ga0207709_10375267 3300025935 Bacteria 1081
822 Ga0207709_10429733 3300025935 Bacteria 1016
823 Ga0207709_10500342 3300025935 Bacteria 948
824 Ga0207709_10511283 3300025935 Bacteria 939
825 Ga0207670_10000353 3300025936 Bacteria 27158
826 Ga0207670_10001799 3300025936 Bacteria 11215
827 Ga0207670_10007640 3300025936 Bacteria 6051
828 Ga0207670_10031309 3300025936 Bacteria 3407
829 Ga0207670_10045254 3300025936 Bacteria 2916
830 Ga0207670_10056195 3300025936 Bacteria 2664
831 Ga0207670_10299621 3300025936 Unclassified 1258
832 Ga0207670_10412405 3300025936 Bacteria 1082
833 Ga0207670_10527882 3300025936 Bacteria 962
834 Ga0207670_10696125 3300025936 Bacteria 841
835 Ga0207669_10099371 3300025937 Bacteria 1919
836 Ga0207669_10108334 3300025937 Bacteria 1855
837 Ga0207704_10072701 3300025938 Bacteria 2187
838 Ga0207704_10129876 3300025938 Bacteria 1742
839 Ga0207704_10259314 3300025938 Bacteria 1310
840 Ga0207704_10362667 3300025938 Bacteria 1132
841 Ga0207665_10000009 3300025939 Bacteria 162252
842 Ga0207665_10109211 3300025939 Bacteria 1941
843 Ga0207665_10166878 3300025939 Bacteria 1588
844 Ga0207665_10171776 3300025939 Bacteria 1566
845 Ga0207665_10632129 3300025939 Bacteria 838
846 Ga0207691_10003277 3300025940 Bacteria 15768
847 Ga0207691_10004503 3300025940 Bacteria 13495
848 Ga0207691_10010463 3300025940 Bacteria 8898
849 Ga0207691_10092206 3300025940 Bacteria 2713
850 Ga0207691_10116544 3300025940 Bacteria 2371
851 Ga0207691_10185036 3300025940 Bacteria 1819
852 Ga0207691_10826394 3300025940 Bacteria 778
853 Ga0207711_10001951 3300025941 Bacteria 18724
854 Ga0207711_10033137 3300025941 Bacteria 4369
855 Ga0207711_10089219 3300025941 Bacteria 2708
856 Ga0207711_10164054 3300025941 Bacteria 2013
857 Ga0207711_10241614 3300025941 Bacteria 1656
858 Ga0207711_10763902 3300025941 Bacteria 901
859 Ga0207689_10005784 3300025942 Bacteria 10979
860 Ga0207689_10007586 3300025942 Bacteria 9504
861 Ga0207689_10024626 3300025942 Bacteria 5047
862 Ga0207689_10036105 3300025942 Bacteria 4104
863 Ga0207689_10038732 3300025942 Bacteria 3947
864 Ga0207689_10113530 3300025942 Bacteria 2227
865 Ga0207689_10146277 3300025942 Bacteria 1947
866 Ga0207689_10157305 3300025942 Bacteria 1873
867 Ga0207689_10294970 3300025942 Bacteria 1343
868 Ga0207689_10351969 3300025942 Bacteria 1224
869 Ga0207689_10380988 3300025942 Bacteria 1174
870 Ga0207679_10009858 3300025945 Bacteria 6133
871 Ga0207679_10038822 3300025945 Bacteria 3396
872 Ga0207679_10067858 3300025945 Bacteria 2677
873 Ga0207679_10098292 3300025945 Bacteria 2282
874 Ga0207679_10107235 3300025945 Bacteria 2198
875 Ga0207679_10139690 3300025945 Bacteria 1956
876 Ga0207679_10565978 3300025945 Bacteria 1021
877 Ga0207679_10587690 3300025945 Bacteria 1002
878 Ga0207667_10299623 3300025949 Bacteria 1642
879 Ga0207651_10032822 3300025960 Bacteria 3340
880 Ga0207651_10145912 3300025960 Bacteria 1835
881 Ga0207651_10229207 3300025960 Bacteria 1507
882 Ga0207651_10434188 3300025960 Bacteria 1124
883 Ga0207651_10578429 3300025960 Bacteria 979
884 Ga0207651_10858512 3300025960 Bacteria 807
885 Ga0207712_10001036 3300025961 Bacteria 19681
886 Ga0207712_10016432 3300025961 Bacteria 4792
887 Ga0207712_10028687 3300025961 Bacteria 3725
888 Ga0207712_10032257 3300025961 Bacteria 3535
889 Ga0207712_10141355 3300025961 Bacteria 1848
890 Ga0207712_10261475 3300025961 Bacteria 1404
891 Ga0207712_10498030 3300025961 Bacteria 1041
892 Ga0207712_10572080 3300025961 Bacteria 974
893 Ga0207712_10598767 3300025961 Unclassified 953
894 Ga0207668_10049163 3300025972 Bacteria 2897
895 Ga0207668_10269266 3300025972 Bacteria 1392
896 Ga0207640_10370569 3300025981 Bacteria 1157
897 Ga0207640_10924354 3300025981 Bacteria 763
898 Ga0207640_10945013 3300025981 Bacteria 755
899 Ga0207658_10008065 3300025986 Bacteria 7175
900 Ga0207658_10070295 3300025986 Bacteria 2648
901 Ga0207658_10647155 3300025986 Bacteria 952
902 Ga0207677_10385691 3300026023 Bacteria 1184
903 Ga0207703_10008425 3300026035 Bacteria 8150
904 Ga0207703_10057177 3300026035 Bacteria 3180
905 Ga0207703_10067803 3300026035 Bacteria 2937
906 Ga0207703_10107094 3300026035 Bacteria 2379
907 Ga0207703_10188412 3300026035 Bacteria 1825
908 Ga0207703_10188850 3300026035 Bacteria 1823
909 Ga0207703_10272715 3300026035 Unclassified 1533
910 Ga0207703_10656836 3300026035 Bacteria 995
911 Ga0207639_10001408 3300026041 Bacteria 16225
912 Ga0207639_10136876 3300026041 Unclassified 2035
913 Ga0207639_10374540 3300026041 Bacteria 1277
914 Ga0207639_10677894 3300026041 Bacteria 955
915 Ga0207639_10838749 3300026041 Bacteria 858
916 Ga0207678_10046702 3300026067 Bacteria 3745
917 Ga0207678_10061587 3300026067 Bacteria 3227
918 Ga0207678_10498498 3300026067 Bacteria 1061
919 Ga0207708_10000113 3300026075 Bacteria 62692
920 Ga0207708_10001454 3300026075 Bacteria 17754
921 Ga0207708_10016737 3300026075 Bacteria 5517
922 Ga0207708_10033605 3300026075 Bacteria 3898
923 Ga0207708_10040594 3300026075 Bacteria 3547
924 Ga0207708_10140512 3300026075 Bacteria 1894
925 Ga0207708_10185942 3300026075 Bacteria 1651
926 Ga0207708_10194410 3300026075 Bacteria 1616
927 Ga0207708_10324204 3300026075 Bacteria 1258
928 Ga0207708_10429596 3300026075 Bacteria 1097
929 Ga0207708_10436124 3300026075 Bacteria 1089
930 Ga0207702_10058217 3300026078 Unclassified 3288
931 Ga0207702_10636562 3300026078 Bacteria 1048
932 Ga0207641_10017870 3300026088 Bacteria 5809
933 Ga0207641_10047480 3300026088 Bacteria 3621
934 Ga0207641_10164113 3300026088 Bacteria 2022
935 Ga0207641_10237332 3300026088 Bacteria 1697
936 Ga0207641_10242976 3300026088 Bacteria 1678
937 Ga0207641_10326353 3300026088 Bacteria 1457
938 Ga0207641_10449262 3300026088 Bacteria 1245
939 Ga0207641_10548202 3300026088 Bacteria 1127
940 Ga0207648_10006108 3300026089 Bacteria 12009
941 Ga0207648_10013974 3300026089 Bacteria 7442
942 Ga0207648_10027501 3300026089 Bacteria 5049
943 Ga0207648_10039122 3300026089 Bacteria 4170
944 Ga0207648_10143304 3300026089 Bacteria 2107
945 Ga0207648_10236684 3300026089 Bacteria 1625
946 Ga0207648_10239601 3300026089 Bacteria 1615
947 Ga0207648_10269731 3300026089 Bacteria 1520
948 Ga0207648_10286096 3300026089 Bacteria 1475
949 Ga0207648_10417851 3300026089 Bacteria 1217
950 Ga0207676_10003794 3300026095 Bacteria 10686
951 Ga0207676_10004304 3300026095 Bacteria 10065
952 Ga0207676_10016892 3300026095 Bacteria 5283
953 Ga0207676_10116396 3300026095 Bacteria 2246
954 Ga0207676_10267871 3300026095 Bacteria 1546
955 Ga0207676_10395532 3300026095 Bacteria 1290
956 Ga0207676_11244685 3300026095 Bacteria 738
957 Ga0207674_10000497 3300026116 Bacteria 51891
958 Ga0207674_10040494 3300026116 Bacteria 4825
959 Ga0207674_10063269 3300026116 Bacteria 3735
960 Ga0207674_10153204 3300026116 Bacteria 2261
961 Ga0207674_10176653 3300026116 Bacteria 2088
962 Ga0207674_10251358 3300026116 Bacteria 1715
963 Ga0207674_10386887 3300026116 Bacteria 1352
964 Ga0207674_10455702 3300026116 Bacteria 1236
965 Ga0207674_10824582 3300026116 Bacteria 895
966 Ga0207675_100002642 3300026118 Bacteria 17690
967 Ga0207675_100030063 3300026118 Bacteria 5058
968 Ga0207675_100044737 3300026118 Bacteria 4138
969 Ga0207675_100062427 3300026118 Bacteria 3480
970 Ga0207675_100072073 3300026118 Bacteria 3231
971 Ga0207675_100088129 3300026118 Bacteria 2915
972 Ga0207675_100266125 3300026118 Bacteria 1662
973 Ga0207675_100296195 3300026118 Bacteria 1575
974 Ga0207675_100372294 3300026118 Bacteria 1403
975 Ga0207675_100443031 3300026118 Bacteria 1286
976 Ga0207683_10208815 3300026121 Bacteria 1777
977 Ga0207683_10287630 3300026121 Bacteria 1503
978 Ga0207683_10468872 3300026121 Bacteria 1162
979 Ga0207698_10077409 3300026142 Bacteria 2667
980 Ga0207698_10088806 3300026142 Bacteria 2522
981 Ga0207698_10454910 3300026142 Bacteria 1237
982 Ga0209179_1068908 3300027512 Bacteria 773
983 Ga0209970_1040200 3300027614 Bacteria 830
984 Ga0209588_1007099 3300027671 Bacteria 3284
985 Ga0207428_10002648 3300027907 Bacteria 17841
986 Ga0207428_10006746 3300027907 Bacteria 10531
987 Ga0207428_10018170 3300027907 Bacteria 6012
988 Ga0207428_10026651 3300027907 Bacteria 4821
989 Ga0207428_10355267 3300027907 Bacteria 1078
990 Ga0268266_10038547 3300028379 Bacteria 4068
991 Ga0268266_10708086 3300028379 Bacteria 971
992 Ga0268266_10917530 3300028379 Bacteria 847
993 Ga0268265_10007235 3300028380 Bacteria 7502
994 Ga0268265_10063613 3300028380 Bacteria 2839
995 Ga0268265_10089434 3300028380 Bacteria 2456
996 Ga0268265_10139828 3300028380 Bacteria 2025
997 Ga0268265_10264139 3300028380 Bacteria 1532
998 Ga0268265_10428721 3300028380 Bacteria 1230
999 Ga0268264_10067297 3300028381 Bacteria 3023
1000 Ga0268264_10206162 3300028381 Bacteria 1802
1001 Ga0268264_10208394 3300028381 Unclassified 1793
1002 Ga0268264_10213485 3300028381 Bacteria 1773
1003 Ga0268264_10217679 3300028381 Bacteria 1756
1004 Ga0265319_1067223 3300028563 Bacteria 1153
1005 Ga0265334_10020191 3300028573 Bacteria 2731
1006 Ga0307515_10043991 3300028794 Bacteria 6920
1007 Ga0265338_10011728 3300028800 Bacteria 10085
1008 Ga0265338_10126030 3300028800 Bacteria 2032
1009 Ga0265338_10556680 3300028800 Bacteria 802
1010 Ga0314311_1187385 3300030733 Bacteria 989
1011 Ga0265327_10004233 3300031251 Bacteria 12874
1012 Ga0307509_10080880 3300031507 Bacteria 3359
1013 Ga0307408_100290214 3300031548 Unclassified 1366
1014 Ga0307408_100316066 3300031548 Bacteria 1314
1015 Ga0265314_10280673 3300031711 Bacteria 942
1016 Ga0316576_10120608 3300031727 Bacteria 1969
1017 Ga0307516_10033412 3300031730 Bacteria 5175
1018 Ga0307405_10056668 3300031731 Bacteria 2459
1019 Ga0307405_10191760 3300031731 Bacteria 1477
1020 Ga0307405_10323057 3300031731 Bacteria 1180
1021 Ga0307413_10208855 3300031824 Bacteria 1416
1022 Ga0307413_10499767 3300031824 Bacteria 976
1023 Ga0307410_10187820 3300031852 Bacteria 1569
1024 Ga0307410_10857043 3300031852 Bacteria 776
1025 Ga0307406_10021986 3300031901 Bacteria 3780
1026 Ga0307407_10026441 3300031903 Bacteria 3073
1027 Ga0307407_10581973 3300031903 Bacteria 831
1028 Ga0307412_10308264 3300031911 Bacteria 1254
1029 Ga0307412_10699236 3300031911 Bacteria 870
1030 Ga0307409_100040391 3300031995 Bacteria 3473
1031 Ga0307409_100427059 3300031995 Bacteria 1273
1032 Ga0307409_100919340 3300031995 Bacteria 889
1033 Ga0307416_100013178 3300032002 Bacteria 5610
1034 Ga0307416_100035694 3300032002 Bacteria 3801
1035 Ga0307416_100221467 3300032002 Bacteria 1815
1036 Ga0307416_100233703 3300032002 Bacteria 1775
1037 Ga0307416_100680505 3300032002 Bacteria 1116
1038 Ga0307416_100996707 3300032002 Bacteria 941
1039 Ga0307416_101407953 3300032002 Bacteria 803
1040 Ga0307414_10140469 3300032004 Bacteria 1890
1041 Ga0307415_100012839 3300032126 Bacteria 4862
1042 Ga0307415_100051611 3300032126 Bacteria 2792
1043 Ga0307415_100208336 3300032126 Bacteria 1557
1044 Ga0307415_100276637 3300032126 Bacteria 1378
1045 Ga0307415_100324121 3300032126 Bacteria 1286
1046 Ga0307415_100673934 3300032126 Bacteria 930
1047 Ga0373940_0073367 3300035088 Bacteria 1000
1048 Ga0373949_0000118 3300035090 Bacteria 29256
1049 Ga0373951_0004140 3300035091 Bacteria 3466
1050 Ga0373936_0000046 3300035113 Bacteria 82874
1051 Ga0373939_0104140 3300035114 Bacteria 979
1052 Ga0373961_0000019 3300035241 Bacteria 100887
1053 Ga0373937_0285233 3300036401 Bacteria 1560
1054 Ga0316584_0110202 3300036712 Bacteria 2060
1055 Ga0395900_0197753 3300037418 Bacteria 2036
1056 Ga0395898_0222853 3300037466 Bacteria 1799
1057 Ga0395905_0274165 3300037471 Bacteria 1573
1058 Ga0436364_0340931 3300037853 Bacteria 711
1059 Ga0242420_027470 3300038996 Bacteria 1043
1060 Ga0436365_1401300 3300039437 Bacteria 2998
1061 Ga0436363_0996298 3300039450 Bacteria 731
1062 Ga0451851_1121094 3300041507 Unclassified 2785
1063 Ga0439448_0027050 3300042005 Bacteria 1806
1064 Ga0439455_0001463 3300042012 Bacteria 3960
1065 Ga0450889_008733 3300042144 Bacteria 1033
1066 Ga0439458_0002523 3300042157 Bacteria 4438
1067 Ga0439434_0002802 3300042435 Bacteria 5087
1068 Ga0451577_0883174 3300042876 Bacteria 805
1069 Ga0451577_0906667 3300042876 Bacteria 794
1070 Ga0453684_1177004 3300044712 Bacteria 806
1071 Ga0466960_0290801 3300044901 Bacteria 918
1072 Ga0451576_0685873 3300045051 Bacteria 1076
1073 Ga0451576_0713132 3300045051 Bacteria 1054
1074 Ga0451576_1057137 3300045051 Bacteria 850
1075 Ga0451576_1192578 3300045051 Bacteria 795
1076 Ga0495629_0306691 3300046459 Bacteria 1086
1077 Ga0495638_0000001 3300046460 Bacteria 1114121
1078 Ga0495580_0161496 3300046472 Bacteria 1551
1079 Ga0495630_0225938 3300046517 Bacteria 1430
1080 Ga0495632_0001279 3300046519 Bacteria 21296
1081 Ga0495663_0000585 3300046525 Bacteria 12778
1082 Ga0495598_0000784 3300046537 Bacteria 6066
1083 Ga0495621_0000444 3300046539 Bacteria 10213
1084 Ga0495622_0073117 3300046557 Bacteria 1582
1085 Ga0495668_0000102 3300046616 Bacteria 137192
1086 Ga0495668_0000368 3300046616 Bacteria 59517
1087 Ga0495668_0077421 3300046616 Bacteria 1826
1088 Ga0495670_0054461 3300046691 Bacteria 2004
1089 Ga0495649_0127274 3300046694 Bacteria 1345
1090 Ga0495636_0040290 3300047318 Bacteria 1937
1091 Ga0495672_0021359 3300047320 Bacteria 4224
1092 Ga0495602_0364822 3300048088 Bacteria 1039
1093 Ga0496100_0031761 3300048903 Bacteria 3286
1094 Ga0496101_0084018 3300048904 Bacteria 2357
1095 Ga0496102_0020019 3300048905 Bacteria 5904
1096 Ga0496102_0044303 3300048905 Bacteria 4038
1097 Ga0496103_0104061 3300048906 Bacteria 1799
1098 Ga0496104_0003667 3300048907 Bacteria 13257
1099 Ga0496104_0061916 3300048907 Bacteria 3548
1100 Ga0496105_0032957 3300048908 Bacteria 4253
1101 Ga0496106_0001548 3300048909 Bacteria 17324
1102 Ga0496106_0901438 3300048909 Bacteria 698
1103 Ga0496107_0391478 3300048910 Bacteria 1034
1104 Ga0496107_0446640 3300048910 Bacteria 961
1105 Ga0496108_0165129 3300048911 Bacteria 1914
1106 Ga0496108_0268975 3300048911 Bacteria 1483
1107 Ga0496108_0551753 3300048911 Bacteria 1005
1108 Ga0496109_0000097 3300048912 Bacteria 90961
1109 Ga0496109_0354255 3300048912 Bacteria 1386
1110 Ga0496109_0510216 3300048912 Bacteria 1135
1111 Ga0496110_0002140 3300048913 Bacteria 14760
1112 Ga0496110_0219033 3300048913 Bacteria 1731
1113 Ga0496111_0007844 3300048914 Bacteria 7031
1114 Ga0496111_0057323 3300048914 Bacteria 2820
1115 Ga0496112_0004561 3300048915 Bacteria 11772
1116 Ga0496112_0208631 3300048915 Bacteria 1911
1117 Ga0496112_0370437 3300048915 Bacteria 1374
1118 Ga0496112_0699692 3300048915 Bacteria 941
1119 Ga0496113_0031890 3300048916 Bacteria 3828
1120 Ga0496113_0171225 3300048916 Bacteria 1720
1121 Ga0501307_036672 3300049162 Bacteria 699
1122 Ga0501290_018448 3300049513 Bacteria 940
1123 Ga0501291_035098 3300049514 Bacteria 861
1124 Ga0501292_001513 3300049515 Bacteria 2869
1125 Ga0501295_007194 3300049518 Bacteria 1609
1126 Ga0501296_000795 3300049519 Bacteria 3121
1127 Ga0501297_000606 3300049520 Bacteria 3235
1128 Ga0501298_001056 3300049521 Bacteria 3957
1129 Ga0501298_006412 3300049521 Bacteria 1923
1130 Ga0501298_007908 3300049521 Bacteria 1775
1131 Ga0501299_000661 3300049522 Bacteria 4090
1132 Ga0501300_005675 3300049523 Bacteria 1838
1133 Ga0501317_023254 3300049533 Bacteria 854
1134 Ga0501036_0120591 3300049572 Bacteria 2215
1135 Ga0501038_0003087 3300049574 Bacteria 15525
1136 Ga0501042_0191287 3300049578 Bacteria 1476
1137 Ga0501068_0026968 3300049584 Bacteria 3390
1138 Ga0501069_0100678 3300049585 Bacteria 1640
1139 Ga0501071_0906598 3300049587 Bacteria 680
1140 Ga0501072_0097978 3300049588 Bacteria 2331
1141 Ga0501072_0120570 3300049588 Bacteria 2090
1142 Ga0501072_0300440 3300049588 Bacteria 1276
1143 Ga0501075_0019697 3300049591 Bacteria 4898
1144 Ga0501075_0159154 3300049591 Bacteria 1723
1145 Ga0501076_0050168 3300049592 Bacteria 3301
1146 Ga0501077_0348301 3300049593 Bacteria 945
1147 Ga0501202_012254 3300049652 Bacteria 1615
1148 Ga0501207_001429 3300049654 Bacteria 2985
1149 Ga0501207_009287 3300049654 Bacteria 1435
1150 Ga0501208_057872 3300049655 Bacteria 753
1151 Ga0501214_002681 3300049659 Bacteria 1520
1152 Ga0501216_001490 3300049660 Bacteria 3168
1153 Ga0501216_002340 3300049660 Bacteria 2678
1154 Ga0501216_008483 3300049660 Bacteria 1619
1155 Ga0501217_001694 3300049661 Bacteria 4199
1156 Ga0501217_006796 3300049661 Bacteria 2439
1157 Ga0501223_001842 3300049663 Bacteria 4794
1158 Ga0501223_005017 3300049663 Bacteria 2799
1159 Ga0501223_019744 3300049663 Bacteria 1323
1160 Ga0501223_021891 3300049663 Bacteria 1250
1161 Ga0501223_033974 3300049663 Bacteria 991
1162 Ga0501224_003389 3300049664 Bacteria 2220
1163 Ga0501224_006716 3300049664 Bacteria 1670
1164 Ga0501227_000666 3300049665 Bacteria 7500
1165 Ga0501227_023516 3300049665 Bacteria 1433
1166 Ga0501227_062979 3300049665 Bacteria 953
1167 Ga0501227_068774 3300049665 Unclassified 917
1168 Ga0501230_062895 3300049667 Bacteria 754
1169 Ga0501233_001925 3300049668 Bacteria 3609
1170 Ga0501235_004656 3300049669 Bacteria 2966
1171 Ga0501235_024590 3300049669 Bacteria 1345
1172 Ga0501236_051428 3300049670 Bacteria 709
1173 Ga0501240_005871 3300049673 Bacteria 1489
1174 Ga0501243_011882 3300049675 Bacteria 1370
1175 Ga0501252_008562 3300049682 Bacteria 1178
1176 Ga0501256_004000 3300049685 Bacteria 1250
1177 Ga0501257_018797 3300049686 Bacteria 1614
1178 Ga0501257_023342 3300049686 Bacteria 1467
1179 Ga0501257_053150 3300049686 Bacteria 1013
1180 Ga0501257_072998 3300049686 Bacteria 878
1181 Ga0501259_020567 3300049688 Bacteria 1172
1182 Ga0501260_003055 3300049689 Bacteria 1484
1183 Ga0501221_026495 3300049704 Bacteria 1179
1184 Ga0501221_056353 3300049704 Bacteria 898
1185 Ga0501225_0024210 3300049705 Bacteria 1671
1186 Ga0501225_0029308 3300049705 Bacteria 1512
1187 Ga0501225_0076413 3300049705 Bacteria 957
1188 Ga0501234_002117 3300049707 Bacteria 3138
1189 Ga0501234_009022 3300049707 Bacteria 1555
1190 Ga0501234_025335 3300049707 Bacteria 951
1191 Ga0501234_031105 3300049707 Bacteria 863
1192 Ga0501245_029036 3300049708 Bacteria 905
1193 Ga0501080_0071393 3300049742 Bacteria 3230
1194 Ga0501081_0218760 3300049743 Bacteria 1385
1195 Ga0501083_0069307 3300049744 Bacteria 2346
1196 Ga0501232_006181 3300049757 Bacteria 1220
1197 Ga0501268_003456 3300049765 Bacteria 2163
1198 Ga0501268_012932 3300049765 Bacteria 1341
1199 Ga0501269_015665 3300049766 Bacteria 932
1200 Ga0501271_002133 3300049768 Bacteria 1745
1201 Ga0501275_010210 3300049772 Bacteria 999
1202 Ga0501283_000685 3300049779 Bacteria 4472
1203 Ga0501283_004435 3300049779 Bacteria 1899
1204 Ga0501035_0340430 3300049822 Bacteria 1257
1205 Ga0501045_0008318 3300049824 Bacteria 7225
1206 Ga0501204_005613 3300049850 Bacteria 1381
1207 Ga0501212_003878 3300049851 Bacteria 1902
1208 nmdc:mga00v17_113434_c1 3300050491 Bacteria 1721
1209 nmdc:mga0k408_131361_c1 3300050493 Bacteria 1486
1210 nmdc:mga06z11_323035_c1 3300050494 Bacteria 921
1211 nmdc:mga05p37_1248819_c1 3300050507 Bacteria 762
1212 nmdc:mga05p37_255786_c1 3300050507 Bacteria 2098
1213 nmdc:mga05p37_300996_c1 3300050507 Bacteria 1905
1214 nmdc:mga05p37_39714_c1 3300050507 Bacteria 5778
1215 nmdc:mga05p37_522177_c1 3300050507 Bacteria 1358
1216 nmdc:mga05p37_558633_c1 3300050507 Bacteria 1301
1217 nmdc:mga05p37_748434_c1 3300050507 Bacteria 1078
1218 nmdc:mga05p37_97705_c1 3300050507 Bacteria 3617
1219 nmdc:mga09592_117536_c1 3300050508 Bacteria 2282
1220 nmdc:mga09592_151620_c1 3300050508 Bacteria 2000
1221 nmdc:mga09592_414826_c1 3300050508 Bacteria 1163
1222 nmdc:mga09592_423763_c1 3300050508 Bacteria 1149
1223 nmdc:mga09592_47498_c1 3300050508 Bacteria 3618
1224 nmdc:mga0qj67_118874_c1 3300050509 Bacteria 2137
1225 nmdc:mga0qj67_616480_c1 3300050509 Bacteria 867
1226 nmdc:mga0qj67_77946_c1 3300050509 Bacteria 2652
1227 nmdc:mga0qj67_80140_c1 3300050509 Bacteria 2616
1228 nmdc:mga0qj67_95138_c1 3300050509 Bacteria 2397
1229 nmdc:mga06r32_1026356_c1 3300050510 Bacteria 776
1230 nmdc:mga06r32_123798_c1 3300050510 Bacteria 2552
1231 nmdc:mga06r32_133554_c1 3300050510 Bacteria 2456
1232 nmdc:mga06r32_14119_c1 3300050510 Bacteria 7244
1233 nmdc:mga06r32_2395_c1 3300050510 Bacteria 16782
1234 nmdc:mga06r32_263004_c1 3300050510 Bacteria 1713
1235 nmdc:mga06r32_266010_c1 3300050510 Bacteria 1702
1236 nmdc:mga06r32_26683_c1 3300050510 Bacteria 5389
1237 nmdc:mga06r32_528331_c1 3300050510 Bacteria 1155
1238 nmdc:mga06r32_593602_c1 3300050510 Bacteria 1079
1239 nmdc:mga06r32_666372_c1 3300050510 Bacteria 1008
1240 nmdc:mga08y16_10385_c1 3300050511 Bacteria 9767
1241 nmdc:mga08y16_152506_c1 3300050511 Bacteria 2402
1242 nmdc:mga08y16_176771_c1 3300050511 Bacteria 2217
1243 nmdc:mga08y16_405210_c1 3300050511 Unclassified 1395
1244 nmdc:mga08y16_55366_c1 3300050511 Bacteria 4145
1245 nmdc:mga08y16_62860_c1 3300050511 Bacteria 3877
1246 nmdc:mga08y16_639331_c1 3300050511 Bacteria 1069
1247 nmdc:mga08y16_9503_c1 3300050511 Bacteria 10206
1248 nmdc:mga0n895_1092566_c1 3300050512 Unclassified 775
1249 nmdc:mga0n895_12235_c1 3300050512 Bacteria 7689
1250 nmdc:mga0n895_195860_c1 3300050512 Bacteria 2052
1251 nmdc:mga0n895_291295_c1 3300050512 Bacteria 1655
1252 nmdc:mga0n895_325163_c1 3300050512 Bacteria 1558
1253 nmdc:mga0n895_34627_c1 3300050512 Bacteria 4863
1254 nmdc:mga0n895_431482_c1 3300050512 Bacteria 1331
1255 nmdc:mga0rr50_522018_c1 3300050513 Bacteria 1010
1256 nmdc:mga0rr50_81223_c1 3300050513 Bacteria 2501
1257 nmdc:mga08x19_10_c1 3300050514 Bacteria 404490
1258 nmdc:mga08x19_1367_c1 3300050514 Bacteria 15098
1259 nmdc:mga08x19_63892_c1 3300050514 Bacteria 2389
1260 nmdc:mga0a205_143742_c1 3300050515 Bacteria 2286
1261 nmdc:mga0a205_18693_c1 3300050515 Bacteria 6522
1262 nmdc:mga0a205_23555_c1 3300050515 Bacteria 5840
1263 nmdc:mga0a205_238474_c1 3300050515 Bacteria 1700
1264 nmdc:mga0a205_285740_c1 3300050515 Bacteria 1525
1265 nmdc:mga0a205_318359_c1 3300050515 Bacteria 1427
1266 nmdc:mga0a205_424763_c1 3300050515 Bacteria 1191
1267 nmdc:mga0a205_479809_c1 3300050515 Bacteria 1102
1268 nmdc:mga0a205_56014_c1 3300050515 Bacteria 3807
1269 nmdc:mga0a205_56451_c1 3300050515 Bacteria 3791
1270 nmdc:mga0a205_99017_c1 3300050515 Bacteria 2814
1271 Ga0495601_0045973 3300053077 Bacteria 2747
1272 Ga0500635_0003469 3300053080 Bacteria 3971
1273 Ga0495655_0042539 3300053083 Bacteria 1167
1274 Ga0495619_0091366 3300053085 Bacteria 2061
1275 Ga0495619_0422903 3300053085 Bacteria 919
1276 Ga0500578_0027682 3300053086 Bacteria 3641
1277 Ga0500646_0045680 3300053090 Bacteria 1247
1278 Ga0500583_0004038 3300053092 Bacteria 4720
1279 Ga0500566_0023181 3300053094 Bacteria 3643
1280 Ga0500566_0190252 3300053094 Bacteria 1045
1281 Ga0500641_0031152 3300053096 Bacteria 2102
1282 Ga0500650_0205498 3300053098 Bacteria 896
1283 Ga0500554_000552 3300053102 Bacteria 7694
1284 Ga0500555_001623 3300053103 Bacteria 6793
1285 Ga0500572_005407 3300053111 Bacteria 2891
1286 Ga0500595_000092 3300053119 Bacteria 61814
1287 Ga0500614_000111 3300053123 Bacteria 19636
1288 Ga0500614_003148 3300053123 Bacteria 3577
1289 Ga0500642_0047332 3300053130 Bacteria 1884
1290 Ga0500559_0024391 3300053136 Bacteria 2573
1291 Ga0500585_067732 3300053144 Bacteria 1288
1292 Ga0500603_000780 3300053150 Bacteria 7642
1293 Ga0500616_0000009 3300053153 Bacteria 779095
1294 Ga0500616_0199085 3300053153 Unclassified 888
1295 Ga0500622_0013506 3300053156 Bacteria 4407
1296 Ga0500638_223230 3300053162 Bacteria 780
1297 Ga0500636_0028491 3300053177 Bacteria 3298
1298 Ga0500661_025048 3300055283 Bacteria 1055
1299 Ga0587084_057852 3300059477 Bacteria 703
1300 Ga0587066_053172 3300059490 Bacteria 804
1301 Ga0587070_063829 3300059491 Bacteria 768
1302 Ga0587085_041241 3300059506 Bacteria 805
1303 Ga0587085_056449 3300059506 Bacteria 731
1304 Ga0587067_052062 3300059640 Bacteria 832
1305 Ga0587072_064723 3300059643 Bacteria 760
1306 Ga0587076_045792 3300059645 Bacteria 835
1307 Ga0587078_027059 3300059646 Bacteria 756
1308 Ga0587079_068722 3300059647 Bacteria 785
1309 Ga0587071_079155 3300060344 Bacteria 729
1310 Ga0530510_0252744 3300061734 Bacteria 1314

