F492862

General Info

Members Datasets Scaffolds Average Seq Length
1310 397 1278 397

Family's Representative Sequence

Representative Sequence 3300053087|Ga0500643_000767|Ga0500643_000767_14111_15451
Length 435
Sequence MLCSFGNSRHCGARTPILDDVHAYPIGFRRMILSRYERMIAKRYLLPGKGEGFIFLVAGISLFAVMLGVAALIIVMSVMNGFRAELFDKIVGLNGHAVVQGYGGRLPDWRDVLAEAKRTPGVTSATPMIEQPLMASSEGRVEGVIVRGMTVADIAGNQTIAGNVLRGKLKALQPGNDNVAIGARLAEQLGVTVGSAISLISPQGQTTPFGSVPRIVSYRVAAIFEVGVYDYDKAFVIMPIENAQVLLLMGDTVGMIEVQTVDPDKVGTILAPLAAKVAGRAEVADWRSMNAQLFEALAVERVAMFVVLSIIILVLVRAKNRDIAILRTMGATRRGLIKIFVTVGVTIGSLGIVAGLVLGAIFLFFRQSVVNFIQLVTGQNLWDPSIRFLTELPSKTDPFEVAGICVMALVFSFLATLYPAFKAASTDPVQVLRYE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
4 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
5 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
6 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
7 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
8 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
9 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
10 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
11 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
12 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
13 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
14 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
15 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
16 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
17 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
18 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
19 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
20 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
21 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
22 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
23 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
24 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
25 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
26 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
27 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
28 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
29 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
30 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
31 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
32 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
33 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
34 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
35 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
36 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
37 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
38 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
39 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
40 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
41 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
42 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
43 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
44 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
45 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
46 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
47 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
48 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
49 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
50 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
51 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
52 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
53 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
54 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
55 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
56 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
57 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
58 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
59 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
60 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
61 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
62 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
63 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
64 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
65 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
66 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
67 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
68 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
69 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
70 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
71 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
72 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
73 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
74 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
75 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
76 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
77 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
78 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
79 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
80 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
81 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
82 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
83 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
84 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
85 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
86 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
87 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
88 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
89 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
90 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
91 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
92 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
93 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
94 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
95 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
96 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
97 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
98 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
99 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
100 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
101 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
102 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
103 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
104 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
105 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
106 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
107 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
108 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
109 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
110 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
111 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
112 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
113 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
114 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
115 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
116 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
117 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
118 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
119 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
120 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
121 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
122 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
123 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
124 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
125 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
126 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
127 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
128 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
129 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
130 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
131 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
132 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
133 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
134 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
135 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
136 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
137 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
138 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
139 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
140 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
141 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
142 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
143 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
144 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
145 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
146 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
147 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
148 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
149 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
150 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
151 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
152 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
153 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
154 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
158 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
161 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
162 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
166 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
168 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
169 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
170 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
172 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
173 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
225 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
229 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
230 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
231 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
232 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
233 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
234 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
235 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
236 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
237 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
238 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
239 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
240 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
241 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
242 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
243 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
244 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
245 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
246 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
247 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
248 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
249 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
250 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
251 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
252 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
253 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
254 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
255 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
256 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
257 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
258 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
259 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
260 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
261 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
262 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
263 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
264 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
265 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
266 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
267 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
268 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
269 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
270 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
271 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
272 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
273 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
274 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
275 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
276 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
277 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
278 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
279 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
280 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
281 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
282 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
283 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
284 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
285 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
286 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
287 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
288 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
289 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
290 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
291 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
292 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
293 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
294 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
295 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
296 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
297 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
298 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
299 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
300 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
301 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
302 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
303 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
304 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
305 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
306 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
307 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
308 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
309 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
310 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
311 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
312 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
313 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
314 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
315 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
316 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
317 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
318 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
319 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
320 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
321 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
322 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
323 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
324 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
325 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
326 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
327 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
328 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
329 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
330 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
331 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
332 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
333 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
334 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
335 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
336 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
337 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
338 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
339 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
340 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
341 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
342 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
343 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
351 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
352 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
353 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
354 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
355 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
356 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
357 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
358 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
359 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
360 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
361 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
363 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
364 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
365 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
366 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
367 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
368 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
369 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
370 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
371 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
372 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
373 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
374 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
375 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
376 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
377 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
378 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
379 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
380 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
381 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
382 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
383 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
384 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
385 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
386 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
387 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
388 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
389 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
390 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
391 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
392 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
393 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
394 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
395 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
396 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
397 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.48
Metatranscriptomes 0.08
Isolates 2.44

