F492822

General Info

Members Datasets Scaffolds Average Seq Length
1306 412 1300 132

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0106996|Ga0436364_0106996_5080_5559
Length 159
Sequence MSERKRAPRRLPSQRGGNSRRGPKPAARQRGLGAEGYTVTHRRYVPYSHAHYGGNLVDGAYVLGLFGDVATEACIQMDGDEGLFASYSDVQFRAPVLAGDVLEVTASVASVGRRSRVLSFTARVMCRADPARGPSAAVVLGEPIVAVTATGTVVVPPAQ

Samples

Sample ID Description Type Environment
1 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
2 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
3 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
4 2643221641 Nocardioides sp. Root122 Isolate Unclassified
5 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
6 2855683550 Micromonospora sp. RP3T Isolate Unclassified
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
78 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
79 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
80 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
81 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
98 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
124 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
137 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
196 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
197 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
200 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
201 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
202 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
203 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
204 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
205 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
206 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
207 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
208 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
209 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
210 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
211 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
212 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
213 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
214 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
215 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
216 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
217 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
218 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
219 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
220 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
221 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
222 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
223 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
224 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
225 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
226 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
227 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
228 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
229 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
230 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
231 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
232 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
233 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
234 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
235 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
236 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
237 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
238 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
239 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
240 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
241 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
242 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
243 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
244 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
245 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
246 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
247 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
248 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
249 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
250 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
251 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
252 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
253 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
254 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
255 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
256 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
257 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
258 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
259 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
260 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
261 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
262 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
263 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
264 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
265 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
266 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
267 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
268 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
269 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
270 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
271 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
272 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
273 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
274 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
275 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
276 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
277 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
278 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
279 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
280 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
281 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