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025939 Ga0207665_10632129 Ga0207665_106321291 199
2 3300013100 Ga0157373_10187574 Ga0157373_101875741 207
3 3300009094 Ga0111539_10535552 Ga0111539_105355522 208
4 3300050511 nmdc:mga08y16_152506_c1 nmdc:mga08y16_152506_c1_1057_1710 208
5 iso_pu_bacteria 2890804823 2890807823 208
6 3300005445 Ga0070708_100562120 Ga0070708_1005621201 209
7 3300005468 Ga0070707_100286846 Ga0070707_1002868462 209
8 3300013307 Ga0157372_10674811 Ga0157372_106748112 209
9 3300026088 Ga0207641_10017870 Ga0207641_100178703 209
10 3300049588 Ga0501072_0120570 Ga0501072_0120570_684_1415 209
11 2162886011 MRS1b_contig_7197761 MRS1b_0302.00002400 210
12 3300004798 Ga0058859_10031964 Ga0058859_100319641 210
13 3300004801 Ga0058860_10034522 Ga0058860_100345221 210
14 3300005289 Ga0065704_10129117 Ga0065704_101291172 210
15 3300005290 Ga0065712_10003563 Ga0065712_100035633 210
16 3300005290 Ga0065712_10079425 Ga0065712_100794251 210
17 3300005293 Ga0065715_10247701 Ga0065715_102477012 210
18 3300005329 Ga0070683_100006442 Ga0070683_1000064423 210
19 3300005330 Ga0070690_100011190 Ga0070690_1000111903 210
20 3300005330 Ga0070690_100016133 Ga0070690_1000161331 210
21 3300005331 Ga0070670_100070995 Ga0070670_1000709953 210
22 3300005340 Ga0070689_100003971 Ga0070689_1000039718 210
23 3300005340 Ga0070689_100009680 Ga0070689_1000096804 210
24 3300005364 Ga0070673_100518389 Ga0070673_1005183892 210
25 3300005365 Ga0070688_100325748 Ga0070688_1003257482 210
26 3300005366 Ga0070659_100058089 Ga0070659_1000580893 210
27 3300005440 Ga0070705_100063912 Ga0070705_1000639121 210
28 3300005444 Ga0070694_100605886 Ga0070694_1006058861 210
29 3300005466 Ga0070685_10126084 Ga0070685_101260842 210
30 3300005467 Ga0070706_101044167 Ga0070706_1010441671 210
31 3300005518 Ga0070699_100415358 Ga0070699_1004153581 210
32 3300005530 Ga0070679_100389431 Ga0070679_1003894312 210
33 3300005535 Ga0070684_100002281 Ga0070684_1000022813 210
34 3300005544 Ga0070686_100153256 Ga0070686_1001532561 210
35 3300005545 Ga0070695_100190685 Ga0070695_1001906851 210
36 3300005564 Ga0070664_100000148 Ga0070664_10000014819 210
37 3300005618 Ga0068864_100700074 Ga0068864_1007000742 210
38 3300005719 Ga0068861_100361312 Ga0068861_1003613122 210
39 3300005719 Ga0068861_100584100 Ga0068861_1005841001 210
40 3300005841 Ga0068863_100116953 Ga0068863_1001169533 210
41 3300006195 Ga0075366_10241062 Ga0075366_102410622 210
42 3300006847 Ga0075431_100057804 Ga0075431_1000578043 210
43 3300006847 Ga0075431_101282056 Ga0075431_1012820561 210
44 3300007076 Ga0075435_100280424 Ga0075435_1002804242 210
45 3300009094 Ga0111539_10114115 Ga0111539_101141154 210
46 3300009094 Ga0111539_11342789 Ga0111539_113427891 210
47 3300009147 Ga0114129_10196672 Ga0114129_101966723 210
48 3300009148 Ga0105243_10032206 Ga0105243_100322064 210
49 3300009553 Ga0105249_10116041 Ga0105249_101160413 210
50 3300013296 Ga0157374_10385416 Ga0157374_103854162 210
51 3300014325 Ga0163163_10036230 Ga0163163_100362305 210
52 3300025315 Ga0207697_10023951 Ga0207697_100239513 210
53 3300025916 Ga0207663_10095303 Ga0207663_100953032 210
54 3300025918 Ga0207662_10570445 Ga0207662_105704451 210
55 3300025920 Ga0207649_10005241 Ga0207649_100052413 210
56 3300025925 Ga0207650_10105444 Ga0207650_101054442 210
57 3300025932 Ga0207690_10054165 Ga0207690_100541653 210
58 3300025933 Ga0207706_10067984 Ga0207706_100679842 210
59 3300025936 Ga0207670_10045254 Ga0207670_100452542 210
60 3300025938 Ga0207704_10259314 Ga0207704_102593142 210
61 3300025945 Ga0207679_10038822 Ga0207679_100388223 210
62 3300025960 Ga0207651_10578429 Ga0207651_105784292 210
63 3300025961 Ga0207712_10016432 Ga0207712_100164325 210
64 3300025986 Ga0207658_10070295 Ga0207658_100702951 210
65 3300026067 Ga0207678_10498498 Ga0207678_104984982 210
66 3300028381 Ga0268264_10206162 Ga0268264_102061622 210
67 3300028794 Ga0307515_10043991 Ga0307515_100439916 210
68 3300031507 Ga0307509_10080880 Ga0307509_100808804 210
69 3300031730 Ga0307516_10033412 Ga0307516_100334123 210
70 3300035090 Ga0373949_0000118 Ga0373949_0000118_11512_12144 210
71 3300035113 Ga0373936_0000046 Ga0373936_0000046_44580_45212 210
72 3300035241 Ga0373961_0000019 Ga0373961_0000019_39421_40053 210
73 3300039450 Ga0436363_0996298 Ga0436363_0996298_25_657 210
74 3300041507 Ga0451851_1121094 Ga0451851_1121094_922_1554 210
75 3300044901 Ga0466960_0290801 Ga0466960_0290801_160_819 210
76 3300046557 Ga0495622_0073117 Ga0495622_0073117_912_1544 210
77 3300046694 Ga0495649_0127274 Ga0495649_0127274_362_994 210
78 3300048907 Ga0496104_0003667 Ga0496104_0003667_1852_2511 210
79 3300048908 Ga0496105_0032957 Ga0496105_0032957_1730_2389 210
80 3300048909 Ga0496106_0901438 Ga0496106_0901438_13_672 210
81 3300048911 Ga0496108_0268975 Ga0496108_0268975_326_985 210
82 3300048912 Ga0496109_0354255 Ga0496109_0354255_359_1018 210
83 3300048913 Ga0496110_0002140 Ga0496110_0002140_8457_9116 210
84 3300048914 Ga0496111_0057323 Ga0496111_0057323_207_866 210
85 3300048915 Ga0496112_0004561 Ga0496112_0004561_1550_2209 210
86 3300048916 Ga0496113_0031890 Ga0496113_0031890_2792_3451 210
87 3300049584 Ga0501068_0026968 Ga0501068_0026968_698_1330 210
88 3300049587 Ga0501071_0906598 Ga0501071_0906598_28_660 210
89 3300049588 Ga0501072_0097978 Ga0501072_0097978_998_1630 210
90 3300049591 Ga0501075_0159154 Ga0501075_0159154_399_1058 210
91 3300049744 Ga0501083_0069307 Ga0501083_0069307_1389_2021 210
92 3300050491 nmdc:mga00v17_113434_c1 nmdc:mga00v17_113434_c1_972_1667 210
93 3300050493 nmdc:mga0k408_131361_c1 nmdc:mga0k408_131361_c1_529_1161 210
94 3300050507 nmdc:mga05p37_300996_c1 nmdc:mga05p37_300996_c1_179_811 210
95 3300050509 nmdc:mga0qj67_616480_c1 nmdc:mga0qj67_616480_c1_95_727 210
96 3300050510 nmdc:mga06r32_2395_c1 nmdc:mga06r32_2395_c1_8736_9368 210
97 3300050510 nmdc:mga06r32_666372_c1 nmdc:mga06r32_666372_c1_139_771 210
98 3300050511 nmdc:mga08y16_405210_c1 nmdc:mga08y16_405210_c1_382_1014 210
99 3300050512 nmdc:mga0n895_1092566_c1 nmdc:mga0n895_1092566_c1_115_747 210
100 3300053080 Ga0500635_0003469 Ga0500635_0003469_144_776 210
101 3300053086 Ga0500578_0027682 Ga0500578_0027682_2960_3592 210
102 3300053090 Ga0500646_0045680 Ga0500646_0045680_191_823 210
103 3300053092 Ga0500583_0004038 Ga0500583_0004038_3333_3965 210
104 3300053094 Ga0500566_0023181 Ga0500566_0023181_1615_2247 210
105 3300053094 Ga0500566_0190252 Ga0500566_0190252_337_969 210
106 3300053102 Ga0500554_000552 Ga0500554_000552_144_776 210
107 3300053111 Ga0500572_005407 Ga0500572_005407_247_879 210
108 3300053119 Ga0500595_000092 Ga0500595_000092_36997_37629 210
109 3300053123 Ga0500614_000111 Ga0500614_000111_6991_7623 210
110 3300053123 Ga0500614_003148 Ga0500614_003148_2899_3531 210
111 3300053130 Ga0500642_0047332 Ga0500642_0047332_524_1156 210
112 3300053136 Ga0500559_0024391 Ga0500559_0024391_1829_2461 210
113 3300053144 Ga0500585_067732 Ga0500585_067732_80_712 210
114 3300053150 Ga0500603_000780 Ga0500603_000780_6438_7070 210
115 3300053156 Ga0500622_0013506 Ga0500622_0013506_2864_3496 210
116 3300053162 Ga0500638_223230 Ga0500638_223230_26_658 210
117 3300053177 Ga0500636_0028491 Ga0500636_0028491_1673_2305 210
118 3300055283 Ga0500661_025048 Ga0500661_025048_407_1039 210
119 3300000549 LJQas_1000065 LJQas_10000656 211
120 3300003320 rootH2_10056818 rootH2_100568183 211
121 3300003322 rootL2_10095937 rootL2_100959375 211
122 3300003791 Ga0055530_10017977 Ga0055530_100179773 211
123 3300004798 Ga0058859_11695945 Ga0058859_116959451 211
124 3300004799 Ga0058863_11837207 Ga0058863_118372071 211
125 3300004800 Ga0058861_11471527 Ga0058861_114715271 211
126 3300004803 Ga0058862_12821340 Ga0058862_128213401 211
127 3300005290 Ga0065712_10080397 Ga0065712_100803973 211
128 3300005293 Ga0065715_10535185 Ga0065715_105351851 211
129 3300005330 Ga0070690_100000028 Ga0070690_1000000282 211
130 3300005335 Ga0070666_10002543 Ga0070666_100025431 211
131 3300005340 Ga0070689_100006168 Ga0070689_1000061686 211
132 3300005340 Ga0070689_100014395 Ga0070689_1000143953 211
133 3300005343 Ga0070687_100295912 Ga0070687_1002959121 211
134 3300005344 Ga0070661_100563304 Ga0070661_1005633042 211
135 3300005353 Ga0070669_100005403 Ga0070669_1000054034 211
136 3300005356 Ga0070674_100134908 Ga0070674_1001349082 211
137 3300005364 Ga0070673_100005533 Ga0070673_1000055333 211
138 3300005367 Ga0070667_100005724 Ga0070667_1000057242 211
139 3300005438 Ga0070701_10414871 Ga0070701_104148711 211
140 3300005440 Ga0070705_100175116 Ga0070705_1001751162 211
141 3300005444 Ga0070694_100074460 Ga0070694_1000744602 211
142 3300005445 Ga0070708_100079378 Ga0070708_1000793781 211
143 3300005455 Ga0070663_100034311 Ga0070663_1000343112 211
144 3300005459 Ga0068867_100065549 Ga0068867_1000655492 211
145 3300005466 Ga0070685_10032431 Ga0070685_100324313 211
146 3300005466 Ga0070685_10288357 Ga0070685_102883572 211
147 3300005467 Ga0070706_100308505 Ga0070706_1003085052 211
148 3300005468 Ga0070707_100000015 Ga0070707_10000001543 211
149 3300005518 Ga0070699_100413370 Ga0070699_1004133701 211
150 3300005543 Ga0070672_100558483 Ga0070672_1005584831 211
151 3300005543 Ga0070672_100873614 Ga0070672_1008736141 211
152 3300005544 Ga0070686_100109277 Ga0070686_1001092772 211
153 3300005547 Ga0070693_100048883 Ga0070693_1000488832 211
154 3300005548 Ga0070665_100037083 Ga0070665_1000370831 211
155 3300005563 Ga0068855_100087221 Ga0068855_1000872213 211
156 3300005564 Ga0070664_100084436 Ga0070664_1000844362 211
157 3300005577 Ga0068857_100041888 Ga0068857_1000418883 211
158 3300005578 Ga0068854_100134409 Ga0068854_1001344092 211
159 3300005614 Ga0068856_100015456 Ga0068856_1000154564 211
160 3300005615 Ga0070702_100013276 Ga0070702_1000132762 211
161 3300005616 Ga0068852_100040345 Ga0068852_1000403454 211
162 3300005617 Ga0068859_100001575 Ga0068859_1000015758 211
163 3300005617 Ga0068859_100041995 Ga0068859_1000419951 211
164 3300005618 Ga0068864_100833200 Ga0068864_1008332001 211
165 3300005718 Ga0068866_10010335 Ga0068866_100103352 211
166 3300005841 Ga0068863_100010284 Ga0068863_1000102843 211
167 3300005841 Ga0068863_100934441 Ga0068863_1009344411 211
168 3300005842 Ga0068858_100003653 Ga0068858_1000036533 211
169 3300005842 Ga0068858_100766825 Ga0068858_1007668252 211
170 3300005843 Ga0068860_100003890 Ga0068860_10000389010 211
171 3300005843 Ga0068860_100972775 Ga0068860_1009727752 211
172 3300005844 Ga0068862_100041205 Ga0068862_1000412052 211
173 3300005937 Ga0081455_10001687 Ga0081455_1000168722 211
174 3300005983 Ga0081540_1124227 Ga0081540_11242271 211
175 3300005985 Ga0081539_10000894 Ga0081539_1000089426 211
176 3300006028 Ga0070717_10073256 Ga0070717_100732562 211
177 3300006178 Ga0075367_10262618 Ga0075367_102626181 211
178 3300006237 Ga0097621_100052203 Ga0097621_1000522032 211
179 3300006358 Ga0068871_100230448 Ga0068871_1002304481 211
180 3300006844 Ga0075428_100536921 Ga0075428_1005369212 211
181 3300006844 Ga0075428_101134591 Ga0075428_1011345911 211
182 3300006846 Ga0075430_100085326 Ga0075430_1000853262 211
183 3300006846 Ga0075430_100435889 Ga0075430_1004358891 211
184 3300006847 Ga0075431_100035439 Ga0075431_1000354391 211
185 3300006847 Ga0075431_100066610 Ga0075431_1000666103 211
186 3300006847 Ga0075431_100100445 Ga0075431_1001004454 211
187 3300006847 Ga0075431_100155084 Ga0075431_1001550842 211
188 3300006847 Ga0075431_100602523 Ga0075431_1006025232 211
189 3300006852 Ga0075433_10638665 Ga0075433_106386652 211
190 3300006871 Ga0075434_100417650 Ga0075434_1004176502 211
191 3300006880 Ga0075429_100492724 Ga0075429_1004927242 211
192 3300006931 Ga0097620_100001575 Ga0097620_1000015758 211
193 3300006931 Ga0097620_100041994 Ga0097620_1000419941 211
194 3300009011 Ga0105251_10098085 Ga0105251_100980852 211
195 3300009094 Ga0111539_10185305 Ga0111539_101853052 211
196 3300009101 Ga0105247_10013198 Ga0105247_100131982 211
197 3300009147 Ga0114129_10402416 Ga0114129_104024162 211
198 3300009147 Ga0114129_10428106 Ga0114129_104281062 211
199 3300009148 Ga0105243_10305632 Ga0105243_103056322 211
200 3300009174 Ga0105241_10070312 Ga0105241_100703122 211
201 3300009176 Ga0105242_10236901 Ga0105242_102369012 211
202 3300009177 Ga0105248_10006741 Ga0105248_100067412 211
203 3300011119 Ga0105246_10069181 Ga0105246_100691812 211
204 3300013297 Ga0157378_10007523 Ga0157378_100075236 211
205 3300013308 Ga0157375_10003408 Ga0157375_100034087 211
206 3300014325 Ga0163163_10180742 Ga0163163_101807422 211
207 3300014325 Ga0163163_10850039 Ga0163163_108500391 211
208 3300014326 Ga0157380_10013224 Ga0157380_100132242 211
209 3300014968 Ga0157379_10000882 Ga0157379_100008828 211
210 3300014969 Ga0157376_10034180 Ga0157376_100341801 211
211 3300020069 Ga0197907_10083167 Ga0197907_100831671 211
212 3300020070 Ga0206356_10897421 Ga0206356_108974211 211
213 3300020076 Ga0206355_1431193 Ga0206355_14311931 211
214 3300020078 Ga0206352_10038393 Ga0206352_100383932 211
215 3300020078 Ga0206352_10615686 Ga0206352_106156861 211
216 3300020080 Ga0206350_10210031 Ga0206350_102100311 211
217 3300020081 Ga0206354_10204332 Ga0206354_102043321 211
218 3300020082 Ga0206353_11344678 Ga0206353_113446781 211
219 3300022467 Ga0224712_10213915 Ga0224712_102139151 211
220 3300022467 Ga0224712_10316952 Ga0224712_103169521 211