Biome Distribution

Category Percentage (%)
Aerial Root 0.23
Bulb 0
Endosphere 10.69
Nodule 0
Rhizoplane 4.05
Rhizosphere 78.4
Stem 0
Stem Tuber 0.08
Unclassified 6.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2073436 2162886007 Bacteria 4126
2 SwRhRL2b_contig_2799799 2162886007 Bacteria 27953
3 JGI24736J21556_1000121 3300001904 Bacteria 13331
4 JGI24736J21556_1000891 3300001904 Bacteria 5513
5 JGI24736J21556_1006068 3300001904 Bacteria 2040
6 JGI24741J21665_1000108 3300001915 Bacteria 22031
7 JGI24741J21665_1003555 3300001915 Bacteria 3684
8 JGI24752J21851_1000406 3300001976 Bacteria 5895
9 JGI24752J21851_1001029 3300001976 Bacteria 3799
10 JGI24740J21852_10004902 3300001979 Bacteria 5695
11 JGI24740J21852_10009757 3300001979 Bacteria 3737
12 JGI24740J21852_10021751 3300001979 Bacteria 2218
13 JGI24740J21852_10023035 3300001979 Bacteria 2133
14 JGI24739J22299_10021175 3300001989 Bacteria 2317
15 JGI24739J22299_10029225 3300001989 Bacteria 1918
16 JGI24737J22298_10001265 3300001990 Bacteria 8943
17 JGI24737J22298_10005107 3300001990 Bacteria 4544
18 JGI24737J22298_10005230 3300001990 Bacteria 4491
19 JGI24737J22298_10005290 3300001990 Bacteria 4463
20 JGI24737J22298_10011295 3300001990 Bacteria 2929
21 JGI24735J21928_10000918 3300002067 Bacteria 10528
22 JGI24735J21928_10003300 3300002067 Bacteria 5506
23 JGI24735J21928_10023622 3300002067 Bacteria 1864
24 JGI24750J21931_1000121 3300002070 Bacteria 12486
25 JGI24748J21848_1000044 3300002074 Bacteria 59119
26 JGI24738J21930_10000672 3300002075 Bacteria 9918
27 JGI24738J21930_10001184 3300002075 Bacteria 7324
28 JGI24738J21930_10001453 3300002075 Bacteria 6592
29 JGI24749J21850_1000073 3300002076 Bacteria 18143
30 JGI24034J26672_10000020 3300002239 Bacteria 122643
31 JGI24034J26672_10005054 3300002239 Bacteria 1883
32 JGI24034J26672_10006041 3300002239 Bacteria 1744
33 JGI24751J29686_10000408 3300002459 Bacteria 13658
34 JGI25150J39212_1000020 3300002774 Bacteria 134928
35 JGI25165J46597_1000032 3300003214 Bacteria 294371
36 JGI25153J46596_10000006 3300003215 Bacteria 447760
37 JGI25153J46596_10000017 3300003215 Bacteria 274325
38 JGI25153J46596_10002165 3300003215 Bacteria 11473
39 Ga0055525_1000040 3300003759 Bacteria 286933
40 Ga0055542_1000046 3300003762 Bacteria 201922
41 Ga0055529_1000007 3300003763 Bacteria 403604
42 Ga0055526_1003107 3300003771 Bacteria 10770
43 Ga0055537_1004762 3300003773 Bacteria 3798
44 Ga0055524_1000255 3300003775 Bacteria 54719
45 Ga0055536_1006170 3300003781 Bacteria 5664
46 Ga0055536_1009965 3300003781 Bacteria 3844
47 Ga0055536_1010031 3300003781 Bacteria 3825
48 Ga0055536_1015014 3300003781 Bacteria 2677
49 Ga0055530_10000095 3300003791 Bacteria 74707
50 Ga0055530_10000591 3300003791 Bacteria 31446
51 Ga0055540_1004749 3300003792 Bacteria 5993
52 Ga0055531_10000671 3300003794 Bacteria 29301
53 Ga0055531_10001569 3300003794 Bacteria 16727
54 Ga0055531_10011724 3300003794 Bacteria 4194
55 Ga0055531_10011725 3300003794 Bacteria 4194
56 Ga0055531_10019298 3300003794 Bacteria 2766
57 Ga0065165_1003103 3300005262 Bacteria 12353
58 Ga0065165_1003364 3300005262 Bacteria 11354
59 Ga0065165_1007100 3300005262 Bacteria 5620
60 Ga0065704_10000280 3300005289 Bacteria 50510
61 Ga0065712_10029270 3300005290 Bacteria 1457
62 Ga0065712_10099620 3300005290 Bacteria 2086
63 Ga0065715_10009180 3300005293 Bacteria 4044
64 Ga0065715_10127491 3300005293 Bacteria 2086
65 Ga0065707_10084704 3300005295 Bacteria 6869
66 Ga0065707_10090473 3300005295 Bacteria 4133
67 Ga0065707_10094263 3300005295 Bacteria 3520
68 Ga0065707_10104511 3300005295 Bacteria 2682
69 Ga0065707_10118130 3300005295 Bacteria 2194
70 Ga0070658_10000001 3300005327 Bacteria 856789
71 Ga0070658_10000426 3300005327 Bacteria 36543
72 Ga0070658_10005098 3300005327 Bacteria 10688
73 Ga0070658_10005793 3300005327 Bacteria 10018
74 Ga0070658_10008733 3300005327 Bacteria 8138
75 Ga0070658_10009419 3300005327 Bacteria 7846
76 Ga0070658_10012865 3300005327 Bacteria 6716
77 Ga0070658_10027431 3300005327 Bacteria 4570
78 Ga0070658_10031926 3300005327 Bacteria 4232
79 Ga0070658_10055567 3300005327 Bacteria 3216
80 Ga0070658_10061125 3300005327 Bacteria 3069
81 Ga0070658_10070785 3300005327 Bacteria 2856
82 Ga0070658_10095443 3300005327 Bacteria 2455
83 Ga0070658_10106894 3300005327 Bacteria 2315
84 Ga0070658_10119049 3300005327 Bacteria 2193
85 Ga0070658_10119965 3300005327 Bacteria 2185
86 Ga0070658_10141249 3300005327 Bacteria 2012
87 Ga0070676_10035663 3300005328 Bacteria 2862
88 Ga0070683_100000854 3300005329 Bacteria 22519
89 Ga0070683_100005212 3300005329 Bacteria 10820
90 Ga0070683_100008718 3300005329 Bacteria 8623
91 Ga0070683_100040226 3300005329 Bacteria 4297
92 Ga0070683_100059308 3300005329 Bacteria 3555
93 Ga0070683_100175071 3300005329 Bacteria 2037
94 Ga0070690_100000014 3300005330 Bacteria 87494
95 Ga0070670_100000060 3300005331 Bacteria 113477
96 Ga0070670_100000239 3300005331 Bacteria 49801
97 Ga0070670_100000600 3300005331 Bacteria 28387
98 Ga0070670_100010781 3300005331 Bacteria 7808
99 Ga0070670_100012240 3300005331 Bacteria 7339
100 Ga0070670_100023308 3300005331 Bacteria 5328
101 Ga0070670_100063442 3300005331 Bacteria 3171
102 Ga0070670_100077433 3300005331 Bacteria 2857
103 Ga0070670_100102172 3300005331 Bacteria 2469
104 Ga0070670_100148733 3300005331 Bacteria 2027
105 Ga0070670_100170553 3300005331 Bacteria 1887
106 Ga0070677_10000069 3300005333 Bacteria 32294
107 Ga0070677_10005209 3300005333 Bacteria 4278
108 Ga0070677_10027224 3300005333 Bacteria 2151
109 Ga0070666_10000027 3300005335 Bacteria 151010
110 Ga0070666_10000033 3300005335 Bacteria 121625
111 Ga0070666_10003878 3300005335 Bacteria 9083
112 Ga0070666_10011986 3300005335 Bacteria 5456
113 Ga0070666_10013898 3300005335 Bacteria 5115
114 Ga0070666_10073807 3300005335 Bacteria 2324
115 Ga0070680_100001216 3300005336 Bacteria 18552
116 Ga0070680_100003659 3300005336 Bacteria 11488
117 Ga0070680_100003741 3300005336 Bacteria 11369
118 Ga0070680_100042385 3300005336 Bacteria 3693
119 Ga0070660_100001041 3300005339 Bacteria 18641
120 Ga0070660_100004125 3300005339 Bacteria 10026
121 Ga0070660_100004456 3300005339 Bacteria 9679
122 Ga0070660_100004535 3300005339 Bacteria 9598
123 Ga0070660_100005756 3300005339 Bacteria 8588
124 Ga0070660_100016903 3300005339 Bacteria 5308
125 Ga0070660_100019896 3300005339 Bacteria 4925
126 Ga0070660_100024798 3300005339 Bacteria 4453
127 Ga0070660_100026476 3300005339 Bacteria 4318
128 Ga0070660_100072184 3300005339 Bacteria 2697
129 Ga0070689_100004623 3300005340 Bacteria 9327
130 Ga0070691_10005292 3300005341 Bacteria 5863
131 Ga0070661_100000001 3300005344 Bacteria 424830
132 Ga0070661_100000112 3300005344 Bacteria 67887
133 Ga0070661_100002224 3300005344 Bacteria 13306
134 Ga0070661_100003111 3300005344 Bacteria 11417
135 Ga0070661_100015488 3300005344 Bacteria 5381
136 Ga0070661_100044482 3300005344 Bacteria 3244
137 Ga0070661_100047745 3300005344 Bacteria 3133
138 Ga0070661_100150851 3300005344 Bacteria 1757
139 Ga0070692_10000276 3300005345 Bacteria 14447
140 Ga0070692_10083396 3300005345 Bacteria 1726
141 Ga0070668_100000035 3300005347 Bacteria 82135
142 Ga0070668_100000060 3300005347 Bacteria 67693
143 Ga0070668_100003597 3300005347 Bacteria 11435
144 Ga0070668_100009575 3300005347 Bacteria 7190
145 Ga0070668_100018654 3300005347 Bacteria 5208
146 Ga0070668_100021732 3300005347 Bacteria 4848
147 Ga0070668_100038039 3300005347 Bacteria 3676
148 Ga0070669_100000053 3300005353 Bacteria 113601
149 Ga0070669_100000075 3300005353 Bacteria 98073
150 Ga0070669_100000099 3300005353 Bacteria 85328
151 Ga0070669_100001205 3300005353 Bacteria 18825
152 Ga0070669_100020482 3300005353 Bacteria 4724
153 Ga0070669_100020753 3300005353 Bacteria 4692
154 Ga0070669_100122919 3300005353 Bacteria 1983
155 Ga0070675_100004368 3300005354 Bacteria 10784
156 Ga0070675_100011037 3300005354 Bacteria 7070
157 Ga0070675_100023252 3300005354 Bacteria 4954
158 Ga0070671_100000015 3300005355 Bacteria 166132
159 Ga0070671_100000113 3300005355 Bacteria 52082
160 Ga0070671_100000190 3300005355 Bacteria 41368
161 Ga0070671_100000327 3300005355 Bacteria 32467
162 Ga0070671_100002037 3300005355 Bacteria 15580
163 Ga0070671_100007604 3300005355 Bacteria 8666
164 Ga0070671_100008093 3300005355 Bacteria 8418
165 Ga0070671_100008390 3300005355 Bacteria 8280
166 Ga0070671_100015333 3300005355 Bacteria 6189
167 Ga0070671_100019634 3300005355 Bacteria 5503
168 Ga0070671_100021031 3300005355 Bacteria 5325
169 Ga0070671_100023547 3300005355 Bacteria 5040
170 Ga0070671_100030067 3300005355 Bacteria 4483
171 Ga0070674_100009284 3300005356 Bacteria 5888
172 Ga0070674_100014348 3300005356 Bacteria 4926
173 Ga0070674_100053320 3300005356 Bacteria 2792
174 Ga0070674_100084803 3300005356 Bacteria 2272
175 Ga0070673_100012393 3300005364 Bacteria 5851
176 Ga0070673_100024106 3300005364 Bacteria 4455
177 Ga0070673_100043201 3300005364 Bacteria 3481
178 Ga0070673_100070226 3300005364 Bacteria 2810
179 Ga0070673_100097304 3300005364 Bacteria 2417
180 Ga0070673_100140507 3300005364 Bacteria 2036
181 Ga0070688_100000293 3300005365 Bacteria 25617
182 Ga0070659_100000295 3300005366 Bacteria 39046
183 Ga0070659_100006675 3300005366 Bacteria 8340
184 Ga0070659_100011599 3300005366 Bacteria 6523
185 Ga0070659_100018927 3300005366 Bacteria 5204
186 Ga0070659_100047315 3300005366 Bacteria 3374
187 Ga0070659_100064755 3300005366 Bacteria 2893
188 Ga0070659_100066150 3300005366 Bacteria 2864
189 Ga0070659_100066294 3300005366 Bacteria 2861
190 Ga0070659_100163956 3300005366 Bacteria 1818
191 Ga0070667_100000039 3300005367 Bacteria 170228
192 Ga0070667_100000101 3300005367 Bacteria 108015
193 Ga0070667_100000641 3300005367 Bacteria 33965
194 Ga0070667_100001208 3300005367 Bacteria 23502
195 Ga0070667_100003436 3300005367 Bacteria 13491
196 Ga0070667_100004021 3300005367 Bacteria 12447
197 Ga0070667_100006718 3300005367 Bacteria 9558
198 Ga0070667_100022655 3300005367 Bacteria 5208
199 Ga0070667_100038971 3300005367 Bacteria 3984
200 Ga0070714_100023631 3300005435 Bacteria 5052
201 Ga0070663_100000130 3300005455 Bacteria 35749
202 Ga0070663_100016467 3300005455 Bacteria 4803
203 Ga0070663_100071886 3300005455 Bacteria 2518
204 Ga0070663_100164634 3300005455 Bacteria 1709
205 Ga0070678_100013495 3300005456 Bacteria 5125
206 Ga0070678_100043903 3300005456 Bacteria 3188
207 Ga0070678_100215517 3300005456 Bacteria 1593
208 Ga0070662_100000115 3300005457 Bacteria 44962
209 Ga0070662_100006701 3300005457 Bacteria 7442
210 Ga0070662_100009118 3300005457 Bacteria 6478
211 Ga0070662_100016311 3300005457 Bacteria 4986
212 Ga0070681_10258930 3300005458 Bacteria 1652
213 Ga0068867_100061840 3300005459 Bacteria 2781
214 Ga0070685_10000874 3300005466 Bacteria 16316
215 Ga0070679_100000017 3300005530 Bacteria 129377
216 Ga0070679_100044316 3300005530 Bacteria 4432
217 Ga0070679_100071379 3300005530 Bacteria 3463
218 Ga0070684_100002712 3300005535 Bacteria 13085
219 Ga0070684_100003585 3300005535 Bacteria 11679
220 Ga0070684_100243422 3300005535 Bacteria 1643
221 Ga0068853_100000423 3300005539 Bacteria 28766
222 Ga0068853_100000667 3300005539 Bacteria 23621
223 Ga0068853_100001390 3300005539 Bacteria 17494
224 Ga0068853_100025624 3300005539 Bacteria 4950
225 Ga0068853_100032929 3300005539 Bacteria 4394
226 Ga0068853_100128129 3300005539 Bacteria 2269
227 Ga0068853_100180764 3300005539 Bacteria 1913
228 Ga0068853_100209539 3300005539 Bacteria 1776
229 Ga0070672_100003681 3300005543 Bacteria 9966
230 Ga0070672_100025228 3300005543 Bacteria 4407
231 Ga0070686_100000010 3300005544 Bacteria 192116
232 Ga0070693_100000590 3300005547 Bacteria 16076
233 Ga0070693_100006901 3300005547 Bacteria 5521
234 Ga0070665_100000075 3300005548 Bacteria 189496
235 Ga0070665_100000254 3300005548 Bacteria 88587
236 Ga0070665_100000458 3300005548 Bacteria 59389
237 Ga0070665_100003976 3300005548 Bacteria 15587
238 Ga0070665_100015682 3300005548 Bacteria 7612
239 Ga0070665_100040311 3300005548 Bacteria 4695
240 Ga0068855_100000408 3300005563 Bacteria 53275
241 Ga0068855_100002714 3300005563 Bacteria 21825
242 Ga0068855_100069282 3300005563 Bacteria 4105
243 Ga0068855_100153996 3300005563 Bacteria 2612
244 Ga0068855_100281784 3300005563 Bacteria 1845
245 Ga0070664_100000865 3300005564 Bacteria 23434
246 Ga0070664_100001240 3300005564 Bacteria 20395
247 Ga0070664_100003974 3300005564 Bacteria 11892
248 Ga0070664_100006589 3300005564 Bacteria 9363
249 Ga0068857_100002222 3300005577 Bacteria 15811
250 Ga0068857_100006265 3300005577 Bacteria 10176
251 Ga0068857_100025810 3300005577 Bacteria 5174
252 Ga0068857_100057195 3300005577 Bacteria 3461
253 Ga0068857_100067243 3300005577 Bacteria 3189
254 Ga0068854_100000334 3300005578 Bacteria 30834
255 Ga0068854_100033126 3300005578 Bacteria 3601
256 Ga0068854_100078243 3300005578 Bacteria 2436
257 Ga0068856_100000085 3300005614 Bacteria 87665
258 Ga0068856_100009633 3300005614 Bacteria 9377
259 Ga0068856_100046594 3300005614 Bacteria 4270
260 Ga0068856_100198389 3300005614 Bacteria 2021
261 Ga0068856_100199400 3300005614 Bacteria 2016
262 Ga0068856_100295401 3300005614 Bacteria 1637
263 Ga0068852_100000812 3300005616 Bacteria 20583
264 Ga0068852_100004158 3300005616 Bacteria 10197
265 Ga0068852_100018733 3300005616 Bacteria 5460
266 Ga0068852_100071468 3300005616 Bacteria 3047
267 Ga0068852_100082374 3300005616 Bacteria 2859
268 Ga0068852_100089870 3300005616 Bacteria 2746
269 Ga0068852_100121772 3300005616 Bacteria 2390
270 Ga0068852_100157997 3300005616 Bacteria 2114
271 Ga0068852_100205310 3300005616 Bacteria 1866
272 Ga0068859_100000194 3300005617 Bacteria 59075
273 Ga0068859_100002944 3300005617 Bacteria 17270
274 Ga0068859_100018641 3300005617 Bacteria 6977
275 Ga0068859_100022708 3300005617 Bacteria 6291
276 Ga0068859_100293380 3300005617 Bacteria 1719
277 Ga0068864_100000016 3300005618 Bacteria 292454
278 Ga0068864_100000069 3300005618 Bacteria 114134
279 Ga0068864_100002890 3300005618 Bacteria 14193
280 Ga0068864_100003627 3300005618 Bacteria 12763
281 Ga0068864_100019314 3300005618 Bacteria 5697
282 Ga0068864_100031094 3300005618 Bacteria 4528
283 Ga0068864_100045911 3300005618 Bacteria 3748
284 Ga0068864_100096314 3300005618 Bacteria 2619
285 Ga0068861_100000005 3300005719 Bacteria 101677
286 Ga0068861_100024150 3300005719 Bacteria 4393
287 Ga0068861_100055885 3300005719 Bacteria 3011
288 Ga0068851_10023723 3300005834 Bacteria 3000
289 Ga0068851_10027213 3300005834 Bacteria 2817
290 Ga0068851_10060228 3300005834 Bacteria 1943
291 Ga0068863_100000001 3300005841 Bacteria 581116
292 Ga0068863_100000033 3300005841 Bacteria 170238
293 Ga0068863_100000047 3300005841 Bacteria 140249
294 Ga0068863_100000072 3300005841 Bacteria 113996
295 Ga0068863_100003811 3300005841 Bacteria 14900
296 Ga0068863_100006452 3300005841 Bacteria 11504
297 Ga0068863_100009112 3300005841 Bacteria 9693
298 Ga0068863_100017751 3300005841 Bacteria 6811
299 Ga0068863_100019998 3300005841 Bacteria 6403
300 Ga0068863_100058526 3300005841 Bacteria 3646
301 Ga0068858_100000236 3300005842 Bacteria 59846
302 Ga0068858_100003263 3300005842 Bacteria 16173
303 Ga0068858_100011701 3300005842 Bacteria 8274
304 Ga0068858_100023615 3300005842 Bacteria 5729
305 Ga0068860_100000080 3300005843 Bacteria 170152
306 Ga0068860_100000181 3300005843 Bacteria 101627
307 Ga0068860_100000244 3300005843 Bacteria 82768
308 Ga0068860_100000247 3300005843 Bacteria 81527
309 Ga0068860_100002453 3300005843 Bacteria 19472
310 Ga0068860_100004118 3300005843 Bacteria 14896
311 Ga0068860_100086508 3300005843 Bacteria 2983
312 Ga0068860_100167734 3300005843 Bacteria 2120
313 Ga0068862_100000040 3300005844 Bacteria 167832
314 Ga0068862_100000082 3300005844 Bacteria 113125
315 Ga0068862_100000115 3300005844 Bacteria 94951
316 Ga0068862_100000340 3300005844 Bacteria 50605
317 Ga0068862_100000394 3300005844 Bacteria 47088
318 Ga0068862_100000699 3300005844 Bacteria 34289
319 Ga0068862_100024420 3300005844 Bacteria 5072
320 Ga0068862_100028798 3300005844 Bacteria 4678
321 Ga0081455_10000477 3300005937 Bacteria 51914
322 Ga0070717_10033097 3300006028 Bacteria 4168
323 Ga0075368_10002991 3300006042 Bacteria 5584
324 Ga0075363_100058006 3300006048 Bacteria 2079
325 Ga0075364_10037041 3300006051 Bacteria 3156
326 Ga0075367_10000543 3300006178 Bacteria 14309
327 Ga0075366_10037972 3300006195 Bacteria 2844
328 Ga0075366_10067825 3300006195 Bacteria 2123
329 Ga0097621_100010846 3300006237 Bacteria 6687
330 Ga0097621_100064043 3300006237 Bacteria 3023
331 Ga0075370_10000017 3300006353 Bacteria 60451
332 Ga0068871_100025924 3300006358 Bacteria 4568
333 Ga0097620_100000194 3300006931 Bacteria 59075
334 Ga0097620_100002944 3300006931 Bacteria 17270
335 Ga0097620_100018639 3300006931 Bacteria 6977
336 Ga0097620_100022708 3300006931 Bacteria 6291
337 Ga0097620_100293390 3300006931 Bacteria 1719
338 Ga0105251_10000611 3300009011 Bacteria 32749
339 Ga0105240_10019075 3300009093 Bacteria 9173
340 Ga0105240_10020733 3300009093 Bacteria 8757
341 Ga0105240_10021491 3300009093 Bacteria 8582
342 Ga0105240_10022857 3300009093 Bacteria 8285
343 Ga0105240_10027010 3300009093 Bacteria 7525
344 Ga0105240_10116790 3300009093 Bacteria 3218
345 Ga0105240_10165092 3300009093 Bacteria 2627
346 Ga0105245_10000967 3300009098 Bacteria 26188
347 Ga0105245_10005928 3300009098 Bacteria 10734
348 Ga0105245_10012573 3300009098 Bacteria 7368
349 Ga0105247_10001024 3300009101 Bacteria 21058
350 Ga0105247_10001062 3300009101 Bacteria 20537
351 Ga0105243_10000202 3300009148 Bacteria 69670
352 Ga0105241_10008753 3300009174 Bacteria 7437
353 Ga0105241_10017168 3300009174 Bacteria 5316
354 Ga0105241_10022201 3300009174 Bacteria 4699
355 Ga0105241_10032258 3300009174 Bacteria 3926
356 Ga0105241_10235654 3300009174 Bacteria 1545
357 Ga0105248_10000021 3300009177 Bacteria 276159
358 Ga0105248_10000101 3300009177 Bacteria 95328
359 Ga0105248_10000135 3300009177 Bacteria 85668
360 Ga0105248_10000425 3300009177 Bacteria 48192
361 Ga0105248_10001148 3300009177 Bacteria 29534
362 Ga0105248_10001289 3300009177 Bacteria 27923
363 Ga0105248_10003624 3300009177 Bacteria 17137
364 Ga0105248_10003648 3300009177 Bacteria 17091
365 Ga0105248_10015954 3300009177 Bacteria 8272
366 Ga0105248_10027890 3300009177 Bacteria 6287
367 Ga0105248_10030301 3300009177 Bacteria 6041
368 Ga0105248_10064610 3300009177 Bacteria 4109
369 Ga0105248_10402801 3300009177 Bacteria 1540
370 Ga0105237_10024764 3300009545 Bacteria 6139
371 Ga0105237_10043357 3300009545 Bacteria 4532
372 Ga0105237_10287654 3300009545 Bacteria 1646
373 Ga0105238_10005494 3300009551 Bacteria 12520
374 Ga0105238_10029832 3300009551 Bacteria 5555
375 Ga0105238_10032563 3300009551 Bacteria 5305
376 Ga0105238_10088855 3300009551 Bacteria 3076
377 Ga0105238_10180704 3300009551 Bacteria 2086
378 Ga0105238_10287466 3300009551 Bacteria 1626
379 Ga0105238_10323579 3300009551 Bacteria 1528
380 Ga0105249_10000064 3300009553 Bacteria 151646
381 Ga0105249_10000128 3300009553 Bacteria 101030
382 Ga0105249_10000240 3300009553 Bacteria 61072
383 Ga0105249_10004336 3300009553 Bacteria 12270
384 Ga0105249_10015668 3300009553 Bacteria 6712
385 Ga0105148_100077 3300009978 Bacteria 15102
386 Ga0105239_10001100 3300010375 Bacteria 37356
387 Ga0105239_10010865 3300010375 Bacteria 10171
388 Ga0105239_10036515 3300010375 Bacteria 5396
389 Ga0157373_10015861 3300013100 Bacteria 5500
390 Ga0157373_10021560 3300013100 Bacteria 4679
391 Ga0157373_10036787 3300013100 Bacteria 3511
392 Ga0157373_10079931 3300013100 Bacteria 2306
393 Ga0157373_10149965 3300013100 Bacteria 1640
394 Ga0157371_10000024 3300013102 Bacteria 281202
395 Ga0157371_10001787 3300013102 Bacteria 21747
396 Ga0157371_10006810 3300013102 Bacteria 9341
397 Ga0157371_10012041 3300013102 Bacteria 6631
398 Ga0157371_10015870 3300013102 Bacteria 5635
399 Ga0157371_10090121 3300013102 Bacteria 2172
400 Ga0157371_10091689 3300013102 Bacteria 2152
401 Ga0157371_10104675 3300013102 Bacteria 2008
402 Ga0157370_10000630 3300013104 Bacteria 43948
403 Ga0157370_10008771 3300013104 Bacteria 10869
404 Ga0157370_10033309 3300013104 Bacteria 5023
405 Ga0157370_10047005 3300013104 Bacteria 4138
406 Ga0157370_10053984 3300013104 Bacteria 3831
407 Ga0157370_10061518 3300013104 Bacteria 3563
408 Ga0157370_10070396 3300013104 Bacteria 3302
409 Ga0157370_10151509 3300013104 Bacteria 2158
410 Ga0157370_10152416 3300013104 Bacteria 2151
411 Ga0157370_10163638 3300013104 Bacteria 2070
412 Ga0157370_10196995 3300013104 Bacteria 1869
413 Ga0157369_10000298 3300013105 Bacteria 66393
414 Ga0157369_10007448 3300013105 Bacteria 12605
415 Ga0157369_10015564 3300013105 Bacteria 8572
416 Ga0157369_10020312 3300013105 Bacteria 7423
417 Ga0157369_10059183 3300013105 Bacteria 4132
418 Ga0157369_10085431 3300013105 Bacteria 3372