282 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
283 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
284 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
285 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
286 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
287 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
288 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
289 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
290 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
291 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
292 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
293 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
294 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
295 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
296 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
297 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
298 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
299 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
300 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
301 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
302 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
303 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
304 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
305 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
306 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
307 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
308 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
309 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
310 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
311 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
312 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
313 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
314 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
315 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
316 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
317 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
318 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
319 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
320 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
321 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
322 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
323 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
324 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
325 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
326 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
327 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
328 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
329 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
330 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
331 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
332 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
333 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
334 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
335 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
336 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
337 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
338 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
339 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
340 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
341 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
342 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
343 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
344 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
345 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
346 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
347 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
348 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
349 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
350 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
351 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
352 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
353 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
354 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
355 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
360 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
370 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
371 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
372 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
373 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
374 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
375 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
376 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
377 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
378 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
379 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
380 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
381 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
382 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
383 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
384 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
385 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
387 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
388 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
389 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
390 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
391 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
392 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
393 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
394 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
395 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
396 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
397 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
398 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
399 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
400 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
401 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
402 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
403 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
404 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
405 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
406 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
407 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
408 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
409 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
410 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
411 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
412 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.77
Metatranscriptomes 0.77
Isolates 0.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.14
Nodule 0
Rhizoplane 9.57
Rhizosphere 85.22
Stem 0
Stem Tuber 0
Unclassified 2.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10010206 3300001979 Bacteria 3629
2 JGI24740J21852_10017166 3300001979 Bacteria 2594
3 JGI24739J22299_10020441 3300001989 Bacteria 2365
4 JGI24737J22298_10011107 3300001990 Bacteria 2956
5 JGI24737J22298_10158422 3300001990 Bacteria 668
6 JGI24735J21928_10024929 3300002067 Bacteria 1806
7 Ga0070658_10059220 3300005327 Bacteria 3119
8 Ga0070658_10090323 3300005327 Bacteria 2524
9 Ga0070658_10163053 3300005327 Bacteria 1871
10 Ga0070658_10466784 3300005327 Bacteria 1089
11 Ga0070676_10449508 3300005328 Bacteria 906
12 Ga0070683_100039111 3300005329 Bacteria 4352
13 Ga0070683_100110191 3300005329 Bacteria 2597
14 Ga0070683_100308211 3300005329 Bacteria 1506
15 Ga0070683_100486318 3300005329 Bacteria 1179
16 Ga0070683_101069937 3300005329 Bacteria 775
17 Ga0070683_101101973 3300005329 Bacteria 763
18 Ga0070683_101625839 3300005329 Bacteria 621
19 Ga0070690_100373213 3300005330 Bacteria 1041
20 Ga0070690_100505520 3300005330 Bacteria 905
21 Ga0068869_100114192 3300005334 Bacteria 2058
22 Ga0068869_101400194 3300005334 Bacteria 619
23 Ga0070682_100069703 3300005337 Bacteria 2246
24 Ga0070682_100111907 3300005337 Bacteria 1821
25 Ga0070682_100894847 3300005337 Bacteria 729
26 Ga0068868_100168751 3300005338 Bacteria 1811
27 Ga0068868_100300720 3300005338 Bacteria 1363
28 Ga0068868_100323109 3300005338 Bacteria 1315
29 Ga0068868_100410383 3300005338 Bacteria 1170
30 Ga0070660_100071828 3300005339 Bacteria 2703
31 Ga0070660_101366104 3300005339 Bacteria 602
32 Ga0070691_10469820 3300005341 Bacteria 722
33 Ga0070687_100263292 3300005343 Bacteria 1077
34 Ga0070687_100443252 3300005343 Bacteria 862
35 Ga0070661_100231882 3300005344 Bacteria 1419
36 Ga0070692_10042979 3300005345 Bacteria 2323
37 Ga0070692_10052824 3300005345 Bacteria 2117
38 Ga0070692_10216071 3300005345 Bacteria 1131
39 Ga0070668_100332598 3300005347 Bacteria 1281
40 Ga0070675_102227321 3300005354 Bacteria 505
41 Ga0070674_100399266 3300005356 Bacteria 1123
42 Ga0070674_100400167 3300005356 Bacteria 1122
43 Ga0070688_100568670 3300005365 Bacteria 864
44 Ga0070688_100697478 3300005365 Bacteria 786
45 Ga0070659_100002813 3300005366 Bacteria 12393
46 Ga0070659_100084399 3300005366 Bacteria 2540
47 Ga0070659_100098643 3300005366 Bacteria 2349
48 Ga0070659_100129965 3300005366 Bacteria 2045
49 Ga0070667_100068859 3300005367 Bacteria 3012
50 Ga0070667_100085200 3300005367 Bacteria 2710
51 Ga0070667_100614762 3300005367 Bacteria 1002
52 Ga0070667_102079382 3300005367 Bacteria 535
53 Ga0070709_10014787 3300005434 Bacteria 4423
54 Ga0070709_10033111 3300005434 Bacteria 3122
55 Ga0070709_10738358 3300005434 Bacteria 768
56 Ga0070709_11184572 3300005434 Bacteria 613
57 Ga0070714_100035649 3300005435 Bacteria 4170
58 Ga0070714_100097337 3300005435 Bacteria 2586
59 Ga0070714_100179288 3300005435 Bacteria 1927
60 Ga0070714_100867473 3300005435 Bacteria 876
61 Ga0070714_100945911 3300005435 Bacteria 837
62 Ga0070714_101267374 3300005435 Bacteria 719
63 Ga0070713_100024410 3300005436 Bacteria 4707
64 Ga0070713_100120547 3300005436 Bacteria 2300
65 Ga0070713_100619129 3300005436 Bacteria 1029
66 Ga0070713_100828923 3300005436 Bacteria 887
67 Ga0070710_10001197 3300005437 Bacteria 12272
68 Ga0070710_10049041 3300005437 Bacteria 2360
69 Ga0070710_10080114 3300005437 Bacteria 1904
70 Ga0070710_10082152 3300005437 Bacteria 1883
71 Ga0070711_100012377 3300005439 Bacteria 5328
72 Ga0070711_100039016 3300005439 Bacteria 3196
73 Ga0070711_100115544 3300005439 Bacteria 1976
74 Ga0070711_100773522 3300005439 Bacteria 813
75 Ga0070711_100924372 3300005439 Bacteria 745
76 Ga0070711_101301472 3300005439 Bacteria 631
77 Ga0070705_100481022 3300005440 Bacteria 938
78 Ga0070700_100252036 3300005441 Bacteria 1267
79 Ga0070700_100527007 3300005441 Bacteria 914
80 Ga0070708_100049685 3300005445 Bacteria 3711
81 Ga0070708_100378205 3300005445 Bacteria 1335
82 Ga0070708_100447613 3300005445 Bacteria 1218
83 Ga0070708_100579662 3300005445 Bacteria 1058
84 Ga0070708_101339038 3300005445 Bacteria 668
85 Ga0070663_100057000 3300005455 Bacteria 2801
86 Ga0070678_100072244 3300005456 Bacteria 2586
87 Ga0070678_100207646 3300005456 Bacteria 1621
88 Ga0070678_100762303 3300005456 Bacteria 876
89 Ga0070678_100786703 3300005456 Bacteria 863
90 Ga0070678_101310509 3300005456 Bacteria 674
91 Ga0070678_101746513 3300005456 Bacteria 586
92 Ga0070662_101616961 3300005457 Bacteria 559
93 Ga0070681_10571108 3300005458 Bacteria 1045
94 Ga0068867_101656836 3300005459 Bacteria 599
95 Ga0070685_10132006 3300005466 Bacteria 1563
96 Ga0070685_10185609 3300005466 Bacteria 1342
97 Ga0070685_10335037 3300005466 Bacteria 1030
98 Ga0070706_100010370 3300005467 Bacteria 8654
99 Ga0070706_100064133 3300005467 Bacteria 3395
100 Ga0070706_100132282 3300005467 Bacteria 2328
101 Ga0070706_101280916 3300005467 Bacteria 672
102 Ga0070707_100001899 3300005468 Bacteria 20032
103 Ga0070707_100003928 3300005468 Bacteria 13990
104 Ga0070707_100087282 3300005468 Bacteria 3017
105 Ga0070707_100140049 3300005468 Bacteria 2354
106 Ga0070707_100274731 3300005468 Bacteria 1638
107 Ga0070707_100334056 3300005468 Bacteria 1472
108 Ga0070707_100478268 3300005468 Bacteria 1207
109 Ga0070707_100597461 3300005468 Bacteria 1066