221 3300025298 Ga0209050_1001878 Ga0209050_100187814 211
222 3300025298 Ga0209050_1008381 Ga0209050_10083816 211
223 3300025899 Ga0207642_10077971 Ga0207642_100779712 211
224 3300025903 Ga0207680_10001635 Ga0207680_100016358 211
225 3300025910 Ga0207684_10231086 Ga0207684_102310862 211
226 3300025920 Ga0207649_10244374 Ga0207649_102443742 211
227 3300025922 Ga0207646_10000025 Ga0207646_1000002571 211
228 3300025923 Ga0207681_10023540 Ga0207681_100235404 211
229 3300025934 Ga0207686_10192931 Ga0207686_101929311 211
230 3300025935 Ga0207709_10500342 Ga0207709_105003422 211
231 3300025936 Ga0207670_10001799 Ga0207670_100017996 211
232 3300025936 Ga0207670_10007640 Ga0207670_100076406 211
233 3300025937 Ga0207669_10108334 Ga0207669_101083342 211
234 3300025939 Ga0207665_10166878 Ga0207665_101668782 211
235 3300025940 Ga0207691_10004503 Ga0207691_100045032 211
236 3300025940 Ga0207691_10826394 Ga0207691_108263941 211
237 3300025941 Ga0207711_10001951 Ga0207711_100019519 211
238 3300025945 Ga0207679_10139690 Ga0207679_101396902 211
239 3300025949 Ga0207667_10299623 Ga0207667_102996232 211
240 3300025960 Ga0207651_10032822 Ga0207651_100328222 211
241 3300025986 Ga0207658_10008065 Ga0207658_100080654 211
242 3300026035 Ga0207703_10008425 Ga0207703_100084253 211
243 3300026067 Ga0207678_10061587 Ga0207678_100615872 211
244 3300026075 Ga0207708_10436124 Ga0207708_104361242 211
245 3300026078 Ga0207702_10636562 Ga0207702_106365622 211
246 3300026088 Ga0207641_10449262 Ga0207641_104492622 211
247 3300026089 Ga0207648_10013974 Ga0207648_100139742 211
248 3300026116 Ga0207674_10040494 Ga0207674_100404943 211
249 3300026116 Ga0207674_10386887 Ga0207674_103868871 211
250 3300026121 Ga0207683_10208815 Ga0207683_102088152 211
251 3300026142 Ga0207698_10077409 Ga0207698_100774092 211
252 3300027512 Ga0209179_1068908 Ga0209179_10689081 211
253 3300027907 Ga0207428_10018170 Ga0207428_100181705 211
254 3300028379 Ga0268266_10038547 Ga0268266_100385471 211
255 3300028380 Ga0268265_10264139 Ga0268265_102641392 211
256 3300028381 Ga0268264_10217679 Ga0268264_102176792 211
257 3300028563 Ga0265319_1067223 Ga0265319_10672231 211
258 3300028573 Ga0265334_10020191 Ga0265334_100201912 211
259 3300028800 Ga0265338_10011728 Ga0265338_100117288 211
260 3300028800 Ga0265338_10556680 Ga0265338_105566801 211
261 3300031251 Ga0265327_10004233 Ga0265327_100042334 211
262 3300031711 Ga0265314_10280673 Ga0265314_102806731 211
263 3300031995 Ga0307409_100919340 Ga0307409_1009193401 211
264 3300037853 Ga0436364_0340931 Ga0436364_0340931_48_683 211
265 3300039437 Ga0436365_1401300 Ga0436365_1401300_2180_2815 211
266 3300042876 Ga0451577_0883174 Ga0451577_0883174_75_713 211
267 3300044712 Ga0453684_1177004 Ga0453684_1177004_121_759 211
268 3300045051 Ga0451576_0685873 Ga0451576_0685873_25_660 211
269 3300046460 Ga0495638_0000001 Ga0495638_0000001_582414_583049 211
270 3300046517 Ga0495630_0225938 Ga0495630_0225938_24_659 211
271 3300046519 Ga0495632_0001279 Ga0495632_0001279_6322_6957 211
272 3300046616 Ga0495668_0000368 Ga0495668_0000368_2811_3473 211
273 3300048088 Ga0495602_0364822 Ga0495602_0364822_390_1025 211
274 3300048903 Ga0496100_0031761 Ga0496100_0031761_2151_2786 211
275 3300048904 Ga0496101_0084018 Ga0496101_0084018_1642_2277 211
276 3300048905 Ga0496102_0020019 Ga0496102_0020019_2028_2663 211
277 3300048906 Ga0496103_0104061 Ga0496103_0104061_1107_1742 211
278 3300048907 Ga0496104_0061916 Ga0496104_0061916_1122_1757 211
279 3300048909 Ga0496106_0001548 Ga0496106_0001548_6335_6970 211
280 3300048910 Ga0496107_0391478 Ga0496107_0391478_188_838 211
281 3300048912 Ga0496109_0000097 Ga0496109_0000097_31795_32433 211
282 3300048912 Ga0496109_0510216 Ga0496109_0510216_45_680 211
283 3300048914 Ga0496111_0007844 Ga0496111_0007844_4601_5236 211
284 3300049533 Ga0501317_023254 Ga0501317_023254_24_662 211
285 3300049578 Ga0501042_0191287 Ga0501042_0191287_702_1337 211
286 3300049585 Ga0501069_0100678 Ga0501069_0100678_177_812 211
287 3300049588 Ga0501072_0300440 Ga0501072_0300440_587_1222 211
288 3300049591 Ga0501075_0019697 Ga0501075_0019697_297_932 211
289 3300049592 Ga0501076_0050168 Ga0501076_0050168_581_1216 211
290 3300049593 Ga0501077_0348301 Ga0501077_0348301_197_832 211
291 3300049742 Ga0501080_0071393 Ga0501080_0071393_1211_1846 211
292 3300049743 Ga0501081_0218760 Ga0501081_0218760_366_1001 211
293 3300049822 Ga0501035_0340430 Ga0501035_0340430_310_945 211
294 3300049824 Ga0501045_0008318 Ga0501045_0008318_936_1571 211
295 3300050494 nmdc:mga06z11_323035_c1 nmdc:mga06z11_323035_c1_233_871 211
296 3300050507 nmdc:mga05p37_522177_c1 nmdc:mga05p37_522177_c1_64_702 211
297 3300050508 nmdc:mga09592_414826_c1 nmdc:mga09592_414826_c1_505_1143 211
298 3300050509 nmdc:mga0qj67_118874_c1 nmdc:mga0qj67_118874_c1_130_768 211
299 3300050510 nmdc:mga06r32_133554_c1 nmdc:mga06r32_133554_c1_367_1005 211
300 3300050510 nmdc:mga06r32_14119_c1 nmdc:mga06r32_14119_c1_347_985 211
301 3300050510 nmdc:mga06r32_263004_c1 nmdc:mga06r32_263004_c1_47_685 211
302 3300050510 nmdc:mga06r32_593602_c1 nmdc:mga06r32_593602_c1_410_1045 211
303 3300050511 nmdc:mga08y16_176771_c1 nmdc:mga08y16_176771_c1_66_704 211
304 3300050512 nmdc:mga0n895_195860_c1 nmdc:mga0n895_195860_c1_1137_1775 211
305 3300050512 nmdc:mga0n895_325163_c1 nmdc:mga0n895_325163_c1_32_694 211
306 3300050515 nmdc:mga0a205_56014_c1 nmdc:mga0a205_56014_c1_2354_2992 211
307 3300053085 Ga0495619_0091366 Ga0495619_0091366_883_1518 211
308 3300053085 Ga0495619_0422903 Ga0495619_0422903_17_652 211
309 3300053096 Ga0500641_0031152 Ga0500641_0031152_330_968 211
310 3300053098 Ga0500650_0205498 Ga0500650_0205498_91_726 211
311 3300053103 Ga0500555_001623 Ga0500555_001623_1125_1763 211
312 3300053153 Ga0500616_0000009 Ga0500616_0000009_156056_156691 211
313 3300053153 Ga0500616_0199085 Ga0500616_0199085_68_703 211
314 3300059477 Ga0587084_057852 Ga0587084_057852_35_670 211
315 3300005334 Ga0068869_100250644 Ga0068869_1002506442 212
316 3300005539 Ga0068853_100005648 Ga0068853_1000056486 212
317 3300005563 Ga0068855_101237986 Ga0068855_1012379861 212
318 3300009177 Ga0105248_10257786 Ga0105248_102577862 212
319 3300013296 Ga0157374_10612465 Ga0157374_106124652 212
320 3300014325 Ga0163163_10782687 Ga0163163_107826871 212
321 3300025941 Ga0207711_10763902 Ga0207711_107639021 212
322 3300026041 Ga0207639_10001408 Ga0207639_100014088 212
323 3300026041 Ga0207639_10838749 Ga0207639_108387491 212
324 3300028379 Ga0268266_10708086 Ga0268266_107080861 212
325 3300028800 Ga0265338_10126030 Ga0265338_101260302 212
326 3300031727 Ga0316576_10120608 Ga0316576_101206082 212
327 3300036712 Ga0316584_0110202 Ga0316584_0110202_1265_1906 212
328 3300049766 Ga0501269_015665 Ga0501269_015665_142_867 212
329 3300050508 nmdc:mga09592_47498_c1 nmdc:mga09592_47498_c1_1673_2311 212
330 3300050509 nmdc:mga0qj67_95138_c1 nmdc:mga0qj67_95138_c1_1426_2064 212
331 3300050510 nmdc:mga06r32_123798_c1 nmdc:mga06r32_123798_c1_725_1363 212
332 3300059491 Ga0587070_063829 Ga0587070_063829_42_710 212
333 3300059646 Ga0587078_027059 Ga0587078_027059_30_698 212
334 3300059647 Ga0587079_068722 Ga0587079_068722_48_716 212
335 3300060344 Ga0587071_079155 Ga0587071_079155_28_696 212
336 3300005344 Ga0070661_100732682 Ga0070661_1007326821 213
337 3300005355 Ga0070671_100759675 Ga0070671_1007596751 213
338 3300005456 Ga0070678_100643863 Ga0070678_1006438632 213
339 3300005459 Ga0068867_100430948 Ga0068867_1004309482 213
340 3300005564 Ga0070664_100199155 Ga0070664_1001991552 213
341 3300005617 Ga0068859_100886998 Ga0068859_1008869981 213
342 3300005617 Ga0068859_101513349 Ga0068859_1015133491 213
343 3300006237 Ga0097621_100060254 Ga0097621_1000602544 213
344 3300006931 Ga0097620_100886815 Ga0097620_1008868151 213
345 3300006931 Ga0097620_101513497 Ga0097620_1015134971 213
346 3300013308 Ga0157375_10826115 Ga0157375_108261152 213
347 3300025908 Ga0207643_10162141 Ga0207643_101621411 213
348 3300025925 Ga0207650_10213152 Ga0207650_102131522 213
349 3300025940 Ga0207691_10185036 Ga0207691_101850362 213
350 3300025945 Ga0207679_10565978 Ga0207679_105659781 213
351 3300026089 Ga0207648_10143304 Ga0207648_101433043 213
352 3300049572 Ga0501036_0120591 Ga0501036_0120591_468_1151 214
353 3300005288 Ga0065714_10064425 Ga0065714_10064425126 215
354 3300005290 Ga0065712_10067727 Ga0065712_10067727126 215
355 3300005293 Ga0065715_10089978 Ga0065715_100899785 215
356 3300005440 Ga0070705_100050866 Ga0070705_1000508663 215
357 3300006871 Ga0075434_100616942 Ga0075434_1006169421 215
358 3300050511 nmdc:mga08y16_639331_c1 nmdc:mga08y16_639331_c1_398_1045 215
359 3300005937 Ga0081455_10020179 Ga0081455_100201794 216
360 3300005295 Ga0065707_10161075 Ga0065707_101610752 217
361 3300005337 Ga0070682_100033339 Ga0070682_1000333393 217
362 3300005345 Ga0070692_10041057 Ga0070692_100410573 217
363 3300005406 Ga0070703_10005734 Ga0070703_100057344 217
364 3300005440 Ga0070705_100058014 Ga0070705_1000580142 217
365 3300005441 Ga0070700_100231212 Ga0070700_1002312121 217
366 3300005441 Ga0070700_100630265 Ga0070700_1006302651 217
367 3300005444 Ga0070694_100009682 Ga0070694_1000096822 217
368 3300005444 Ga0070694_100120848 Ga0070694_1001208482 217
369 3300005444 Ga0070694_100133515 Ga0070694_1001335152 217
370 3300005545 Ga0070695_100408168 Ga0070695_1004081682 217
371 3300005546 Ga0070696_100053597 Ga0070696_1000535972 217
372 3300005546 Ga0070696_100118292 Ga0070696_1001182922 217
373 3300005546 Ga0070696_100185767 Ga0070696_1001857672 217
374 3300005546 Ga0070696_100395008 Ga0070696_1003950082 217
375 3300005547 Ga0070693_100009962 Ga0070693_1000099623 217
376 3300005549 Ga0070704_100130851 Ga0070704_1001308512 217
377 3300005549 Ga0070704_100951353 Ga0070704_1009513531 217
378 3300005614 Ga0068856_100124725 Ga0068856_1001247254 217
379 3300005615 Ga0070702_100016247 Ga0070702_1000162474 217
380 3300005616 Ga0068852_100551494 Ga0068852_1005514942 217
381 3300005617 Ga0068859_100069624 Ga0068859_1000696242 217
382 3300005618 Ga0068864_100015996 Ga0068864_1000159962 217
383 3300005834 Ga0068851_10001281 Ga0068851_100012817 217
384 3300005842 Ga0068858_100096439 Ga0068858_1000964392 217
385 3300006852 Ga0075433_10042324 Ga0075433_100423242 217
386 3300006871 Ga0075434_100012109 Ga0075434_1000121098 217
387 3300006871 Ga0075434_100652644 Ga0075434_1006526442 217
388 3300006931 Ga0097620_100069624 Ga0097620_1000696242 217
389 3300007076 Ga0075435_100290935 Ga0075435_1002909352 217
390 3300009093 Ga0105240_10044998 Ga0105240_100449986 217
391 3300009147 Ga0114129_10610320 Ga0114129_106103202 217
392 3300009148 Ga0105243_10466201 Ga0105243_104662012 217
393 3300009148 Ga0105243_10814878 Ga0105243_108148781 217
394 3300009545 Ga0105237_10000521 Ga0105237_100005216 217
395 3300009545 Ga0105237_10547031 Ga0105237_105470312 217
396 3300013307 Ga0157372_10001998 Ga0157372_1000199815 217
397 3300013307 Ga0157372_10732184 Ga0157372_107321841 217
398 3300013308 Ga0157375_10011344 Ga0157375_100113447 217
399 3300014325 Ga0163163_10005967 Ga0163163_100059672 217
400 3300025321 Ga0207656_10001382 Ga0207656_100013827 217
401 3300025885 Ga0207653_10007178 Ga0207653_100071782 217
402 3300025904 Ga0207647_10055134 Ga0207647_100551342 217
403 3300025913 Ga0207695_10287760 Ga0207695_102877602 217
404 3300025913 Ga0207695_10823402 Ga0207695_108234021 217
405 3300025914 Ga0207671_10003001 Ga0207671_100030013 217
406 3300025914 Ga0207671_10212068 Ga0207671_102120682 217
407 3300025918 Ga0207662_10251875 Ga0207662_102518752 217
408 3300025935 Ga0207709_10429733 Ga0207709_104297331 217
409 3300025942 Ga0207689_10036105 Ga0207689_100361053 217
410 3300025961 Ga0207712_10598767 Ga0207712_105987671 217
411 3300026035 Ga0207703_10057177 Ga0207703_100571772 217
412 3300026035 Ga0207703_10067803 Ga0207703_100678032 217
413 3300026041 Ga0207639_10136876 Ga0207639_101368761 217
414 3300026041 Ga0207639_10677894 Ga0207639_106778941 217
415 3300026075 Ga0207708_10140512 Ga0207708_101405123 217
416 3300026078 Ga0207702_10058217 Ga0207702_100582175 217
417 3300026088 Ga0207641_10164113 Ga0207641_101641132 217
418 3300026088 Ga0207641_10237332 Ga0207641_102373322 217
419 3300026095 Ga0207676_10004304 Ga0207676_100043044 217
420 3300026095 Ga0207676_11244685 Ga0207676_112446851 217
421 3300026142 Ga0207698_10088806 Ga0207698_100888061 217
422 3300028381 Ga0268264_10213485 Ga0268264_102134852 217
423 3300032002 Ga0307416_100221467 Ga0307416_1002214671 217
424 3300032126 Ga0307415_100276637 Ga0307415_1002766372 217
425 3300038996 Ga0242420_027470 Ga0242420_027470_169_822 217
426 3300042876 Ga0451577_0906667 Ga0451577_0906667_100_756 217
427 3300045051 Ga0451576_0713132 Ga0451576_0713132_349_1005 217
428 3300045051 Ga0451576_1192578 Ga0451576_1192578_87_740 217
429 3300046616 Ga0495668_0000102 Ga0495668_0000102_110020_110673 217
430 3300048905 Ga0496102_0044303 Ga0496102_0044303_3317_3970 217
431 3300048910 Ga0496107_0446640 Ga0496107_0446640_257_910 217
432 3300048911 Ga0496108_0551753 Ga0496108_0551753_327_980 217
433 3300048913 Ga0496110_0219033 Ga0496110_0219033_818_1471 217
434 3300049162 Ga0501307_036672 Ga0501307_036672_21_674 217
435 3300049513 Ga0501290_018448 Ga0501290_018448_16_699 217
436 3300049521 Ga0501298_006412 Ga0501298_006412_1232_1885 217