419 Ga0157369_10098048 3300013105 Bacteria 3126
420 Ga0157369_10147122 3300013105 Bacteria 2491
421 Ga0157369_10262020 3300013105 Bacteria 1803
422 Ga0157369_10282852 3300013105 Bacteria 1727
423 Ga0157369_10419569 3300013105 Bacteria 1387
424 Ga0157374_10108537 3300013296 Bacteria 2668
425 Ga0157374_10137826 3300013296 Bacteria 2367
426 Ga0157374_10186710 3300013296 Bacteria 2027
427 Ga0157378_10009084 3300013297 Bacteria 8653
428 Ga0157378_10009089 3300013297 Bacteria 8650
429 Ga0163162_10011412 3300013306 Bacteria 8664
430 Ga0163162_10019992 3300013306 Bacteria 6576
431 Ga0163162_10032340 3300013306 Bacteria 5195
432 Ga0163162_10058728 3300013306 Bacteria 3877
433 Ga0163162_10079338 3300013306 Bacteria 3349
434 Ga0163162_10123473 3300013306 Bacteria 2694
435 Ga0163162_10156160 3300013306 Bacteria 2402
436 Ga0157372_10002117 3300013307 Bacteria 21588
437 Ga0157372_10050512 3300013307 Bacteria 4626
438 Ga0157372_10067101 3300013307 Bacteria 4031
439 Ga0157372_10088171 3300013307 Bacteria 3522
440 Ga0157372_10183583 3300013307 Bacteria 2422
441 Ga0157372_10443442 3300013307 Bacteria 1513
442 Ga0157375_10001309 3300013308 Bacteria 21456
443 Ga0157375_10233883 3300013308 Bacteria 1997
444 Ga0163163_10001398 3300014325 Bacteria 20368
445 Ga0163163_10005046 3300014325 Bacteria 11379
446 Ga0163163_10069584 3300014325 Bacteria 3504
447 Ga0157380_10000086 3300014326 Bacteria 51604
448 Ga0157380_10003455 3300014326 Bacteria 10849
449 Ga0157380_10012788 3300014326 Bacteria 6097
450 Ga0157380_10042553 3300014326 Bacteria 3550
451 Ga0157379_10023112 3300014968 Bacteria 5513
452 Ga0157379_10088296 3300014968 Bacteria 2780
453 Ga0163161_10000110 3300017792 Bacteria 78102
454 Ga0163161_10023162 3300017792 Bacteria 4378
455 Ga0163161_10067247 3300017792 Bacteria 2617
456 Ga0163161_10091294 3300017792 Bacteria 2254
457 Ga0213873_10000009 3300021358 Bacteria 237102
458 Ga0213874_10032767 3300021377 Bacteria 1511
459 Ga0213876_10000004 3300021384 Bacteria 943822
460 Ga0213876_10000120 3300021384 Bacteria 85450
461 Ga0213875_10000202 3300021388 Bacteria 60869
462 Ga0207672_1000420 3300025223 Bacteria 5379
463 Ga0209147_100986 3300025229 Bacteria 12362
464 Ga0209563_100019 3300025230 Bacteria 697828
465 Ga0207425_1000022 3300025245 Bacteria 355305
466 Ga0209677_102955 3300025253 Bacteria 5922
467 Ga0209148_1000026 3300025254 Bacteria 629213
468 Ga0209129_1000882 3300025258 Bacteria 18478
469 Ga0209233_1000066 3300025261 Bacteria 381218
470 Ga0209233_1005448 3300025261 Bacteria 4220
471 Ga0209565_1000010 3300025263 Bacteria 687724
472 Ga0209565_1000457 3300025263 Bacteria 31431
473 Ga0209455_1000005 3300025272 Bacteria 1416756
474 Ga0209673_1003099 3300025273 Bacteria 10179
475 Ga0209675_1000025 3300025291 Bacteria 294102
476 Ga0209676_1000276 3300025292 Bacteria 106867
477 Ga0209676_1000362 3300025292 Bacteria 85770
478 Ga0209676_1000453 3300025292 Bacteria 69137
479 Ga0209676_1003652 3300025292 Bacteria 9231
480 Ga0209025_1000842 3300025294 Bacteria 48558
481 Ga0209564_1001884 3300025295 Bacteria 18863
482 Ga0209758_1000001 3300025297 Bacteria 1981790
483 Ga0209758_1000004 3300025297 Bacteria 1375322
484 Ga0209758_1003161 3300025297 Bacteria 15473
485 Ga0209050_1000001 3300025298 Bacteria 3563507
486 Ga0209050_1000026 3300025298 Bacteria 499134
487 Ga0209050_1000728 3300025298 Bacteria 47923
488 Ga0209050_1000929 3300025298 Bacteria 38383
489 Ga0209050_1001953 3300025298 Bacteria 19508
490 Ga0209050_1003410 3300025298 Bacteria 11774
491 Ga0209050_1010796 3300025298 Bacteria 4444
492 Ga0209050_1013486 3300025298 Bacteria 3620
493 Ga0209256_1000010 3300025299 Bacteria 912110
494 Ga0207426_1006530 3300025302 Bacteria 5049
495 Ga0209051_1000246 3300025303 Bacteria 91170
496 Ga0209257_1000009 3300025304 Bacteria 1205047
497 Ga0209257_1000487 3300025304 Bacteria 71315
498 Ga0209257_1000596 3300025304 Bacteria 59951
499 Ga0209257_1001934 3300025304 Bacteria 22347
500 Ga0209257_1002097 3300025304 Bacteria 20929
501 Ga0209257_1005321 3300025304 Bacteria 9124
502 Ga0209257_1006680 3300025304 Bacteria 7306
503 Ga0209257_1024324 3300025304 Bacteria 2100
504 Ga0207697_10000215 3300025315 Bacteria 30925
505 Ga0207656_10024257 3300025321 Bacteria 2451
506 Ga0207696_1005361 3300025711 Bacteria 5332
507 Ga0207713_1003637 3300025735 Bacteria 10380
508 Ga0207713_1004913 3300025735 Bacteria 8544
509 Ga0207682_10002221 3300025893 Bacteria 8760
510 Ga0207682_10004052 3300025893 Bacteria 6231
511 Ga0207710_10001018 3300025900 Bacteria 14639
512 Ga0207710_10006828 3300025900 Bacteria 4860
513 Ga0207680_10000009 3300025903 Bacteria 464571
514 Ga0207680_10000166 3300025903 Bacteria 32189
515 Ga0207680_10006457 3300025903 Bacteria 5668
516 Ga0207680_10007346 3300025903 Bacteria 5363
517 Ga0207680_10015008 3300025903 Bacteria 4031
518 Ga0207680_10051598 3300025903 Bacteria 2460
519 Ga0207680_10077538 3300025903 Bacteria 2079
520 Ga0207647_10004794 3300025904 Bacteria 10008
521 Ga0207647_10007344 3300025904 Bacteria 7969
522 Ga0207647_10007821 3300025904 Bacteria 7696
523 Ga0207647_10012687 3300025904 Bacteria 5856
524 Ga0207647_10024411 3300025904 Bacteria 3986
525 Ga0207647_10024730 3300025904 Bacteria 3958
526 Ga0207647_10056532 3300025904 Bacteria 2407
527 Ga0207647_10077547 3300025904 Bacteria 1997
528 Ga0207647_10133175 3300025904 Bacteria 1460
529 Ga0207645_10022598 3300025907 Bacteria 4090
530 Ga0207645_10084976 3300025907 Bacteria 2031
531 Ga0207705_10000002 3300025909 Bacteria 2046852
532 Ga0207705_10000070 3300025909 Bacteria 130733
533 Ga0207705_10000166 3300025909 Bacteria 71368
534 Ga0207705_10000246 3300025909 Bacteria 53316
535 Ga0207705_10000269 3300025909 Bacteria 49725
536 Ga0207705_10002067 3300025909 Bacteria 15608
537 Ga0207705_10002293 3300025909 Bacteria 14807
538 Ga0207705_10003616 3300025909 Bacteria 11775
539 Ga0207705_10005021 3300025909 Bacteria 9924
540 Ga0207705_10005919 3300025909 Bacteria 9093
541 Ga0207705_10008122 3300025909 Bacteria 7686
542 Ga0207705_10023177 3300025909 Bacteria 4429
543 Ga0207705_10024156 3300025909 Bacteria 4338
544 Ga0207705_10057909 3300025909 Bacteria 2796
545 Ga0207705_10109073 3300025909 Bacteria 2043
546 Ga0207705_10157514 3300025909 Bacteria 1704
547 Ga0207654_10000322 3300025911 Bacteria 28667
548 Ga0207654_10006812 3300025911 Bacteria 5748
549 Ga0207654_10008528 3300025911 Bacteria 5189
550 Ga0207654_10046325 3300025911 Bacteria 2479
551 Ga0207707_10102803 3300025912 Bacteria 2498
552 Ga0207707_10132000 3300025912 Bacteria 2184
553 Ga0207707_10216150 3300025912 Bacteria 1669
554 Ga0207695_10005843 3300025913 Bacteria 16170
555 Ga0207695_10016338 3300025913 Bacteria 8687
556 Ga0207695_10017663 3300025913 Bacteria 8288
557 Ga0207695_10025410 3300025913 Bacteria 6630
558 Ga0207695_10061440 3300025913 Bacteria 3883
559 Ga0207695_10097895 3300025913 Bacteria 2934
560 Ga0207695_10115879 3300025913 Bacteria 2654
561 Ga0207671_10003834 3300025914 Bacteria 14716
562 Ga0207671_10005000 3300025914 Bacteria 12412
563 Ga0207671_10026943 3300025914 Bacteria 4301
564 Ga0207660_10002754 3300025917 Bacteria 11517
565 Ga0207660_10005643 3300025917 Bacteria 8122
566 Ga0207657_10000015 3300025919 Bacteria 175776
567 Ga0207657_10000020 3300025919 Bacteria 157826
568 Ga0207657_10000084 3300025919 Bacteria 89401
569 Ga0207657_10000479 3300025919 Bacteria 42180
570 Ga0207657_10001100 3300025919 Bacteria 28711
571 Ga0207657_10002325 3300025919 Bacteria 20602
572 Ga0207657_10003251 3300025919 Bacteria 17394
573 Ga0207657_10004202 3300025919 Bacteria 15253
574 Ga0207657_10005965 3300025919 Bacteria 12674
575 Ga0207657_10006898 3300025919 Bacteria 11715
576 Ga0207657_10008147 3300025919 Bacteria 10684
577 Ga0207657_10009217 3300025919 Bacteria 9948
578 Ga0207657_10043475 3300025919 Bacteria 3957
579 Ga0207657_10067110 3300025919 Bacteria 3051
580 Ga0207657_10076014 3300025919 Bacteria 2834
581 Ga0207657_10131701 3300025919 Bacteria 2049
582 Ga0207657_10161702 3300025919 Bacteria 1818
583 Ga0207649_10000018 3300025920 Bacteria 225137
584 Ga0207649_10000150 3300025920 Bacteria 56988
585 Ga0207649_10000816 3300025920 Bacteria 20025
586 Ga0207649_10001766 3300025920 Bacteria 12397
587 Ga0207649_10005446 3300025920 Bacteria 6890
588 Ga0207649_10072451 3300025920 Bacteria 2204
589 Ga0207649_10121916 3300025920 Bacteria 1759
590 Ga0207649_10132215 3300025920 Bacteria 1697
591 Ga0207652_10000001 3300025921 Bacteria 1006643
592 Ga0207652_10001258 3300025921 Bacteria 22543
593 Ga0207652_10016170 3300025921 Bacteria 6086
594 Ga0207652_10018385 3300025921 Bacteria 5732
595 Ga0207652_10055411 3300025921 Bacteria 3410
596 Ga0207652_10088345 3300025921 Bacteria 2719
597 Ga0207681_10000002 3300025923 Bacteria 985597
598 Ga0207681_10000003 3300025923 Bacteria 713245
599 Ga0207681_10000090 3300025923 Bacteria 78944
600 Ga0207681_10000106 3300025923 Bacteria 71721
601 Ga0207681_10005789 3300025923 Bacteria 7582
602 Ga0207681_10033359 3300025923 Bacteria 3375
603 Ga0207694_10002516 3300025924 Bacteria 14889
604 Ga0207694_10003464 3300025924 Bacteria 12536
605 Ga0207694_10010331 3300025924 Bacteria 7038
606 Ga0207694_10011456 3300025924 Bacteria 6692
607 Ga0207694_10113407 3300025924 Bacteria 2158
608 Ga0207694_10213819 3300025924 Bacteria 1571
609 Ga0207650_10000398 3300025925 Bacteria 39522
610 Ga0207650_10000622 3300025925 Bacteria 28338
611 Ga0207650_10000677 3300025925 Bacteria 26783
612 Ga0207650_10000994 3300025925 Bacteria 21325
613 Ga0207650_10030254 3300025925 Bacteria 3898
614 Ga0207650_10040280 3300025925 Bacteria 3418
615 Ga0207650_10044079 3300025925 Bacteria 3277
616 Ga0207650_10071076 3300025925 Bacteria 2617
617 Ga0207650_10088727 3300025925 Bacteria 2359
618 Ga0207650_10149039 3300025925 Bacteria 1845
619 Ga0207659_10005540 3300025926 Bacteria 7659
620 Ga0207659_10014449 3300025926 Bacteria 5093
621 Ga0207659_10032128 3300025926 Bacteria 3599
622 Ga0207687_10001006 3300025927 Bacteria 19126
623 Ga0207687_10002092 3300025927 Bacteria 13638
624 Ga0207664_10101970 3300025929 Bacteria 2372
625 Ga0207644_10000002 3300025931 Bacteria 942221
626 Ga0207644_10000012 3300025931 Bacteria 186652
627 Ga0207644_10000082 3300025931 Bacteria 69981
628 Ga0207644_10002441 3300025931 Bacteria 11988
629 Ga0207644_10004265 3300025931 Bacteria 9278
630 Ga0207644_10005036 3300025931 Bacteria 8627
631 Ga0207644_10005640 3300025931 Bacteria 8151
632 Ga0207644_10033704 3300025931 Bacteria 3582
633 Ga0207644_10065548 3300025931 Bacteria 2641
634 Ga0207644_10073598 3300025931 Bacteria 2505
635 Ga0207644_10157817 3300025931 Bacteria 1761
636 Ga0207690_10000032 3300025932 Bacteria 152479
637 Ga0207690_10000421 3300025932 Bacteria 27634
638 Ga0207690_10003515 3300025932 Bacteria 9336
639 Ga0207690_10008097 3300025932 Bacteria 6237
640 Ga0207690_10009365 3300025932 Bacteria 5817
641 Ga0207690_10010375 3300025932 Bacteria 5534
642 Ga0207690_10041568 3300025932 Bacteria 3013
643 Ga0207690_10056245 3300025932 Bacteria 2653
644 Ga0207690_10059238 3300025932 Bacteria 2594
645 Ga0207690_10139868 3300025932 Bacteria 1782
646 Ga0207690_10255293 3300025932 Bacteria 1356
647 Ga0207706_10000032 3300025933 Bacteria 142723
648 Ga0207706_10000728 3300025933 Bacteria 34396
649 Ga0207706_10007807 3300025933 Bacteria 9877
650 Ga0207706_10018099 3300025933 Bacteria 6339
651 Ga0207706_10022018 3300025933 Bacteria 5720
652 Ga0207706_10027821 3300025933 Bacteria 5054
653 Ga0207706_10044800 3300025933 Bacteria 3920
654 Ga0207706_10048827 3300025933 Bacteria 3743
655 Ga0207706_10070856 3300025933 Bacteria 3066
656 Ga0207706_10084448 3300025933 Bacteria 2791
657 Ga0207706_10184661 3300025933 Bacteria 1831
658 Ga0207706_10206875 3300025933 Bacteria 1721
659 Ga0207709_10000123 3300025935 Bacteria 115697
660 Ga0207669_10000075 3300025937 Bacteria 50601
661 Ga0207669_10019815 3300025937 Bacteria 3512
662 Ga0207691_10002713 3300025940 Bacteria 17293
663 Ga0207711_10000025 3300025941 Bacteria 289972
664 Ga0207711_10000657 3300025941 Bacteria 34462
665 Ga0207711_10002354 3300025941 Bacteria 16941
666 Ga0207711_10006861 3300025941 Bacteria 9564
667 Ga0207711_10011008 3300025941 Bacteria 7516
668 Ga0207711_10016384 3300025941 Bacteria 6161
669 Ga0207711_10018413 3300025941 Bacteria 5805
670 Ga0207711_10019722 3300025941 Bacteria 5616
671 Ga0207711_10021056 3300025941 Bacteria 5446
672 Ga0207711_10024826 3300025941 Bacteria 5028
673 Ga0207711_10026699 3300025941 Bacteria 4847
674 Ga0207711_10037716 3300025941 Bacteria 4107
675 Ga0207711_10040191 3300025941 Bacteria 3979
676 Ga0207711_10060303 3300025941 Bacteria 3269
677 Ga0207661_10000831 3300025944 Bacteria 20221
678 Ga0207661_10012545 3300025944 Bacteria 6163
679 Ga0207679_10000208 3300025945 Bacteria 46600
680 Ga0207679_10004430 3300025945 Bacteria 8746
681 Ga0207679_10005172 3300025945 Bacteria 8172
682 Ga0207679_10041557 3300025945 Bacteria 3298
683 Ga0207679_10057533 3300025945 Bacteria 2876
684 Ga0207679_10164329 3300025945 Bacteria 1821
685 Ga0207667_10000010 3300025949 Bacteria 477432
686 Ga0207667_10004698 3300025949 Bacteria 16712
687 Ga0207667_10005797 3300025949 Bacteria 15070
688 Ga0207667_10006320 3300025949 Bacteria 14356
689 Ga0207667_10008224 3300025949 Bacteria 12413
690 Ga0207667_10015113 3300025949 Bacteria 8777
691 Ga0207667_10029444 3300025949 Bacteria 5955
692 Ga0207667_10033460 3300025949 Bacteria 5525
693 Ga0207667_10050099 3300025949 Bacteria 4407
694 Ga0207667_10050876 3300025949 Bacteria 4370
695 Ga0207667_10212712 3300025949 Bacteria 1982
696 Ga0207667_10265784 3300025949 Bacteria 1754
697 Ga0207651_10063988 3300025960 Bacteria 2572
698 Ga0207651_10089293 3300025960 Bacteria 2249
699 Ga0207651_10145648 3300025960 Bacteria 1836
700 Ga0207712_10000044 3300025961 Bacteria 171240
701 Ga0207712_10000196 3300025961 Bacteria 61501
702 Ga0207712_10000610 3300025961 Bacteria 28399
703 Ga0207712_10022323 3300025961 Bacteria 4166
704 Ga0207712_10062248 3300025961 Bacteria 2651
705 Ga0207668_10000017 3300025972 Bacteria 158934
706 Ga0207668_10000056 3300025972 Bacteria 93913
707 Ga0207668_10000155 3300025972 Bacteria 47429
708 Ga0207668_10001145 3300025972 Bacteria 15787
709 Ga0207668_10002025 3300025972 Bacteria 11827
710 Ga0207668_10014294 3300025972 Bacteria 4912
711 Ga0207640_10000344 3300025981 Bacteria 30468
712 Ga0207640_10006896 3300025981 Bacteria 6246
713 Ga0207640_10007956 3300025981 Bacteria 5854
714 Ga0207640_10032055 3300025981 Bacteria 3256
715 Ga0207640_10072150 3300025981 Bacteria 2328
716 Ga0207640_10076616 3300025981 Bacteria 2271
717 Ga0207640_10198082 3300025981 Bacteria 1520
718 Ga0207658_10000077 3300025986 Bacteria 108352
719 Ga0207658_10000164 3300025986 Bacteria 70677
720 Ga0207658_10000401 3300025986 Bacteria 41615
721 Ga0207658_10000539 3300025986 Bacteria 34304
722 Ga0207658_10004171 3300025986 Bacteria 10073
723 Ga0207658_10012458 3300025986 Bacteria 5809
724 Ga0207658_10013707 3300025986 Bacteria 5543
725 Ga0207658_10015489 3300025986 Bacteria 5231
726 Ga0207658_10022574 3300025986 Bacteria 4383
727 Ga0207658_10038878 3300025986 Bacteria 3431
728 Ga0207703_10000564 3300026035 Bacteria 38136
729 Ga0207703_10000812 3300026035 Bacteria 30815
730 Ga0207703_10003247 3300026035 Bacteria 13660
731 Ga0207703_10013730 3300026035 Bacteria 6313
732 Ga0207703_10019872 3300026035 Bacteria 5250
733 Ga0207639_10000095 3300026041 Bacteria 74687
734 Ga0207639_10000336 3300026041 Bacteria 32587
735 Ga0207639_10000489 3300026041 Bacteria 27390
736 Ga0207639_10010581 3300026041 Bacteria 6391
737 Ga0207639_10019828 3300026041 Bacteria 4803
738 Ga0207639_10023407 3300026041 Bacteria 4461
739 Ga0207639_10042037 3300026041 Bacteria 3424
740 Ga0207639_10066009 3300026041 Bacteria 2811
741 Ga0207639_10186214 3300026041 Bacteria 1770
742 Ga0207639_10224704 3300026041 Bacteria 1624
743 Ga0207678_10000072 3300026067 Bacteria 81033
744 Ga0207678_10001829 3300026067 Bacteria 19504
745 Ga0207678_10007099 3300026067 Bacteria 9933
746 Ga0207678_10030297 3300026067 Bacteria 4724
747 Ga0207678_10038514 3300026067 Bacteria 4154
748 Ga0207678_10069387 3300026067 Bacteria 3022
749 Ga0207678_10118931 3300026067 Bacteria 2255
750 Ga0207678_10218833 3300026067 Bacteria 1630
751 Ga0207702_10000072 3300026078 Bacteria 113840
752 Ga0207702_10002235 3300026078 Bacteria 18571
753 Ga0207702_10007811 3300026078 Bacteria 9075
754 Ga0207702_10012218 3300026078 Bacteria 7145
755 Ga0207702_10021377 3300026078 Bacteria 5357
756 Ga0207702_10031513 3300026078 Bacteria 4419
757 Ga0207702_10073429 3300026078 Bacteria 2949
758 Ga0207702_10163577 3300026078 Bacteria 2034
759 Ga0207702_10297725 3300026078 Bacteria 1530
760 Ga0207641_10000001 3300026088 Bacteria 1180841
761 Ga0207641_10000002 3300026088 Bacteria 981004
762 Ga0207641_10000047 3300026088 Bacteria 179977
763 Ga0207641_10000079 3300026088 Bacteria 141110
764 Ga0207641_10000084 3300026088 Bacteria 133555
765 Ga0207641_10000243 3300026088 Bacteria 70600
766 Ga0207641_10001505 3300026088 Bacteria 22818
767 Ga0207641_10003760 3300026088 Bacteria 13327
768 Ga0207641_10004404 3300026088 Bacteria 12203
769 Ga0207641_10005121 3300026088 Bacteria 11227
770 Ga0207641_10024416 3300026088 Bacteria 4983
771 Ga0207641_10064697 3300026088 Bacteria 3126
772 Ga0207676_10000005 3300026095 Bacteria 698744
773 Ga0207676_10000009 3300026095 Bacteria 545256
774 Ga0207676_10000193 3300026095 Bacteria 53147
775 Ga0207676_10000827 3300026095 Bacteria 24173
776 Ga0207676_10002638 3300026095 Bacteria 12786
777 Ga0207676_10005022 3300026095 Bacteria 9368
778 Ga0207676_10005207 3300026095 Bacteria 9203
779 Ga0207676_10081953 3300026095 Bacteria 2622
780 Ga0207676_10118969 3300026095 Bacteria 2224
781 Ga0207676_10365965 3300026095 Bacteria 1338
782 Ga0207674_10000139 3300026116 Bacteria 84273
783 Ga0207674_10003807 3300026116 Bacteria 18398
784 Ga0207674_10008081 3300026116 Bacteria 12197
785 Ga0207674_10009858 3300026116 Bacteria 10873
786 Ga0207674_10027716 3300026116 Bacteria 5987
787 Ga0207674_10043416 3300026116 Bacteria 4635
788 Ga0207674_10056051 3300026116 Bacteria 4004
789 Ga0207674_10060077 3300026116 Bacteria 3845
790 Ga0207674_10078530 3300026116 Bacteria 3306
791 Ga0207674_10119675 3300026116 Bacteria 2602
792 Ga0207675_100000020 3300026118 Bacteria 117374
793 Ga0207675_100000162 3300026118 Bacteria 59062
794 Ga0207675_100000169 3300026118 Bacteria 58328
795 Ga0207675_100000207 3300026118 Bacteria 54791
796 Ga0207675_100088124 3300026118 Bacteria 2915
797 Ga0207683_10000564 3300026121 Bacteria 34296
798 Ga0207683_10003594 3300026121 Bacteria 13517
799 Ga0207683_10071022 3300026121 Bacteria 3077
800 Ga0207698_10001627 3300026142 Bacteria 13082
801 Ga0207698_10002005 3300026142 Bacteria 12004
802 Ga0207698_10003274 3300026142 Bacteria 9730
803 Ga0207698_10006765 3300026142 Bacteria 7164
804 Ga0207698_10011216 3300026142 Bacteria 5800
805 Ga0207698_10011523 3300026142 Bacteria 5737
806 Ga0207698_10012374 3300026142 Bacteria 5580
807 Ga0207698_10052316 3300026142 Bacteria 3128
808 Ga0207698_10081586 3300026142 Bacteria 2611
809 Ga0207698_10151311 3300026142 Bacteria 2014
810 Ga0209813_10000099 3300027866 Bacteria 32132
811 Ga0268266_10000002 3300028379 Bacteria 3059047
812 Ga0268266_10000069 3300028379 Bacteria 239714
813 Ga0268266_10000103 3300028379 Bacteria 179736
814 Ga0268266_10023125 3300028379 Bacteria 5290
815 Ga0268266_10045715 3300028379 Bacteria 3746
816 Ga0268266_10102358 3300028379 Bacteria 2526
817 Ga0268266_10195921 3300028379 Bacteria 1847
818 Ga0268265_10000003 3300028380 Bacteria 949201
819 Ga0268265_10000030 3300028380 Bacteria 228157
820 Ga0268265_10000200 3300028380 Bacteria 69474
821 Ga0268265_10000241 3300028380 Bacteria 62423
822 Ga0268265_10000658 3300028380 Bacteria 34307
823 Ga0268265_10005390 3300028380 Bacteria 8757
824 Ga0268265_10027622 3300028380 Bacteria 4052
825 Ga0268265_10043759 3300028380 Bacteria 3330
826 Ga0268265_10079809 3300028380 Bacteria 2579
827 Ga0268264_10000010 3300028381 Bacteria 596543
828 Ga0268264_10000131 3300028381 Bacteria 181459
829 Ga0268264_10000144 3300028381 Bacteria 168841
830 Ga0268264_10000214 3300028381 Bacteria 114177
831 Ga0268264_10000253 3300028381 Bacteria 98587
832 Ga0268264_10002774 3300028381 Bacteria 15281
833 Ga0268264_10013314 3300028381 Bacteria 6771
834 Ga0268264_10034701 3300028381 Bacteria 4151
835 Ga0268264_10143682 3300028381 Bacteria 2131
836 Ga0307513_10012671 3300031456 Bacteria 10387
837 Ga0307408_100012406 3300031548 Bacteria 5644
838 Ga0307508_10003045 3300031616 Bacteria 17248
839 Ga0307405_10015599 3300031731 Bacteria 4120
840 Ga0307405_10048042 3300031731 Bacteria 2630
841 Ga0307413_10176223 3300031824 Bacteria 1519
842 Ga0307410_10006873 3300031852 Bacteria 6180
843 Ga0307410_10059150 3300031852 Bacteria 2615
844 Ga0307410_10084502 3300031852 Bacteria 2238
845 Ga0307406_10032775 3300031901 Bacteria 3174
846 Ga0307407_10017322 3300031903 Bacteria 3612