110 Ga0070698_100001616 3300005471 Bacteria 25085
111 Ga0070698_100001711 3300005471 Bacteria 24475
112 Ga0070698_100002455 3300005471 Bacteria 20452
113 Ga0070698_100002555 3300005471 Bacteria 20032
114 Ga0070698_100047863 3300005471 Bacteria 4371
115 Ga0070698_100173179 3300005471 Bacteria 2098
116 Ga0070698_100208288 3300005471 Bacteria 1891
117 Ga0070698_100217971 3300005471 Bacteria 1842
118 Ga0070699_100201261 3300005518 Bacteria 1771
119 Ga0070699_100519747 3300005518 Bacteria 1082
120 Ga0070679_100074111 3300005530 Bacteria 3395
121 Ga0070679_100077816 3300005530 Bacteria 3306
122 Ga0070679_100190272 3300005530 Bacteria 2021
123 Ga0070684_100004679 3300005535 Bacteria 10449
124 Ga0070684_100137835 3300005535 Bacteria 2205
125 Ga0070684_100178423 3300005535 Bacteria 1931
126 Ga0070684_101102541 3300005535 Bacteria 746
127 Ga0070684_101494394 3300005535 Bacteria 637
128 Ga0070684_101511698 3300005535 Bacteria 633
129 Ga0070684_101536258 3300005535 Bacteria 628
130 Ga0070697_100090792 3300005536 Bacteria 2525
131 Ga0070697_100239195 3300005536 Bacteria 1550
132 Ga0068853_100054483 3300005539 Bacteria 3446
133 Ga0068853_101208724 3300005539 Bacteria 730
134 Ga0070672_100197908 3300005543 Bacteria 1680
135 Ga0070672_101367062 3300005543 Bacteria 633
136 Ga0070686_100211937 3300005544 Bacteria 1395
137 Ga0070686_101846560 3300005544 Bacteria 515
138 Ga0070696_100566953 3300005546 Bacteria 912
139 Ga0070696_100995253 3300005546 Bacteria 700
140 Ga0070693_100100839 3300005547 Bacteria 1759
141 Ga0070693_100116170 3300005547 Bacteria 1654
142 Ga0070704_101301940 3300005549 Bacteria 665
143 Ga0068855_100721681 3300005563 Bacteria 1065
144 Ga0068855_101822240 3300005563 Bacteria 618
145 Ga0070664_100939371 3300005564 Bacteria 812
146 Ga0070664_101505778 3300005564 Bacteria 637
147 Ga0070664_101861055 3300005564 Bacteria 571
148 Ga0068857_100412843 3300005577 Bacteria 1257
149 Ga0068857_100739220 3300005577 Bacteria 937
150 Ga0068857_101049042 3300005577 Bacteria 786
151 Ga0068857_101750470 3300005577 Bacteria 608
152 Ga0068854_100900007 3300005578 Bacteria 778
153 Ga0068856_100030983 3300005614 Bacteria 5232
154 Ga0068856_100285392 3300005614 Bacteria 1667
155 Ga0068856_100494913 3300005614 Bacteria 1243
156 Ga0068856_100510916 3300005614 Bacteria 1222
157 Ga0068856_102630625 3300005614 Bacteria 509
158 Ga0070702_100043779 3300005615 Bacteria 2524
159 Ga0070702_100077130 3300005615 Bacteria 1985
160 Ga0070702_100107794 3300005615 Bacteria 1721
161 Ga0068852_100216176 3300005616 Bacteria 1821
162 Ga0068852_100554744 3300005616 Bacteria 1149
163 Ga0068852_101043018 3300005616 Bacteria 837
164 Ga0068852_101935503 3300005616 Bacteria 612
165 Ga0068859_100678381 3300005617 Bacteria 1122
166 Ga0068859_102550143 3300005617 Bacteria 563
167 Ga0068864_100001246 3300005618 Bacteria 21141
168 Ga0068864_100144978 3300005618 Bacteria 2146
169 Ga0068864_100320018 3300005618 Bacteria 1457
170 Ga0068864_100330553 3300005618 Bacteria 1434
171 Ga0068864_100589373 3300005618 Bacteria 1078
172 Ga0068864_102075519 3300005618 Bacteria 575
173 Ga0068866_10515481 3300005718 Bacteria 794
174 Ga0068861_100134863 3300005719 Bacteria 2008
175 Ga0068861_100156966 3300005719 Bacteria 1873
176 Ga0068861_101157354 3300005719 Bacteria 746
177 Ga0068870_10805173 3300005840 Bacteria 657
178 Ga0068863_101112080 3300005841 Bacteria 795
179 Ga0068858_100156339 3300005842 Bacteria 2146
180 Ga0068860_100000882 3300005843 Bacteria 33314
181 Ga0068860_102674595 3300005843 Bacteria 518
182 Ga0068862_101143751 3300005844 Bacteria 775
183 Ga0081455_10651712 3300005937 Bacteria 678
184 Ga0081538_10219542 3300005981 Bacteria 756
185 Ga0081540_1001512 3300005983 Bacteria 19996
186 Ga0081540_1062927 3300005983 Bacteria 1759
187 Ga0081539_10000301 3300005985 Bacteria 111476
188 Ga0081539_10024753 3300005985 Bacteria 3885
189 Ga0070717_10049807 3300006028 Bacteria 3440
190 Ga0070717_10123360 3300006028 Bacteria 2221
191 Ga0070717_10164326 3300006028 Bacteria 1927
192 Ga0070717_10255088 3300006028 Bacteria 1550
193 Ga0070717_10740744 3300006028 Bacteria 893
194 Ga0070717_10849863 3300006028 Bacteria 830
195 Ga0070717_11215088 3300006028 Bacteria 686
196 Ga0070717_11435594 3300006028 Bacteria 626
197 Ga0075365_10005082 3300006038 Bacteria 7063
198 Ga0075365_10058909 3300006038 Bacteria 2558
199 Ga0075365_10083948 3300006038 Bacteria 2161
200 Ga0075365_10245973 3300006038 Bacteria 1256
201 Ga0075365_10529473 3300006038 Bacteria 833
202 Ga0075368_10007644 3300006042 Bacteria 3820
203 Ga0075368_10095287 3300006042 Bacteria 1219
204 Ga0075363_100003533 3300006048 Bacteria 6672
205 Ga0075363_100004855 3300006048 Bacteria 5939
206 Ga0075363_100005297 3300006048 Bacteria 5725
207 Ga0075363_100092171 3300006048 Bacteria 1669
208 Ga0075363_100755052 3300006048 Bacteria 590
209 Ga0075364_10041025 3300006051 Bacteria 3004
210 Ga0075364_10043016 3300006051 Bacteria 2936
211 Ga0075364_10094991 3300006051 Bacteria 1981
212 Ga0070715_10001650 3300006163 Bacteria 6609
213 Ga0070715_10015521 3300006163 Bacteria 2843
214 Ga0070715_10022717 3300006163 Bacteria 2449
215 Ga0070715_10091351 3300006163 Bacteria 1402
216 Ga0070715_10150720 3300006163 Bacteria 1139
217 Ga0070716_100001590 3300006173 Bacteria 10223
218 Ga0070716_100017725 3300006173 Bacteria 3697
219 Ga0070716_100056395 3300006173 Bacteria 2252
220 Ga0070716_100194324 3300006173 Bacteria 1343
221 Ga0070716_100396081 3300006173 Bacteria 992
222 Ga0070712_100148949 3300006175 Bacteria 1794
223 Ga0070712_100841093 3300006175 Bacteria 789
224 Ga0070712_101048767 3300006175 Bacteria 706
225 Ga0075367_10004312 3300006178 Bacteria 6918
226 Ga0075367_10133488 3300006178 Bacteria 1535
227 Ga0097621_100129981 3300006237 Bacteria 2143
228 Ga0097621_100435582 3300006237 Bacteria 1179
229 Ga0097621_101603898 3300006237 Bacteria 619
230 Ga0075370_10087195 3300006353 Bacteria 1798
231 Ga0075428_100000550 3300006844 Bacteria 38346
232 Ga0075428_100050071 3300006844 Bacteria 4582
233 Ga0075428_100081782 3300006844 Bacteria 3524
234 Ga0075430_100057812 3300006846 Bacteria 3261