437 3300049660 Ga0501216_001490 Ga0501216_001490_1176_1829 217
438 3300049661 Ga0501217_006796 Ga0501217_006796_47_700 217
439 3300049663 Ga0501223_005017 Ga0501223_005017_221_904 217
440 3300049665 Ga0501227_062979 Ga0501227_062979_68_721 217
441 3300049667 Ga0501230_062895 Ga0501230_062895_79_732 217
442 3300049670 Ga0501236_051428 Ga0501236_051428_46_699 217
443 3300049673 Ga0501240_005871 Ga0501240_005871_568_1221 217
444 3300049688 Ga0501259_020567 Ga0501259_020567_303_986 217
445 3300049704 Ga0501221_056353 Ga0501221_056353_223_876 217
446 3300049705 Ga0501225_0029308 Ga0501225_0029308_39_692 217
447 3300049707 Ga0501234_025335 Ga0501234_025335_101_754 217
448 3300049765 Ga0501268_003456 Ga0501268_003456_968_1621 217
449 3300050507 nmdc:mga05p37_748434_c1 nmdc:mga05p37_748434_c1_80_733 217
450 3300050511 nmdc:mga08y16_62860_c1 nmdc:mga08y16_62860_c1_2990_3643 217
451 3300050512 nmdc:mga0n895_34627_c1 nmdc:mga0n895_34627_c1_115_771 217
452 3300050515 nmdc:mga0a205_18693_c1 nmdc:mga0a205_18693_c1_202_858 217
453 3300050515 nmdc:mga0a205_479809_c1 nmdc:mga0a205_479809_c1_427_1080 217
454 3300005439 Ga0070711_100000013 Ga0070711_100000013108 218
455 3300005440 Ga0070705_100000331 Ga0070705_10000033114 218
456 3300005444 Ga0070694_100296935 Ga0070694_1002969352 218
457 3300005445 Ga0070708_100105618 Ga0070708_1001056182 218
458 3300005467 Ga0070706_100001365 Ga0070706_1000013657 218
459 3300005518 Ga0070699_100000062 Ga0070699_10000006214 218
460 3300005545 Ga0070695_100096559 Ga0070695_1000965591 218
461 3300005545 Ga0070695_100941854 Ga0070695_1009418541 218
462 3300005546 Ga0070696_100000407 Ga0070696_10000040714 218
463 3300005546 Ga0070696_100008878 Ga0070696_1000088787 218
464 3300005547 Ga0070693_100005168 Ga0070693_1000051683 218
465 3300006852 Ga0075433_10080265 Ga0075433_100802653 218
466 3300006914 Ga0075436_100105479 Ga0075436_1001054792 218
467 3300007076 Ga0075435_100557056 Ga0075435_1005570561 218
468 3300009093 Ga0105240_10926597 Ga0105240_109265971 218
469 3300025885 Ga0207653_10000132 Ga0207653_1000013230 218
470 3300025910 Ga0207684_10000230 Ga0207684_1000023025 218
471 3300025916 Ga0207663_10000020 Ga0207663_1000002087 218
472 3300025939 Ga0207665_10171776 Ga0207665_101717762 218
473 3300026075 Ga0207708_10429596 Ga0207708_104295961 218
474 3300032002 Ga0307416_100996707 Ga0307416_1009967071 218
475 3300050512 nmdc:mga0n895_291295_c1 nmdc:mga0n895_291295_c1_702_1358 218
476 3300050512 nmdc:mga0n895_431482_c1 nmdc:mga0n895_431482_c1_655_1311 218
477 3300050514 nmdc:mga08x19_10_c1 nmdc:mga08x19_10_c1_299349_300005 218
478 3300050514 nmdc:mga08x19_63892_c1 nmdc:mga08x19_63892_c1_742_1398 218
479 3300050515 nmdc:mga0a205_56451_c1 nmdc:mga0a205_56451_c1_1707_2363 218
480 3300005295 Ga0065707_10000738 Ga0065707_1000073812 219
481 3300005295 Ga0065707_10237779 Ga0065707_102377791 219
482 3300005329 Ga0070683_100089060 Ga0070683_1000890602 219
483 3300005340 Ga0070689_100069171 Ga0070689_1000691713 219
484 3300005340 Ga0070689_100854734 Ga0070689_1008547341 219
485 3300005341 Ga0070691_10281698 Ga0070691_102816981 219
486 3300005355 Ga0070671_100037532 Ga0070671_1000375322 219
487 3300005365 Ga0070688_100032114 Ga0070688_1000321141 219
488 3300005365 Ga0070688_100323249 Ga0070688_1003232491 219
489 3300005406 Ga0070703_10000179 Ga0070703_100001792 219
490 3300005438 Ga0070701_10279757 Ga0070701_102797572 219
491 3300005441 Ga0070700_100000645 Ga0070700_10000064510 219
492 3300005445 Ga0070708_100122743 Ga0070708_1001227433 219
493 3300005455 Ga0070663_100164421 Ga0070663_1001644212 219
494 3300005457 Ga0070662_100212555 Ga0070662_1002125552 219
495 3300005466 Ga0070685_10006057 Ga0070685_100060574 219
496 3300005466 Ga0070685_10103209 Ga0070685_101032092 219
497 3300005466 Ga0070685_10225090 Ga0070685_102250901 219
498 3300005468 Ga0070707_100000108 Ga0070707_10000010825 219
499 3300005471 Ga0070698_100123779 Ga0070698_1001237792 219
500 3300005535 Ga0070684_100110192 Ga0070684_1001101922 219
501 3300005535 Ga0070684_100530474 Ga0070684_1005304742 219
502 3300005536 Ga0070697_100005855 Ga0070697_1000058559 219
503 3300005543 Ga0070672_100038051 Ga0070672_1000380512 219
504 3300005549 Ga0070704_100007453 Ga0070704_1000074534 219
505 3300005578 Ga0068854_100637353 Ga0068854_1006373531 219
506 3300005616 Ga0068852_100093840 Ga0068852_1000938403 219
507 3300005617 Ga0068859_100002187 Ga0068859_10000218710 219
508 3300005617 Ga0068859_100105209 Ga0068859_1001052094 219
509 3300005618 Ga0068864_100157461 Ga0068864_1001574612 219
510 3300005841 Ga0068863_100847915 Ga0068863_1008479151 219
511 3300005844 Ga0068862_100003050 Ga0068862_1000030504 219
512 3300006358 Ga0068871_100276808 Ga0068871_1002768082 219
513 3300006358 Ga0068871_100965479 Ga0068871_1009654791 219
514 3300006847 Ga0075431_101100799 Ga0075431_1011007991 219
515 3300006880 Ga0075429_100022418 Ga0075429_1000224187 219
516 3300006931 Ga0097620_100002186 Ga0097620_10000218610 219
517 3300006931 Ga0097620_100105213 Ga0097620_1001052134 219
518 3300009094 Ga0111539_10001564 Ga0111539_100015648 219
519 3300009101 Ga0105247_10469462 Ga0105247_104694622 219
520 3300009148 Ga0105243_10000050 Ga0105243_1000005056 219
521 3300009148 Ga0105243_10611854 Ga0105243_106118542 219
522 3300009176 Ga0105242_10000654 Ga0105242_1000065419 219
523 3300009177 Ga0105248_10040098 Ga0105248_100400984 219
524 3300009553 Ga0105249_10097360 Ga0105249_100973603 219
525 3300013104 Ga0157370_10460798 Ga0157370_104607982 219
526 3300013296 Ga0157374_10591243 Ga0157374_105912432 219
527 3300013306 Ga0163162_10024045 Ga0163162_100240455 219
528 3300013306 Ga0163162_10070323 Ga0163162_100703233 219
529 3300013306 Ga0163162_10440443 Ga0163162_104404431 219
530 3300013306 Ga0163162_10445127 Ga0163162_104451272 219
531 3300013306 Ga0163162_10613848 Ga0163162_106138482 219
532 3300013307 Ga0157372_10061967 Ga0157372_100619673 219
533 3300013307 Ga0157372_10411643 Ga0157372_104116432 219
534 3300013308 Ga0157375_10614678 Ga0157375_106146781 219
535 3300014326 Ga0157380_10195025 Ga0157380_101950252 219
536 3300014745 Ga0157377_10455467 Ga0157377_104554671 219
537 3300017792 Ga0163161_10243730 Ga0163161_102437302 219
538 3300025885 Ga0207653_10000011 Ga0207653_10000011112 219
539 3300025922 Ga0207646_10000495 Ga0207646_1000049541 219
540 3300025931 Ga0207644_10219614 Ga0207644_102196142 219
541 3300025934 Ga0207686_10000028 Ga0207686_1000002856 219
542 3300025935 Ga0207709_10000082 Ga0207709_1000008256 219
543 3300025936 Ga0207670_10056195 Ga0207670_100561952 219
544 3300025936 Ga0207670_10696125 Ga0207670_106961251 219
545 3300025940 Ga0207691_10010463 Ga0207691_100104638 219
546 3300025941 Ga0207711_10033137 Ga0207711_100331375 219
547 3300025961 Ga0207712_10498030 Ga0207712_104980302 219
548 3300026067 Ga0207678_10046702 Ga0207678_100467023 219
549 3300026075 Ga0207708_10001454 Ga0207708_100014549 219
550 3300026075 Ga0207708_10194410 Ga0207708_101944102 219
551 3300026088 Ga0207641_10326353 Ga0207641_103263532 219
552 3300026118 Ga0207675_100062427 Ga0207675_1000624271 219
553 3300027907 Ga0207428_10006746 Ga0207428_100067467 219
554 3300028380 Ga0268265_10139828 Ga0268265_101398281 219
555 3300031548 Ga0307408_100316066 Ga0307408_1003160662 219
556 3300031852 Ga0307410_10187820 Ga0307410_101878203 219
557 3300031852 Ga0307410_10857043 Ga0307410_108570431 219
558 3300031903 Ga0307407_10581973 Ga0307407_105819731 219
559 3300032002 Ga0307416_100680505 Ga0307416_1006805052 219
560 3300032126 Ga0307415_100012839 Ga0307415_1000128394 219
561 3300036401 Ga0373937_0285233 Ga0373937_0285233_527_1186 219
562 3300046459 Ga0495629_0306691 Ga0495629_0306691_44_703 219
563 3300046691 Ga0495670_0054461 Ga0495670_0054461_1091_1750 219
564 3300049705 Ga0501225_0076413 Ga0501225_0076413_194_853 219
565 3300050508 nmdc:mga09592_151620_c1 nmdc:mga09592_151620_c1_677_1336 219
566 3300050510 nmdc:mga06r32_1026356_c1 nmdc:mga06r32_1026356_c1_25_684 219
567 3300050511 nmdc:mga08y16_55366_c1 nmdc:mga08y16_55366_c1_365_1024 219
568 3300053077 Ga0495601_0045973 Ga0495601_0045973_134_793 219
569 3300053083 Ga0495655_0042539 Ga0495655_0042539_57_716 219
570 3300005468 Ga0070707_100059545 Ga0070707_1000595454 220
571 3300005471 Ga0070698_100000179 Ga0070698_1000001797 220
572 3300005518 Ga0070699_100480877 Ga0070699_1004808771 220
573 3300005545 Ga0070695_100390353 Ga0070695_1003903531 220
574 3300006173 Ga0070716_100000003 Ga0070716_100000003213 220
575 3300007265 Ga0099794_10012526 Ga0099794_100125265 220
576 3300025922 Ga0207646_10141056 Ga0207646_101410562 220
577 3300025939 Ga0207665_10000009 Ga0207665_1000000994 220
578 3300025945 Ga0207679_10098292 Ga0207679_100982923 220
579 3300027671 Ga0209588_1007099 Ga0209588_10070993 220
580 3300031995 Ga0307409_100040391 Ga0307409_1000403913 220
581 3300032002 Ga0307416_101407953 Ga0307416_1014079531 220
582 3300005289 Ga0065704_10086130 Ga0065704_100861302 221
583 3300005295 Ga0065707_10146111 Ga0065707_101461111 221
584 3300005331 Ga0070670_100053153 Ga0070670_1000531532 221
585 3300005334 Ga0068869_100019148 Ga0068869_1000191481 221
586 3300005334 Ga0068869_100052599 Ga0068869_1000525991 221
587 3300005347 Ga0070668_100072791 Ga0070668_1000727912 221
588 3300005354 Ga0070675_100921389 Ga0070675_1009213891 221
589 3300005355 Ga0070671_100005882 Ga0070671_1000058821 221
590 3300005459 Ga0068867_100105891 Ga0068867_1001058912 221
591 3300005468 Ga0070707_100336895 Ga0070707_1003368952 221
592 3300005577 Ga0068857_100084816 Ga0068857_1000848162 221
593 3300005719 Ga0068861_100348704 Ga0068861_1003487041 221
594 3300009148 Ga0105243_10094542 Ga0105243_100945423 221
595 3300009148 Ga0105243_10126505 Ga0105243_101265052 221
596 3300009553 Ga0105249_10000201 Ga0105249_1000020131 221
597 3300013306 Ga0163162_10000128 Ga0163162_1000012831 221
598 3300014325 Ga0163163_10040071 Ga0163163_100400711 221
599 3300014326 Ga0157380_10270562 Ga0157380_102705622 221
600 3300025910 Ga0207684_10022979 Ga0207684_100229793 221
601 3300025911 Ga0207654_10489516 Ga0207654_104895162 221
602 3300025925 Ga0207650_10012071 Ga0207650_100120713 221
603 3300025931 Ga0207644_10028593 Ga0207644_100285932 221
604 3300025935 Ga0207709_10301372 Ga0207709_103013721 221
605 3300025935 Ga0207709_10375267 Ga0207709_103752671 221
606 3300025942 Ga0207689_10038732 Ga0207689_100387325 221
607 3300025942 Ga0207689_10157305 Ga0207689_101573052 221
608 3300025961 Ga0207712_10001036 Ga0207712_1000103612 221
609 3300025972 Ga0207668_10049163 Ga0207668_100491632 221
610 3300026089 Ga0207648_10286096 Ga0207648_102860962 221
611 3300026116 Ga0207674_10063269 Ga0207674_100632692 221
612 3300026116 Ga0207674_10251358 Ga0207674_102513581 221
613 3300037471 Ga0395905_0274165 Ga0395905_0274165_596_1261 221
614 3300061734 Ga0530510_0252744 Ga0530510_0252744_101_766 221
615 3300005293 Ga0065715_10115173 Ga0065715_101151732 222
616 3300005293 Ga0065715_10396899 Ga0065715_103968991 222
617 3300005330 Ga0070690_100068515 Ga0070690_1000685153 222
618 3300005331 Ga0070670_100002896 Ga0070670_1000028961 222
619 3300005337 Ga0070682_100000127 Ga0070682_1000001274 222
620 3300005343 Ga0070687_100052966 Ga0070687_1000529662 222
621 3300005353 Ga0070669_100121717 Ga0070669_1001217171 222
622 3300005354 Ga0070675_100194739 Ga0070675_1001947392 222
623 3300005355 Ga0070671_100034368 Ga0070671_1000343683 222
624 3300005364 Ga0070673_100017733 Ga0070673_1000177332 222
625 3300005365 Ga0070688_100279606 Ga0070688_1002796061 222
626 3300005365 Ga0070688_100495661 Ga0070688_1004956611 222
627 3300005367 Ga0070667_100086358 Ga0070667_1000863582 222
628 3300005445 Ga0070708_100000042 Ga0070708_10000004250 222
629 3300005456 Ga0070678_100043493 Ga0070678_1000434932 222
630 3300005459 Ga0068867_100033387 Ga0068867_1000333873 222
631 3300005466 Ga0070685_10180482 Ga0070685_101804822 222
632 3300005467 Ga0070706_100011232 Ga0070706_1000112327 222
633 3300005467 Ga0070706_100140347 Ga0070706_1001403474 222
634 3300005467 Ga0070706_100161902 Ga0070706_1001619022 222
635 3300005467 Ga0070706_100289769 Ga0070706_1002897691 222
636 3300005468 Ga0070707_100265533 Ga0070707_1002655332 222
637 3300005468 Ga0070707_100730905 Ga0070707_1007309051 222
638 3300005471 Ga0070698_100004813 Ga0070698_1000048133 222
639 3300005471 Ga0070698_100351722 Ga0070698_1003517221 222
640 3300005518 Ga0070699_100018147 Ga0070699_1000181473 222
641 3300005518 Ga0070699_100027829 Ga0070699_1000278293 222
642 3300005518 Ga0070699_100535454 Ga0070699_1005354541 222
643 3300005536 Ga0070697_100000377 Ga0070697_10000037711 222
644 3300005536 Ga0070697_100024665 Ga0070697_1000246652 222
645 3300005536 Ga0070697_100089740 Ga0070697_1000897402 222
646 3300005543 Ga0070672_100078866 Ga0070672_1000788662 222
647 3300005544 Ga0070686_100026324 Ga0070686_1000263243 222
648 3300005546 Ga0070696_100037377 Ga0070696_1000373771 222
649 3300005546 Ga0070696_100050813 Ga0070696_1000508133 222
650 3300005546 Ga0070696_100113071 Ga0070696_1001130712 222
651 3300005549 Ga0070704_100555425 Ga0070704_1005554251 222
652 3300005564 Ga0070664_100213759 Ga0070664_1002137592 222
653 3300005578 Ga0068854_100469401 Ga0068854_1004694011 222
654 3300005615 Ga0070702_100032184 Ga0070702_1000321842 222
655 3300005618 Ga0068864_100384660 Ga0068864_1003846602 222