847 Ga0307412_10000217 3300031911 Bacteria 38437
848 Ga0307412_10007490 3300031911 Bacteria 6196
849 Ga0307412_10012573 3300031911 Bacteria 4940
850 Ga0307412_10013742 3300031911 Bacteria 4756
851 Ga0307412_10059194 3300031911 Bacteria 2566
852 Ga0307412_10081628 3300031911 Bacteria 2237
853 Ga0307409_100003300 3300031995 Bacteria 8720
854 Ga0307409_100027178 3300031995 Bacteria 4050
855 Ga0307409_100107167 3300031995 Bacteria 2334
856 Ga0307409_100110622 3300031995 Bacteria 2303
857 Ga0307416_100007655 3300032002 Bacteria 6892
858 Ga0307416_100046864 3300032002 Bacteria 3416
859 Ga0307416_100120207 3300032002 Bacteria 2339
860 Ga0307416_100239140 3300032002 Bacteria 1758
861 Ga0307414_10000102 3300032004 Bacteria 61667
862 Ga0307414_10007698 3300032004 Bacteria 6067
863 Ga0307414_10031959 3300032004 Bacteria 3459
864 Ga0307414_10167674 3300032004 Bacteria 1752
865 Ga0307411_10000842 3300032005 Bacteria 11511
866 Ga0307411_10011016 3300032005 Bacteria 4855
867 Ga0307411_10046178 3300032005 Bacteria 2806
868 Ga0307411_10083673 3300032005 Bacteria 2205
869 Ga0307415_100003371 3300032126 Bacteria 8123
870 Ga0307415_100004917 3300032126 Bacteria 7021
871 Ga0307510_10009544 3300033180 Bacteria 11562
872 Ga0373930_0004218 3300034816 Bacteria 2324
873 Ga0373939_0007681 3300035114 Bacteria 2625
874 Ga0373960_0012196 3300035121 Bacteria 2132
875 Ga0373942_0016069 3300035207 Bacteria 1833
876 Ga0373931_0014483 3300035691 Bacteria 3856
877 Ga0373937_0008621 3300036401 Bacteria 8857
878 Ga0395899_0001490 3300037312 Bacteria 19903
879 Ga0395899_0005334 3300037312 Bacteria 9982
880 Ga0395899_0028911 3300037312 Bacteria 4171
881 Ga0395899_0029112 3300037312 Bacteria 4153
882 Ga0395899_0052077 3300037312 Bacteria 3035
883 Ga0395900_0000136 3300037418 Bacteria 123664
884 Ga0395900_0001721 3300037418 Bacteria 25276
885 Ga0395900_0003476 3300037418 Bacteria 17008
886 Ga0395900_0013116 3300037418 Bacteria 8468
887 Ga0395900_0026754 3300037418 Bacteria 5903
888 Ga0395900_0044344 3300037418 Bacteria 4582
889 Ga0395900_0062533 3300037418 Bacteria 3827
890 Ga0395900_0081907 3300037418 Bacteria 3315
891 Ga0395900_0100225 3300037418 Bacteria 2975
892 Ga0395900_0117586 3300037418 Bacteria 2727
893 Ga0395900_0154726 3300037418 Bacteria 2342
894 Ga0395898_0009090 3300037466 Bacteria 10465
895 Ga0395898_0017511 3300037466 Bacteria 7316
896 Ga0395898_0027062 3300037466 Bacteria 5761
897 Ga0395898_0037746 3300037466 Bacteria 4790
898 Ga0395898_0084412 3300037466 Bacteria 3061
899 Ga0395905_0002287 3300037471 Bacteria 21496
900 Ga0395905_0002970 3300037471 Bacteria 18434
901 Ga0395905_0002973 3300037471 Bacteria 18422
902 Ga0395905_0005695 3300037471 Bacteria 12658
903 Ga0395905_0006096 3300037471 Bacteria 12180
904 Ga0395905_0006619 3300037471 Bacteria 11621
905 Ga0395905_0009873 3300037471 Bacteria 9303
906 Ga0395905_0018503 3300037471 Bacteria 6612
907 Ga0395905_0040376 3300037471 Bacteria 4377
908 Ga0395905_0093296 3300037471 Bacteria 2823
909 Ga0395905_0113025 3300037471 Bacteria 2551
910 Ga0395905_0116455 3300037471 Bacteria 2512
911 Ga0395905_0158865 3300037471 Bacteria 2125
912 Ga0436364_0380874 3300037853 Bacteria 90281
913 Ga0395901_0000030 3300038443 Bacteria 241916
914 Ga0395901_0000463 3300038443 Bacteria 47092
915 Ga0395901_0000671 3300038443 Bacteria 39338
916 Ga0395901_0001898 3300038443 Bacteria 21582
917 Ga0395901_0004293 3300038443 Bacteria 14380
918 Ga0395901_0008909 3300038443 Bacteria 10163
919 Ga0395901_0033722 3300038443 Bacteria 5286
920 Ga0395901_0039175 3300038443 Bacteria 4904
921 Ga0395901_0040232 3300038443 Bacteria 4842
922 Ga0395901_0119981 3300038443 Bacteria 2763
923 Ga0395901_0255415 3300038443 Bacteria 1825
924 Ga0237819_00608 3300038705 Bacteria 11820
925 Ga0436365_0010969 3300039437 Bacteria 175809
926 Ga0436365_0192103 3300039437 Bacteria 182879
927 Ga0436365_1252890 3300039437 Bacteria 2598
928 Ga0436363_1591101 3300039450 Bacteria 2747
929 Ga0436362_0544255 3300039453 Bacteria 20760
930 Ga0439439_0013802 3300041406 Bacteria 1960
931 Ga0439461_0000593 3300041410 Bacteria 5240
932 Ga0439465_0000607 3300041413 Bacteria 10860
933 Ga0439465_0001762 3300041413 Bacteria 7081
934 Ga0439431_0000029 3300041997 Bacteria 22226
935 Ga0439445_0000832 3300042004 Bacteria 6516
936 Ga0439445_0006296 3300042004 Bacteria 2726
937 Ga0439445_0022740 3300042004 Bacteria 1583
938 Ga0439448_0019649 3300042005 Bacteria 2082
939 Ga0439432_000209 3300042006 Bacteria 20859
940 Ga0439455_0015693 3300042012 Bacteria 1743
941 Ga0439458_0002738 3300042157 Bacteria 4246
942 Ga0439458_0004687 3300042157 Bacteria 3118
943 Ga0439434_0000160 3300042435 Bacteria 18106
944 Ga0466969_0008949 3300044656 Bacteria 5309
945 Ga0466969_0028040 3300044656 Bacteria 2880
946 Ga0466972_0072552 3300044658 Bacteria 1642
947 Ga0466966_0000027 3300044684 Bacteria 106520
948 Ga0466966_0000259 3300044684 Bacteria 35163
949 Ga0466966_0037307 3300044684 Bacteria 3135
950 Ga0466963_0000398 3300044694 Bacteria 19838
951 Ga0466963_0008394 3300044694 Bacteria 6187
952 Ga0466963_0009575 3300044694 Bacteria 5839
953 Ga0466963_0022760 3300044694 Bacteria 3972
954 Ga0466963_0056660 3300044694 Bacteria 2608
955 Ga0466963_0090925 3300044694 Bacteria 2078
956 Ga0466963_0184748 3300044694 Bacteria 1456
957 Ga0466971_0005272 3300044719 Bacteria 5603
958 Ga0466970_0005052 3300044765 Bacteria 6524
959 Ga0466970_0015833 3300044765 Bacteria 3882
960 Ga0466957_0000189 3300044842 Bacteria 28184
961 Ga0466957_0001989 3300044842 Bacteria 10883
962 Ga0466957_0002971 3300044842 Bacteria 9203
963 Ga0466957_0040988 3300044842 Bacteria 2799
964 Ga0466959_0061920 3300045049 Bacteria 2720
965 Ga0466959_0062783 3300045049 Bacteria 2699
966 Ga0466959_0065491 3300045049 Bacteria 2637
967 Ga0466959_0233400 3300045049 Bacteria 1273
968 Ga0451576_0000023 3300045051 Bacteria 477965
969 Ga0451576_0015993 3300045051 Bacteria 8294
970 Ga0466958_0004544 3300045836 Bacteria 7336
971 Ga0466958_0008674 3300045836 Bacteria 5644
972 Ga0466967_0000059 3300045976 Bacteria 40142
973 Ga0466967_0022648 3300045976 Bacteria 5132
974 Ga0466967_0028129 3300045976 Bacteria 4688
975 Ga0466967_0045200 3300045976 Bacteria 3825
976 Ga0466967_0050203 3300045976 Bacteria 3652
977 Ga0466967_0051476 3300045976 Bacteria 3609
978 Ga0466967_0080030 3300045976 Bacteria 2947
979 Ga0466967_0108787 3300045976 Bacteria 2544
980 Ga0495627_000153 3300046453 Bacteria 80825
981 Ga0495627_000197 3300046453 Bacteria 66158
982 Ga0495627_001254 3300046453 Bacteria 15689
983 Ga0495627_003860 3300046453 Bacteria 6432
984 Ga0495638_0000249 3300046460 Bacteria 73312
985 Ga0495638_0000344 3300046460 Bacteria 58565
986 Ga0495650_0000058 3300046471 Bacteria 302308
987 Ga0495650_0001171 3300046471 Bacteria 28029
988 Ga0495650_0005879 3300046471 Bacteria 7804
989 Ga0495650_0027305 3300046471 Bacteria 2640
990 Ga0495639_0076173 3300046475 Bacteria 1556
991 Ga0495596_0000074 3300046500 Bacteria 70574
992 Ga0495596_0002000 3300046500 Bacteria 11224
993 Ga0495607_0056108 3300046501 Bacteria 2262
994 Ga0495583_0000262 3300046506 Bacteria 86241
995 Ga0495583_0002572 3300046506 Bacteria 15258
996 Ga0495583_0012492 3300046506 Bacteria 4800
997 Ga0495583_0015069 3300046506 Bacteria 4225
998 Ga0495583_0067603 3300046506 Bacteria 1578
999 Ga0495606_0004804 3300046507 Bacteria 13281
1000 Ga0495606_0134288 3300046507 Bacteria 1467
1001 Ga0495610_0000020 3300046512 Bacteria 344007
1002 Ga0495610_0000071 3300046512 Bacteria 121210
1003 Ga0495616_0005044 3300046513 Bacteria 8215
1004 Ga0495616_0023551 3300046513 Bacteria 3311
1005 Ga0495632_0000328 3300046519 Bacteria 45623
1006 Ga0495632_0000445 3300046519 Bacteria 39318
1007 Ga0495632_0004828 3300046519 Bacteria 9055
1008 Ga0495637_0009479 3300046520 Bacteria 4746
1009 Ga0495643_0000014 3300046522 Bacteria 314632
1010 Ga0495643_0004377 3300046522 Bacteria 9900
1011 Ga0495643_0037651 3300046522 Bacteria 2651
1012 Ga0495643_0109563 3300046522 Bacteria 1405
1013 Ga0495648_0000015 3300046524 Bacteria 285838
1014 Ga0495648_0000166 3300046524 Bacteria 77879
1015 Ga0495648_0060044 3300046524 Bacteria 2265
1016 Ga0495648_0076891 3300046524 Bacteria 1915
1017 Ga0495663_0000007 3300046525 Bacteria 262438
1018 Ga0495663_0012666 3300046525 Bacteria 2352
1019 Ga0495642_0012012 3300046528 Bacteria 3337
1020 Ga0495654_0003443 3300046530 Bacteria 9688
1021 Ga0495621_0000041 3300046539 Bacteria 25070
1022 Ga0495621_0005284 3300046539 Bacteria 3699
1023 Ga0495597_0042592 3300046542 Bacteria 2024
1024 Ga0495622_0043090 3300046557 Bacteria 2098
1025 Ga0495633_0000398 3300046558 Bacteria 45509
1026 Ga0495633_0000429 3300046558 Bacteria 43661
1027 Ga0495633_0000803 3300046558 Bacteria 28051
1028 Ga0495633_0005142 3300046558 Bacteria 8105
1029 Ga0495668_0000001 3300046616 Bacteria 1013420
1030 Ga0495668_0000261 3300046616 Bacteria 74577
1031 Ga0495668_0011572 3300046616 Bacteria 5276
1032 Ga0495668_0015552 3300046616 Bacteria 4440
1033 Ga0495668_0019004 3300046616 Bacteria 3966
1034 Ga0495668_0034522 3300046616 Bacteria 2837
1035 Ga0495625_0000910 3300046660 Bacteria 39828
1036 Ga0495625_0001272 3300046660 Bacteria 31687
1037 Ga0495625_0011447 3300046660 Bacteria 7235
1038 Ga0495625_0070314 3300046660 Bacteria 2457
1039 Ga0495625_0113288 3300046660 Bacteria 1852
1040 Ga0495661_0054521 3300046665 Bacteria 2400
1041 Ga0495623_0026785 3300046679 Bacteria 3710
1042 Ga0495669_0000144 3300046684 Bacteria 45112
1043 Ga0495669_0001308 3300046684 Bacteria 10308
1044 Ga0495669_0001742 3300046684 Bacteria 8912
1045 Ga0495669_0015219 3300046684 Bacteria 3293
1046 Ga0495669_0016219 3300046684 Bacteria 3190
1047 Ga0495669_0018311 3300046684 Bacteria 3010
1048 Ga0495670_0000004 3300046691 Bacteria 310086
1049 Ga0495670_0004174 3300046691 Bacteria 7078
1050 Ga0495670_0015429 3300046691 Bacteria 3754
1051 Ga0495670_0074160 3300046691 Bacteria 1726
1052 Ga0495671_0000032 3300046692 Bacteria 201185
1053 Ga0495671_0000084 3300046692 Bacteria 89406
1054 Ga0495600_0000496 3300046809 Bacteria 20357
1055 Ga0495687_006553 3300047443 Bacteria 7103
1056 Ga0495687_007272 3300047443 Bacteria 6566
1057 Ga0495677_0004180 3300047445 Bacteria 5566
1058 Ga0495673_0000206 3300047469 Bacteria 89432
1059 Ga0495673_0013796 3300047469 Bacteria 4224
1060 Ga0495681_0000008 3300047470 Bacteria 215295
1061 Ga0495681_0000123 3300047470 Bacteria 68069
1062 Ga0495681_0012624 3300047470 Bacteria 4951
1063 Ga0495681_0035421 3300047470 Bacteria 2478
1064 Ga0495686_0000979 3300047472 Bacteria 35004
1065 Ga0495686_0005860 3300047472 Bacteria 9577
1066 Ga0495686_0010637 3300047472 Bacteria 6533
1067 Ga0495686_0012221 3300047472 Bacteria 6013
1068 Ga0495686_0012769 3300047472 Bacteria 5859
1069 Ga0495686_0033576 3300047472 Bacteria 3312
1070 Ga0495686_0035797 3300047472 Bacteria 3188
1071 Ga0495602_0004784 3300048088 Bacteria 14153
1072 Ga0495615_0000138 3300048090 Bacteria 18315
1073 Ga0495626_0002682 3300048091 Bacteria 12023
1074 Ga0496102_0000120 3300048905 Bacteria 112432
1075 Ga0496102_0000162 3300048905 Bacteria 89746
1076 Ga0496102_0003256 3300048905 Bacteria 13777
1077 Ga0496102_0018907 3300048905 Bacteria 6062
1078 Ga0496102_0045935 3300048905 Bacteria 3965
1079 Ga0496102_0071574 3300048905 Bacteria 3184
1080 Ga0496102_0145956 3300048905 Bacteria 2221
1081 Ga0496103_0000154 3300048906 Bacteria 72239
1082 Ga0496103_0000186 3300048906 Bacteria 62771
1083 Ga0496103_0000190 3300048906 Bacteria 61731
1084 Ga0496103_0005969 3300048906 Bacteria 7284
1085 Ga0496103_0065693 3300048906 Bacteria 2263
1086 Ga0496104_0005413 3300048907 Bacteria 11171
1087 Ga0496104_0007512 3300048907 Bacteria 9636
1088 Ga0496105_0000395 3300048908 Bacteria 28676
1089 Ga0496105_0014021 3300048908 Bacteria 6376
1090 Ga0496105_0014368 3300048908 Bacteria 6300
1091 Ga0496106_0052474 3300048909 Bacteria 3076
1092 Ga0496107_0000238 3300048910 Bacteria 28814
1093 Ga0496108_0002936 3300048911 Bacteria 13709
1094 Ga0496108_0011426 3300048911 Bacteria 7217
1095 Ga0496108_0023201 3300048911 Bacteria 5104
1096 Ga0496108_0039064 3300048911 Bacteria 3956
1097 Ga0496108_0089350 3300048911 Bacteria 2618
1098 Ga0496108_0114302 3300048911 Bacteria 2311
1099 Ga0496109_0022332 3300048912 Bacteria 5603
1100 Ga0496109_0030464 3300048912 Bacteria 4835
1101 Ga0496109_0077484 3300048912 Bacteria 3059
1102 Ga0496110_0025382 3300048913 Bacteria 5063
1103 Ga0496110_0029045 3300048913 Bacteria 4754
1104 Ga0496110_0038030 3300048913 Bacteria 4185
1105 Ga0496110_0081696 3300048913 Bacteria 2881
1106 Ga0496110_0104060 3300048913 Bacteria 2547
1107 Ga0496110_0125578 3300048913 Bacteria 2315
1108 Ga0496111_0014013 3300048914 Bacteria 5467
1109 Ga0496111_0030567 3300048914 Bacteria 3831
1110 Ga0496111_0086901 3300048914 Bacteria 2288
1111 Ga0496112_0001644 3300048915 Bacteria 17341
1112 Ga0496112_0004154 3300048915 Bacteria 12193
1113 Ga0496112_0008627 3300048915 Bacteria 9138
1114 Ga0496112_0016901 3300048915 Bacteria 6846
1115 Ga0496112_0045063 3300048915 Bacteria 4323
1116 Ga0496113_0000233 3300048916 Bacteria 26178
1117 Ga0496113_0013272 3300048916 Bacteria 5575
1118 Ga0496113_0014181 3300048916 Bacteria 5428
1119 Ga0496113_0026484 3300048916 Bacteria 4146
1120 Ga0496113_0030649 3300048916 Bacteria 3895
1121 Ga0496114_0005866 3300048917 Bacteria 9649
1122 Ga0496114_0018497 3300048917 Bacteria 5635
1123 Ga0496115_0000354 3300048918 Bacteria 38566
1124 Ga0496115_0000744 3300048918 Bacteria 24046
1125 Ga0496115_0097680 3300048918 Bacteria 2405
1126 Ga0496116_0003722 3300048919 Bacteria 14913
1127 Ga0496116_0016544 3300048919 Bacteria 5765
1128 Ga0496116_0079436 3300048919 Bacteria 2041
1129 Ga0496116_0085600 3300048919 Bacteria 1937
1130 Ga0496117_0000317 3300048920 Bacteria 84472
1131 Ga0496117_0000323 3300048920 Bacteria 83916
1132 Ga0496117_0000977 3300048920 Bacteria 43773
1133 Ga0496117_0019977 3300048920 Bacteria 5479
1134 Ga0496117_0033768 3300048920 Bacteria 3864
1135 Ga0496117_0048265 3300048920 Bacteria 3043
1136 Ga0496118_0000144 3300048921 Bacteria 124411
1137 Ga0496118_0000303 3300048921 Bacteria 85332
1138 Ga0496118_0001203 3300048921 Bacteria 39844
1139 Ga0496118_0001409 3300048921 Bacteria 36243
1140 Ga0496118_0003389 3300048921 Bacteria 20144
1141 Ga0496118_0018978 3300048921 Bacteria 6165
1142 Ga0496118_0049835 3300048921 Bacteria 3220
1143 Ga0496118_0161284 3300048921 Bacteria 1386
1144 Ga0496119_0005020 3300048922 Bacteria 12894
1145 Ga0496119_0013696 3300048922 Bacteria 6432
1146 Ga0496119_0036846 3300048922 Bacteria 3186
1147 Ga0496120_0005113 3300048923 Bacteria 10605
1148 Ga0496120_0075082 3300048923 Bacteria 1846
1149 Ga0496121_0000070 3300048924 Bacteria 249187
1150 Ga0496121_0000136 3300048924 Bacteria 165350
1151 Ga0496121_0000977 3300048924 Bacteria 51197
1152 Ga0496121_0005366 3300048924 Bacteria 16475
1153 Ga0496121_0014401 3300048924 Bacteria 8395
1154 Ga0496121_0020344 3300048924 Bacteria 6578
1155 Ga0496121_0030180 3300048924 Bacteria 4986
1156 Ga0496121_0040745 3300048924 Bacteria 4070
1157 Ga0496122_0001715 3300048925 Bacteria 34006
1158 Ga0496122_0002251 3300048925 Bacteria 27964
1159 Ga0496122_0006376 3300048925 Bacteria 13569
1160 Ga0496122_0007052 3300048925 Bacteria 12633
1161 Ga0496122_0019822 3300048925 Bacteria 6122
1162 Ga0496123_0000518 3300048926 Bacteria 67308
1163 Ga0496123_0002605 3300048926 Bacteria 21912
1164 Ga0496123_0007112 3300048926 Bacteria 10629
1165 Ga0496123_0095459 3300048926 Bacteria 1749
1166 Ga0496124_0000177 3300048927 Bacteria 128355
1167 Ga0496124_0000214 3300048927 Bacteria 113007
1168 Ga0496124_0001292 3300048927 Bacteria 38002
1169 Ga0496124_0001555 3300048927 Bacteria 33169
1170 Ga0496124_0005357 3300048927 Bacteria 14482
1171 Ga0496124_0007025 3300048927 Bacteria 12060
1172 Ga0496124_0031410 3300048927 Bacteria 4701
1173 Ga0496124_0041353 3300048927 Bacteria 3978
1174 Ga0496124_0052536 3300048927 Bacteria 3461
1175 Ga0496124_0100741 3300048927 Bacteria 2341
1176 Ga0496124_0220131 3300048927 Bacteria 1428
1177 Ga0496125_0000335 3300048928 Bacteria 90043
1178 Ga0496125_0000336 3300048928 Bacteria 89942
1179 Ga0496125_0003763 3300048928 Bacteria 18060
1180 Ga0496125_0010661 3300048928 Bacteria 9278
1181 Ga0496125_0128682 3300048928 Bacteria 1788
1182 Ga0496126_0000044 3300048929 Bacteria 335904
1183 Ga0496126_0000505 3300048929 Bacteria 76567
1184 Ga0496126_0021123 3300048929 Bacteria 6366
1185 Ga0501292_005333 3300049515 Bacteria 1790
1186 Ga0501314_001129 3300049530 Bacteria 1868
1187 Ga0501032_0047162 3300049569 Bacteria 2910
1188 Ga0501033_0010863 3300049570 Bacteria 6980
1189 Ga0501034_0114666 3300049571 Bacteria 2683
1190 Ga0501038_0015524 3300049574 Bacteria 6923
1191 Ga0501043_0048111 3300049579 Bacteria 3353
1192 Ga0501047_0014003 3300049581 Bacteria 7622
1193 Ga0501047_0127533 3300049581 Bacteria 2425
1194 Ga0501067_0051532 3300049583 Bacteria 2281
1195 Ga0501223_000531 3300049663 Bacteria 9182
1196 Ga0501224_000012 3300049664 Bacteria 92585
1197 Ga0501233_000809 3300049668 Bacteria 5246
1198 Ga0501235_006351 3300049669 Bacteria 2573
1199 Ga0501249_011424 3300049679 Bacteria 1864
1200 Ga0501249_011750 3300049679 Bacteria 1842
1201 Ga0501257_000506 3300049686 Bacteria 7747
1202 Ga0501225_0000035 3300049705 Bacteria 46375
1203 Ga0501225_0000079 3300049705 Bacteria 30869
1204 Ga0501225_0003012 3300049705 Bacteria 5146
1205 Ga0501234_002015 3300049707 Bacteria 3207
1206 Ga0501241_008291 3300049758 Bacteria 1898
1207 Ga0501280_003413 3300049776 Bacteria 2445
1208 Ga0501044_0016890 3300049823 Bacteria 7831
1209 Ga0501044_0037270 3300049823 Bacteria 5083
1210 Ga0501044_0049714 3300049823 Bacteria 4328
1211 Ga0501226_000091 3300049853 Bacteria 23656
1212 nmdc:mga0k408_23313_c1 3300050493 Bacteria 3489
1213 nmdc:mga06z11_280_c1 3300050494 Bacteria 19957
1214 nmdc:mga04h51_176_c1 3300050495 Bacteria 18091
1215 nmdc:mga05p37_446868_c1 3300050507 Bacteria 1497
1216 Ga0500610_0000163 3300053079 Bacteria 19889
1217 Ga0500643_000050 3300053087 Bacteria 147005
1218 Ga0500643_000767 3300053087 Bacteria 20946
1219 Ga0500643_001021 3300053087 Bacteria 17039
1220 Ga0500643_002098 3300053087 Bacteria 10611
1221 Ga0500643_002654 3300053087 Bacteria 9025
1222 Ga0500643_003471 3300053087 Bacteria 7583
1223 Ga0500643_007566 3300053087 Bacteria 4358
1224 Ga0500643_008642 3300053087 Bacteria 3984
1225 Ga0500643_014021 3300053087 Bacteria 2804
1226 Ga0500644_0048128 3300053088 Bacteria 1450
1227 Ga0500566_0003363 3300053094 Bacteria 9550
1228 Ga0500641_0017037 3300053096 Bacteria 2711
1229 Ga0500641_0047033 3300053096 Bacteria 1763
1230 Ga0500556_0000049 3300053104 Bacteria 122572
1231 Ga0500556_0008568 3300053104 Bacteria 2954
1232 Ga0500592_000053 3300053116 Bacteria 34136
1233 Ga0500592_000166 3300053116 Bacteria 13275
1234 Ga0500592_003257 3300053116 Bacteria 2589
1235 Ga0500595_000516 3300053119 Bacteria 23303
1236 Ga0500595_001738 3300053119 Bacteria 11365
1237 Ga0500597_019710 3300053120 Bacteria 2636
1238 Ga0500608_015045 3300053122 Bacteria 3467
1239 Ga0500618_002319 3300053125 Bacteria 7305
1240 Ga0500618_002424 3300053125 Bacteria 7070
1241 Ga0500642_0000002 3300053130 Bacteria 795093
1242 Ga0500642_0002812 3300053130 Bacteria 5165
1243 Ga0500642_0005484 3300053130 Bacteria 4095
1244 Ga0500655_000103 3300053133 Bacteria 21718
1245 Ga0500658_0001066 3300053134 Bacteria 11224
1246 Ga0500658_0003575 3300053134 Bacteria 5868
1247 Ga0500658_0016765 3300053134 Bacteria 2731
1248 Ga0500559_0009931 3300053136 Bacteria 4100
1249 Ga0500559_0011560 3300053136 Bacteria 3770
1250 Ga0500559_0012178 3300053136 Bacteria 3661
1251 Ga0500559_0018002 3300053136 Bacteria 2986
1252 Ga0500568_0047815 3300053139 Bacteria 1693
1253 Ga0500573_0000061 3300053140 Bacteria 67535
1254 Ga0500573_0075996 3300053140 Bacteria 1912
1255 Ga0500590_000032 3300053148 Bacteria 34068
1256 Ga0500604_0005801 3300053151 Bacteria 3263
1257 Ga0500616_0007347 3300053153 Bacteria 7022
1258 Ga0500616_0012043 3300053153 Bacteria 5076
1259 Ga0500622_0007913 3300053156 Bacteria 5984
1260 Ga0500622_0130236 3300053156 Bacteria 1210
1261 Ga0500624_000001 3300053157 Bacteria 284974
1262 Ga0500624_000045 3300053157 Bacteria 89838
1263 Ga0500624_000052 3300053157 Bacteria 74126
1264 Ga0500627_0000005 3300053158 Bacteria 167950
1265 Ga0500627_0000451 3300053158 Bacteria 11144
1266 Ga0500627_0000994 3300053158 Bacteria 7709
1267 Ga0500627_0001095 3300053158 Bacteria 7404
1268 Ga0500639_048669 3300053163 Bacteria 2213
1269 Ga0500636_0001875 3300053177 Bacteria 11512
1270 Ga0500636_0002215 3300053177 Bacteria 10763
1271 Ga0500637_0000010 3300053178 Bacteria 81649
1272 Ga0500570_000646 3300053724 Bacteria 14095
1273 Ga0500645_000692 3300053730 Bacteria 20960
1274 Ga0500645_002262 3300053730 Bacteria 8752
1275 Ga0500645_002467 3300053730 Bacteria 8211
1276 Ga0500645_035275 3300053730 Bacteria 1491
1277 Ga0500596_001842 3300053735 Bacteria 4258
1278 Ga0466962_0006671 3300061719 Bacteria 5538