235 Ga0075431_100023822 3300006847 Bacteria 6266
236 Ga0075431_100058441 3300006847 Bacteria 3980
237 Ga0075431_100365358 3300006847 Bacteria 1449
238 Ga0075431_100993604 3300006847 Bacteria 806
239 Ga0075433_10043688 3300006852 Bacteria 3891
240 Ga0075433_10123849 3300006852 Bacteria 2296
241 Ga0075434_100037030 3300006871 Bacteria 4828
242 Ga0075434_101648579 3300006871 Bacteria 649
243 Ga0075429_100018659 3300006880 Bacteria 6007
244 Ga0075429_100317502 3300006880 Bacteria 1363
245 Ga0075429_100484070 3300006880 Bacteria 1084
246 Ga0068865_100349561 3300006881 Bacteria 1197
247 Ga0068865_101273494 3300006881 Bacteria 653
248 Ga0075436_100017016 3300006914 Bacteria 4977
249 Ga0075436_100033822 3300006914 Bacteria 3523
250 Ga0075436_100055144 3300006914 Bacteria 2744
251 Ga0075436_100124083 3300006914 Bacteria 1808
252 Ga0075436_100155302 3300006914 Bacteria 1612
253 Ga0075436_100197433 3300006914 Bacteria 1424
254 Ga0097620_100678423 3300006931 Bacteria 1122
255 Ga0097620_102550192 3300006931 Bacteria 563
256 Ga0075435_100077280 3300007076 Bacteria 2729
257 Ga0075435_100186502 3300007076 Bacteria 1754
258 Ga0075435_100941926 3300007076 Bacteria 753
259 Ga0075435_101694831 3300007076 Bacteria 555
260 Ga0099795_10098003 3300007788 Bacteria 1146
261 Ga0099795_10168808 3300007788 Unclassified 908
262 Ga0105251_10178502 3300009011 Bacteria 957
263 Ga0111539_10072443 3300009094 Bacteria 4063
264 Ga0111539_10103607 3300009094 Bacteria 3339
265 Ga0111539_11452492 3300009094 Bacteria 795
266 Ga0105245_10033266 3300009098 Bacteria 4568
267 Ga0105245_10072114 3300009098 Bacteria 3137
268 Ga0105245_10186295 3300009098 Bacteria 1986
269 Ga0105245_10277400 3300009098 Bacteria 1637
270 Ga0105245_11322891 3300009098 Bacteria 770
271 Ga0105245_11551034 3300009098 Bacteria 714
272 Ga0105245_11731961 3300009098 Bacteria 677
273 Ga0105247_10397408 3300009101 Bacteria 981
274 Ga0105247_10489185 3300009101 Bacteria 894
275 Ga0114129_10000517 3300009147 Bacteria 47115
276 Ga0114129_10043767 3300009147 Bacteria 6300
277 Ga0114129_10198170 3300009147 Bacteria 2722
278 Ga0114129_10671994 3300009147 Bacteria 1334
279 Ga0105243_10096341 3300009148 Bacteria 2447
280 Ga0105243_10102438 3300009148 Bacteria 2379
281 Ga0105243_10266705 3300009148 Bacteria 1536
282 Ga0105243_10321852 3300009148 Bacteria 1409
283 Ga0105243_10345484 3300009148 Bacteria 1364
284 Ga0105243_10883563 3300009148 Bacteria 888
285 Ga0105241_10177292 3300009174 Bacteria 1765
286 Ga0105241_11432238 3300009174 Bacteria 663
287 Ga0105242_10059768 3300009176 Bacteria 3129
288 Ga0105242_11073203 3300009176 Bacteria 818
289 Ga0105248_10078501 3300009177 Bacteria 3711
290 Ga0105248_10210452 3300009177 Bacteria 2191
291 Ga0105248_10286706 3300009177 Bacteria 1854
292 Ga0105248_11473615 3300009177 Bacteria 770
293 Ga0105248_11484331 3300009177 Bacteria 767
294 Ga0105237_10380082 3300009545 Bacteria 1417
295 Ga0105238_10126613 3300009551 Bacteria 2533
296 Ga0105238_10430481 3300009551 Bacteria 1315
297 Ga0105238_10545302 3300009551 Bacteria 1164
298 Ga0105238_11575637 3300009551 Bacteria 687
299 Ga0105249_10094482 3300009553 Bacteria 2802
300 Ga0105249_10649552 3300009553 Bacteria 1112
301 Ga0105249_10984586 3300009553 Bacteria 912
302 Ga0105249_12363079 3300009553 Bacteria 604
303 Ga0099796_10175098 3300010159 Bacteria 858
304 Ga0099796_10501394 3300010159 Bacteria 543
305 Ga0105239_10003866 3300010375 Bacteria 18175
306 Ga0105239_10025711 3300010375 Bacteria 6483
307 Ga0105239_10192247 3300010375 Bacteria 2284
308 Ga0105246_10099446 3300011119 Bacteria 2114
309 Ga0105246_10112396 3300011119 Bacteria 2003
310 Ga0105246_10191818 3300011119 Bacteria 1582
311 Ga0105246_10344305 3300011119 Bacteria 1219
312 Ga0105246_11069884 3300011119 Bacteria 735
313 Ga0105246_11390842 3300011119 Bacteria 654
314 Ga0157335_1021832 3300012492 Bacteria 614
315 Ga0157371_10032175 3300013102 Bacteria 3776
316 Ga0157371_10058612 3300013102 Bacteria 2731
317 Ga0157371_10836853 3300013102 Bacteria 695
318 Ga0157370_10784106 3300013104 Bacteria 868
319 Ga0157370_10957626 3300013104 Bacteria 776
320 Ga0157369_10010796 3300013105 Bacteria 10399
321 Ga0157369_10252582 3300013105 Bacteria 1840
322 Ga0157369_10262232 3300013105 Bacteria 1802
323 Ga0157369_10811746 3300013105 Bacteria 961
324 Ga0157369_10869833 3300013105 Bacteria 925
325 Ga0157369_11351227 3300013105 Bacteria 726
326 Ga0157369_11686805 3300013105 Bacteria 644
327 Ga0157374_11462394 3300013296 Bacteria 706
328 Ga0163162_10388021 3300013306 Bacteria 1529
329 Ga0163162_10602930 3300013306 Bacteria 1224
330 Ga0163162_11800444 3300013306 Bacteria 700
331 Ga0157372_10003827 3300013307 Bacteria 16176
332 Ga0157372_10176399 3300013307 Bacteria 2473
333 Ga0157372_10192118 3300013307 Bacteria 2365
334 Ga0157372_10572686 3300013307 Bacteria 1316
335 Ga0157372_11041619 3300013307 Bacteria 947
336 Ga0157372_12987023 3300013307 Bacteria 541
337 Ga0157372_13214530 3300013307 Bacteria 521
338 Ga0157375_10005642 3300013308 Bacteria 10897
339 Ga0157375_10006629 3300013308 Bacteria 10075
340 Ga0157375_10814001 3300013308 Bacteria 1082
341 Ga0163163_10042895 3300014325 Bacteria 4433
342 Ga0163163_10080236 3300014325 Bacteria 3263
343 Ga0163163_11023422 3300014325 Bacteria 889
344 Ga0157380_10210439 3300014326 Bacteria 1732
345 Ga0157380_10521427 3300014326 Bacteria 1159
346 Ga0157380_13002027 3300014326 Bacteria 538
347 Ga0182008_10089423 3300014497 Bacteria 1518
348 Ga0157377_10426788 3300014745 Bacteria 909
349 Ga0157379_10038769 3300014968 Bacteria 4250
350 Ga0157379_11195035 3300014968 Bacteria 731
351 Ga0157376_10363778 3300014969 Bacteria 1388
352 Ga0163161_10090775 3300017792 Bacteria 2260
353 Ga0163161_10160926 3300017792 Bacteria 1712
354 Ga0197907_10263981 3300020069 Bacteria 2182
355 Ga0206356_11853272 3300020070 Bacteria 1259
356 Ga0206349_1420320 3300020075 Bacteria 1512
357 Ga0206351_10212896 3300020077 Bacteria 1273
358 Ga0206352_10642632 3300020078 Bacteria 1275
359 Ga0206350_10114685 3300020080 Bacteria 2569
360 Ga0206354_11197999 3300020081 Bacteria 1273
361 Ga0206353_10402442 3300020082 Bacteria 1062