656 3300005718 Ga0068866_10013317 Ga0068866_100133173 222
657 3300005719 Ga0068861_100030549 Ga0068861_1000305492 222
658 3300005719 Ga0068861_100126534 Ga0068861_1001265342 222
659 3300005719 Ga0068861_100648079 Ga0068861_1006480791 222
660 3300005719 Ga0068861_100809996 Ga0068861_1008099961 222
661 3300005719 Ga0068861_101247413 Ga0068861_1012474131 222
662 3300005840 Ga0068870_10115444 Ga0068870_101154441 222
663 3300005841 Ga0068863_100052392 Ga0068863_1000523922 222
664 3300005842 Ga0068858_100255704 Ga0068858_1002557042 222
665 3300006237 Ga0097621_100016538 Ga0097621_1000165383 222
666 3300006358 Ga0068871_100171045 Ga0068871_1001710451 222
667 3300006852 Ga0075433_10114189 Ga0075433_101141892 222
668 3300006881 Ga0068865_100018879 Ga0068865_1000188793 222
669 3300007076 Ga0075435_100382440 Ga0075435_1003824402 222
670 3300007265 Ga0099794_10178415 Ga0099794_101784151 222
671 3300009147 Ga0114129_10471567 Ga0114129_104715672 222
672 3300009147 Ga0114129_10785360 Ga0114129_107853601 222
673 3300009148 Ga0105243_10064428 Ga0105243_100644283 222
674 3300009174 Ga0105241_10033309 Ga0105241_100333092 222
675 3300009176 Ga0105242_10010374 Ga0105242_100103746 222
676 3300009177 Ga0105248_10093536 Ga0105248_100935362 222
677 3300010375 Ga0105239_10061392 Ga0105239_100613922 222
678 3300013297 Ga0157378_10050101 Ga0157378_100501012 222
679 3300013306 Ga0163162_10154748 Ga0163162_101547482 222
680 3300013308 Ga0157375_10045937 Ga0157375_100459372 222
681 3300013308 Ga0157375_10379817 Ga0157375_103798172 222
682 3300013308 Ga0157375_10806804 Ga0157375_108068041 222
683 3300014325 Ga0163163_10192995 Ga0163163_101929951 222
684 3300014326 Ga0157380_10007349 Ga0157380_100073499 222
685 3300014745 Ga0157377_10062306 Ga0157377_100623062 222
686 3300014969 Ga0157376_10435733 Ga0157376_104357332 222
687 3300017792 Ga0163161_10073173 Ga0163161_100731733 222
688 3300025908 Ga0207643_10336099 Ga0207643_103360991 222
689 3300025908 Ga0207643_10341906 Ga0207643_103419061 222
690 3300025910 Ga0207684_10022593 Ga0207684_100225936 222
691 3300025910 Ga0207684_10119197 Ga0207684_101191972 222
692 3300025910 Ga0207684_10218397 Ga0207684_102183971 222
693 3300025910 Ga0207684_10605798 Ga0207684_106057981 222
694 3300025922 Ga0207646_10186559 Ga0207646_101865591 222
695 3300025925 Ga0207650_10001364 Ga0207650_100013641 222
696 3300025926 Ga0207659_10513725 Ga0207659_105137252 222
697 3300025931 Ga0207644_10050927 Ga0207644_100509271 222
698 3300025934 Ga0207686_10272249 Ga0207686_102722491 222
699 3300025936 Ga0207670_10031309 Ga0207670_100313092 222
700 3300025936 Ga0207670_10412405 Ga0207670_104124051 222
701 3300025938 Ga0207704_10129876 Ga0207704_101298761 222
702 3300025940 Ga0207691_10003277 Ga0207691_100032775 222
703 3300025941 Ga0207711_10089219 Ga0207711_100892192 222
704 3300025942 Ga0207689_10113530 Ga0207689_101135302 222
705 3300025945 Ga0207679_10587690 Ga0207679_105876901 222
706 3300025960 Ga0207651_10145912 Ga0207651_101459121 222
707 3300025960 Ga0207651_10434188 Ga0207651_104341881 222
708 3300025972 Ga0207668_10269266 Ga0207668_102692661 222
709 3300025986 Ga0207658_10647155 Ga0207658_106471551 222
710 3300026035 Ga0207703_10188412 Ga0207703_101884122 222
711 3300026075 Ga0207708_10040594 Ga0207708_100405941 222
712 3300026075 Ga0207708_10324204 Ga0207708_103242042 222
713 3300026088 Ga0207641_10242976 Ga0207641_102429762 222
714 3300026089 Ga0207648_10006108 Ga0207648_100061089 222
715 3300026095 Ga0207676_10016892 Ga0207676_100168925 222
716 3300026095 Ga0207676_10267871 Ga0207676_102678712 222
717 3300026118 Ga0207675_100002642 Ga0207675_1000026425 222
718 3300026118 Ga0207675_100296195 Ga0207675_1002961952 222
719 3300028379 Ga0268266_10917530 Ga0268266_109175302 222
720 3300031731 Ga0307405_10323057 Ga0307405_103230572 222
721 3300032002 Ga0307416_100233703 Ga0307416_1002337032 222
722 3300032126 Ga0307415_100673934 Ga0307415_1006739341 222
723 3300037418 Ga0395900_0197753 Ga0395900_0197753_503_1171 222
724 3300042435 Ga0439434_0002802 Ga0439434_0002802_4366_5034 222
725 3300046525 Ga0495663_0000585 Ga0495663_0000585_4905_5573 222
726 3300046537 Ga0495598_0000784 Ga0495598_0000784_4819_5487 222
727 3300046539 Ga0495621_0000444 Ga0495621_0000444_5551_6219 222
728 3300046616 Ga0495668_0077421 Ga0495668_0077421_588_1256 222
729 3300050507 nmdc:mga05p37_558633_c1 nmdc:mga05p37_558633_c1_616_1284 222
730 3300050515 nmdc:mga0a205_424763_c1 nmdc:mga0a205_424763_c1_197_865 222
731 2162886007 SwRhRL2b_contig_333894 SwRhRL2b_0691.00000380 223
732 3300001990 JGI24737J22298_10092677 JGI24737J22298_100926771 223
733 3300003203 JGI25406J46586_10039049 JGI25406J46586_100390491 223
734 3300004801 Ga0058860_11737881 Ga0058860_117378811 223
735 3300004803 Ga0058862_12589100 Ga0058862_125891001 223
736 3300005289 Ga0065704_10000829 Ga0065704_100008297 223
737 3300005290 Ga0065712_10240815 Ga0065712_102408151 223
738 3300005293 Ga0065715_10104393 Ga0065715_101043933 223
739 3300005293 Ga0065715_10109592 Ga0065715_101095923 223
740 3300005293 Ga0065715_10180929 Ga0065715_101809292 223
741 3300005295 Ga0065707_10095460 Ga0065707_100954603 223
742 3300005330 Ga0070690_100003264 Ga0070690_1000032642 223
743 3300005331 Ga0070670_100167051 Ga0070670_1001670512 223
744 3300005334 Ga0068869_100022876 Ga0068869_1000228762 223
745 3300005334 Ga0068869_100316991 Ga0068869_1003169912 223
746 3300005335 Ga0070666_10090310 Ga0070666_100903102 223
747 3300005335 Ga0070666_10335076 Ga0070666_103350761 223
748 3300005336 Ga0070680_100000421 Ga0070680_10000042127 223
749 3300005337 Ga0070682_100190434 Ga0070682_1001904341 223
750 3300005340 Ga0070689_100311965 Ga0070689_1003119652 223
751 3300005340 Ga0070689_100324600 Ga0070689_1003246002 223
752 3300005343 Ga0070687_100143758 Ga0070687_1001437582 223
753 3300005343 Ga0070687_100544416 Ga0070687_1005444161 223
754 3300005345 Ga0070692_10011072 Ga0070692_100110722 223
755 3300005353 Ga0070669_100020076 Ga0070669_1000200764 223
756 3300005353 Ga0070669_100099423 Ga0070669_1000994232 223
757 3300005354 Ga0070675_100225360 Ga0070675_1002253601 223
758 3300005355 Ga0070671_100011267 Ga0070671_1000112677 223
759 3300005355 Ga0070671_100155239 Ga0070671_1001552392 223
760 3300005356 Ga0070674_100154249 Ga0070674_1001542492 223
761 3300005365 Ga0070688_100085882 Ga0070688_1000858822 223
762 3300005367 Ga0070667_100060127 Ga0070667_1000601273 223
763 3300005438 Ga0070701_10007022 Ga0070701_100070223 223
764 3300005438 Ga0070701_10007157 Ga0070701_100071572 223
765 3300005440 Ga0070705_100030966 Ga0070705_1000309663 223
766 3300005440 Ga0070705_100223723 Ga0070705_1002237232 223
767 3300005444 Ga0070694_100368105 Ga0070694_1003681051 223
768 3300005445 Ga0070708_100215507 Ga0070708_1002155072 223
769 3300005456 Ga0070678_100337886 Ga0070678_1003378861 223
770 3300005457 Ga0070662_100066872 Ga0070662_1000668721 223
771 3300005458 Ga0070681_10000053 Ga0070681_1000005317 223
772 3300005468 Ga0070707_100052168 Ga0070707_1000521684 223
773 3300005471 Ga0070698_100004484 Ga0070698_1000044845 223
774 3300005471 Ga0070698_100235375 Ga0070698_1002353751 223
775 3300005518 Ga0070699_100334442 Ga0070699_1003344422 223
776 3300005530 Ga0070679_100000030 Ga0070679_10000003042 223
777 3300005536 Ga0070697_100013784 Ga0070697_1000137843 223
778 3300005539 Ga0068853_100020508 Ga0068853_1000205083 223
779 3300005543 Ga0070672_100209464 Ga0070672_1002094642 223
780 3300005543 Ga0070672_100271091 Ga0070672_1002710911 223
781 3300005544 Ga0070686_100006775 Ga0070686_1000067758 223
782 3300005545 Ga0070695_100259266 Ga0070695_1002592661 223
783 3300005546 Ga0070696_100021118 Ga0070696_1000211183 223
784 3300005546 Ga0070696_100099026 Ga0070696_1000990262 223
785 3300005546 Ga0070696_100509242 Ga0070696_1005092421 223
786 3300005549 Ga0070704_100056220 Ga0070704_1000562203 223
787 3300005549 Ga0070704_100097836 Ga0070704_1000978363 223
788 3300005564 Ga0070664_100038091 Ga0070664_1000380912 223
789 3300005577 Ga0068857_100832009 Ga0068857_1008320092 223
790 3300005578 Ga0068854_100223781 Ga0068854_1002237812 223
791 3300005578 Ga0068854_100252718 Ga0068854_1002527182 223
792 3300005615 Ga0070702_100016181 Ga0070702_1000161814 223
793 3300005617 Ga0068859_100011920 Ga0068859_1000119202 223
794 3300005617 Ga0068859_100371609 Ga0068859_1003716092 223
795 3300005618 Ga0068864_100023701 Ga0068864_1000237012 223
796 3300005618 Ga0068864_100109841 Ga0068864_1001098412 223
797 3300005618 Ga0068864_100463708 Ga0068864_1004637082 223
798 3300005618 Ga0068864_100598590 Ga0068864_1005985902 223
799 3300005842 Ga0068858_100193503 Ga0068858_1001935032 223
800 3300005842 Ga0068858_100228502 Ga0068858_1002285022 223
801 3300005843 Ga0068860_100033226 Ga0068860_1000332262 223
802 3300005843 Ga0068860_100042101 Ga0068860_1000421013 223
803 3300005844 Ga0068862_100007256 Ga0068862_1000072564 223
804 3300005985 Ga0081539_10000481 Ga0081539_1000048144 223
805 3300006237 Ga0097621_100018262 Ga0097621_1000182623 223
806 3300006237 Ga0097621_100021474 Ga0097621_1000214746 223
807 3300006358 Ga0068871_100004853 Ga0068871_1000048535 223
808 3300006358 Ga0068871_100006785 Ga0068871_1000067855 223
809 3300006358 Ga0068871_100142271 Ga0068871_1001422712 223
810 3300006846 Ga0075430_100008630 Ga0075430_1000086303 223
811 3300006852 Ga0075433_10139143 Ga0075433_101391432 223
812 3300006852 Ga0075433_10233543 Ga0075433_102335432 223
813 3300006871 Ga0075434_100158930 Ga0075434_1001589302 223
814 3300006880 Ga0075429_100132862 Ga0075429_1001328621 223
815 3300006881 Ga0068865_100388368 Ga0068865_1003883681 223
816 3300006931 Ga0097620_100011920 Ga0097620_1000119202 223
817 3300006931 Ga0097620_100371600 Ga0097620_1003716002 223
818 3300007076 Ga0075435_100081544 Ga0075435_1000815443 223
819 3300009094 Ga0111539_10000867 Ga0111539_1000086722 223
820 3300009098 Ga0105245_10075299 Ga0105245_100752992 223
821 3300009147 Ga0114129_10033689 Ga0114129_100336894 223
822 3300009174 Ga0105241_10907214 Ga0105241_109072141 223
823 3300009176 Ga0105242_10025344 Ga0105242_100253444 223
824 3300009176 Ga0105242_10265737 Ga0105242_102657372 223
825 3300009176 Ga0105242_10411429 Ga0105242_104114291 223
826 3300009177 Ga0105248_10010650 Ga0105248_100106501 223
827 3300009177 Ga0105248_10380153 Ga0105248_103801532 223
828 3300009551 Ga0105238_10157869 Ga0105238_101578692 223
829 3300009553 Ga0105249_10129962 Ga0105249_101299622 223
830 3300009553 Ga0105249_10151407 Ga0105249_101514072 223
831 3300009553 Ga0105249_11073559 Ga0105249_110735591 223
832 3300010375 Ga0105239_10316117 Ga0105239_103161172 223
833 3300011119 Ga0105246_10400750 Ga0105246_104007501 223
834 3300011119 Ga0105246_10433483 Ga0105246_104334832 223
835 3300013296 Ga0157374_10030105 Ga0157374_100301054 223
836 3300013296 Ga0157374_10585484 Ga0157374_105854841 223
837 3300013296 Ga0157374_11081381 Ga0157374_110813811 223
838 3300013297 Ga0157378_10213866 Ga0157378_102138662 223
839 3300013297 Ga0157378_10272538 Ga0157378_102725382 223
840 3300013297 Ga0157378_10537086 Ga0157378_105370861 223
841 3300013297 Ga0157378_10591790 Ga0157378_105917902 223
842 3300013306 Ga0163162_10030447 Ga0163162_100304477 223
843 3300013306 Ga0163162_10040876 Ga0163162_100408762 223
844 3300013306 Ga0163162_10463258 Ga0163162_104632582 223
845 3300013308 Ga0157375_10008099 Ga0157375_100080999 223
846 3300014325 Ga0163163_10002688 Ga0163163_100026888 223
847 3300014325 Ga0163163_10152729 Ga0163163_101527291 223
848 3300014325 Ga0163163_10658402 Ga0163163_106584021 223
849 3300014326 Ga0157380_10011362 Ga0157380_100113622 223
850 3300014969 Ga0157376_10020328 Ga0157376_100203284 223
851 3300025903 Ga0207680_10079682 Ga0207680_100796822 223
852 3300025903 Ga0207680_10608006 Ga0207680_106080061 223
853 3300025910 Ga0207684_10015726 Ga0207684_100157263 223
854 3300025912 Ga0207707_10000063 Ga0207707_1000006341 223
855 3300025917 Ga0207660_10000454 Ga0207660_100004549 223
856 3300025921 Ga0207652_10000091 Ga0207652_1000009163 223
857 3300025923 Ga0207681_10086189 Ga0207681_100861892 223
858 3300025924 Ga0207694_10446625 Ga0207694_104466251 223
859 3300025926 Ga0207659_10184186 Ga0207659_101841861 223
860 3300025931 Ga0207644_10029527 Ga0207644_100295274 223
861 3300025933 Ga0207706_10029411 Ga0207706_100294112 223
862 3300025934 Ga0207686_10306685 Ga0207686_103066851 223
863 3300025936 Ga0207670_10299621 Ga0207670_102996211 223
864 3300025937 Ga0207669_10099371 Ga0207669_100993712 223
865 3300025940 Ga0207691_10116544 Ga0207691_101165443 223
866 3300025942 Ga0207689_10005784 Ga0207689_100057843 223
867 3300025942 Ga0207689_10007586 Ga0207689_100075867 223
868 3300025942 Ga0207689_10024626 Ga0207689_100246264 223
869 3300025945 Ga0207679_10067858 Ga0207679_100678582 223
870 3300025961 Ga0207712_10141355 Ga0207712_101413552 223
871 3300025961 Ga0207712_10261475 Ga0207712_102614752 223
872 3300025961 Ga0207712_10572080 Ga0207712_105720801 223
873 3300025981 Ga0207640_10924354 Ga0207640_109243541 223
874 3300026035 Ga0207703_10272715 Ga0207703_102727151 223
875 3300026035 Ga0207703_10656836 Ga0207703_106568361 223
876 3300026041 Ga0207639_10374540 Ga0207639_103745402 223
877 3300026088 Ga0207641_10047480 Ga0207641_100474803 223
878 3300026095 Ga0207676_10003794 Ga0207676_100037948 223