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049583 Ga0501067_0051532 Ga0501067_0051532_1224_2267 323
2 3300045976 Ga0466967_0028129 Ga0466967_0028129_17_1123 335
3 3300048926 Ga0496123_0095459 Ga0496123_0095459_10_1056 338
4 3300033180 Ga0307510_10009544 Ga0307510_100095448 341
5 3300053087 Ga0500643_002654 Ga0500643_002654_3743_4993 341
6 3300005353 Ga0070669_100020753 Ga0070669_1000207535 346
7 3300005364 Ga0070673_100043201 Ga0070673_1000432013 346
8 3300005366 Ga0070659_100006675 Ga0070659_1000066752 348
9 3300025919 Ga0207657_10000084 Ga0207657_1000008447 348
10 3300025932 Ga0207690_10003515 Ga0207690_100035157 348
11 3300005327 Ga0070658_10000001 Ga0070658_1000000154 349
12 3300025909 Ga0207705_10000002 Ga0207705_100000021825 349
13 3300026041 Ga0207639_10224704 Ga0207639_102247041 349
14 3300049515 Ga0501292_005333 Ga0501292_005333_153_1352 351
15 3300005327 Ga0070658_10012865 Ga0070658_100128654 352
16 3300005331 Ga0070670_100170553 Ga0070670_1001705532 352
17 3300005355 Ga0070671_100015333 Ga0070671_1000153333 352
18 3300005364 Ga0070673_100024106 Ga0070673_1000241065 352
19 3300005616 Ga0068852_100157997 Ga0068852_1001579972 352
20 3300005834 Ga0068851_10060228 Ga0068851_100602282 352
21 3300025909 Ga0207705_10057909 Ga0207705_100579093 352
22 3300025925 Ga0207650_10149039 Ga0207650_101490391 352
23 3300025931 Ga0207644_10065548 Ga0207644_100655483 352
24 3300025960 Ga0207651_10145648 Ga0207651_101456482 352
25 3300026142 Ga0207698_10151311 Ga0207698_101513112 352
26 3300048911 Ga0496108_0011426 Ga0496108_0011426_342_1592 352
27 3300005290 Ga0065712_10099620 Ga0065712_100996202 354
28 3300005293 Ga0065715_10127491 Ga0065715_101274912 354
29 3300005327 Ga0070658_10070785 Ga0070658_100707853 354
30 3300005331 Ga0070670_100000600 Ga0070670_10000060010 354
31 3300005333 Ga0070677_10005209 Ga0070677_100052092 354
32 3300005344 Ga0070661_100150851 Ga0070661_1001508512 354
33 3300005354 Ga0070675_100004368 Ga0070675_1000043683 354
34 3300005355 Ga0070671_100000190 Ga0070671_10000019039 354
35 3300005367 Ga0070667_100038971 Ga0070667_1000389712 354
36 3300005456 Ga0070678_100043903 Ga0070678_1000439032 354
37 3300005564 Ga0070664_100001240 Ga0070664_1000012408 354
38 3300009177 Ga0105248_10003624 Ga0105248_1000362423 354
39 3300025920 Ga0207649_10121916 Ga0207649_101219162 354
40 3300025926 Ga0207659_10014449 Ga0207659_100144493 354
41 3300025931 Ga0207644_10073598 Ga0207644_100735982 354
42 3300025933 Ga0207706_10048827 Ga0207706_100488272 354
43 3300025937 Ga0207669_10019815 Ga0207669_100198152 354
44 3300025941 Ga0207711_10026699 Ga0207711_100266992 354
45 3300025945 Ga0207679_10004430 Ga0207679_100044302 354
46 3300025986 Ga0207658_10038878 Ga0207658_100388782 354
47 3300026121 Ga0207683_10071022 Ga0207683_100710222 354
48 3300028379 Ga0268266_10102358 Ga0268266_101023582 354
49 3300046684 Ga0495669_0001308 Ga0495669_0001308_6298_7548 354
50 3300048916 Ga0496113_0026484 Ga0496113_0026484_626_1876 354
51 3300042157 Ga0439458_0002738 Ga0439458_0002738_161_1411 356
52 3300005543 Ga0070672_100025228 Ga0070672_1000252282 357
53 3300017792 Ga0163161_10023162 Ga0163161_100231622 357
54 3300025940 Ga0207691_10002713 Ga0207691_100027135 357
55 3300053140 Ga0500573_0000061 Ga0500573_0000061_32622_33872 358
56 3300005327 Ga0070658_10008733 Ga0070658_100087332 359
57 3300005530 Ga0070679_100044316 Ga0070679_1000443162 359
58 3300025909 Ga0207705_10002067 Ga0207705_100020677 359
59 3300025909 Ga0207705_10003616 Ga0207705_100036163 359
60 3300025919 Ga0207657_10005965 Ga0207657_100059659 359
61 3300025921 Ga0207652_10018385 Ga0207652_100183853 359
62 3300049776 Ga0501280_003413 Ga0501280_003413_1320_2435 359
63 3300044658 Ga0466972_0072552 Ga0466972_0072552_406_1632 361
64 3300053156 Ga0500622_0130236 Ga0500622_0130236_11_1126 361
65 3300005327 Ga0070658_10141249 Ga0070658_101412492 364
66 3300005616 Ga0068852_100000812 Ga0068852_10000081216 364
67 3300013102 Ga0157371_10012041 Ga0157371_100120414 364
68 3300013105 Ga0157369_10020312 Ga0157369_100203127 364
69 3300013307 Ga0157372_10050512 Ga0157372_100505122 364
70 3300025920 Ga0207649_10132215 Ga0207649_101322152 364
71 3300025949 Ga0207667_10004698 Ga0207667_100046987 364
72 3300026078 Ga0207702_10012218 Ga0207702_100122187 364
73 3300026142 Ga0207698_10006765 Ga0207698_100067654 364
74 3300053136 Ga0500559_0011560 Ga0500559_0011560_416_1663 364
75 3300005327 Ga0070658_10031926 Ga0070658_100319262 365
76 3300005344 Ga0070661_100047745 Ga0070661_1000477453 365
77 3300005539 Ga0068853_100209539 Ga0068853_1002095392 365
78 3300005614 Ga0068856_100046594 Ga0068856_1000465946 365
79 3300006237 Ga0097621_100064043 Ga0097621_1000640432 365
80 3300009177 Ga0105248_10064610 Ga0105248_100646103 365
81 3300013306 Ga0163162_10123473 Ga0163162_101234732 365
82 3300013308 Ga0157375_10233883 Ga0157375_102338832 365
83 3300025941 Ga0207711_10040191 Ga0207711_100401912 365
84 3300026041 Ga0207639_10186214 Ga0207639_101862142 365
85 3300026067 Ga0207678_10218833 Ga0207678_102188332 365
86 3300048917 Ga0496114_0005866 Ga0496114_0005866_5270_6520 365
87 3300005548 Ga0070665_100000075 Ga0070665_100000075187 366
88 3300013307 Ga0157372_10088171 Ga0157372_100881712 366
89 3300028379 Ga0268266_10000103 Ga0268266_1000010348 366
90 3300031731 Ga0307405_10015599 Ga0307405_100155992 366
91 3300031901 Ga0307406_10032775 Ga0307406_100327754 366
92 3300031903 Ga0307407_10017322 Ga0307407_100173223 366
93 3300031995 Ga0307409_100027178 Ga0307409_1000271785 366
94 3300032126 Ga0307415_100003371 Ga0307415_1000033715 366
95 3300046507 Ga0495606_0004804 Ga0495606_0004804_7559_8818 366
96 3300046616 Ga0495668_0019004 Ga0495668_0019004_2676_3926 366
97 3300046684 Ga0495669_0015219 Ga0495669_0015219_866_2116 366
98 3300046684 Ga0495669_0018311 Ga0495669_0018311_595_1845 366
99 3300053177 Ga0500636_0001875 Ga0500636_0001875_5944_7203 366
100 3300005834 Ga0068851_10023723 Ga0068851_100237233 367
101 3300021384 Ga0213876_10000120 Ga0213876_1000012028 367
102 3300025321 Ga0207656_10024257 Ga0207656_100242573 367
103 3300025909 Ga0207705_10000246 Ga0207705_1000024643 367
104 3300025949 Ga0207667_10000010 Ga0207667_10000010166 367
105 3300026041 Ga0207639_10000489 Ga0207639_1000048927 367
106 3300039437 Ga0436365_0010969 Ga0436365_0010969_111091_112341 367
107 3300039437 Ga0436365_1252890 Ga0436365_1252890_1288_2574 367
108 3300045049 Ga0466959_0233400 Ga0466959_0233400_31_1257 367
109 3300046471 Ga0495650_0027305 Ga0495650_0027305_530_1759 367
110 3300005345 Ga0070692_10000276 Ga0070692_100002762 368
111 3300048911 Ga0496108_0023201 Ga0496108_0023201_3675_4925 368
112 3300049679 Ga0501249_011750 Ga0501249_011750_511_1761 368
113 3300053136 Ga0500559_0009931 Ga0500559_0009931_790_2037 368
114 3300005336 Ga0070680_100003659 Ga0070680_1000036596 369
115 3300005548 Ga0070665_100000458 Ga0070665_10000045825 369
116 3300005578 Ga0068854_100033126 Ga0068854_1000331262 369
117 3300009093 Ga0105240_10021491 Ga0105240_100214917 369
118 3300009551 Ga0105238_10088855 Ga0105238_100888553 369
119 3300013104 Ga0157370_10047005 Ga0157370_100470053 369
120 3300013105 Ga0157369_10262020 Ga0157369_102620202 369
121 3300025304 Ga0209257_1024324 Ga0209257_10243242 369
122 3300025913 Ga0207695_10061440 Ga0207695_100614402 369
123 3300025917 Ga0207660_10005643 Ga0207660_100056439 369
124 3300025949 Ga0207667_10015113 Ga0207667_100151138 369
125 3300025981 Ga0207640_10006896 Ga0207640_100068968 369
126 3300026142 Ga0207698_10002005 Ga0207698_100020058 369
127 3300028379 Ga0268266_10000002 Ga0268266_100000022224 369
128 3300031852 Ga0307410_10006873 Ga0307410_100068732 371
129 3300031911 Ga0307412_10012573 Ga0307412_100125732 371
130 3300031995 Ga0307409_100003300 Ga0307409_10000330010 371
131 3300032005 Ga0307411_10000842 Ga0307411_100008425 371
132 3300044656 Ga0466969_0028040 Ga0466969_0028040_1077_2327 371
133 3300044684 Ga0466966_0037307 Ga0466966_0037307_245_1495 371
134 3300045049 Ga0466959_0065491 Ga0466959_0065491_689_1939 371
135 3300047472 Ga0495686_0012221 Ga0495686_0012221_4515_5762 371
136 3300013105 Ga0157369_10007448 Ga0157369_100074484 372
137 3300013307 Ga0157372_10443442 Ga0157372_104434421 372
138 3300049570 Ga0501033_0010863 Ga0501033_0010863_706_1956 372
139 3300049823 Ga0501044_0037270 Ga0501044_0037270_81_1331 372
140 3300003781 Ga0055536_1006170 Ga0055536_10061703 373
141 3300005344 Ga0070661_100000001 Ga0070661_10000000125 373
142 3300005548 Ga0070665_100040311 Ga0070665_1000403111 373
143 3300025292 Ga0209676_1000276 Ga0209676_10002763 373
144 3300025304 Ga0209257_1006680 Ga0209257_10066805 373
145 3300025920 Ga0207649_10000018 Ga0207649_1000001850 373
146 3300028379 Ga0268266_10045715 Ga0268266_100457155 373
147 3300032004 Ga0307414_10031959 Ga0307414_100319593 373
148 3300046539 Ga0495621_0000041 Ga0495621_0000041_5047_6297 373
149 3300046558 Ga0495633_0000803 Ga0495633_0000803_21656_22906 373
150 3300046684 Ga0495669_0001742 Ga0495669_0001742_5694_6944 373
151 3300046691 Ga0495670_0004174 Ga0495670_0004174_1205_2455 373
152 3300001979 JGI24740J21852_10023035 JGI24740J21852_100230352 374
153 3300003781 Ga0055536_1010031 Ga0055536_10100313 374
154 3300003781 Ga0055536_1015014 Ga0055536_10150142 374
155 3300003791 Ga0055530_10000095 Ga0055530_1000009524 374
156 3300003794 Ga0055531_10000671 Ga0055531_100006713 374
157 3300005327 Ga0070658_10119049 Ga0070658_101190492 374
158 3300005329 Ga0070683_100040226 Ga0070683_1000402265 374
159 3300005336 Ga0070680_100001216 Ga0070680_1000012164 374
160 3300005336 Ga0070680_100003741 Ga0070680_1000037411 374
161 3300005339 Ga0070660_100005756 Ga0070660_1000057565 374
162 3300005339 Ga0070660_100026476 Ga0070660_1000264764 374
163 3300005355 Ga0070671_100000113 Ga0070671_10000011356 374
164 3300005355 Ga0070671_100000327 Ga0070671_10000032730 374
165 3300005355 Ga0070671_100030067 Ga0070671_1000300674 374
166 3300005364 Ga0070673_100070226 Ga0070673_1000702262 374
167 3300005530 Ga0070679_100000017 Ga0070679_10000001753 374
168 3300005530 Ga0070679_100071379 Ga0070679_1000713793 374
169 3300005535 Ga0070684_100243422 Ga0070684_1002434222 374
170 3300005563 Ga0068855_100069282 Ga0068855_1000692823 374
171 3300005563 Ga0068855_100153996 Ga0068855_1001539963 374
172 3300005618 Ga0068864_100096314 Ga0068864_1000963142 374
173 3300009177 Ga0105248_10000135 Ga0105248_100001353 374
174 3300009177 Ga0105248_10000425 Ga0105248_1000042553 374
175 3300013104 Ga0157370_10008771 Ga0157370_1000877111 374
176 3300013105 Ga0157369_10000298 Ga0157369_1000029847 374
177 3300013105 Ga0157369_10419569 Ga0157369_104195692 374
178 3300021358 Ga0213873_10000009 Ga0213873_1000000919 374
179 3300021384 Ga0213876_10000004 Ga0213876_10000004298 374
180 3300025291 Ga0209675_1000025 Ga0209675_100002583 374
181 3300025292 Ga0209676_1000362 Ga0209676_100036224 374
182 3300025292 Ga0209676_1000453 Ga0209676_100045358 374
183 3300025298 Ga0209050_1000728 Ga0209050_100072820 374
184 3300025298 Ga0209050_1000929 Ga0209050_100092913 374
185 3300025298 Ga0209050_1001953 Ga0209050_10019534 374
186 3300025304 Ga0209257_1000487 Ga0209257_100048747 374
187 3300025304 Ga0209257_1000596 Ga0209257_100059634 374
188 3300025904 Ga0207647_10007344 Ga0207647_100073442 374
189 3300025909 Ga0207705_10005919 Ga0207705_100059195 374
190 3300025917 Ga0207660_10002754 Ga0207660_100027547 374
191 3300025919 Ga0207657_10001100 Ga0207657_100011005 374
192 3300025921 Ga0207652_10000001 Ga0207652_10000001903 374
193 3300025921 Ga0207652_10001258 Ga0207652_100012583 374
194 3300025931 Ga0207644_10005036 Ga0207644_1000503611 374
195 3300025931 Ga0207644_10005640 Ga0207644_100056408 374
196 3300025941 Ga0207711_10006861 Ga0207711_100068612 374
197 3300025941 Ga0207711_10011008 Ga0207711_100110085 374
198 3300025945 Ga0207679_10164329 Ga0207679_101643292 374
199 3300025949 Ga0207667_10050876 Ga0207667_100508764 374
200 3300025981 Ga0207640_10072150 Ga0207640_100721503 374
201 3300026067 Ga0207678_10030297 Ga0207678_100302972 374
202 3300026067 Ga0207678_10118931 Ga0207678_101189312 374
203 3300026095 Ga0207676_10081953 Ga0207676_100819532 374
204 3300026142 Ga0207698_10003274 Ga0207698_100032744 374
205 3300028381 Ga0268264_10034701 Ga0268264_100347013 374
206 3300031911 Ga0307412_10059194 Ga0307412_100591941 374
207 3300036401 Ga0373937_0008621 Ga0373937_0008621_6085_7335 374
208 3300037312 Ga0395899_0029112 Ga0395899_0029112_2130_3380 374
209 3300037418 Ga0395900_0003476 Ga0395900_0003476_12226_13476 374
210 3300037418 Ga0395900_0044344 Ga0395900_0044344_3126_4376 374
211 3300037466 Ga0395898_0009090 Ga0395898_0009090_8441_9691 374
212 3300037471 Ga0395905_0005695 Ga0395905_0005695_761_2011 374
213 3300037471 Ga0395905_0006619 Ga0395905_0006619_9078_10328 374
214 3300038443 Ga0395901_0000671 Ga0395901_0000671_30064_31314 374
215 3300038443 Ga0395901_0001898 Ga0395901_0001898_11374_12624 374
216 3300038443 Ga0395901_0004293 Ga0395901_0004293_4358_5608 374
217 3300039437 Ga0436365_0192103 Ga0436365_0192103_158093_159343 374
218 3300039453 Ga0436362_0544255 Ga0436362_0544255_4133_5383 374
219 3300044842 Ga0466957_0040988 Ga0466957_0040988_581_1828 374
220 3300046453 Ga0495627_000197 Ga0495627_000197_49696_50895 374
221 3300046471 Ga0495650_0001171 Ga0495650_0001171_15282_16481 374
222 3300046500 Ga0495596_0002000 Ga0495596_0002000_8634_9833 374
223 3300046512 Ga0495610_0000020 Ga0495610_0000020_6781_8022 374
224 3300046513 Ga0495616_0023551 Ga0495616_0023551_2097_3296 374
225 3300046519 Ga0495632_0000445 Ga0495632_0000445_348_1589 374
226 3300046679 Ga0495623_0026785 Ga0495623_0026785_458_1708 374
227 3300047470 Ga0495681_0000123 Ga0495681_0000123_51581_52780 374
228 3300048088 Ga0495602_0004784 Ga0495602_0004784_5154_6404 374
229 3300048090 Ga0495615_0000138 Ga0495615_0000138_4294_5535 374
230 3300048091 Ga0495626_0002682 Ga0495626_0002682_2840_4120 374
231 3300048909 Ga0496106_0052474 Ga0496106_0052474_1525_2775 374
232 3300048910 Ga0496107_0000238 Ga0496107_0000238_1310_2560 374
233 3300048911 Ga0496108_0089350 Ga0496108_0089350_1291_2541 374
234 3300048913 Ga0496110_0025382 Ga0496110_0025382_151_1401 374
235 3300048914 Ga0496111_0030567 Ga0496111_0030567_1257_2507 374
236 3300048915 Ga0496112_0045063 Ga0496112_0045063_1683_2933 374
237 3300048916 Ga0496113_0030649 Ga0496113_0030649_434_1684 374
238 3300048921 Ga0496118_0161284 Ga0496118_0161284_121_1365 374
239 3300048924 Ga0496121_0005366 Ga0496121_0005366_14235_15434 374
240 3300048925 Ga0496122_0006376 Ga0496122_0006376_10857_12098 374
241 3300048926 Ga0496123_0007112 Ga0496123_0007112_8308_9549 374
242 3300001979 JGI24740J21852_10021751 JGI24740J21852_100217512 375
243 3300001989 JGI24739J22299_10021175 JGI24739J22299_100211752 375
244 3300001990 JGI24737J22298_10001265 JGI24737J22298_100012652 375
245 3300001990 JGI24737J22298_10005290 JGI24737J22298_100052902 375
246 3300002067 JGI24735J21928_10003300 JGI24735J21928_100033004 375
247 3300002067 JGI24735J21928_10023622 JGI24735J21928_100236221 375
248 3300002075 JGI24738J21930_10001453 JGI24738J21930_100014534 375
249 3300005262 Ga0065165_1007100 Ga0065165_10071002 375
250 3300005290 Ga0065712_10029270 Ga0065712_100292702 375
251 3300005327 Ga0070658_10000426 Ga0070658_1000042634 375
252 3300005327 Ga0070658_10005098 Ga0070658_100050986 375
253 3300005327 Ga0070658_10095443 Ga0070658_100954432 375
254 3300005327 Ga0070658_10119965 Ga0070658_101199652 375
255 3300005329 Ga0070683_100000854 Ga0070683_1000008546 375
256 3300005329 Ga0070683_100005212 Ga0070683_1000052128 375
257 3300005331 Ga0070670_100077433 Ga0070670_1000774333 375
258 3300005335 Ga0070666_10073807 Ga0070666_100738073 375
259 3300005339 Ga0070660_100001041 Ga0070660_1000010418 375
260 3300005339 Ga0070660_100016903 Ga0070660_1000169032 375
261 3300005339 Ga0070660_100024798 Ga0070660_1000247982 375
262 3300005341 Ga0070691_10005292 Ga0070691_100052923 375
263 3300005344 Ga0070661_100000112 Ga0070661_10000011234 375
264 3300005344 Ga0070661_100003111 Ga0070661_10000311112 375
265 3300005353 Ga0070669_100122919 Ga0070669_1001229192 375
266 3300005355 Ga0070671_100008093 Ga0070671_1000080935 375
267 3300005356 Ga0070674_100009284 Ga0070674_1000092843 375
268 3300005366 Ga0070659_100000295 Ga0070659_10000029534 375
269 3300005366 Ga0070659_100011599 Ga0070659_1000115994 375
270 3300005366 Ga0070659_100047315 Ga0070659_1000473152 375
271 3300005367 Ga0070667_100003436 Ga0070667_1000034368 375
272 3300005435 Ga0070714_100023631 Ga0070714_1000236312 375
273 3300005455 Ga0070663_100000130 Ga0070663_10000013012 375
274 3300005457 Ga0070662_100000115 Ga0070662_1000001157 375
275 3300005535 Ga0070684_100002712 Ga0070684_1000027123 375
276 3300005535 Ga0070684_100003585 Ga0070684_1000035858 375
277 3300005539 Ga0068853_100000423 Ga0068853_10000042318 375
278 3300005539 Ga0068853_100000667 Ga0068853_10000066715 375
279 3300005539 Ga0068853_100180764 Ga0068853_1001807642 375
280 3300005547 Ga0070693_100000590 Ga0070693_1000005904 375
281 3300005547 Ga0070693_100006901 Ga0070693_1000069013 375
282 3300005563 Ga0068855_100002714 Ga0068855_10000271413 375
283 3300005563 Ga0068855_100281784 Ga0068855_1002817842 375
284 3300005564 Ga0070664_100000865 Ga0070664_10000086515 375
285 3300005577 Ga0068857_100006265 Ga0068857_1000062655 375
286 3300005577 Ga0068857_100025810 Ga0068857_1000258104 375
287 3300005577 Ga0068857_100057195 Ga0068857_1000571954 375
288 3300005614 Ga0068856_100000085 Ga0068856_10000008512 375
289 3300005614 Ga0068856_100198389 Ga0068856_1001983892 375
290 3300005616 Ga0068852_100004158 Ga0068852_1000041584 375
291 3300005616 Ga0068852_100071468 Ga0068852_1000714682 375
292 3300005616 Ga0068852_100089870 Ga0068852_1000898703 375
293 3300005618 Ga0068864_100003627 Ga0068864_1000036277 375
294 3300005618 Ga0068864_100045911 Ga0068864_1000459112 375
295 3300005834 Ga0068851_10027213 Ga0068851_100272133 375
296 3300005841 Ga0068863_100019998 Ga0068863_1000199984 375
297 3300005841 Ga0068863_100058526 Ga0068863_1000585263 375
298 3300006028 Ga0070717_10033097 Ga0070717_100330975 375
299 3300009093 Ga0105240_10019075 Ga0105240_100190759 375
300 3300009174 Ga0105241_10032258 Ga0105241_100322582 375
301 3300009177 Ga0105248_10003648 Ga0105248_1000364821 375
302 3300009551 Ga0105238_10005494 Ga0105238_100054944 375
303 3300009551 Ga0105238_10029832 Ga0105238_100298322 375
304 3300010375 Ga0105239_10010865 Ga0105239_1001086512 375
305 3300013100 Ga0157373_10021560 Ga0157373_100215603 375
306 3300013100 Ga0157373_10036787 Ga0157373_100367871 375
307 3300013102 Ga0157371_10001787 Ga0157371_1000178723 375
308 3300013102 Ga0157371_10015870 Ga0157371_100158704 375
309 3300013104 Ga0157370_10070396 Ga0157370_100703962 375
310 3300013104 Ga0157370_10152416 Ga0157370_101524162 375
311 3300013105 Ga0157369_10015564 Ga0157369_100155644 375
312 3300013105 Ga0157369_10147122 Ga0157369_101471223 375
313 3300013296 Ga0157374_10186710 Ga0157374_101867102 375
314 3300013307 Ga0157372_10002117 Ga0157372_1000211711 375
315 3300014325 Ga0163163_10005046 Ga0163163_100050464 375
316 3300014325 Ga0163163_10069584 Ga0163163_100695842 375
317 3300014968 Ga0157379_10023112 Ga0157379_100231122 375
318 3300025903 Ga0207680_10077538 Ga0207680_100775382 375
319 3300025904 Ga0207647_10012687 Ga0207647_100126872 375
320 3300025904 Ga0207647_10077547 Ga0207647_100775472 375
321 3300025909 Ga0207705_10000269 Ga0207705_1000026929 375
322 3300025909 Ga0207705_10023177 Ga0207705_100231772 375
323 3300025911 Ga0207654_10046325 Ga0207654_100463252 375
324 3300025912 Ga0207707_10132000 Ga0207707_101320002 375
325 3300025913 Ga0207695_10025410 Ga0207695_100254107 375
326 3300025919 Ga0207657_10000015 Ga0207657_1000001568 375
327 3300025919 Ga0207657_10004202 Ga0207657_100042022 375
328 3300025919 Ga0207657_10131701 Ga0207657_101317012 375
329 3300025920 Ga0207649_10000150 Ga0207649_1000015020 375
330 3300025920 Ga0207649_10005446 Ga0207649_100054464 375
331 3300025921 Ga0207652_10055411 Ga0207652_100554112 375
332 3300025924 Ga0207694_10002516 Ga0207694_1000251613 375
333 3300025924 Ga0207694_10010331 Ga0207694_100103319 375
334 3300025924 Ga0207694_10011456 Ga0207694_100114564 375
335 3300025925 Ga0207650_10030254 Ga0207650_100302543 375
336 3300025925 Ga0207650_10071076 Ga0207650_100710761 375
337 3300025929 Ga0207664_10101970 Ga0207664_101019702 375
338 3300025931 Ga0207644_10002441 Ga0207644_1000244112 375
339 3300025932 Ga0207690_10000032 Ga0207690_10000032128 375
340 3300025932 Ga0207690_10008097 Ga0207690_100080972 375
341 3300025933 Ga0207706_10000032 Ga0207706_1000003232 375
342 3300025933 Ga0207706_10084448 Ga0207706_100844482 375
343 3300025941 Ga0207711_10002354 Ga0207711_1000235421 375
344 3300025941 Ga0207711_10018413 Ga0207711_100184133 375
345 3300025944 Ga0207661_10000831 Ga0207661_100008316 375
346 3300025945 Ga0207679_10000208 Ga0207679_1000020842 375
347 3300025945 Ga0207679_10057533 Ga0207679_100575332 375
348 3300025949 Ga0207667_10033460 Ga0207667_100334605 375
349 3300025949 Ga0207667_10212712 Ga0207667_102127122 375
350 3300025949 Ga0207667_10265784 Ga0207667_102657842 375
351 3300025981 Ga0207640_10198082 Ga0207640_101980821 375
352 3300025986 Ga0207658_10015489 Ga0207658_100154893 375
353 3300026041 Ga0207639_10000095 Ga0207639_1000009511 375
354 3300026067 Ga0207678_10001829 Ga0207678_1000182912 375
355 3300026078 Ga0207702_10000072 Ga0207702_10000072103 375
356 3300026078 Ga0207702_10073429 Ga0207702_100734293 375
357 3300026088 Ga0207641_10003760 Ga0207641_100037607 375
358 3300026088 Ga0207641_10064697 Ga0207641_100646972 375
359 3300026095 Ga0207676_10005207 Ga0207676_1000520711 375
360 3300026095 Ga0207676_10118969 Ga0207676_101189692 375
361 3300026116 Ga0207674_10000139 Ga0207674_1000013919 375
362 3300026116 Ga0207674_10008081 Ga0207674_100080817 375
363 3300026142 Ga0207698_10001627 Ga0207698_1000162714 375
364 3300026142 Ga0207698_10011216 Ga0207698_100112162 375
365 3300026142 Ga0207698_10012374 Ga0207698_100123745 375
366 3300028379 Ga0268266_10195921 Ga0268266_101959212 375
367 3300031911 Ga0307412_10081628 Ga0307412_100816282 375
368 3300031995 Ga0307409_100110622 Ga0307409_1001106221 375
369 3300032005 Ga0307411_10011016 Ga0307411_100110162 375
370 3300034816 Ga0373930_0004218 Ga0373930_0004218_608_1858 375
371 3300035114 Ga0373939_0007681 Ga0373939_0007681_588_1838 375
372 3300035121 Ga0373960_0012196 Ga0373960_0012196_363_1613 375
373 3300035207 Ga0373942_0016069 Ga0373942_0016069_316_1566 375
374 3300035691 Ga0373931_0014483 Ga0373931_0014483_1343_2593 375
375 3300037312 Ga0395899_0005334 Ga0395899_0005334_5420_6670 375
376 3300037312 Ga0395899_0052077 Ga0395899_0052077_1554_2804 375
377 3300037418 Ga0395900_0001721 Ga0395900_0001721_7579_8829 375
378 3300037418 Ga0395900_0013116 Ga0395900_0013116_2495_3745 375
379 3300037418 Ga0395900_0026754 Ga0395900_0026754_3383_4633 375
380 3300037466 Ga0395898_0017511 Ga0395898_0017511_5566_6816 375
381 3300037466 Ga0395898_0037746 Ga0395898_0037746_2398_3648 375
382 3300037471 Ga0395905_0002287 Ga0395905_0002287_8578_9828 375
383 3300037471 Ga0395905_0018503 Ga0395905_0018503_2203_3453 375
384 3300037471 Ga0395905_0040376 Ga0395905_0040376_184_1434 375
385 3300037471 Ga0395905_0158865 Ga0395905_0158865_533_1783 375
386 3300038443 Ga0395901_0000463 Ga0395901_0000463_9462_10712 375
387 3300038443 Ga0395901_0040232 Ga0395901_0040232_238_1488 375
388 3300044694 Ga0466963_0008394 Ga0466963_0008394_519_1769 375
389 3300044694 Ga0466963_0056660 Ga0466963_0056660_1348_2598 375
390 3300044694 Ga0466963_0184748 Ga0466963_0184748_14_1264 375
391 3300044765 Ga0466970_0015833 Ga0466970_0015833_1060_2310 375
392 3300044842 Ga0466957_0001989 Ga0466957_0001989_5112_6362 375
393 3300045049 Ga0466959_0062783 Ga0466959_0062783_348_1598 375
394 3300045836 Ga0466958_0008674 Ga0466958_0008674_695_1945 375
395 3300045976 Ga0466967_0022648 Ga0466967_0022648_88_1338 375
396 3300045976 Ga0466967_0051476 Ga0466967_0051476_1686_2936 375
397 3300045976 Ga0466967_0080030 Ga0466967_0080030_530_1780 375
398 3300045976 Ga0466967_0108787 Ga0466967_0108787_638_1888 375
399 3300046684 Ga0495669_0016219 Ga0495669_0016219_242_1492 375
400 3300048905 Ga0496102_0145956 Ga0496102_0145956_679_1929 375
401 3300048911 Ga0496108_0039064 Ga0496108_0039064_1321_2571 375
402 3300048912 Ga0496109_0030464 Ga0496109_0030464_2664_3914 375
403 3300048913 Ga0496110_0125578 Ga0496110_0125578_163_1413 375
404 3300048915 Ga0496112_0008627 Ga0496112_0008627_2755_4005 375
405 3300048916 Ga0496113_0013272 Ga0496113_0013272_1347_2597 375
406 3300049581 Ga0501047_0127533 Ga0501047_0127533_160_1401 375
407 3300049823 Ga0501044_0049714 Ga0501044_0049714_2689_3930 375
408 3300001990 JGI24737J22298_10005107 JGI24737J22298_100051073 376
409 3300005289 Ga0065704_10000280 Ga0065704_100002805 376
410 3300005329 Ga0070683_100059308 Ga0070683_1000593083 376
411 3300005336 Ga0070680_100042385 Ga0070680_1000423854 376
412 3300005339 Ga0070660_100072184 Ga0070660_1000721842 376
413 3300005347 Ga0070668_100003597 Ga0070668_1000035976 376
414 3300005353 Ga0070669_100001205 Ga0070669_1000012052 376
415 3300005355 Ga0070671_100007604 Ga0070671_10000760410 376
416 3300005355 Ga0070671_100023547 Ga0070671_1000235472 376
417 3300005366 Ga0070659_100018927 Ga0070659_1000189277 376
418 3300005366 Ga0070659_100064755 Ga0070659_1000647552 376
419 3300005367 Ga0070667_100001208 Ga0070667_1000012087 376
420 3300005455 Ga0070663_100071886 Ga0070663_1000718862 376
421 3300005843 Ga0068860_100167734 Ga0068860_1001677342 376
422 3300005844 Ga0068862_100028798 Ga0068862_1000287984 376
423 3300006051 Ga0075364_10037041 Ga0075364_100370412 376
424 3300009148 Ga0105243_10000202 Ga0105243_1000020216 376
425 3300009177 Ga0105248_10015954 Ga0105248_100159542 376
426 3300009551 Ga0105238_10180704 Ga0105238_101807042 376
427 3300013104 Ga0157370_10000630 Ga0157370_1000063024 376
428 3300013296 Ga0157374_10137826 Ga0157374_101378262 376
429 3300013307 Ga0157372_10067101 Ga0157372_100671014 376
430 3300025711 Ga0207696_1005361 Ga0207696_10053614 376
431 3300025735 Ga0207713_1004913 Ga0207713_10049135 376
432 3300025903 Ga0207680_10051598 Ga0207680_100515982 376
433 3300025904 Ga0207647_10024411 Ga0207647_100244113 376
434 3300025904 Ga0207647_10056532 Ga0207647_100565322 376
435 3300025909 Ga0207705_10157514 Ga0207705_101575142 376
436 3300025912 Ga0207707_10102803 Ga0207707_101028032 376
437 3300025919 Ga0207657_10067110 Ga0207657_100671102 376
438 3300025919 Ga0207657_10076014 Ga0207657_100760143 376
439 3300025923 Ga0207681_10000090 Ga0207681_1000009056 376
440 3300025924 Ga0207694_10113407 Ga0207694_101134072 376