362 Ga0206353_10745009 3300020082 Bacteria 1435
363 Ga0213875_10225645 3300021388 Bacteria 882
364 Ga0224712_10035100 3300022467 Bacteria 1849
365 Ga0207682_10251010 3300025893 Bacteria 824
366 Ga0207692_10000912 3300025898 Bacteria 10677
367 Ga0207692_10004830 3300025898 Bacteria 5361
368 Ga0207692_10040547 3300025898 Bacteria 2298
369 Ga0207692_10127797 3300025898 Bacteria 1431
370 Ga0207692_10900639 3300025898 Bacteria 582
371 Ga0207710_10062505 3300025900 Bacteria 1692
372 Ga0207710_10245670 3300025900 Bacteria 894
373 Ga0207688_10031839 3300025901 Bacteria 2913
374 Ga0207688_10226399 3300025901 Bacteria 1128
375 Ga0207688_10456119 3300025901 Bacteria 797
376 Ga0207647_10008271 3300025904 Bacteria 7470
377 Ga0207647_10031995 3300025904 Bacteria 3383
378 Ga0207647_10171147 3300025904 Bacteria 1264
379 Ga0207685_10009391 3300025905 Bacteria 2839
380 Ga0207685_10011678 3300025905 Bacteria 2650
381 Ga0207685_10443350 3300025905 Bacteria 674
382 Ga0207699_10007237 3300025906 Bacteria 5418
383 Ga0207699_10035153 3300025906 Bacteria 2849
384 Ga0207699_10119325 3300025906 Bacteria 1703
385 Ga0207699_10210466 3300025906 Bacteria 1322
386 Ga0207643_10052970 3300025908 Bacteria 2305
387 Ga0207643_10110487 3300025908 Bacteria 1619
388 Ga0207705_10083637 3300025909 Bacteria 2329
389 Ga0207705_10147116 3300025909 Bacteria 1763
390 Ga0207705_10158850 3300025909 Bacteria 1697
391 Ga0207705_10410237 3300025909 Bacteria 1048
392 Ga0207684_10007287 3300025910 Bacteria 9972
393 Ga0207684_10031813 3300025910 Bacteria 4488
394 Ga0207684_10290658 3300025910 Bacteria 1409
395 Ga0207707_10286151 3300025912 Bacteria 1427
396 Ga0207707_10584468 3300025912 Bacteria 946
397 Ga0207707_11542043 3300025912 Bacteria 525
398 Ga0207671_10136199 3300025914 Bacteria 1888
399 Ga0207671_11485792 3300025914 Bacteria 523
400 Ga0207693_10016510 3300025915 Bacteria 5899
401 Ga0207693_10021973 3300025915 Bacteria 5072
402 Ga0207693_10101953 3300025915 Bacteria 2251
403 Ga0207693_10374507 3300025915 Bacteria 1114
404 Ga0207693_10510811 3300025915 Bacteria 938
405 Ga0207663_10036973 3300025916 Bacteria 2940
406 Ga0207663_10460420 3300025916 Bacteria 982
407 Ga0207662_10019269 3300025918 Bacteria 3880
408 Ga0207662_10220927 3300025918 Bacteria 1234
409 Ga0207662_10807407 3300025918 Bacteria 661
410 Ga0207657_10082537 3300025919 Bacteria 2698
411 Ga0207657_10084314 3300025919 Bacteria 2664
412 Ga0207657_10302809 3300025919 Bacteria 1266
413 Ga0207649_10154646 3300025920 Bacteria 1583
414 Ga0207649_10565395 3300025920 Bacteria 871
415 Ga0207652_10128741 3300025921 Bacteria 2256
416 Ga0207652_10426884 3300025921 Bacteria 1195
417 Ga0207652_10785101 3300025921 Bacteria 846
418 Ga0207646_10001319 3300025922 Bacteria 30760
419 Ga0207646_10008213 3300025922 Bacteria 10490
420 Ga0207646_10367305 3300025922 Bacteria 1300
421 Ga0207646_10408755 3300025922 Bacteria 1226
422 Ga0207646_11194662 3300025922 Bacteria 667
423 Ga0207646_11634991 3300025922 Bacteria 555
424 Ga0207681_10410275 3300025923 Bacteria 1096
425 Ga0207694_11573758 3300025924 Bacteria 554
426 Ga0207659_10790512 3300025926 Bacteria 815
427 Ga0207687_10012913 3300025927 Bacteria 5457
428 Ga0207687_10027986 3300025927 Bacteria 3785
429 Ga0207687_10788875 3300025927 Bacteria 810
430 Ga0207700_10008201 3300025928 Bacteria 6453
431 Ga0207700_10090102 3300025928 Bacteria 2419
432 Ga0207700_10105655 3300025928 Bacteria 2255
433 Ga0207700_10134288 3300025928 Bacteria 2025
434 Ga0207700_10134647 3300025928 Bacteria 2022
435 Ga0207700_10225360 3300025928 Bacteria 1591
436 Ga0207700_10258258 3300025928 Bacteria 1491
437 Ga0207700_10505543 3300025928 Bacteria 1070
438 Ga0207700_10688514 3300025928 Bacteria 912
439 Ga0207700_10723817 3300025928 Bacteria 889
440 Ga0207664_10001557 3300025929 Bacteria 15047
441 Ga0207664_10018816 3300025929 Bacteria 5095
442 Ga0207664_10044030 3300025929 Bacteria 3493
443 Ga0207664_10134335 3300025929 Bacteria 2086
444 Ga0207664_10141108 3300025929 Bacteria 2038
445 Ga0207664_10144057 3300025929 Bacteria 2019
446 Ga0207664_10207160 3300025929 Bacteria 1695
447 Ga0207664_10251096 3300025929 Bacteria 1544
448 Ga0207664_10368204 3300025929 Bacteria 1274
449 Ga0207664_10487623 3300025929 Bacteria 1103
450 Ga0207664_11591660 3300025929 Bacteria 575
451 Ga0207690_10011248 3300025932 Bacteria 5344
452 Ga0207690_10217220 3300025932 Bacteria 1461
453 Ga0207690_11770413 3300025932 Bacteria 516
454 Ga0207706_10644213 3300025933 Bacteria 908
455 Ga0207706_11412657 3300025933 Bacteria 571
456 Ga0207686_10076344 3300025934 Bacteria 2172
457 Ga0207709_10058737 3300025935 Bacteria 2391
458 Ga0207709_10116483 3300025935 Bacteria 1796
459 Ga0207709_10154800 3300025935 Bacteria 1592
460 Ga0207670_11104346 3300025936 Bacteria 670
461 Ga0207669_10510203 3300025937 Bacteria 964
462 Ga0207704_10296751 3300025938 Bacteria 1236
463 Ga0207704_10419398 3300025938 Bacteria 1061
464 Ga0207704_10662430 3300025938 Bacteria 861
465 Ga0207704_11277059 3300025938 Bacteria 627
466 Ga0207665_10003665 3300025939 Bacteria 10262
467 Ga0207665_10004055 3300025939 Bacteria 9776
468 Ga0207665_10043834 3300025939 Bacteria 2992
469 Ga0207665_10606864 3300025939 Bacteria 855
470 Ga0207665_10617002 3300025939 Bacteria 848
471 Ga0207691_10061400 3300025940 Bacteria 3414
472 Ga0207691_10447246 3300025940 Bacteria 1100
473 Ga0207711_10256991 3300025941 Bacteria 1605
474 Ga0207711_10379105 3300025941 Bacteria 1312
475 Ga0207711_11283892 3300025941 Bacteria 674
476 Ga0207689_10860342 3300025942 Bacteria 765
477 Ga0207661_10008501 3300025944 Bacteria 7337
478 Ga0207661_10051113 3300025944 Bacteria 3297
479 Ga0207661_10072555 3300025944 Bacteria 2816
480 Ga0207661_10139064 3300025944 Bacteria 2088
481 Ga0207679_10133516 3300025945 Bacteria 1995
482 Ga0207679_10312853 3300025945 Bacteria 1357
483 Ga0207667_10468545 3300025949 Bacteria 1279
484 Ga0207667_12007063 3300025949 Bacteria 539
485 Ga0207651_10463972 3300025960 Bacteria 1089
486 Ga0207712_10095250 3300025961 Bacteria 2201
487 Ga0207712_10198365 3300025961 Bacteria 1589
488 Ga0207712_10521195 3300025961 Bacteria 1019
489 Ga0207712_11126959 3300025961 Bacteria 699