879 3300026118 Ga0207675_100088129 Ga0207675_1000881292 223
880 3300026121 Ga0207683_10468872 Ga0207683_104688721 223
881 3300026142 Ga0207698_10454910 Ga0207698_104549102 223
882 3300027907 Ga0207428_10002648 Ga0207428_1000264811 223
883 3300028380 Ga0268265_10007235 Ga0268265_100072354 223
884 3300028381 Ga0268264_10067297 Ga0268264_100672971 223
885 3300028381 Ga0268264_10208394 Ga0268264_102083942 223
886 3300031548 Ga0307408_100290214 Ga0307408_1002902141 223
887 3300046472 Ga0495580_0161496 Ga0495580_0161496_432_1175 223
888 3300047318 Ga0495636_0040290 Ga0495636_0040290_256_927 223
889 3300047320 Ga0495672_0021359 Ga0495672_0021359_2530_3201 223
890 3300049665 Ga0501227_068774 Ga0501227_068774_118_789 223
891 3300050509 nmdc:mga0qj67_77946_c1 nmdc:mga0qj67_77946_c1_519_1190 223
892 3300050510 nmdc:mga06r32_26683_c1 nmdc:mga06r32_26683_c1_150_821 223
893 3300050511 nmdc:mga08y16_10385_c1 nmdc:mga08y16_10385_c1_6519_7232 223
894 3300050513 nmdc:mga0rr50_522018_c1 nmdc:mga0rr50_522018_c1_222_893 223
895 3300050515 nmdc:mga0a205_23555_c1 nmdc:mga0a205_23555_c1_3754_4467 223
896 3300000532 CNAas_1000262 CNAas_10002623 224
897 3300005290 Ga0065712_10013558 Ga0065712_100135581 224
898 3300005295 Ga0065707_10102119 Ga0065707_101021194 224
899 3300005331 Ga0070670_100047290 Ga0070670_1000472902 224
900 3300005331 Ga0070670_100142071 Ga0070670_1001420712 224
901 3300005331 Ga0070670_101132451 Ga0070670_1011324511 224
902 3300005334 Ga0068869_100224008 Ga0068869_1002240082 224
903 3300005334 Ga0068869_100623402 Ga0068869_1006234021 224
904 3300005336 Ga0070680_100469877 Ga0070680_1004698771 224
905 3300005340 Ga0070689_100000485 Ga0070689_1000004855 224
906 3300005345 Ga0070692_10091585 Ga0070692_100915852 224
907 3300005437 Ga0070710_10695401 Ga0070710_106954011 224
908 3300005441 Ga0070700_100000516 Ga0070700_1000005165 224
909 3300005441 Ga0070700_100214079 Ga0070700_1002140792 224
910 3300005444 Ga0070694_100009355 Ga0070694_1000093557 224
911 3300005445 Ga0070708_100145761 Ga0070708_1001457613 224
912 3300005458 Ga0070681_10014275 Ga0070681_100142751 224
913 3300005458 Ga0070681_10145352 Ga0070681_101453523 224
914 3300005458 Ga0070681_10742147 Ga0070681_107421471 224
915 3300005459 Ga0068867_100053425 Ga0068867_1000534253 224
916 3300005467 Ga0070706_100000305 Ga0070706_10000030532 224
917 3300005468 Ga0070707_100135619 Ga0070707_1001356192 224
918 3300005471 Ga0070698_100033500 Ga0070698_1000335003 224
919 3300005471 Ga0070698_100048626 Ga0070698_1000486262 224
920 3300005471 Ga0070698_100068371 Ga0070698_1000683713 224
921 3300005518 Ga0070699_100053154 Ga0070699_1000531544 224
922 3300005536 Ga0070697_100151728 Ga0070697_1001517282 224
923 3300005536 Ga0070697_100207006 Ga0070697_1002070062 224
924 3300005545 Ga0070695_100055964 Ga0070695_1000559642 224
925 3300005545 Ga0070695_100199684 Ga0070695_1001996841 224
926 3300005545 Ga0070695_100329478 Ga0070695_1003294782 224
927 3300005546 Ga0070696_100006330 Ga0070696_1000063308 224
928 3300005546 Ga0070696_100105037 Ga0070696_1001050372 224
929 3300005546 Ga0070696_100165866 Ga0070696_1001658662 224
930 3300005547 Ga0070693_100055714 Ga0070693_1000557142 224
931 3300005547 Ga0070693_100583624 Ga0070693_1005836241 224
932 3300005564 Ga0070664_100343651 Ga0070664_1003436512 224
933 3300005577 Ga0068857_100597863 Ga0068857_1005978631 224
934 3300005577 Ga0068857_100751979 Ga0068857_1007519792 224
935 3300005577 Ga0068857_100904173 Ga0068857_1009041731 224
936 3300005614 Ga0068856_100646778 Ga0068856_1006467781 224
937 3300005617 Ga0068859_100079254 Ga0068859_1000792544 224
938 3300005618 Ga0068864_100023785 Ga0068864_1000237852 224
939 3300005618 Ga0068864_100156985 Ga0068864_1001569851 224
940 3300005719 Ga0068861_100018221 Ga0068861_1000182214 224
941 3300005719 Ga0068861_100196547 Ga0068861_1001965472 224
942 3300005840 Ga0068870_10039482 Ga0068870_100394823 224
943 3300005841 Ga0068863_100143325 Ga0068863_1001433252 224
944 3300005843 Ga0068860_100134777 Ga0068860_1001347772 224
945 3300005844 Ga0068862_100066785 Ga0068862_1000667852 224
946 3300005985 Ga0081539_10092100 Ga0081539_100921002 224
947 3300006237 Ga0097621_100488756 Ga0097621_1004887561 224
948 3300006358 Ga0068871_100037219 Ga0068871_1000372192 224
949 3300006844 Ga0075428_100359200 Ga0075428_1003592002 224
950 3300006846 Ga0075430_100017968 Ga0075430_1000179686 224
951 3300006846 Ga0075430_100577975 Ga0075430_1005779751 224
952 3300006847 Ga0075431_100037575 Ga0075431_1000375755 224
953 3300006852 Ga0075433_10032185 Ga0075433_100321856 224
954 3300006852 Ga0075433_10126487 Ga0075433_101264873 224
955 3300006852 Ga0075433_10218449 Ga0075433_102184491 224
956 3300006871 Ga0075434_100026758 Ga0075434_1000267585 224
957 3300006880 Ga0075429_100127297 Ga0075429_1001272972 224
958 3300006880 Ga0075429_100212982 Ga0075429_1002129822 224
959 3300006914 Ga0075436_100001040 Ga0075436_1000010404 224
960 3300006931 Ga0097620_100079256 Ga0097620_1000792564 224
961 3300007076 Ga0075435_100000658 Ga0075435_1000006582 224
962 3300009011 Ga0105251_10073124 Ga0105251_100731242 224
963 3300009094 Ga0111539_10329136 Ga0111539_103291362 224
964 3300009098 Ga0105245_10665849 Ga0105245_106658492 224
965 3300009147 Ga0114129_10020879 Ga0114129_100208791 224
966 3300009147 Ga0114129_10030274 Ga0114129_100302746 224
967 3300009147 Ga0114129_10176276 Ga0114129_101762761 224
968 3300009147 Ga0114129_10954828 Ga0114129_109548281 224
969 3300009147 Ga0114129_11555243 Ga0114129_115552431 224
970 3300009174 Ga0105241_10015189 Ga0105241_100151892 224
971 3300009174 Ga0105241_10037269 Ga0105241_100372693 224
972 3300009177 Ga0105248_10006862 Ga0105248_100068629 224
973 3300009177 Ga0105248_10062483 Ga0105248_100624834 224
974 3300009177 Ga0105248_10536831 Ga0105248_105368312 224
975 3300009177 Ga0105248_10997338 Ga0105248_109973382 224
976 3300009545 Ga0105237_10008814 Ga0105237_100088147 224
977 3300010375 Ga0105239_10102964 Ga0105239_101029642 224
978 3300013100 Ga0157373_10118581 Ga0157373_101185812 224
979 3300013306 Ga0163162_10155290 Ga0163162_101552901 224
980 3300013306 Ga0163162_10698304 Ga0163162_106983042 224
981 3300013308 Ga0157375_10022414 Ga0157375_100224141 224
982 3300013308 Ga0157375_10735555 Ga0157375_107355551 224
983 3300014326 Ga0157380_10346948 Ga0157380_103469482 224
984 3300014326 Ga0157380_10671782 Ga0157380_106717821 224
985 3300014745 Ga0157377_10037345 Ga0157377_100373454 224
986 3300014968 Ga0157379_10695194 Ga0157379_106951941 224
987 3300014969 Ga0157376_10425225 Ga0157376_104252252 224
988 3300025908 Ga0207643_10048352 Ga0207643_100483521 224
989 3300025908 Ga0207643_10173009 Ga0207643_101730092 224
990 3300025910 Ga0207684_10000053 Ga0207684_1000005358 224
991 3300025910 Ga0207684_10447986 Ga0207684_104479862 224
992 3300025911 Ga0207654_10064473 Ga0207654_100644731 224
993 3300025911 Ga0207654_10344022 Ga0207654_103440222 224
994 3300025912 Ga0207707_10630736 Ga0207707_106307361 224
995 3300025914 Ga0207671_10082769 Ga0207671_100827691 224
996 3300025924 Ga0207694_10633251 Ga0207694_106332511 224
997 3300025925 Ga0207650_10148766 Ga0207650_101487662 224
998 3300025925 Ga0207650_10174994 Ga0207650_101749942 224
999 3300025935 Ga0207709_10008758 Ga0207709_100087583 224
1000 3300025936 Ga0207670_10000353 Ga0207670_100003536 224
1001 3300025936 Ga0207670_10527882 Ga0207670_105278821 224
1002 3300025942 Ga0207689_10294970 Ga0207689_102949701 224
1003 3300025942 Ga0207689_10380988 Ga0207689_103809882 224
1004 3300026075 Ga0207708_10000113 Ga0207708_1000011317 224
1005 3300026075 Ga0207708_10185942 Ga0207708_101859422 224
1006 3300026088 Ga0207641_10548202 Ga0207641_105482022 224
1007 3300026089 Ga0207648_10027501 Ga0207648_100275013 224
1008 3300026089 Ga0207648_10417851 Ga0207648_104178511 224
1009 3300026116 Ga0207674_10153204 Ga0207674_101532042 224
1010 3300026116 Ga0207674_10455702 Ga0207674_104557021 224
1011 3300026118 Ga0207675_100030063 Ga0207675_1000300634 224
1012 3300028380 Ga0268265_10089434 Ga0268265_100894342 224
1013 3300028380 Ga0268265_10428721 Ga0268265_104287211 224
1014 3300030733 Ga0314311_1187385 Ga0314311_11873851 224
1015 3300031731 Ga0307405_10056668 Ga0307405_100566682 224
1016 3300031731 Ga0307405_10191760 Ga0307405_101917602 224
1017 3300031824 Ga0307413_10208855 Ga0307413_102088551 224
1018 3300031824 Ga0307413_10499767 Ga0307413_104997671 224
1019 3300031901 Ga0307406_10021986 Ga0307406_100219863 224
1020 3300031903 Ga0307407_10026441 Ga0307407_100264413 224
1021 3300031911 Ga0307412_10308264 Ga0307412_103082642 224
1022 3300031995 Ga0307409_100427059 Ga0307409_1004270592 224
1023 3300032002 Ga0307416_100013178 Ga0307416_1000131784 224
1024 3300032002 Ga0307416_100035694 Ga0307416_1000356944 224
1025 3300032004 Ga0307414_10140469 Ga0307414_101404692 224
1026 3300032126 Ga0307415_100051611 Ga0307415_1000516112 224
1027 3300032126 Ga0307415_100208336 Ga0307415_1002083362 224
1028 3300032126 Ga0307415_100324121 Ga0307415_1003241212 224
1029 3300035088 Ga0373940_0073367 Ga0373940_0073367_263_937 224
1030 3300035091 Ga0373951_0004140 Ga0373951_0004140_1635_2309 224
1031 3300037466 Ga0395898_0222853 Ga0395898_0222853_412_1086 224
1032 3300042005 Ga0439448_0027050 Ga0439448_0027050_330_1064 224
1033 3300042012 Ga0439455_0001463 Ga0439455_0001463_263_997 224
1034 3300042144 Ga0450889_008733 Ga0450889_008733_153_887 224
1035 3300042157 Ga0439458_0002523 Ga0439458_0002523_1248_1982 224
1036 3300048916 Ga0496113_0171225 Ga0496113_0171225_781_1455 224
1037 3300049515 Ga0501292_001513 Ga0501292_001513_67_828 224
1038 3300049521 Ga0501298_007908 Ga0501298_007908_667_1341 224
1039 3300049574 Ga0501038_0003087 Ga0501038_0003087_6412_7086 224
1040 3300049654 Ga0501207_001429 Ga0501207_001429_1189_1863 224
1041 3300049654 Ga0501207_009287 Ga0501207_009287_312_986 224
1042 3300049655 Ga0501208_057872 Ga0501208_057872_45_719 224
1043 3300049659 Ga0501214_002681 Ga0501214_002681_489_1163 224
1044 3300049660 Ga0501216_002340 Ga0501216_002340_185_859 224
1045 3300049661 Ga0501217_001694 Ga0501217_001694_157_831 224
1046 3300049663 Ga0501223_001842 Ga0501223_001842_682_1356 224
1047 3300049663 Ga0501223_021891 Ga0501223_021891_344_1018 224
1048 3300049663 Ga0501223_033974 Ga0501223_033974_145_906 224
1049 3300049664 Ga0501224_003389 Ga0501224_003389_225_986 224
1050 3300049665 Ga0501227_000666 Ga0501227_000666_3763_4437 224
1051 3300049665 Ga0501227_023516 Ga0501227_023516_318_992 224
1052 3300049668 Ga0501233_001925 Ga0501233_001925_2765_3439 224
1053 3300049669 Ga0501235_004656 Ga0501235_004656_1295_1969 224
1054 3300049669 Ga0501235_024590 Ga0501235_024590_221_895 224
1055 3300049682 Ga0501252_008562 Ga0501252_008562_97_771 224
1056 3300049686 Ga0501257_018797 Ga0501257_018797_384_1058 224
1057 3300049686 Ga0501257_053150 Ga0501257_053150_46_720 224
1058 3300049686 Ga0501257_072998 Ga0501257_072998_75_836 224
1059 3300049705 Ga0501225_0024210 Ga0501225_0024210_749_1423 224
1060 3300049707 Ga0501234_002117 Ga0501234_002117_1361_2035 224
1061 3300049707 Ga0501234_009022 Ga0501234_009022_99_773 224
1062 3300049708 Ga0501245_029036 Ga0501245_029036_70_831 224
1063 3300049757 Ga0501232_006181 Ga0501232_006181_449_1123 224
1064 3300049765 Ga0501268_012932 Ga0501268_012932_395_1069 224
1065 3300049772 Ga0501275_010210 Ga0501275_010210_166_840 224
1066 3300049779 Ga0501283_004435 Ga0501283_004435_1081_1755 224
1067 3300049850 Ga0501204_005613 Ga0501204_005613_375_1136 224
1068 3300049851 Ga0501212_003878 Ga0501212_003878_44_718 224
1069 3300050507 nmdc:mga05p37_1248819_c1 nmdc:mga05p37_1248819_c1_32_706 224
1070 3300050507 nmdc:mga05p37_255786_c1 nmdc:mga05p37_255786_c1_1191_1865 224
1071 3300050507 nmdc:mga05p37_39714_c1 nmdc:mga05p37_39714_c1_5072_5746 224
1072 3300050507 nmdc:mga05p37_97705_c1 nmdc:mga05p37_97705_c1_1560_2234 224
1073 3300050508 nmdc:mga09592_117536_c1 nmdc:mga09592_117536_c1_410_1084 224
1074 3300050508 nmdc:mga09592_423763_c1 nmdc:mga09592_423763_c1_307_981 224
1075 3300050509 nmdc:mga0qj67_80140_c1 nmdc:mga0qj67_80140_c1_1243_1917 224
1076 3300050510 nmdc:mga06r32_266010_c1 nmdc:mga06r32_266010_c1_476_1150 224
1077 3300050510 nmdc:mga06r32_528331_c1 nmdc:mga06r32_528331_c1_28_702 224
1078 3300050512 nmdc:mga0n895_12235_c1 nmdc:mga0n895_12235_c1_147_821 224
1079 3300050513 nmdc:mga0rr50_81223_c1 nmdc:mga0rr50_81223_c1_1084_1758 224
1080 3300050514 nmdc:mga08x19_1367_c1 nmdc:mga08x19_1367_c1_14392_15066 224
1081 3300050515 nmdc:mga0a205_285740_c1 nmdc:mga0a205_285740_c1_622_1296 224
1082 3300050515 nmdc:mga0a205_318359_c1 nmdc:mga0a205_318359_c1_38_712 224
1083 3300050515 nmdc:mga0a205_99017_c1 nmdc:mga0a205_99017_c1_697_1371 224
1084 3300059506 Ga0587085_056449 Ga0587085_056449_15_695 224
1085 2162886007 SwRhRL2b_contig_1876824 SwRhRL2b_0144.00001660 225
1086 3300000531 CNBas_1000356 CNBas_10003562 225
1087 3300002459 JGI24751J29686_10000003 JGI24751J29686_1000000323 225
1088 3300003203 JGI25406J46586_10006502 JGI25406J46586_100065023 225
1089 3300004803 Ga0058862_12800948 Ga0058862_128009481 225
1090 3300005289 Ga0065704_10080070 Ga0065704_100800704 225
1091 3300005290 Ga0065712_10001262 Ga0065712_100012623 225
1092 3300005290 Ga0065712_10004631 Ga0065712_100046312 225
1093 3300005290 Ga0065712_10103634 Ga0065712_101036343 225