441 3300025931 Ga0207644_10033704 Ga0207644_100337044 376
442 3300025932 Ga0207690_10010375 Ga0207690_100103752 376
443 3300025932 Ga0207690_10059238 Ga0207690_100592382 376
444 3300025933 Ga0207706_10018099 Ga0207706_100180994 376
445 3300025933 Ga0207706_10022018 Ga0207706_100220184 376
446 3300025941 Ga0207711_10037716 Ga0207711_100377164 376
447 3300026067 Ga0207678_10007099 Ga0207678_100070992 376
448 3300026067 Ga0207678_10038514 Ga0207678_100385142 376
449 3300026116 Ga0207674_10027716 Ga0207674_100277162 376
450 3300026142 Ga0207698_10052316 Ga0207698_100523162 376
451 3300028380 Ga0268265_10027622 Ga0268265_100276222 376
452 3300028381 Ga0268264_10013314 Ga0268264_100133145 376
453 3300032002 Ga0307416_100046864 Ga0307416_1000468641 376
454 3300032126 Ga0307415_100004917 Ga0307415_1000049172 376
455 3300037418 Ga0395900_0062533 Ga0395900_0062533_964_2214 376
456 3300037418 Ga0395900_0100225 Ga0395900_0100225_891_2141 376
457 3300037466 Ga0395898_0027062 Ga0395898_0027062_3213_4463 376
458 3300037471 Ga0395905_0002970 Ga0395905_0002970_10035_11285 376
459 3300037471 Ga0395905_0002973 Ga0395905_0002973_1609_2859 376
460 3300037471 Ga0395905_0006096 Ga0395905_0006096_5095_6345 376
461 3300037471 Ga0395905_0009873 Ga0395905_0009873_248_1498 376
462 3300037471 Ga0395905_0093296 Ga0395905_0093296_909_2159 376
463 3300037471 Ga0395905_0116455 Ga0395905_0116455_18_1268 376
464 3300038443 Ga0395901_0008909 Ga0395901_0008909_3430_4680 376
465 3300038443 Ga0395901_0033722 Ga0395901_0033722_4012_5262 376
466 3300038443 Ga0395901_0255415 Ga0395901_0255415_16_1266 376
467 3300042004 Ga0439445_0022740 Ga0439445_0022740_202_1452 376
468 3300042005 Ga0439448_0019649 Ga0439448_0019649_406_1650 376
469 3300042012 Ga0439455_0015693 Ga0439455_0015693_469_1713 376
470 3300042157 Ga0439458_0004687 Ga0439458_0004687_990_2234 376
471 3300044694 Ga0466963_0009575 Ga0466963_0009575_668_1918 376
472 3300045049 Ga0466959_0061920 Ga0466959_0061920_1114_2364 376
473 3300046616 Ga0495668_0000261 Ga0495668_0000261_364_1623 376
474 3300047469 Ga0495673_0013796 Ga0495673_0013796_183_1430 376
475 3300047472 Ga0495686_0000979 Ga0495686_0000979_20459_21706 376
476 3300048905 Ga0496102_0000162 Ga0496102_0000162_86849_88126 376
477 3300048906 Ga0496103_0000190 Ga0496103_0000190_51604_52881 376
478 3300048907 Ga0496104_0005413 Ga0496104_0005413_7925_9202 376
479 3300048908 Ga0496105_0000395 Ga0496105_0000395_15463_16740 376
480 3300048911 Ga0496108_0114302 Ga0496108_0114302_812_2062 376
481 3300048915 Ga0496112_0001644 Ga0496112_0001644_967_2217 376
482 3300048915 Ga0496112_0004154 Ga0496112_0004154_2250_3527 376
483 3300048916 Ga0496113_0000233 Ga0496113_0000233_17893_19170 376
484 3300048919 Ga0496116_0079436 Ga0496116_0079436_12_1178 376
485 3300048920 Ga0496117_0000323 Ga0496117_0000323_80075_81352 376
486 3300048921 Ga0496118_0003389 Ga0496118_0003389_16863_18140 376
487 3300048922 Ga0496119_0005020 Ga0496119_0005020_10969_12246 376
488 3300048923 Ga0496120_0005113 Ga0496120_0005113_649_1926 376
489 3300048925 Ga0496122_0002251 Ga0496122_0002251_17894_19171 376
490 3300048926 Ga0496123_0002605 Ga0496123_0002605_6895_8172 376
491 3300048927 Ga0496124_0005357 Ga0496124_0005357_3129_4406 376
492 3300048928 Ga0496125_0003763 Ga0496125_0003763_6440_7717 376
493 3300048929 Ga0496126_0000044 Ga0496126_0000044_118297_119574 376
494 3300049579 Ga0501043_0048111 Ga0501043_0048111_2009_3256 376
495 3300049823 Ga0501044_0016890 Ga0501044_0016890_340_1587 376
496 3300002239 JGI24034J26672_10006041 JGI24034J26672_100060412 377
497 3300005327 Ga0070658_10009419 Ga0070658_100094192 377
498 3300005327 Ga0070658_10027431 Ga0070658_100274313 377
499 3300005328 Ga0070676_10035663 Ga0070676_100356632 377
500 3300005329 Ga0070683_100008718 Ga0070683_1000087182 377
501 3300005331 Ga0070670_100023308 Ga0070670_1000233083 377
502 3300005335 Ga0070666_10003878 Ga0070666_100038783 377
503 3300005339 Ga0070660_100004125 Ga0070660_1000041254 377
504 3300005344 Ga0070661_100015488 Ga0070661_1000154884 377
505 3300005345 Ga0070692_10083396 Ga0070692_100833961 377
506 3300005355 Ga0070671_100021031 Ga0070671_1000210312 377
507 3300005356 Ga0070674_100053320 Ga0070674_1000533202 377
508 3300005364 Ga0070673_100012393 Ga0070673_1000123933 377
509 3300005367 Ga0070667_100006718 Ga0070667_1000067184 377
510 3300005455 Ga0070663_100164634 Ga0070663_1001646342 377
511 3300005456 Ga0070678_100013495 Ga0070678_1000134955 377
512 3300005457 Ga0070662_100006701 Ga0070662_1000067012 377
513 3300005457 Ga0070662_100009118 Ga0070662_1000091182 377
514 3300005543 Ga0070672_100003681 Ga0070672_1000036812 377
515 3300005548 Ga0070665_100015682 Ga0070665_10001568211 377
516 3300005564 Ga0070664_100006589 Ga0070664_1000065894 377
517 3300005616 Ga0068852_100018733 Ga0068852_1000187332 377
518 3300005618 Ga0068864_100019314 Ga0068864_1000193146 377
519 3300005841 Ga0068863_100017751 Ga0068863_1000177514 377
520 3300005842 Ga0068858_100023615 Ga0068858_1000236156 377
521 3300009177 Ga0105248_10001289 Ga0105248_1000128911 377
522 3300013100 Ga0157373_10015861 Ga0157373_100158615 377
523 3300013104 Ga0157370_10151509 Ga0157370_101515092 377
524 3300013306 Ga0163162_10011412 Ga0163162_100114123 377
525 3300013308 Ga0157375_10001309 Ga0157375_1000130916 377
526 3300014325 Ga0163163_10001398 Ga0163163_100013984 377
527 3300025903 Ga0207680_10006457 Ga0207680_100064573 377
528 3300025904 Ga0207647_10133175 Ga0207647_101331752 377
529 3300025907 Ga0207645_10084976 Ga0207645_100849762 377
530 3300025909 Ga0207705_10005021 Ga0207705_100050212 377
531 3300025909 Ga0207705_10008122 Ga0207705_100081222 377
532 3300025909 Ga0207705_10109073 Ga0207705_101090732 377
533 3300025913 Ga0207695_10097895 Ga0207695_100978952 377
534 3300025919 Ga0207657_10000020 Ga0207657_10000020161 377
535 3300025919 Ga0207657_10000479 Ga0207657_1000047921 377
536 3300025919 Ga0207657_10003251 Ga0207657_100032516 377
537 3300025921 Ga0207652_10016170 Ga0207652_100161702 377
538 3300025921 Ga0207652_10088345 Ga0207652_100883452 377
539 3300025931 Ga0207644_10004265 Ga0207644_1000426510 377
540 3300025932 Ga0207690_10009365 Ga0207690_100093652 377
541 3300025933 Ga0207706_10000728 Ga0207706_100007285 377
542 3300025933 Ga0207706_10007807 Ga0207706_1000780712 377
543 3300025933 Ga0207706_10184661 Ga0207706_101846612 377
544 3300025941 Ga0207711_10021056 Ga0207711_100210566 377
545 3300025944 Ga0207661_10012545 Ga0207661_100125454 377
546 3300025945 Ga0207679_10041557 Ga0207679_100415573 377
547 3300025986 Ga0207658_10022574 Ga0207658_100225742 377
548 3300026088 Ga0207641_10024416 Ga0207641_100244162 377
549 3300026095 Ga0207676_10002638 Ga0207676_1000263817 377
550 3300026118 Ga0207675_100088124 Ga0207675_1000881243 377
551 3300026121 Ga0207683_10003594 Ga0207683_100035945 377
552 3300028380 Ga0268265_10079809 Ga0268265_100798093 377
553 3300037312 Ga0395899_0001490 Ga0395899_0001490_5144_6394 377
554 3300037312 Ga0395899_0028911 Ga0395899_0028911_1942_3168 377
555 3300037418 Ga0395900_0000136 Ga0395900_0000136_18717_19967 377
556 3300037466 Ga0395898_0084412 Ga0395898_0084412_807_2033 377
557 3300037471 Ga0395905_0113025 Ga0395905_0113025_300_1550 377
558 3300038443 Ga0395901_0000030 Ga0395901_0000030_159475_160725 377
559 3300044694 Ga0466963_0000398 Ga0466963_0000398_13861_15111 377
560 3300044694 Ga0466963_0022760 Ga0466963_0022760_1093_2343 377
561 3300044842 Ga0466957_0002971 Ga0466957_0002971_3411_4661 377
562 3300045976 Ga0466967_0000059 Ga0466967_0000059_22103_23353 377
563 3300045976 Ga0466967_0045200 Ga0466967_0045200_1202_2452 377
564 3300045976 Ga0466967_0050203 Ga0466967_0050203_1661_2911 377
565 3300046660 Ga0495625_0001272 Ga0495625_0001272_18470_19720 377
566 3300048905 Ga0496102_0071574 Ga0496102_0071574_1636_2886 377
567 3300048912 Ga0496109_0022332 Ga0496109_0022332_1808_3058 377
568 3300048913 Ga0496110_0029045 Ga0496110_0029045_3261_4511 377
569 3300048914 Ga0496111_0086901 Ga0496111_0086901_179_1429 377
570 3300048915 Ga0496112_0016901 Ga0496112_0016901_3404_4654 377
571 3300048916 Ga0496113_0014181 Ga0496113_0014181_2885_4135 377
572 3300048918 Ga0496115_0097680 Ga0496115_0097680_359_1609 377
573 3300048924 Ga0496121_0030180 Ga0496121_0030180_3312_4559 377
574 3300053116 Ga0500592_003257 Ga0500592_003257_832_2082 377
575 3300001904 JGI24736J21556_1006068 JGI24736J21556_10060682 378
576 3300001915 JGI24741J21665_1003555 JGI24741J21665_10035551 378
577 3300001979 JGI24740J21852_10009757 JGI24740J21852_100097571 378
578 3300001989 JGI24739J22299_10029225 JGI24739J22299_100292251 378
579 3300001990 JGI24737J22298_10011295 JGI24737J22298_100112953 378
580 3300003215 JGI25153J46596_10000006 JGI25153J46596_10000006172 378
581 3300005327 Ga0070658_10106894 Ga0070658_101068941 378
582 3300005333 Ga0070677_10000069 Ga0070677_100000693 378
583 3300005339 Ga0070660_100004535 Ga0070660_1000045354 378
584 3300005339 Ga0070660_100019896 Ga0070660_1000198962 378
585 3300005344 Ga0070661_100002224 Ga0070661_1000022244 378
586 3300005344 Ga0070661_100044482 Ga0070661_1000444823 378
587 3300005354 Ga0070675_100023252 Ga0070675_1000232523 378
588 3300005356 Ga0070674_100014348 Ga0070674_1000143486 378
589 3300005356 Ga0070674_100084803 Ga0070674_1000848031 378
590 3300005364 Ga0070673_100097304 Ga0070673_1000973042 378
591 3300005364 Ga0070673_100140507 Ga0070673_1001405072 378
592 3300005366 Ga0070659_100066150 Ga0070659_1000661502 378
593 3300005366 Ga0070659_100066294 Ga0070659_1000662942 378
594 3300005366 Ga0070659_100163956 Ga0070659_1001639561 378
595 3300005459 Ga0068867_100061840 Ga0068867_1000618402 378
596 3300005577 Ga0068857_100067243 Ga0068857_1000672432 378
597 3300005614 Ga0068856_100295401 Ga0068856_1002954011 378
598 3300005616 Ga0068852_100205310 Ga0068852_1002053101 378
599 3300005843 Ga0068860_100004118 Ga0068860_10000411815 378
600 3300005844 Ga0068862_100000699 Ga0068862_10000069933 378
601 3300006237 Ga0097621_100010846 Ga0097621_1000108465 378
602 3300006358 Ga0068871_100025924 Ga0068871_1000259243 378
603 3300009098 Ga0105245_10012573 Ga0105245_100125734 378
604 3300009174 Ga0105241_10008753 Ga0105241_100087535 378
605 3300009174 Ga0105241_10235654 Ga0105241_102356542 378
606 3300009545 Ga0105237_10287654 Ga0105237_102876542 378
607 3300009551 Ga0105238_10032563 Ga0105238_100325636 378
608 3300009551 Ga0105238_10287466 Ga0105238_102874662 378
609 3300009553 Ga0105249_10000240 Ga0105249_100002406 378
610 3300010375 Ga0105239_10036515 Ga0105239_100365153 378
611 3300013100 Ga0157373_10149965 Ga0157373_101499651 378
612 3300013102 Ga0157371_10000024 Ga0157371_10000024203 378
613 3300013102 Ga0157371_10090121 Ga0157371_100901212 378
614 3300013104 Ga0157370_10196995 Ga0157370_101969952 378
615 3300013307 Ga0157372_10183583 Ga0157372_101835832 378
616 3300014326 Ga0157380_10042553 Ga0157380_100425532 378
617 3300017792 Ga0163161_10067247 Ga0163161_100672472 378
618 3300025253 Ga0209677_102955 Ga0209677_1029552 378
619 3300025261 Ga0209233_1005448 Ga0209233_10054482 378
620 3300025297 Ga0209758_1000001 Ga0209758_10000011653 378
621 3300025893 Ga0207682_10004052 Ga0207682_100040523 378
622 3300025904 Ga0207647_10007821 Ga0207647_100078214 378
623 3300025907 Ga0207645_10022598 Ga0207645_100225985 378
624 3300025909 Ga0207705_10000070 Ga0207705_1000007074 378
625 3300025909 Ga0207705_10002293 Ga0207705_100022937 378
626 3300025911 Ga0207654_10000322 Ga0207654_1000032211 378
627 3300025919 Ga0207657_10002325 Ga0207657_100023255 378
628 3300025919 Ga0207657_10009217 Ga0207657_100092178 378
629 3300025920 Ga0207649_10000816 Ga0207649_1000081621 378
630 3300025920 Ga0207649_10001766 Ga0207649_100017666 378
631 3300025924 Ga0207694_10213819 Ga0207694_102138191 378
632 3300025926 Ga0207659_10005540 Ga0207659_100055404 378
633 3300025932 Ga0207690_10000421 Ga0207690_1000042117 378
634 3300025932 Ga0207690_10041568 Ga0207690_100415682 378
635 3300025932 Ga0207690_10056245 Ga0207690_100562452 378
636 3300025932 Ga0207690_10139868 Ga0207690_101398681 378
637 3300025932 Ga0207690_10255293 Ga0207690_102552931 378
638 3300025933 Ga0207706_10070856 Ga0207706_100708562 378
639 3300025933 Ga0207706_10206875 Ga0207706_102068751 378
640 3300025935 Ga0207709_10000123 Ga0207709_1000012322 378
641 3300025937 Ga0207669_10000075 Ga0207669_1000007516 378
642 3300025949 Ga0207667_10029444 Ga0207667_100294444 378
643 3300025960 Ga0207651_10089293 Ga0207651_100892931 378
644 3300025961 Ga0207712_10000196 Ga0207712_1000019661 378
645 3300025981 Ga0207640_10007956 Ga0207640_100079564 378
646 3300026041 Ga0207639_10019828 Ga0207639_100198286 378
647 3300026078 Ga0207702_10002235 Ga0207702_100022351 378
648 3300026078 Ga0207702_10297725 Ga0207702_102977251 378
649 3300026116 Ga0207674_10056051 Ga0207674_100560512 378
650 3300026121 Ga0207683_10000564 Ga0207683_1000056414 378
651 3300026142 Ga0207698_10011523 Ga0207698_100115232 378
652 3300026142 Ga0207698_10081586 Ga0207698_100815861 378
653 3300028380 Ga0268265_10000658 Ga0268265_1000065832 378
654 3300028381 Ga0268264_10002774 Ga0268264_100027742 378
655 3300031456 Ga0307513_10012671 Ga0307513_100126719 378
656 3300044656 Ga0466969_0008949 Ga0466969_0008949_274_1524 378
657 3300044684 Ga0466966_0000259 Ga0466966_0000259_6559_7809 378
658 3300044694 Ga0466963_0090925 Ga0466963_0090925_423_1673 378
659 3300044719 Ga0466971_0005272 Ga0466971_0005272_2883_4133 378
660 3300044765 Ga0466970_0005052 Ga0466970_0005052_2002_3252 378
661 3300044842 Ga0466957_0000189 Ga0466957_0000189_25148_26398 378
662 3300045836 Ga0466958_0004544 Ga0466958_0004544_3808_5058 378
663 3300046471 Ga0495650_0000058 Ga0495650_0000058_32324_33556 378
664 3300046506 Ga0495583_0002572 Ga0495583_0002572_3935_5167 378
665 3300046506 Ga0495583_0012492 Ga0495583_0012492_3302_4561 378
666 3300046506 Ga0495583_0015069 Ga0495583_0015069_2785_4044 378
667 3300046507 Ga0495606_0134288 Ga0495606_0134288_153_1412 378
668 3300046522 Ga0495643_0037651 Ga0495643_0037651_92_1351 378
669 3300046522 Ga0495643_0109563 Ga0495643_0109563_26_1285 378
670 3300046524 Ga0495648_0000166 Ga0495648_0000166_76357_77616 378
671 3300046528 Ga0495642_0012012 Ga0495642_0012012_1697_2956 378
672 3300046558 Ga0495633_0005142 Ga0495633_0005142_3511_4770 378
673 3300046660 Ga0495625_0000910 Ga0495625_0000910_38280_39539 378
674 3300046660 Ga0495625_0070314 Ga0495625_0070314_909_2168 378
675 3300046660 Ga0495625_0113288 Ga0495625_0113288_83_1342 378
676 3300046684 Ga0495669_0000144 Ga0495669_0000144_43530_44789 378
677 3300047443 Ga0495687_006553 Ga0495687_006553_5663_6922 378
678 3300047443 Ga0495687_007272 Ga0495687_007272_5125_6384 378
679 3300047445 Ga0495677_0004180 Ga0495677_0004180_3584_4843 378
680 3300048905 Ga0496102_0003256 Ga0496102_0003256_375_1634 378
681 3300048906 Ga0496103_0000186 Ga0496103_0000186_49604_50863 378
682 3300048907 Ga0496104_0007512 Ga0496104_0007512_8029_9288 378
683 3300048908 Ga0496105_0014021 Ga0496105_0014021_452_1711 378
684 3300048913 Ga0496110_0038030 Ga0496110_0038030_314_1573 378
685 3300048914 Ga0496111_0014013 Ga0496111_0014013_900_2159 378
686 3300048917 Ga0496114_0018497 Ga0496114_0018497_3995_5254 378
687 3300048918 Ga0496115_0000744 Ga0496115_0000744_17593_18852 378
688 3300048919 Ga0496116_0016544 Ga0496116_0016544_4465_5724 378
689 3300048920 Ga0496117_0000977 Ga0496117_0000977_30743_32002 378
690 3300048921 Ga0496118_0000144 Ga0496118_0000144_17718_18977 378
691 3300048922 Ga0496119_0013696 Ga0496119_0013696_4951_6210 378
692 3300048924 Ga0496121_0000977 Ga0496121_0000977_341_1600 378
693 3300048925 Ga0496122_0019822 Ga0496122_0019822_343_1602 378
694 3300048927 Ga0496124_0000177 Ga0496124_0000177_49425_50684 378
695 3300048928 Ga0496125_0000336 Ga0496125_0000336_88647_89906 378
696 3300048929 Ga0496126_0000505 Ga0496126_0000505_57594_58853 378
697 3300050507 nmdc:mga05p37_446868_c1 nmdc:mga05p37_446868_c1_83_1333 378
698 3300053079 Ga0500610_0000163 Ga0500610_0000163_10227_11486 378
699 3300053130 Ga0500642_0002812 Ga0500642_0002812_3771_5003 378
700 3300053730 Ga0500645_000692 Ga0500645_000692_15231_16490 378
701 3300053735 Ga0500596_001842 Ga0500596_001842_2330_3589 378
702 3300061719 Ga0466962_0006671 Ga0466962_0006671_3808_5058 378
703 3300003759 Ga0055525_1000040 Ga0055525_1000040114 379
704 3300003762 Ga0055542_1000046 Ga0055542_100004610 379
705 3300003763 Ga0055529_1000007 Ga0055529_1000007219 379
706 3300005327 Ga0070658_10005793 Ga0070658_100057932 379
707 3300005339 Ga0070660_100004456 Ga0070660_1000044567 379
708 3300005367 Ga0070667_100004021 Ga0070667_10000402110 379
709 3300005563 Ga0068855_100000408 Ga0068855_10000040842 379
710 3300005578 Ga0068854_100000334 Ga0068854_10000033424 379
711 3300005841 Ga0068863_100000072 Ga0068863_10000007256 379
712 3300005843 Ga0068860_100000247 Ga0068860_10000024742 379
713 3300005844 Ga0068862_100024420 Ga0068862_1000244204 379
714 3300009093 Ga0105240_10027010 Ga0105240_100270105 379
715 3300009177 Ga0105248_10402801 Ga0105248_104028012 379
716 3300013102 Ga0157371_10006810 Ga0157371_100068102 379
717 3300013104 Ga0157370_10061518 Ga0157370_100615183 379
718 3300013104 Ga0157370_10163638 Ga0157370_101636382 379
719 3300013105 Ga0157369_10059183 Ga0157369_100591833 379
720 3300013105 Ga0157369_10085431 Ga0157369_100854313 379
721 3300025230 Ga0209563_100019 Ga0209563_100019164 379
722 3300025254 Ga0209148_1000026 Ga0209148_1000026166 379
723 3300025272 Ga0209455_1000005 Ga0209455_1000005913 379
724 3300025909 Ga0207705_10000166 Ga0207705_1000016642 379
725 3300025913 Ga0207695_10016338 Ga0207695_100163384 379
726 3300025919 Ga0207657_10006898 Ga0207657_100068988 379
727 3300025949 Ga0207667_10006320 Ga0207667_100063206 379
728 3300025981 Ga0207640_10000344 Ga0207640_1000034410 379
729 3300026078 Ga0207702_10031513 Ga0207702_100315132 379
730 3300026088 Ga0207641_10000084 Ga0207641_1000008457 379
731 3300028380 Ga0268265_10043759 Ga0268265_100437593 379
732 3300028381 Ga0268264_10000253 Ga0268264_1000025356 379
733 3300037418 Ga0395900_0081907 Ga0395900_0081907_758_2008 379
734 3300037418 Ga0395900_0154726 Ga0395900_0154726_411_1637 379
735 3300046475 Ga0495639_0076173 Ga0495639_0076173_46_1305 379
736 3300046557 Ga0495622_0043090 Ga0495622_0043090_343_1602 379
737 3300046616 Ga0495668_0000001 Ga0495668_0000001_825947_827197 379
738 3300046809 Ga0495600_0000496 Ga0495600_0000496_12057_13316 379
739 3300047470 Ga0495681_0035421 Ga0495681_0035421_1030_2289 379
740 3300048908 Ga0496105_0014368 Ga0496105_0014368_4902_6143 379
741 3300048924 Ga0496121_0000136 Ga0496121_0000136_137125_138366 379
742 3300053119 Ga0500595_001738 Ga0500595_001738_6358_7617 379
743 3300053125 Ga0500618_002319 Ga0500618_002319_5302_6552 379
744 3300005331 Ga0070670_100102172 Ga0070670_1001021722 380
745 3300005564 Ga0070664_100003974 Ga0070664_1000039743 380
746 3300025945 Ga0207679_10005172 Ga0207679_100051729 380
747 3300031995 Ga0307409_100107167 Ga0307409_1001071672 380
748 3300046500 Ga0495596_0000074 Ga0495596_0000074_12977_14218 380
749 3300046501 Ga0495607_0056108 Ga0495607_0056108_204_1445 380
750 3300048905 Ga0496102_0000120 Ga0496102_0000120_36896_38149 380
751 3300048906 Ga0496103_0000154 Ga0496103_0000154_40384_41637 380
752 3300048919 Ga0496116_0003722 Ga0496116_0003722_3376_4629 380
753 3300048920 Ga0496117_0000317 Ga0496117_0000317_46587_47840 380
754 3300048921 Ga0496118_0000303 Ga0496118_0000303_46591_47844 380
755 3300048922 Ga0496119_0036846 Ga0496119_0036846_57_1310 380
756 3300048924 Ga0496121_0000070 Ga0496121_0000070_174942_176183 380
757 3300048927 Ga0496124_0000214 Ga0496124_0000214_74284_75537 380
758 3300053116 Ga0500592_000166 Ga0500592_000166_10213_11463 380
759 3300053158 Ga0500627_0000451 Ga0500627_0000451_5687_6937 380
760 3300013102 Ga0157371_10091689 Ga0157371_100916892 381
761 3300031824 Ga0307413_10176223 Ga0307413_101762232 381
762 3300031852 Ga0307410_10059150 Ga0307410_100591503 381
763 3300032002 Ga0307416_100007655 Ga0307416_1000076555 381
764 3300032005 Ga0307411_10046178 Ga0307411_100461782 381
765 3300038443 Ga0395901_0119981 Ga0395901_0119981_518_1768 381
766 3300044684 Ga0466966_0000027 Ga0466966_0000027_29214_30464 381
767 3300046691 Ga0495670_0074160 Ga0495670_0074160_338_1579 381
768 3300001904 JGI24736J21556_1000891 JGI24736J21556_10008913 382
769 3300001915 JGI24741J21665_1000108 JGI24741J21665_10001084 382
770 3300002075 JGI24738J21930_10001184 JGI24738J21930_100011846 382
771 3300005327 Ga0070658_10055567 Ga0070658_100555672 382
772 3300005329 Ga0070683_100175071 Ga0070683_1001750712 382
773 3300005455 Ga0070663_100016467 Ga0070663_1000164673 382
774 3300005614 Ga0068856_100009633 Ga0068856_1000096333 382
775 3300009093 Ga0105240_10020733 Ga0105240_100207335 382
776 3300009093 Ga0105240_10116790 Ga0105240_101167903 382
777 3300009174 Ga0105241_10022201 Ga0105241_100222013 382
778 3300009545 Ga0105237_10024764 Ga0105237_100247643 382
779 3300010375 Ga0105239_10001100 Ga0105239_1000110019 382
780 3300013104 Ga0157370_10053984 Ga0157370_100539841 382
781 3300013105 Ga0157369_10098048 Ga0157369_100980483 382
782 3300025904 Ga0207647_10024730 Ga0207647_100247303 382
783 3300025911 Ga0207654_10008528 Ga0207654_100085284 382
784 3300025913 Ga0207695_10005843 Ga0207695_100058439 382
785 3300025913 Ga0207695_10115879 Ga0207695_101158793 382
786 3300025919 Ga0207657_10008147 Ga0207657_100081474 382
787 3300025920 Ga0207649_10072451 Ga0207649_100724512 382
788 3300025961 Ga0207712_10062248 Ga0207712_100622483 382
789 3300026041 Ga0207639_10000336 Ga0207639_1000033614 382
790 3300026067 Ga0207678_10000072 Ga0207678_1000007249 382
791 3300026078 Ga0207702_10007811 Ga0207702_100078114 382
792 3300026116 Ga0207674_10078530 Ga0207674_100785302 382
793 3300031548 Ga0307408_100012406 Ga0307408_1000124063 382
794 3300046453 Ga0495627_001254 Ga0495627_001254_4509_5759 382
795 3300046512 Ga0495610_0000071 Ga0495610_0000071_108116_109366 382
796 3300046513 Ga0495616_0005044 Ga0495616_0005044_5864_7114 382
797 3300046665 Ga0495661_0054521 Ga0495661_0054521_529_1779 382
798 3300047470 Ga0495681_0000008 Ga0495681_0000008_76866_78116 382
799 3300047472 Ga0495686_0012769 Ga0495686_0012769_1427_2653 382
800 3300048913 Ga0496110_0081696 Ga0496110_0081696_203_1453 382
801 3300048924 Ga0496121_0020344 Ga0496121_0020344_944_2191 382
802 3300048924 Ga0496121_0040745 Ga0496121_0040745_1338_2588 382
803 3300048925 Ga0496122_0007052 Ga0496122_0007052_1516_2766 382
804 3300048927 Ga0496124_0001555 Ga0496124_0001555_20235_21485 382
805 3300048928 Ga0496125_0000335 Ga0496125_0000335_48271_49521 382
806 3300053104 Ga0500556_0008568 Ga0500556_0008568_1251_2501 382
807 3300053158 Ga0500627_0000994 Ga0500627_0000994_970_2220 382
808 3300005293 Ga0065715_10009180 Ga0065715_100091804 383
809 3300005331 Ga0070670_100063442 Ga0070670_1000634422 383
810 3300005331 Ga0070670_100148733 Ga0070670_1001487332 383
811 3300005333 Ga0070677_10027224 Ga0070677_100272242 383
812 3300005347 Ga0070668_100000060 Ga0070668_10000006047 383
813 3300005354 Ga0070675_100011037 Ga0070675_1000110375 383
814 3300005456 Ga0070678_100215517 Ga0070678_1002155171 383
815 3300005457 Ga0070662_100016311 Ga0070662_1000163112 383
816 3300005841 Ga0068863_100000001 Ga0068863_100000001271 383
817 3300009553 Ga0105249_10015668 Ga0105249_100156683 383
818 3300013297 Ga0157378_10009089 Ga0157378_100090892 383
819 3300017792 Ga0163161_10091294 Ga0163161_100912943 383
820 3300025893 Ga0207682_10002221 Ga0207682_100022215 383
821 3300025925 Ga0207650_10040280 Ga0207650_100402802 383
822 3300025926 Ga0207659_10032128 Ga0207659_100321283 383
823 3300025933 Ga0207706_10027821 Ga0207706_100278215 383
824 3300025960 Ga0207651_10063988 Ga0207651_100639883 383
825 3300025961 Ga0207712_10022323 Ga0207712_100223233 383
826 3300025972 Ga0207668_10000056 Ga0207668_1000005636 383
827 3300026088 Ga0207641_10000001 Ga0207641_10000001607 383
828 3300031852 Ga0307410_10084502 Ga0307410_100845022 383
829 3300047472 Ga0495686_0005860 Ga0495686_0005860_7662_8906 383
830 3300048927 Ga0496124_0052536 Ga0496124_0052536_370_1620 383
831 3300005347 Ga0070668_100021732 Ga0070668_1000217323 384
832 3300025229 Ga0209147_100986 Ga0209147_1009864 384
833 3300025923 Ga0207681_10033359 Ga0207681_100333593 384
834 3300025931 Ga0207644_10157817 Ga0207644_101578172 384
835 3300025972 Ga0207668_10001145 Ga0207668_100011455 384
836 3300048920 Ga0496117_0033768 Ga0496117_0033768_2034_3284 384
837 3300048921 Ga0496118_0001203 Ga0496118_0001203_31030_32280 384
838 3300005548 Ga0070665_100003976 Ga0070665_1000039764 385
839 3300028379 Ga0268266_10023125 Ga0268266_100231254 385
840 3300046539 Ga0495621_0005284 Ga0495621_0005284_2362_3600 385
841 3300046506 Ga0495583_0067603 Ga0495583_0067603_334_1533 386
842 3300046522 Ga0495643_0004377 Ga0495643_0004377_4401_5600 386
843 3300053119 Ga0500595_000516 Ga0500595_000516_6158_7408 386
844 3300032002 Ga0307416_100120207 Ga0307416_1001202072 387
845 3300042004 Ga0439445_0006296 Ga0439445_0006296_598_1818 388
846 3300038443 Ga0395901_0039175 Ga0395901_0039175_2247_3497 390
847 3300047472 Ga0495686_0010637 Ga0495686_0010637_2314_3561 390
848 3300006195 Ga0075366_10067825 Ga0075366_100678252 392
849 3300006353 Ga0075370_10000017 Ga0075370_1000001743 392
850 3300025933 Ga0207706_10044800 Ga0207706_100448003 392
851 3300031731 Ga0307405_10048042 Ga0307405_100480422 392
852 3300031911 Ga0307412_10013742 Ga0307412_100137421 392
853 3300053096 Ga0500641_0047033 Ga0500641_0047033_432_1673 392
854 3300053158 Ga0500627_0000005 Ga0500627_0000005_101370_102620 392
855 3300046453 Ga0495627_000153 Ga0495627_000153_46795_48045 393
856 3300048928 Ga0496125_0128682 Ga0496125_0128682_203_1429 394
857 3300053730 Ga0500645_002262 Ga0500645_002262_475_1725 394
858 2162886007 SwRhRL2b_contig_2799799 SwRhRL2b_0316.00000390 395
859 3300005295 Ga0065707_10104511 Ga0065707_101045112 395
860 3300005347 Ga0070668_100038039 Ga0070668_1000380394 395
861 3300009177 Ga0105248_10030301 Ga0105248_100303012 395
862 3300013306 Ga0163162_10079338 Ga0163162_100793384 395
863 3300025941 Ga0207711_10060303 Ga0207711_100603032 395
864 3300025972 Ga0207668_10014294 Ga0207668_100142942 395
865 3300045051 Ga0451576_0000023 Ga0451576_0000023_105860_107098 395
866 3300046524 Ga0495648_0076891 Ga0495648_0076891_193_1443 395
867 3300046542 Ga0495597_0042592 Ga0495597_0042592_169_1419 395
868 3300046616 Ga0495668_0034522 Ga0495668_0034522_1539_2789 395
869 3300046691 Ga0495670_0015429 Ga0495670_0015429_593_1843 395
870 3300053096 Ga0500641_0017037 Ga0500641_0017037_82_1332 395
871 3300053125 Ga0500618_002424 Ga0500618_002424_3692_4939 395
872 3300053130 Ga0500642_0005484 Ga0500642_0005484_2626_3876 395