490 Ga0207668_10811464 3300025972 Bacteria 829
491 Ga0207668_11328029 3300025972 Bacteria 648
492 Ga0207658_10043437 3300025986 Bacteria 3267
493 Ga0207658_10064828 3300025986 Bacteria 2742
494 Ga0207658_10175811 3300025986 Bacteria 1768
495 Ga0207677_10782812 3300026023 Bacteria 853
496 Ga0207677_11094463 3300026023 Bacteria 726
497 Ga0207703_10275635 3300026035 Bacteria 1525
498 Ga0207703_10935928 3300026035 Bacteria 830
499 Ga0207639_10734902 3300026041 Bacteria 917
500 Ga0207639_11460252 3300026041 Bacteria 642
501 Ga0207678_10086770 3300026067 Bacteria 2674
502 Ga0207678_10138196 3300026067 Bacteria 2079
503 Ga0207678_10296012 3300026067 Bacteria 1390
504 Ga0207678_10547758 3300026067 Bacteria 1011
505 Ga0207708_10032894 3300026075 Bacteria 3937
506 Ga0207702_10012578 3300026078 Bacteria 7041
507 Ga0207702_10258128 3300026078 Bacteria 1640
508 Ga0207702_10332251 3300026078 Bacteria 1450
509 Ga0207702_10432726 3300026078 Bacteria 1274
510 Ga0207702_10806956 3300026078 Bacteria 928
511 Ga0207641_10096432 3300026088 Bacteria 2597
512 Ga0207641_10592259 3300026088 Bacteria 1085
513 Ga0207641_11008885 3300026088 Bacteria 829
514 Ga0207648_10255716 3300026089 Bacteria 1562
515 Ga0207676_10005287 3300026095 Bacteria 9143
516 Ga0207676_10428034 3300026095 Bacteria 1243
517 Ga0207676_10774922 3300026095 Bacteria 934
518 Ga0207676_10851780 3300026095 Bacteria 892
519 Ga0207676_12201735 3300026095 Bacteria 549
520 Ga0207674_10063146 3300026116 Bacteria 3739
521 Ga0207674_10292033 3300026116 Bacteria 1579
522 Ga0207674_10292423 3300026116 Bacteria 1578
523 Ga0207675_100407249 3300026118 Bacteria 1341
524 Ga0207675_100527475 3300026118 Bacteria 1178
525 Ga0207675_101194659 3300026118 Bacteria 781
526 Ga0207683_10047551 3300026121 Bacteria 3757
527 Ga0207683_10087374 3300026121 Bacteria 2772
528 Ga0207683_10213656 3300026121 Bacteria 1756
529 Ga0207683_10357003 3300026121 Bacteria 1342
530 Ga0207683_10842318 3300026121 Bacteria 851
531 Ga0207683_11213061 3300026121 Bacteria 699
532 Ga0207683_11607668 3300026121 Bacteria 599
533 Ga0207698_10538837 3300026142 Bacteria 1142
534 Ga0207698_11815532 3300026142 Bacteria 625
535 Ga0209179_1048912 3300027512 Bacteria 903
536 Ga0209813_10003830 3300027866 Bacteria 3556
537 Ga0209813_10036283 3300027866 Bacteria 1480
538 Ga0207428_10114133 3300027907 Bacteria 2076
539 Ga0268266_10013813 3300028379 Bacteria 6952
540 Ga0268266_10639544 3300028379 Bacteria 1023
541 Ga0268266_11933246 3300028379 Bacteria 564
542 Ga0268264_10300571 3300028381 Bacteria 1511
543 Ga0265336_10013374 3300028666 Bacteria 2738
544 Ga0307515_10034004 3300028794 Bacteria 8367
545 Ga0307515_10707349 3300028794 Bacteria 624
546 Ga0265338_10001861 3300028800 Bacteria 33146
547 Ga0265330_10218835 3300031235 Bacteria 804
548 Ga0265325_10140511 3300031241 Bacteria 1149
549 Ga0265325_10548580 3300031241 Bacteria 500
550 Ga0307513_10075382 3300031456 Bacteria 3503
551 Ga0316576_10118391 3300031727 Bacteria 1988
552 Ga0316576_10249759 3300031727 Bacteria 1332
553 Ga0307516_10996578 3300031730 Bacteria 510
554 Ga0307405_10114164 3300031731 Bacteria 1835
555 Ga0307413_11793260 3300031824 Bacteria 549
556 Ga0307518_10225066 3300031838 Bacteria 1220
557 Ga0307410_10417753 3300031852 Bacteria 1087
558 Ga0307410_11638336 3300031852 Bacteria 569
559 Ga0307406_10073532 3300031901 Bacteria 2248
560 Ga0307406_10690906 3300031901 Bacteria 851
561 Ga0307406_10963659 3300031901 Bacteria 730
562 Ga0307407_10263087 3300031903 Bacteria 1187
563 Ga0307407_11249620 3300031903 Bacteria 581
564 Ga0307412_10380771 3300031911 Bacteria 1142
565 Ga0307409_100017289 3300031995 Bacteria 4802
566 Ga0307409_100052238 3300031995 Bacteria 3132
567 Ga0307409_100244769 3300031995 Bacteria 1635
568 Ga0307409_100347823 3300031995 Bacteria 1398
569 Ga0307409_100536796 3300031995 Bacteria 1146
570 Ga0307409_101224718 3300031995 Bacteria 774
571 Ga0307409_101723084 3300031995 Bacteria 655
572 Ga0307409_102770322 3300031995 Bacteria 518
573 Ga0307416_100118123 3300032002 Bacteria 2356
574 Ga0307416_100233044 3300032002 Bacteria 1777
575 Ga0307416_101705438 3300032002 Bacteria 735
576 Ga0307414_10918830 3300032004 Bacteria 803
577 Ga0307415_100028523 3300032126 Bacteria 3553
578 Ga0307415_100064890 3300032126 Bacteria 2542
579 Ga0307415_100267361 3300032126 Bacteria 1399
580 Ga0307415_102556235 3300032126 Bacteria 503
581 Ga0307507_10384818 3300033179 Bacteria 806
582 Ga0373958_0160707 3300034819 Bacteria 568
583 Ga0373926_0018669 3300035083 Bacteria 2387
584 Ga0373926_0019617 3300035083 Bacteria 2331
585 Ga0373928_0009595 3300035084 Bacteria 1891
586 Ga0373934_0000025 3300035086 Bacteria 49119
587 Ga0373934_0012177 3300035086 Bacteria 3246
588 Ga0373934_0018287 3300035086 Bacteria 2680
589 Ga0373934_0019874 3300035086 Bacteria 2581
590 Ga0373934_0020746 3300035086 Bacteria 2527
591 Ga0373940_0291128 3300035088 Bacteria 560
592 Ga0373944_0020636 3300035089 Bacteria 1900
593 Ga0373944_0089003 3300035089 Bacteria 1030
594 Ga0373944_0139883 3300035089 Bacteria 847
595 Ga0373951_0122561 3300035091 Bacteria 709
596 Ga0373952_0016920 3300035092 Bacteria 1490
597 Ga0373923_0042500 3300035111 Bacteria 1877
598 Ga0373923_0098372 3300035111 Bacteria 1287
599 Ga0373923_0229013 3300035111 Bacteria 865
600 Ga0373923_0704767 3300035111 Bacteria 501
601 Ga0373936_0007751 3300035113 Bacteria 4031
602 Ga0373936_0013843 3300035113 Bacteria 3079
603 Ga0373936_0208675 3300035113 Bacteria 864
604 Ga0373939_0285111 3300035114 Bacteria 654
605 Ga0373941_0512986 3300035115 Bacteria 511
606 Ga0373945_0031841 3300035116 Bacteria 1865
607 Ga0373945_0185091 3300035116 Bacteria 859
608 Ga0373945_0265668 3300035116 Bacteria 728
609 Ga0373953_0000883 3300035117 Bacteria 8399
610 Ga0373953_0012841 3300035117 Bacteria 2975
611 Ga0373953_0103602 3300035117 Bacteria 1199
612 Ga0373953_0135916 3300035117 Bacteria 1050
613 Ga0373954_0012176 3300035118 Bacteria 3825
614 Ga0373954_0338081 3300035118 Bacteria 743
615 Ga0373954_0473104 3300035118 Bacteria 620
616 Ga0373956_0000119 3300035119 Bacteria 27324
617 Ga0373956_0000574 3300035119 Bacteria 15060