1094 3300005293 Ga0065715_10115373 Ga0065715_101153732 225
1095 3300005293 Ga0065715_10124328 Ga0065715_101243283 225
1096 3300005293 Ga0065715_10180616 Ga0065715_101806161 225
1097 3300005293 Ga0065715_10290099 Ga0065715_102900991 225
1098 3300005293 Ga0065715_10368326 Ga0065715_103683261 225
1099 3300005295 Ga0065707_10008319 Ga0065707_100083192 225
1100 3300005330 Ga0070690_100001595 Ga0070690_10000159510 225
1101 3300005330 Ga0070690_100424509 Ga0070690_1004245091 225
1102 3300005331 Ga0070670_100006256 Ga0070670_1000062564 225
1103 3300005331 Ga0070670_100237756 Ga0070670_1002377562 225
1104 3300005336 Ga0070680_100287547 Ga0070680_1002875471 225
1105 3300005336 Ga0070680_100371458 Ga0070680_1003714582 225
1106 3300005336 Ga0070680_100507557 Ga0070680_1005075572 225
1107 3300005339 Ga0070660_100190261 Ga0070660_1001902612 225
1108 3300005340 Ga0070689_100204250 Ga0070689_1002042502 225
1109 3300005343 Ga0070687_100166240 Ga0070687_1001662402 225
1110 3300005344 Ga0070661_100010978 Ga0070661_1000109781 225
1111 3300005345 Ga0070692_10360363 Ga0070692_103603631 225
1112 3300005353 Ga0070669_100007778 Ga0070669_1000077789 225
1113 3300005356 Ga0070674_100365580 Ga0070674_1003655801 225
1114 3300005364 Ga0070673_100809097 Ga0070673_1008090971 225
1115 3300005364 Ga0070673_101015782 Ga0070673_1010157821 225
1116 3300005366 Ga0070659_100018596 Ga0070659_1000185961 225
1117 3300005366 Ga0070659_100656431 Ga0070659_1006564311 225
1118 3300005440 Ga0070705_100272796 Ga0070705_1002727962 225
1119 3300005441 Ga0070700_100028256 Ga0070700_1000282563 225
1120 3300005441 Ga0070700_100030528 Ga0070700_1000305284 225
1121 3300005441 Ga0070700_100180282 Ga0070700_1001802821 225
1122 3300005444 Ga0070694_100053984 Ga0070694_1000539844 225
1123 3300005456 Ga0070678_100403624 Ga0070678_1004036241 225
1124 3300005457 Ga0070662_100046742 Ga0070662_1000467422 225
1125 3300005457 Ga0070662_100253708 Ga0070662_1002537082 225
1126 3300005458 Ga0070681_10021041 Ga0070681_100210413 225
1127 3300005459 Ga0068867_100195872 Ga0068867_1001958722 225
1128 3300005459 Ga0068867_100437594 Ga0068867_1004375941 225
1129 3300005459 Ga0068867_100667281 Ga0068867_1006672811 225
1130 3300005466 Ga0070685_10288130 Ga0070685_102881301 225
1131 3300005518 Ga0070699_100120465 Ga0070699_1001204652 225
1132 3300005530 Ga0070679_100057191 Ga0070679_1000571913 225
1133 3300005539 Ga0068853_101222362 Ga0068853_1012223621 225
1134 3300005543 Ga0070672_100068037 Ga0070672_1000680373 225
1135 3300005547 Ga0070693_100037897 Ga0070693_1000378972 225
1136 3300005549 Ga0070704_100053350 Ga0070704_1000533502 225
1137 3300005549 Ga0070704_100108344 Ga0070704_1001083441 225
1138 3300005563 Ga0068855_100227266 Ga0068855_1002272662 225
1139 3300005564 Ga0070664_100003302 Ga0070664_1000033028 225
1140 3300005564 Ga0070664_100176420 Ga0070664_1001764202 225
1141 3300005577 Ga0068857_100012788 Ga0068857_1000127881 225
1142 3300005577 Ga0068857_100183617 Ga0068857_1001836171 225
1143 3300005578 Ga0068854_100349640 Ga0068854_1003496402 225
1144 3300005578 Ga0068854_100392104 Ga0068854_1003921041 225
1145 3300005616 Ga0068852_101018401 Ga0068852_1010184011 225
1146 3300005617 Ga0068859_100011747 Ga0068859_1000117475 225
1147 3300005617 Ga0068859_100280881 Ga0068859_1002808812 225
1148 3300005617 Ga0068859_100445092 Ga0068859_1004450922 225
1149 3300005617 Ga0068859_100468556 Ga0068859_1004685562 225
1150 3300005618 Ga0068864_100130971 Ga0068864_1001309712 225
1151 3300005718 Ga0068866_10278879 Ga0068866_102788792 225
1152 3300005719 Ga0068861_100139933 Ga0068861_1001399332 225
1153 3300005719 Ga0068861_100295759 Ga0068861_1002957591 225
1154 3300005719 Ga0068861_100405022 Ga0068861_1004050222 225
1155 3300005719 Ga0068861_100464308 Ga0068861_1004643081 225
1156 3300005840 Ga0068870_10132383 Ga0068870_101323832 225
1157 3300005841 Ga0068863_100564628 Ga0068863_1005646281 225
1158 3300005842 Ga0068858_100093232 Ga0068858_1000932322 225
1159 3300005842 Ga0068858_100207727 Ga0068858_1002077272 225
1160 3300005842 Ga0068858_100226002 Ga0068858_1002260022 225
1161 3300005842 Ga0068858_100516340 Ga0068858_1005163402 225
1162 3300005843 Ga0068860_100500877 Ga0068860_1005008772 225
1163 3300005844 Ga0068862_100041894 Ga0068862_1000418944 225
1164 3300005844 Ga0068862_100085899 Ga0068862_1000858991 225
1165 3300005844 Ga0068862_100691194 Ga0068862_1006911941 225
1166 3300005844 Ga0068862_100841479 Ga0068862_1008414792 225
1167 3300005985 Ga0081539_10015632 Ga0081539_100156323 225
1168 3300006173 Ga0070716_100099154 Ga0070716_1000991542 225
1169 3300006844 Ga0075428_100497178 Ga0075428_1004971782 225
1170 3300006852 Ga0075433_10037648 Ga0075433_100376483 225
1171 3300006852 Ga0075433_10110253 Ga0075433_101102533 225
1172 3300006852 Ga0075433_10299122 Ga0075433_102991222 225
1173 3300006871 Ga0075434_100088868 Ga0075434_1000888683 225
1174 3300006871 Ga0075434_100261117 Ga0075434_1002611171 225
1175 3300006881 Ga0068865_100076284 Ga0068865_1000762843 225
1176 3300006931 Ga0097620_100011747 Ga0097620_1000117475 225
1177 3300006931 Ga0097620_100185788 Ga0097620_1001857882 225
1178 3300006931 Ga0097620_100280879 Ga0097620_1002808792 225
1179 3300006931 Ga0097620_100445123 Ga0097620_1004451232 225
1180 3300006931 Ga0097620_100468582 Ga0097620_1004685821 225
1181 3300009094 Ga0111539_10001279 Ga0111539_1000127920 225
1182 3300009094 Ga0111539_10101746 Ga0111539_101017461 225
1183 3300009094 Ga0111539_10380291 Ga0111539_103802911 225
1184 3300009101 Ga0105247_10000601 Ga0105247_100006018 225
1185 3300009101 Ga0105247_10386084 Ga0105247_103860841 225
1186 3300009147 Ga0114129_10404414 Ga0114129_104044142 225
1187 3300009148 Ga0105243_10666894 Ga0105243_106668941 225
1188 3300009174 Ga0105241_10112857 Ga0105241_101128572 225
1189 3300009174 Ga0105241_10171604 Ga0105241_101716042 225
1190 3300009176 Ga0105242_10025874 Ga0105242_100258742 225
1191 3300009176 Ga0105242_10820359 Ga0105242_108203591 225
1192 3300009177 Ga0105248_10331654 Ga0105248_103316542 225
1193 3300009177 Ga0105248_10449588 Ga0105248_104495881 225
1194 3300009551 Ga0105238_10018282 Ga0105238_100182823 225
1195 3300009553 Ga0105249_10016243 Ga0105249_100162436 225
1196 3300009553 Ga0105249_10042539 Ga0105249_100425392 225
1197 3300013100 Ga0157373_10025718 Ga0157373_100257182 225
1198 3300013100 Ga0157373_10093645 Ga0157373_100936452 225
1199 3300013100 Ga0157373_10270450 Ga0157373_102704501 225
1200 3300013297 Ga0157378_10021331 Ga0157378_100213313 225
1201 3300013306 Ga0163162_10005642 Ga0163162_100056422 225
1202 3300013306 Ga0163162_10196754 Ga0163162_101967542 225
1203 3300013308 Ga0157375_10356104 Ga0157375_103561042 225
1204 3300014325 Ga0163163_10001582 Ga0163163_100015824 225
1205 3300014325 Ga0163163_10002592 Ga0163163_100025928 225
1206 3300014326 Ga0157380_10065258 Ga0157380_100652581 225
1207 3300014326 Ga0157380_10428036 Ga0157380_104280361 225
1208 3300014968 Ga0157379_10424302 Ga0157379_104243021 225
1209 3300017792 Ga0163161_10021410 Ga0163161_100214102 225
1210 3300025315 Ga0207697_10025069 Ga0207697_100250692 225
1211 3300025899 Ga0207642_10328703 Ga0207642_103287031 225
1212 3300025899 Ga0207642_10469085 Ga0207642_104690851 225
1213 3300025900 Ga0207710_10000522 Ga0207710_1000052219 225
1214 3300025904 Ga0207647_10093861 Ga0207647_100938611 225
1215 3300025904 Ga0207647_10275455 Ga0207647_102754552 225
1216 3300025911 Ga0207654_10137857 Ga0207654_101378572 225
1217 3300025911 Ga0207654_10497384 Ga0207654_104973841 225
1218 3300025912 Ga0207707_10029405 Ga0207707_100294056 225
1219 3300025917 Ga0207660_10083497 Ga0207660_100834972 225
1220 3300025917 Ga0207660_10186137 Ga0207660_101861371 225
1221 3300025919 Ga0207657_10369908 Ga0207657_103699081 225
1222 3300025920 Ga0207649_10320455 Ga0207649_103204551 225
1223 3300025920 Ga0207649_10688876 Ga0207649_106888761 225
1224 3300025921 Ga0207652_10072777 Ga0207652_100727773 225
1225 3300025923 Ga0207681_10053894 Ga0207681_100538941 225
1226 3300025924 Ga0207694_10008388 Ga0207694_100083885 225
1227 3300025924 Ga0207694_10457153 Ga0207694_104571531 225
1228 3300025925 Ga0207650_10000007 Ga0207650_10000007266 225
1229 3300025925 Ga0207650_10141749 Ga0207650_101417492 225
1230 3300025925 Ga0207650_10142531 Ga0207650_101425312 225
1231 3300025932 Ga0207690_10128318 Ga0207690_101283182 225
1232 3300025932 Ga0207690_10698449 Ga0207690_106984491 225
1233 3300025933 Ga0207706_10114455 Ga0207706_101144552 225
1234 3300025933 Ga0207706_10416175 Ga0207706_104161752 225
1235 3300025934 Ga0207686_10012011 Ga0207686_100120113 225
1236 3300025934 Ga0207686_10573663 Ga0207686_105736631 225
1237 3300025935 Ga0207709_10511283 Ga0207709_105112832 225
1238 3300025938 Ga0207704_10072701 Ga0207704_100727012 225
1239 3300025938 Ga0207704_10362667 Ga0207704_103626671 225
1240 3300025939 Ga0207665_10109211 Ga0207665_101092112 225
1241 3300025940 Ga0207691_10092206 Ga0207691_100922062 225
1242 3300025941 Ga0207711_10164054 Ga0207711_101640542 225
1243 3300025941 Ga0207711_10241614 Ga0207711_102416142 225
1244 3300025942 Ga0207689_10146277 Ga0207689_101462772 225
1245 3300025942 Ga0207689_10351969 Ga0207689_103519692 225
1246 3300025945 Ga0207679_10009858 Ga0207679_100098585 225
1247 3300025945 Ga0207679_10107235 Ga0207679_101072352 225
1248 3300025960 Ga0207651_10229207 Ga0207651_102292071 225
1249 3300025960 Ga0207651_10858512 Ga0207651_108585121 225
1250 3300025961 Ga0207712_10028687 Ga0207712_100286873 225
1251 3300025961 Ga0207712_10032257 Ga0207712_100322574 225
1252 3300025981 Ga0207640_10370569 Ga0207640_103705692 225
1253 3300025981 Ga0207640_10945013 Ga0207640_109450131 225
1254 3300026023 Ga0207677_10385691 Ga0207677_103856911 225
1255 3300026035 Ga0207703_10107094 Ga0207703_101070943 225
1256 3300026035 Ga0207703_10188850 Ga0207703_101888502 225
1257 3300026075 Ga0207708_10016737 Ga0207708_100167373 225
1258 3300026075 Ga0207708_10033605 Ga0207708_100336053 225
1259 3300026089 Ga0207648_10039122 Ga0207648_100391223 225
1260 3300026089 Ga0207648_10236684 Ga0207648_102366841 225
1261 3300026089 Ga0207648_10239601 Ga0207648_102396012 225
1262 3300026089 Ga0207648_10269731 Ga0207648_102697312 225
1263 3300026095 Ga0207676_10116396 Ga0207676_101163962 225
1264 3300026095 Ga0207676_10395532 Ga0207676_103955322 225
1265 3300026116 Ga0207674_10000497 Ga0207674_1000049723 225
1266 3300026116 Ga0207674_10176653 Ga0207674_101766532 225
1267 3300026116 Ga0207674_10824582 Ga0207674_108245821 225
1268 3300026118 Ga0207675_100044737 Ga0207675_1000447372 225
1269 3300026118 Ga0207675_100072073 Ga0207675_1000720734 225
1270 3300026118 Ga0207675_100266125 Ga0207675_1002661252 225
1271 3300026118 Ga0207675_100372294 Ga0207675_1003722942 225
1272 3300026118 Ga0207675_100443031 Ga0207675_1004430311 225
1273 3300026121 Ga0207683_10287630 Ga0207683_102876302 225
1274 3300027614 Ga0209970_1040200 Ga0209970_10402001 225
1275 3300027907 Ga0207428_10026651 Ga0207428_100266513 225
1276 3300027907 Ga0207428_10355267 Ga0207428_103552671 225
1277 3300028380 Ga0268265_10063613 Ga0268265_100636132 225
1278 3300031911 Ga0307412_10699236 Ga0307412_106992362 225
1279 3300035114 Ga0373939_0104140 Ga0373939_0104140_32_709 225
1280 3300045051 Ga0451576_1057137 Ga0451576_1057137_144_821 225
1281 3300048911 Ga0496108_0165129 Ga0496108_0165129_1060_1743 225
1282 3300048915 Ga0496112_0208631 Ga0496112_0208631_582_1259 225
1283 3300048915 Ga0496112_0370437 Ga0496112_0370437_282_959 225
1284 3300048915 Ga0496112_0699692 Ga0496112_0699692_136_813 225
1285 3300049514 Ga0501291_035098 Ga0501291_035098_80_757 225
1286 3300049518 Ga0501295_007194 Ga0501295_007194_424_1101 225
1287 3300049519 Ga0501296_000795 Ga0501296_000795_1991_2668 225
1288 3300049520 Ga0501297_000606 Ga0501297_000606_615_1292 225
1289 3300049521 Ga0501298_001056 Ga0501298_001056_3161_3838 225
1290 3300049522 Ga0501299_000661 Ga0501299_000661_1584_2261 225
1291 3300049523 Ga0501300_005675 Ga0501300_005675_204_881 225
1292 3300049652 Ga0501202_012254 Ga0501202_012254_337_1014 225
1293 3300049660 Ga0501216_008483 Ga0501216_008483_629_1306 225
1294 3300049663 Ga0501223_019744 Ga0501223_019744_131_808 225
1295 3300049664 Ga0501224_006716 Ga0501224_006716_953_1630 225
1296 3300049675 Ga0501243_011882 Ga0501243_011882_84_761 225
1297 3300049685 Ga0501256_004000 Ga0501256_004000_302_979 225
1298 3300049686 Ga0501257_023342 Ga0501257_023342_719_1396 225
1299 3300049689 Ga0501260_003055 Ga0501260_003055_649_1326 225
1300 3300049704 Ga0501221_026495 Ga0501221_026495_204_881 225
1301 3300049707 Ga0501234_031105 Ga0501234_031105_135_812 225
1302 3300049768 Ga0501271_002133 Ga0501271_002133_828_1505 225
1303 3300049779 Ga0501283_000685 Ga0501283_000685_1846_2523 225
1304 3300050511 nmdc:mga08y16_9503_c1 nmdc:mga08y16_9503_c1_5031_5708 225
1305 3300050515 nmdc:mga0a205_143742_c1 nmdc:mga0a205_143742_c1_779_1456 225
1306 3300050515 nmdc:mga0a205_238474_c1 nmdc:mga0a205_238474_c1_614_1339 225
1307 3300059490 Ga0587066_053172 Ga0587066_053172_66_743 225
1308 3300059506 Ga0587085_041241 Ga0587085_041241_102_779 225
1309 3300059640 Ga0587067_052062 Ga0587067_052062_64_741 225
1310 3300059643 Ga0587072_064723 Ga0587072_064723_12_689 225
1311 3300059645 Ga0587076_045792 Ga0587076_045792_66_743 225