873 3300053133 Ga0500655_000103 Ga0500655_000103_20324_21574 395
874 3300053148 Ga0500590_000032 Ga0500590_000032_26040_27290 395
875 3300053156 Ga0500622_0007913 Ga0500622_0007913_3071_4321 395
876 3300053163 Ga0500639_048669 Ga0500639_048669_745_1995 395
877 3300053724 Ga0500570_000646 Ga0500570_000646_11010_12260 395
878 3300053730 Ga0500645_035275 Ga0500645_035275_72_1325 395
879 iso_pu_bacteria 2510917021 2511129606 395
880 iso_pu_bacteria 2739367664 2739649767 395
881 iso_pu_bacteria 2739367865 2740028240 395
882 iso_pu_bacteria 2882806704 2882807430 395
883 3300005335 Ga0070666_10013898 Ga0070666_100138985 396
884 3300005347 Ga0070668_100009575 Ga0070668_1000095753 396
885 3300005353 Ga0070669_100020482 Ga0070669_1000204824 396
886 3300005367 Ga0070667_100000641 Ga0070667_1000006414 396
887 3300005578 Ga0068854_100078243 Ga0068854_1000782432 396
888 3300005841 Ga0068863_100000047 Ga0068863_10000004776 396
889 3300005843 Ga0068860_100086508 Ga0068860_1000865083 396
890 3300006042 Ga0075368_10002991 Ga0075368_100029912 396
891 3300006048 Ga0075363_100058006 Ga0075363_1000580061 396
892 3300006178 Ga0075367_10000543 Ga0075367_1000054315 396
893 3300009093 Ga0105240_10165092 Ga0105240_101650922 396
894 3300021388 Ga0213875_10000202 Ga0213875_1000020237 396
895 3300025903 Ga0207680_10007346 Ga0207680_100073462 396
896 3300025914 Ga0207671_10005000 Ga0207671_100050009 396
897 3300025972 Ga0207668_10002025 Ga0207668_100020256 396
898 3300025981 Ga0207640_10076616 Ga0207640_100766162 396
899 3300025986 Ga0207658_10000539 Ga0207658_1000053932 396
900 3300026088 Ga0207641_10000079 Ga0207641_1000007975 396
901 3300027866 Ga0209813_10000099 Ga0209813_1000009927 396
902 3300028381 Ga0268264_10143682 Ga0268264_101436821 396
903 3300031911 Ga0307412_10000217 Ga0307412_100002173 396
904 3300032002 Ga0307416_100239140 Ga0307416_1002391401 396
905 3300032004 Ga0307414_10000102 Ga0307414_1000010244 396
906 3300032004 Ga0307414_10167674 Ga0307414_101676741 396
907 3300037853 Ga0436364_0380874 Ga0436364_0380874_47602_48852 396
908 3300046471 Ga0495650_0005879 Ga0495650_0005879_4242_5486 396
909 3300047472 Ga0495686_0033576 Ga0495686_0033576_445_1695 396
910 3300048905 Ga0496102_0018907 Ga0496102_0018907_1295_2545 396
911 3300048921 Ga0496118_0049835 Ga0496118_0049835_1536_2783 396
912 3300048925 Ga0496122_0001715 Ga0496122_0001715_28643_29887 396
913 3300048926 Ga0496123_0000518 Ga0496123_0000518_50506_51750 396
914 3300049530 Ga0501314_001129 Ga0501314_001129_55_1305 396
915 3300049571 Ga0501034_0114666 Ga0501034_0114666_1240_2490 396
916 3300049663 Ga0501223_000531 Ga0501223_000531_1193_2443 396
917 3300049664 Ga0501224_000012 Ga0501224_000012_77854_79104 396
918 3300049668 Ga0501233_000809 Ga0501233_000809_679_1929 396
919 3300049686 Ga0501257_000506 Ga0501257_000506_2512_3762 396
920 3300049705 Ga0501225_0000035 Ga0501225_0000035_43650_44900 396
921 3300049707 Ga0501234_002015 Ga0501234_002015_1764_3014 396
922 3300049853 Ga0501226_000091 Ga0501226_000091_13440_14690 396
923 3300050494 nmdc:mga06z11_280_c1 nmdc:mga06z11_280_c1_4319_5569 396
924 3300050495 nmdc:mga04h51_176_c1 nmdc:mga04h51_176_c1_2088_3338 396
925 3300053120 Ga0500597_019710 Ga0500597_019710_152_1378 396
926 3300053136 Ga0500559_0018002 Ga0500559_0018002_1418_2662 396
927 3300053157 Ga0500624_000001 Ga0500624_000001_215468_216694 396
928 3300053178 Ga0500637_0000010 Ga0500637_0000010_79989_81215 396
929 3300013102 Ga0157371_10104675 Ga0157371_101046752 397
930 3300025949 Ga0207667_10050099 Ga0207667_100500992 397
931 3300037418 Ga0395900_0117586 Ga0395900_0117586_1155_2405 397
932 3300046460 Ga0495638_0000249 Ga0495638_0000249_44843_46093 397
933 3300046506 Ga0495583_0000262 Ga0495583_0000262_34242_35492 397
934 3300046519 Ga0495632_0000328 Ga0495632_0000328_32415_33665 397
935 3300046519 Ga0495632_0004828 Ga0495632_0004828_3501_4751 397
936 3300046520 Ga0495637_0009479 Ga0495637_0009479_557_1807 397
937 3300046522 Ga0495643_0000014 Ga0495643_0000014_300872_302122 397
938 3300046524 Ga0495648_0000015 Ga0495648_0000015_246917_248167 397
939 3300046525 Ga0495663_0000007 Ga0495663_0000007_249230_250480 397
940 3300046558 Ga0495633_0000398 Ga0495633_0000398_11959_13209 397
941 3300046616 Ga0495668_0015552 Ga0495668_0015552_23_1273 397
942 3300046692 Ga0495671_0000032 Ga0495671_0000032_187425_188675 397
943 3300046692 Ga0495671_0000084 Ga0495671_0000084_34442_35692 397
944 3300047469 Ga0495673_0000206 Ga0495673_0000206_52852_54102 397
945 3300047470 Ga0495681_0012624 Ga0495681_0012624_2972_4222 397
946 3300053087 Ga0500643_000050 Ga0500643_000050_59286_60536 397
947 3300053087 Ga0500643_000767 Ga0500643_000767_14111_15451 397
948 3300053087 Ga0500643_007566 Ga0500643_007566_1598_2938 397
949 3300053088 Ga0500644_0048128 Ga0500644_0048128_84_1334 397
950 3300053153 Ga0500616_0007347 Ga0500616_0007347_5204_6448 397
951 3300053157 Ga0500624_000052 Ga0500624_000052_24692_25942 397
952 2162886007 SwRhRL2b_contig_2073436 SwRhRL2b_0553.00003060 398
953 3300001904 JGI24736J21556_1000121 JGI24736J21556_100012112 398
954 3300001976 JGI24752J21851_1000406 JGI24752J21851_10004062 398
955 3300001976 JGI24752J21851_1001029 JGI24752J21851_10010292 398
956 3300001979 JGI24740J21852_10004902 JGI24740J21852_100049027 398
957 3300001990 JGI24737J22298_10005230 JGI24737J22298_100052304 398
958 3300002067 JGI24735J21928_10000918 JGI24735J21928_1000091810 398
959 3300002070 JGI24750J21931_1000121 JGI24750J21931_10001215 398
960 3300002074 JGI24748J21848_1000044 JGI24748J21848_100004446 398
961 3300002075 JGI24738J21930_10000672 JGI24738J21930_1000067210 398
962 3300002076 JGI24749J21850_1000073 JGI24749J21850_10000739 398
963 3300002239 JGI24034J26672_10000020 JGI24034J26672_100000209 398
964 3300002239 JGI24034J26672_10005054 JGI24034J26672_100050542 398
965 3300002459 JGI24751J29686_10000408 JGI24751J29686_100004087 398
966 3300002774 JGI25150J39212_1000020 JGI25150J39212_1000020103 398
967 3300003214 JGI25165J46597_1000032 JGI25165J46597_100003218 398
968 3300003215 JGI25153J46596_10000017 JGI25153J46596_10000017113 398
969 3300003215 JGI25153J46596_10002165 JGI25153J46596_100021654 398
970 3300003771 Ga0055526_1003107 Ga0055526_10031078 398
971 3300003773 Ga0055537_1004762 Ga0055537_10047622 398
972 3300003775 Ga0055524_1000255 Ga0055524_100025545 398
973 3300003781 Ga0055536_1009965 Ga0055536_10099654 398
974 3300003791 Ga0055530_10000591 Ga0055530_100005916 398
975 3300003792 Ga0055540_1004749 Ga0055540_10047496 398
976 3300003794 Ga0055531_10001569 Ga0055531_100015698 398
977 3300003794 Ga0055531_10011724 Ga0055531_100117246 398
978 3300003794 Ga0055531_10011725 Ga0055531_100117256 398
979 3300003794 Ga0055531_10019298 Ga0055531_100192983 398
980 3300005262 Ga0065165_1003103 Ga0065165_10031034 398
981 3300005262 Ga0065165_1003364 Ga0065165_10033648 398
982 3300005295 Ga0065707_10084704 Ga0065707_100847046 398
983 3300005295 Ga0065707_10090473 Ga0065707_100904732 398
984 3300005295 Ga0065707_10094263 Ga0065707_100942634 398
985 3300005295 Ga0065707_10118130 Ga0065707_101181301 398
986 3300005327 Ga0070658_10061125 Ga0070658_100611253 398
987 3300005330 Ga0070690_100000014 Ga0070690_10000001484 398
988 3300005331 Ga0070670_100000060 Ga0070670_10000006092 398
989 3300005331 Ga0070670_100000239 Ga0070670_10000023918 398
990 3300005331 Ga0070670_100010781 Ga0070670_1000107816 398
991 3300005331 Ga0070670_100012240 Ga0070670_1000122405 398
992 3300005335 Ga0070666_10000027 Ga0070666_1000002743 398
993 3300005335 Ga0070666_10000033 Ga0070666_1000003365 398
994 3300005335 Ga0070666_10011986 Ga0070666_100119863 398
995 3300005340 Ga0070689_100004623 Ga0070689_1000046233 398
996 3300005347 Ga0070668_100000035 Ga0070668_10000003541 398
997 3300005347 Ga0070668_100018654 Ga0070668_1000186544 398
998 3300005353 Ga0070669_100000053 Ga0070669_10000005324 398
999 3300005353 Ga0070669_100000075 Ga0070669_10000007541 398
1000 3300005353 Ga0070669_100000099 Ga0070669_10000009932 398
1001 3300005355 Ga0070671_100000015 Ga0070671_10000001552 398
1002 3300005355 Ga0070671_100002037 Ga0070671_10000203712 398
1003 3300005355 Ga0070671_100008390 Ga0070671_1000083904 398
1004 3300005355 Ga0070671_100019634 Ga0070671_1000196343 398
1005 3300005365 Ga0070688_100000293 Ga0070688_1000002939 398
1006 3300005367 Ga0070667_100000039 Ga0070667_100000039100 398
1007 3300005367 Ga0070667_100000101 Ga0070667_10000010175 398
1008 3300005367 Ga0070667_100022655 Ga0070667_1000226554 398
1009 3300005458 Ga0070681_10258930 Ga0070681_102589302 398
1010 3300005466 Ga0070685_10000874 Ga0070685_1000087419 398
1011 3300005539 Ga0068853_100001390 Ga0068853_10000139020 398
1012 3300005539 Ga0068853_100025624 Ga0068853_1000256245 398
1013 3300005539 Ga0068853_100032929 Ga0068853_1000329294 398
1014 3300005539 Ga0068853_100128129 Ga0068853_1001281292 398
1015 3300005544 Ga0070686_100000010 Ga0070686_100000010127 398
1016 3300005548 Ga0070665_100000254 Ga0070665_10000025451 398
1017 3300005577 Ga0068857_100002222 Ga0068857_1000022225 398
1018 3300005614 Ga0068856_100199400 Ga0068856_1001994002 398
1019 3300005616 Ga0068852_100082374 Ga0068852_1000823742 398
1020 3300005616 Ga0068852_100121772 Ga0068852_1001217722 398
1021 3300005617 Ga0068859_100000194 Ga0068859_10000019436 398
1022 3300005617 Ga0068859_100002944 Ga0068859_10000294410 398
1023 3300005617 Ga0068859_100018641 Ga0068859_1000186416 398
1024 3300005617 Ga0068859_100022708 Ga0068859_1000227086 398
1025 3300005617 Ga0068859_100293380 Ga0068859_1002933802 398
1026 3300005618 Ga0068864_100000016 Ga0068864_100000016241 398
1027 3300005618 Ga0068864_100000069 Ga0068864_10000006924 398
1028 3300005618 Ga0068864_100002890 Ga0068864_1000028905 398
1029 3300005618 Ga0068864_100031094 Ga0068864_1000310944 398
1030 3300005719 Ga0068861_100000005 Ga0068861_10000000587 398
1031 3300005719 Ga0068861_100024150 Ga0068861_1000241503 398
1032 3300005719 Ga0068861_100055885 Ga0068861_1000558852 398
1033 3300005841 Ga0068863_100000033 Ga0068863_10000003394 398
1034 3300005841 Ga0068863_100003811 Ga0068863_1000038119 398
1035 3300005841 Ga0068863_100006452 Ga0068863_10000645210 398
1036 3300005841 Ga0068863_100009112 Ga0068863_1000091128 398
1037 3300005842 Ga0068858_100000236 Ga0068858_10000023654 398
1038 3300005842 Ga0068858_100003263 Ga0068858_10000326310 398
1039 3300005842 Ga0068858_100011701 Ga0068858_1000117015 398
1040 3300005843 Ga0068860_100000080 Ga0068860_100000080126 398
1041 3300005843 Ga0068860_100000181 Ga0068860_10000018177 398
1042 3300005843 Ga0068860_100000244 Ga0068860_10000024445 398
1043 3300005843 Ga0068860_100002453 Ga0068860_10000245316 398
1044 3300005844 Ga0068862_100000040 Ga0068862_10000004093 398
1045 3300005844 Ga0068862_100000082 Ga0068862_10000008292 398
1046 3300005844 Ga0068862_100000115 Ga0068862_10000011540 398
1047 3300005844 Ga0068862_100000340 Ga0068862_1000003408 398
1048 3300005844 Ga0068862_100000394 Ga0068862_1000003942 398
1049 3300005937 Ga0081455_10000477 Ga0081455_1000047711 398
1050 3300006195 Ga0075366_10037972 Ga0075366_100379722 398
1051 3300006931 Ga0097620_100000194 Ga0097620_10000019436 398
1052 3300006931 Ga0097620_100002944 Ga0097620_10000294410 398
1053 3300006931 Ga0097620_100018639 Ga0097620_1000186396 398
1054 3300006931 Ga0097620_100022708 Ga0097620_1000227082 398
1055 3300006931 Ga0097620_100293390 Ga0097620_1002933902 398
1056 3300009011 Ga0105251_10000611 Ga0105251_100006112 398
1057 3300009093 Ga0105240_10022857 Ga0105240_100228575 398
1058 3300009098 Ga0105245_10000967 Ga0105245_1000096724 398
1059 3300009098 Ga0105245_10005928 Ga0105245_100059289 398
1060 3300009101 Ga0105247_10001024 Ga0105247_1000102417 398
1061 3300009101 Ga0105247_10001062 Ga0105247_1000106213 398
1062 3300009174 Ga0105241_10017168 Ga0105241_100171685 398
1063 3300009177 Ga0105248_10000021 Ga0105248_10000021210 398
1064 3300009177 Ga0105248_10000101 Ga0105248_100001015 398
1065 3300009177 Ga0105248_10001148 Ga0105248_1000114827 398
1066 3300009177 Ga0105248_10027890 Ga0105248_100278905 398
1067 3300009545 Ga0105237_10043357 Ga0105237_100433573 398
1068 3300009551 Ga0105238_10323579 Ga0105238_103235792 398
1069 3300009553 Ga0105249_10000064 Ga0105249_1000006445 398
1070 3300009553 Ga0105249_10000128 Ga0105249_1000012885 398
1071 3300009553 Ga0105249_10004336 Ga0105249_100043369 398
1072 3300009978 Ga0105148_100077 Ga0105148_1000774 398
1073 3300013100 Ga0157373_10079931 Ga0157373_100799311 398
1074 3300013104 Ga0157370_10033309 Ga0157370_100333094 398
1075 3300013105 Ga0157369_10282852 Ga0157369_102828522 398
1076 3300013296 Ga0157374_10108537 Ga0157374_101085371 398
1077 3300013297 Ga0157378_10009084 Ga0157378_100090849 398
1078 3300013306 Ga0163162_10019992 Ga0163162_100199925 398
1079 3300013306 Ga0163162_10032340 Ga0163162_100323402 398
1080 3300013306 Ga0163162_10058728 Ga0163162_100587284 398
1081 3300013306 Ga0163162_10156160 Ga0163162_101561601 398
1082 3300014326 Ga0157380_10000086 Ga0157380_100000862 398
1083 3300014326 Ga0157380_10003455 Ga0157380_100034552 398
1084 3300014326 Ga0157380_10012788 Ga0157380_100127886 398
1085 3300014968 Ga0157379_10088296 Ga0157379_100882962 398
1086 3300017792 Ga0163161_10000110 Ga0163161_1000011043 398
1087 3300021377 Ga0213874_10032767 Ga0213874_100327672 398
1088 3300025223 Ga0207672_1000420 Ga0207672_10004202 398
1089 3300025245 Ga0207425_1000022 Ga0207425_1000022161 398
1090 3300025258 Ga0209129_1000882 Ga0209129_100088214 398
1091 3300025261 Ga0209233_1000066 Ga0209233_100006619 398
1092 3300025263 Ga0209565_1000010 Ga0209565_1000010555 398
1093 3300025263 Ga0209565_1000457 Ga0209565_100045730 398
1094 3300025273 Ga0209673_1003099 Ga0209673_10030997 398
1095 3300025292 Ga0209676_1003652 Ga0209676_10036527 398
1096 3300025294 Ga0209025_1000842 Ga0209025_10008429 398
1097 3300025295 Ga0209564_1001884 Ga0209564_100188412 398
1098 3300025297 Ga0209758_1000004 Ga0209758_1000004788 398
1099 3300025297 Ga0209758_1003161 Ga0209758_10031618 398
1100 3300025298 Ga0209050_1000001 Ga0209050_10000012807 398
1101 3300025298 Ga0209050_1000026 Ga0209050_1000026207 398
1102 3300025298 Ga0209050_1003410 Ga0209050_10034107 398
1103 3300025298 Ga0209050_1010796 Ga0209050_10107962 398
1104 3300025298 Ga0209050_1013486 Ga0209050_10134865 398
1105 3300025299 Ga0209256_1000010 Ga0209256_1000010835 398
1106 3300025302 Ga0207426_1006530 Ga0207426_10065302 398
1107 3300025303 Ga0209051_1000246 Ga0209051_10002467 398
1108 3300025304 Ga0209257_1000009 Ga0209257_1000009207 398
1109 3300025304 Ga0209257_1001934 Ga0209257_10019348 398
1110 3300025304 Ga0209257_1002097 Ga0209257_10020978 398
1111 3300025304 Ga0209257_1005321 Ga0209257_10053216 398
1112 3300025315 Ga0207697_10000215 Ga0207697_1000021520 398
1113 3300025735 Ga0207713_1003637 Ga0207713_100363710 398
1114 3300025900 Ga0207710_10001018 Ga0207710_1000101810 398
1115 3300025900 Ga0207710_10006828 Ga0207710_100068287 398
1116 3300025903 Ga0207680_10000009 Ga0207680_10000009129 398
1117 3300025903 Ga0207680_10000166 Ga0207680_1000016621 398
1118 3300025903 Ga0207680_10015008 Ga0207680_100150083 398
1119 3300025904 Ga0207647_10004794 Ga0207647_100047947 398
1120 3300025909 Ga0207705_10024156 Ga0207705_100241562 398
1121 3300025911 Ga0207654_10006812 Ga0207654_100068124 398
1122 3300025912 Ga0207707_10216150 Ga0207707_102161502 398
1123 3300025913 Ga0207695_10017663 Ga0207695_100176633 398
1124 3300025914 Ga0207671_10003834 Ga0207671_100038348 398
1125 3300025914 Ga0207671_10026943 Ga0207671_100269433 398
1126 3300025919 Ga0207657_10043475 Ga0207657_100434752 398
1127 3300025919 Ga0207657_10161702 Ga0207657_101617022 398
1128 3300025923 Ga0207681_10000002 Ga0207681_1000000252 398
1129 3300025923 Ga0207681_10000003 Ga0207681_10000003427 398
1130 3300025923 Ga0207681_10000106 Ga0207681_1000010654 398
1131 3300025923 Ga0207681_10005789 Ga0207681_100057892 398
1132 3300025924 Ga0207694_10003464 Ga0207694_100034647 398
1133 3300025925 Ga0207650_10000398 Ga0207650_100003987 398
1134 3300025925 Ga0207650_10000622 Ga0207650_100006227 398
1135 3300025925 Ga0207650_10000677 Ga0207650_1000067716 398
1136 3300025925 Ga0207650_10000994 Ga0207650_100009942 398
1137 3300025925 Ga0207650_10044079 Ga0207650_100440792 398
1138 3300025925 Ga0207650_10088727 Ga0207650_100887271 398
1139 3300025927 Ga0207687_10001006 Ga0207687_1000100617 398
1140 3300025927 Ga0207687_10002092 Ga0207687_100020922 398
1141 3300025931 Ga0207644_10000002 Ga0207644_1000000252 398
1142 3300025931 Ga0207644_10000012 Ga0207644_10000012148 398
1143 3300025931 Ga0207644_10000082 Ga0207644_1000008259 398
1144 3300025941 Ga0207711_10000025 Ga0207711_1000002586 398
1145 3300025941 Ga0207711_10000657 Ga0207711_1000065727 398
1146 3300025941 Ga0207711_10016384 Ga0207711_100163844 398
1147 3300025941 Ga0207711_10019722 Ga0207711_100197222 398
1148 3300025941 Ga0207711_10024826 Ga0207711_100248264 398
1149 3300025949 Ga0207667_10005797 Ga0207667_100057978 398
1150 3300025949 Ga0207667_10008224 Ga0207667_100082247 398
1151 3300025961 Ga0207712_10000044 Ga0207712_10000044126 398
1152 3300025961 Ga0207712_10000610 Ga0207712_1000061012 398
1153 3300025972 Ga0207668_10000017 Ga0207668_10000017101 398
1154 3300025972 Ga0207668_10000155 Ga0207668_100001555 398
1155 3300025981 Ga0207640_10032055 Ga0207640_100320553 398
1156 3300025986 Ga0207658_10000077 Ga0207658_1000007773 398
1157 3300025986 Ga0207658_10000164 Ga0207658_1000016422 398
1158 3300025986 Ga0207658_10000401 Ga0207658_1000040123 398
1159 3300025986 Ga0207658_10004171 Ga0207658_100041718 398
1160 3300025986 Ga0207658_10012458 Ga0207658_100124584 398
1161 3300025986 Ga0207658_10013707 Ga0207658_100137075 398
1162 3300026035 Ga0207703_10000564 Ga0207703_1000056427 398
1163 3300026035 Ga0207703_10000812 Ga0207703_1000081224 398
1164 3300026035 Ga0207703_10003247 Ga0207703_100032474 398
1165 3300026035 Ga0207703_10013730 Ga0207703_100137305 398
1166 3300026035 Ga0207703_10019872 Ga0207703_100198724 398
1167 3300026041 Ga0207639_10010581 Ga0207639_100105817 398
1168 3300026041 Ga0207639_10023407 Ga0207639_100234075 398
1169 3300026041 Ga0207639_10042037 Ga0207639_100420374 398
1170 3300026041 Ga0207639_10066009 Ga0207639_100660092 398
1171 3300026067 Ga0207678_10069387 Ga0207678_100693872 398
1172 3300026078 Ga0207702_10021377 Ga0207702_100213772 398
1173 3300026078 Ga0207702_10163577 Ga0207702_101635772 398
1174 3300026088 Ga0207641_10000002 Ga0207641_1000000293 398
1175 3300026088 Ga0207641_10000047 Ga0207641_10000047162 398
1176 3300026088 Ga0207641_10000243 Ga0207641_100002432 398
1177 3300026088 Ga0207641_10001505 Ga0207641_1000150513 398
1178 3300026088 Ga0207641_10004404 Ga0207641_1000440411 398
1179 3300026088 Ga0207641_10005121 Ga0207641_100051214 398
1180 3300026095 Ga0207676_10000005 Ga0207676_10000005714 398
1181 3300026095 Ga0207676_10000009 Ga0207676_10000009430 398
1182 3300026095 Ga0207676_10000193 Ga0207676_1000019318 398
1183 3300026095 Ga0207676_10000827 Ga0207676_1000082720 398
1184 3300026095 Ga0207676_10005022 Ga0207676_100050225 398
1185 3300026095 Ga0207676_10365965 Ga0207676_103659651 398
1186 3300026116 Ga0207674_10003807 Ga0207674_1000380714 398
1187 3300026116 Ga0207674_10009858 Ga0207674_100098585 398
1188 3300026116 Ga0207674_10043416 Ga0207674_100434162 398
1189 3300026116 Ga0207674_10060077 Ga0207674_100600773 398
1190 3300026116 Ga0207674_10119675 Ga0207674_101196752 398
1191 3300026118 Ga0207675_100000020 Ga0207675_100000020107 398
1192 3300026118 Ga0207675_100000162 Ga0207675_1000001625 398
1193 3300026118 Ga0207675_100000169 Ga0207675_10000016916 398
1194 3300026118 Ga0207675_100000207 Ga0207675_10000020740 398
1195 3300028379 Ga0268266_10000069 Ga0268266_10000069129 398
1196 3300028380 Ga0268265_10000003 Ga0268265_10000003898 398
1197 3300028380 Ga0268265_10000030 Ga0268265_10000030180 398
1198 3300028380 Ga0268265_10000200 Ga0268265_1000020013 398
1199 3300028380 Ga0268265_10000241 Ga0268265_1000024152 398
1200 3300028380 Ga0268265_10005390 Ga0268265_100053905 398
1201 3300028381 Ga0268264_10000010 Ga0268264_10000010269 398
1202 3300028381 Ga0268264_10000131 Ga0268264_10000131126 398
1203 3300028381 Ga0268264_10000144 Ga0268264_10000144142 398
1204 3300028381 Ga0268264_10000214 Ga0268264_1000021435 398
1205 3300031616 Ga0307508_10003045 Ga0307508_100030457 398
1206 3300031911 Ga0307412_10007490 Ga0307412_100074904 398
1207 3300032004 Ga0307414_10007698 Ga0307414_100076983 398
1208 3300032005 Ga0307411_10083673 Ga0307411_100836732 398
1209 3300038705 Ga0237819_00608 Ga0237819_00608_6352_7602 398
1210 3300039450 Ga0436363_1591101 Ga0436363_1591101_63_1310 398
1211 3300041406 Ga0439439_0013802 Ga0439439_0013802_24_1274 398
1212 3300041410 Ga0439461_0000593 Ga0439461_0000593_2171_3421 398
1213 3300041413 Ga0439465_0000607 Ga0439465_0000607_3077_4327 398
1214 3300041413 Ga0439465_0001762 Ga0439465_0001762_2229_3479 398
1215 3300041997 Ga0439431_0000029 Ga0439431_0000029_14912_16162 398
1216 3300042004 Ga0439445_0000832 Ga0439445_0000832_4016_5266 398
1217 3300042006 Ga0439432_000209 Ga0439432_000209_13049_14299 398
1218 3300042435 Ga0439434_0000160 Ga0439434_0000160_8880_10130 398
1219 3300045051 Ga0451576_0015993 Ga0451576_0015993_827_2074 398
1220 3300046453 Ga0495627_003860 Ga0495627_003860_3181_4431 398
1221 3300046460 Ga0495638_0000344 Ga0495638_0000344_28404_29654 398
1222 3300046524 Ga0495648_0060044 Ga0495648_0060044_98_1348 398
1223 3300046525 Ga0495663_0012666 Ga0495663_0012666_819_2069 398
1224 3300046530 Ga0495654_0003443 Ga0495654_0003443_6346_7596 398
1225 3300046558 Ga0495633_0000429 Ga0495633_0000429_21264_22514 398
1226 3300046616 Ga0495668_0011572 Ga0495668_0011572_3016_4266 398
1227 3300046660 Ga0495625_0011447 Ga0495625_0011447_5806_7056 398
1228 3300046691 Ga0495670_0000004 Ga0495670_0000004_203249_204499 398
1229 3300047472 Ga0495686_0035797 Ga0495686_0035797_1072_2322 398
1230 3300048905 Ga0496102_0045935 Ga0496102_0045935_673_1923 398
1231 3300048906 Ga0496103_0005969 Ga0496103_0005969_656_1906 398
1232 3300048906 Ga0496103_0065693 Ga0496103_0065693_803_2053 398
1233 3300048911 Ga0496108_0002936 Ga0496108_0002936_10701_11927 398
1234 3300048912 Ga0496109_0077484 Ga0496109_0077484_268_1518 398
1235 3300048913 Ga0496110_0104060 Ga0496110_0104060_1302_2528 398
1236 3300048918 Ga0496115_0000354 Ga0496115_0000354_24345_25598 398
1237 3300048919 Ga0496116_0085600 Ga0496116_0085600_99_1349 398
1238 3300048920 Ga0496117_0019977 Ga0496117_0019977_3911_5161 398
1239 3300048920 Ga0496117_0048265 Ga0496117_0048265_948_2198 398
1240 3300048921 Ga0496118_0001409 Ga0496118_0001409_7304_8554 398
1241 3300048921 Ga0496118_0018978 Ga0496118_0018978_4260_5510 398
1242 3300048923 Ga0496120_0075082 Ga0496120_0075082_567_1817 398
1243 3300048924 Ga0496121_0014401 Ga0496121_0014401_152_1378 398
1244 3300048927 Ga0496124_0001292 Ga0496124_0001292_22756_24006 398
1245 3300048927 Ga0496124_0007025 Ga0496124_0007025_3434_4660 398
1246 3300048927 Ga0496124_0031410 Ga0496124_0031410_3127_4353 398
1247 3300048927 Ga0496124_0041353 Ga0496124_0041353_84_1310 398
1248 3300048927 Ga0496124_0100741 Ga0496124_0100741_58_1308 398
1249 3300048927 Ga0496124_0220131 Ga0496124_0220131_119_1345 398
1250 3300048928 Ga0496125_0010661 Ga0496125_0010661_3513_4739 398
1251 3300048929 Ga0496126_0021123 Ga0496126_0021123_2062_3288 398
1252 3300049569 Ga0501032_0047162 Ga0501032_0047162_12_1262 398
1253 3300049574 Ga0501038_0015524 Ga0501038_0015524_4036_5286 398
1254 3300049581 Ga0501047_0014003 Ga0501047_0014003_15_1265 398
1255 3300049669 Ga0501235_006351 Ga0501235_006351_902_2128 398
1256 3300049679 Ga0501249_011424 Ga0501249_011424_422_1672 398
1257 3300049705 Ga0501225_0000079 Ga0501225_0000079_20997_22247 398
1258 3300049705 Ga0501225_0003012 Ga0501225_0003012_3874_5100 398
1259 3300049758 Ga0501241_008291 Ga0501241_008291_221_1471 398
1260 3300050493 nmdc:mga0k408_23313_c1 nmdc:mga0k408_23313_c1_2100_3350 398
1261 3300053087 Ga0500643_001021 Ga0500643_001021_14192_15442 398
1262 3300053087 Ga0500643_002098 Ga0500643_002098_32_1285 398
1263 3300053087 Ga0500643_003471 Ga0500643_003471_2311_3561 398
1264 3300053087 Ga0500643_008642 Ga0500643_008642_1148_2398 398
1265 3300053087 Ga0500643_014021 Ga0500643_014021_518_1768 398
1266 3300053094 Ga0500566_0003363 Ga0500566_0003363_6370_7620 398
1267 3300053104 Ga0500556_0000049 Ga0500556_0000049_78384_79667 398
1268 3300053116 Ga0500592_000053 Ga0500592_000053_26873_28123 398
1269 3300053122 Ga0500608_015045 Ga0500608_015045_1572_2822 398
1270 3300053130 Ga0500642_0000002 Ga0500642_0000002_45847_47130 398
1271 3300053134 Ga0500658_0001066 Ga0500658_0001066_6832_8082 398
1272 3300053134 Ga0500658_0003575 Ga0500658_0003575_2731_3957 398
1273 3300053134 Ga0500658_0016765 Ga0500658_0016765_270_1520 398
1274 3300053136 Ga0500559_0012178 Ga0500559_0012178_2224_3474 398
1275 3300053139 Ga0500568_0047815 Ga0500568_0047815_187_1437 398
1276 3300053140 Ga0500573_0075996 Ga0500573_0075996_569_1819 398
1277 3300053151 Ga0500604_0005801 Ga0500604_0005801_257_1507 398
1278 3300053153 Ga0500616_0012043 Ga0500616_0012043_1602_2852 398
1279 3300053157 Ga0500624_000045 Ga0500624_000045_48675_49925 398
1280 3300053158 Ga0500627_0001095 Ga0500627_0001095_5918_7168 398
1281 3300053177 Ga0500636_0002215 Ga0500636_0002215_3239_4489 398
1282 3300053730 Ga0500645_002467 Ga0500645_002467_1312_2562 398
1283 iso_pu_bacteria 2512564014 2512643632 398
1284 iso_pu_bacteria 2599185359 2600226384 398
1285 iso_pu_bacteria 2643221541 2643729322 398
1286 iso_pu_bacteria 2643221560 2643821667 398
1287 iso_pu_bacteria 2643221563 2643835815 398
1288 iso_pu_bacteria 2643221605 2644040619 398
1289 iso_pu_bacteria 2643221606 2644045798 398
1290 iso_pu_bacteria 2643221608 2644056741 398
1291 iso_pu_bacteria 2643221622 2644126339 398
1292 iso_pu_bacteria 2643221671 2644393375 398
1293 iso_pu_bacteria 2775507255 2778124098 398
1294 iso_pu_bacteria 2808606404 2809079673 398
1295 iso_pu_bacteria 2808606405 2809084038 398
1296 iso_pu_bacteria 2818991466 2819712633 398
1297 iso_pu_bacteria 2830075706 2830076419 398
1298 iso_pu_bacteria 2852653556 2852655422 398
1299 iso_pu_bacteria 2852680915 2852681778 398
1300 iso_pu_bacteria 2879163058 2879166971 398
1301 iso_pu_bacteria 2880518877 2880519361 398
1302 iso_pu_bacteria 2885427238 2885428226 398
1303 iso_pu_bacteria 2919709256 2919711113 398
1304 iso_pu_bacteria 2928027323 2928027750 398
1305 iso_pu_bacteria 2928526807 2928527230 398
1306 iso_pu_bacteria 2928968154 2928969286 398
1307 iso_pu_bacteria 2984555340 2984557957 398
1308 iso_pu_bacteria 2984564862 2984567677 398
1309 iso_pu_bacteria 2993356040 2993358729 398
1310 iso_pu_bacteria 8057101203 8057103427 398