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

34

165

0.97

PF10417

1-cysPrx_C

C-terminal domain of 1-Cys peroxiredoxin

185

224

0.93

PF08534

Redoxin

Redoxin

33

183

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kuu-assembly1.cif.gz_B lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form 0.9692 3 210
6p0w-assembly1.cif.gz_A-2 lsfa from p. aeruginosa, a 1-cys prx in reduced form 0.9658 3 210
7kuu-assembly1.cif.gz_B lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form 0.9645 3 210
6p0w-assembly1.cif.gz_A-2 lsfa from p. aeruginosa, a 1-cys prx in reduced form 0.9564 3 210
1xcc-assembly2.cif.gz_D 1-cys peroxidoxin from plasmodium yoelli 0.9457 5 207
ID Description Score Start End Superfamily
af_Q54SE2_176_239_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9878 146 208 3.30.1020.10
af_A0A0R0K508_6_109_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9625 5 106 3.40.30.10
af_P34227_199_260_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9583 146 207 3.30.1020.10
af_Q54SE2_176_239_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9578 146 208 3.30.1020.10
3a2vB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9399 1 141 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A3D2S068-F1-model_v4 Peroxidase 0.9859 1 106 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A659YRX5-F1-model_v4 deleted 0.9844 1 103
AF-A0A2V5ZNJ6-F1-model_v4 Peroxidase 0.9826 3 94 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A1T5DCE5-F1-model_v4 Alkyl hydroperoxide reductase subunit AhpC (Peroxiredoxin) 0.9807 1 207 GO:0005829
GO:0016020
GO:0045454
GO:0051920
AF-A0A3B0MZ76-F1-model_v4 Putative peroxiredoxin (EC 1.11.1.15) 0.9794 1 207 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454

Feature Viewer

pLDDT pTM Quality
89.57 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map