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02687

FtsX

FtsX-like permease family

301

428

0.88

PF12704

MacB_PCD

MacB-like periplasmic core domain

58

276

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
5udf-assembly1.cif.gz_B structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.8542 46 248
5udf-assembly1.cif.gz_D structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.8528 46 248
5udf-assembly1.cif.gz_C structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.8449 46 248
5udf-assembly1.cif.gz_D structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.8337 46 248
5udf-assembly1.cif.gz_C structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.8261 46 248
ID Description Score Start End Superfamily
af_P96281_14_94_2.40.40.20 Mainly Beta;Beta Barrel;Barwin-like endoglucanases; 0.6022 128 224 2.40.40.20
af_P96281_14_94_2.40.40.20 Mainly Beta;Beta Barrel;Barwin-like endoglucanases; 0.5961 128 224 2.40.40.20
3qwzA01 Mainly Beta;Beta Barrel;Barwin-like endoglucanases; 0.5742 125 222 2.40.40.20
af_P9WJP9_660_771_2.40.40.20 Mainly Beta;Beta Barrel;Barwin-like endoglucanases; 0.566 141 208 2.40.40.20
3qwzA01 Mainly Beta;Beta Barrel;Barwin-like endoglucanases; 0.5357 125 222 2.40.40.20
ID Description Score Start End GO Terms
AF-A0A352S7P5-F1-model_v4 Lipoprotein-releasing system transmembrane subunit LolC 0.9435 106 208 GO:0044874
GO:0098797
AF-A0A520ADY4-F1-model_v4 Lipoprotein-releasing system transmembrane subunit, LolC/LolE family 0.9416 1 269 GO:0044874
GO:0098797
AF-A0A520ADY4-F1-model_v4 Lipoprotein-releasing system transmembrane subunit, LolC/LolE family 0.909 1 269 GO:0044874
GO:0098797
AF-A0A3D5ZWP7-F1-model_v4 deleted 0.9088 126 241
AF-A0A348TNR7-F1-model_v4 ABC transporter permease 0.8867 67 224 GO:0044874
GO:0098797

Feature Viewer

pLDDT pTM Quality
75.85 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map