618 Ga0373956_0019935 3300035119 Bacteria 2848
619 Ga0373956_0073902 3300035119 Bacteria 1558
620 Ga0373956_0174461 3300035119 Bacteria 1015
621 Ga0373957_0000264 3300035120 Bacteria 13148
622 Ga0373957_0002235 3300035120 Bacteria 5480
623 Ga0373957_0090508 3300035120 Bacteria 1216
624 Ga0373943_0018410 3300035170 Bacteria 3208
625 Ga0373943_0099509 3300035170 Bacteria 1519
626 Ga0373943_0683442 3300035170 Bacteria 607
627 Ga0373943_0700673 3300035170 Bacteria 600
628 Ga0373946_0005624 3300035171 Bacteria 4527
629 Ga0373946_0046854 3300035171 Bacteria 1794
630 Ga0373946_0600150 3300035171 Bacteria 571
631 Ga0373946_0689580 3300035171 Bacteria 533
632 Ga0373946_0692906 3300035171 Bacteria 532
633 Ga0373955_0000149 3300035172 Bacteria 27794
634 Ga0373955_0013651 3300035172 Bacteria 3935
635 Ga0373955_0027059 3300035172 Bacteria 2960
636 Ga0373955_0120408 3300035172 Bacteria 1525
637 Ga0373955_0170575 3300035172 Bacteria 1287
638 Ga0373955_0817298 3300035172 Bacteria 573
639 Ga0373924_0001940 3300035410 Bacteria 6877
640 Ga0373924_0173346 3300035410 Bacteria 948
641 Ga0373924_0179529 3300035410 Bacteria 931
642 Ga0373924_0181776 3300035410 Bacteria 925
643 Ga0373931_0031311 3300035691 Bacteria 2745
644 Ga0373935_0030337 3300035692 Bacteria 3350
645 Ga0373935_0053930 3300035692 Bacteria 2558
646 Ga0373935_0195239 3300035692 Bacteria 1396
647 Ga0373935_0216645 3300035692 Bacteria 1328
648 Ga0373935_0470873 3300035692 Bacteria 909
649 Ga0373927_0016408 3300035695 Bacteria 4884
650 Ga0373927_0053687 3300035695 Bacteria 2607
651 Ga0373927_0210505 3300035695 Bacteria 1277
652 Ga0373927_0479793 3300035695 Bacteria 822
653 Ga0373927_0514303 3300035695 Bacteria 791
654 Ga0373927_1159178 3300035695 Bacteria 510
655 Ga0373933_0000001 3300035724 Bacteria 228234
656 Ga0373933_0004044 3300035724 Bacteria 8080
657 Ga0373933_0074097 3300035724 Bacteria 2075
658 Ga0373933_0305448 3300035724 Bacteria 1030
659 Ga0373947_0000001 3300035725 Bacteria 510932
660 Ga0373947_0004746 3300035725 Bacteria 7970
661 Ga0373947_0179599 3300035725 Bacteria 1377
662 Ga0373947_0183317 3300035725 Bacteria 1364
663 Ga0373947_0203473 3300035725 Bacteria 1296
664 Ga0373937_0003722 3300036401 Bacteria 12886
665 Ga0373937_0007847 3300036401 Bacteria 9253
666 Ga0373937_0008016 3300036401 Bacteria 9155
667 Ga0373937_0027495 3300036401 Bacteria 5143
668 Ga0373937_0378438 3300036401 Bacteria 1342
669 Ga0373937_0678904 3300036401 Bacteria 976
670 Ga0316584_0007960 3300036712 Bacteria 7272
671 Ga0373925_0007907 3300037068 Bacteria 7741
672 Ga0373925_0018948 3300037068 Bacteria 5003
673 Ga0373925_0052242 3300037068 Bacteria 3053
674 Ga0373925_0060902 3300037068 Bacteria 2834
675 Ga0373925_0250231 3300037068 Bacteria 1421
676 Ga0373925_0692281 3300037068 Bacteria 840
677 Ga0373925_0814952 3300037068 Bacteria 769
678 Ga0373925_1003582 3300037068 Bacteria 687
679 Ga0373925_1551390 3300037068 Bacteria 541
680 Ga0395899_0000961 3300037312 Bacteria 26769
681 Ga0395899_0015944 3300037312 Bacteria 5731
682 Ga0395899_0717072 3300037312 Bacteria 626
683 Ga0395900_0078565 3300037418 Bacteria 3390
684 Ga0395900_0162786 3300037418 Bacteria 2275
685 Ga0395900_0651599 3300037418 Bacteria 990
686 Ga0395900_1567802 3300037418 Bacteria 570
687 Ga0395898_0066518 3300037466 Bacteria 3491
688 Ga0395898_0110468 3300037466 Bacteria 2635
689 Ga0395898_0120237 3300037466 Bacteria 2516
690 Ga0395898_1816070 3300037466 Unclassified 531
691 Ga0395905_0048592 3300037471 Bacteria 3976
692 Ga0395905_0272425 3300037471 Bacteria 1579
693 Ga0436364_0002994 3300037853 Bacteria 1874
694 Ga0436364_0106996 3300037853 Bacteria 14379
695 Ga0436364_1027047 3300037853 Bacteria 1310
696 Ga0436364_1505134 3300037853 Bacteria 934
697 Ga0395901_0011041 3300038443 Bacteria 9150
698 Ga0395901_0048023 3300038443 Bacteria 4432
699 Ga0395901_0086751 3300038443 Bacteria 3272
700 Ga0395901_0186072 3300038443 Bacteria 2178
701 Ga0395901_0186337 3300038443 Bacteria 2176
702 Ga0436365_1465630 3300039437 Bacteria 2516
703 Ga0436363_0317523 3300039450 Bacteria 1097
704 Ga0436363_0964495 3300039450 Bacteria 1514
705 Ga0439438_065533 3300041405 Bacteria 904
706 Ga0439447_025027 3300041407 Bacteria 1541
707 Ga0451791_1151347 3300041451 Bacteria 552
708 Ga0451793_0398120 3300041452 Bacteria 514
709 Ga0451797_1229019 3300041453 Bacteria 1559
710 Ga0451802_1521807 3300041460 Bacteria 687
711 Ga0451833_0553474 3300041491 Bacteria 1153
712 Ga0451839_1549090 3300041496 Bacteria 630
713 Ga0451843_0318951 3300041509 Bacteria 629
714 Ga0451843_0494901 3300041509 Bacteria 1686
715 Ga0451853_0045329 3300041512 Bacteria 538
716 Ga0451853_0618515 3300041512 Bacteria 639
717 Ga0451853_1218569 3300041512 Bacteria 563
718 Ga0439432_023800 3300042006 Bacteria 2015
719 Ga0439432_179066 3300042006 Bacteria 618
720 Ga0439449_0140643 3300042007 Bacteria 898
721 Ga0439464_0020493 3300042439 Bacteria 1811
722 Ga0439440_0173765 3300042993 Bacteria 628
723 Ga0466969_0129901 3300044656 Bacteria 1168
724 Ga0466965_0443774 3300044683 Bacteria 722
725 Ga0466965_0771583 3300044683 Bacteria 555
726 Ga0466966_0006938 3300044684 Bacteria 7501
727 Ga0466966_0028740 3300044684 Bacteria 3619
728 Ga0466961_0060596 3300044693 Bacteria 2406
729 Ga0466961_0066816 3300044693 Bacteria 2283
730 Ga0466961_0508529 3300044693 Bacteria 727
731 Ga0466963_0028890 3300044694 Bacteria 3564
732 Ga0466963_0070988 3300044694 Bacteria 2343
733 Ga0466963_0200758 3300044694 Bacteria 1395
734 Ga0466963_0265612 3300044694 Bacteria 1205
735 Ga0466963_0348456 3300044694 Bacteria 1043
736 Ga0466963_0440355 3300044694 Bacteria 919
737 Ga0466963_0902858 3300044694 Bacteria 623
738 Ga0466964_0712213 3300044706 Bacteria 560
739 Ga0466971_0047103 3300044719 Bacteria 1938
740 Ga0466970_0041029 3300044765 Bacteria 2459
741 Ga0466957_0064436 3300044842 Bacteria 2255
742 Ga0466960_0003052 3300044901 Bacteria 6402
743 Ga0466960_0014114 3300044901 Bacteria 3410
744 Ga0466960_0032770 3300044901 Bacteria 2409
745 Ga0466960_0206374 3300044901 Bacteria 1076
746 Ga0466960_0437836 3300044901 Bacteria 758
747 Ga0466960_0801468 3300044901 Bacteria 570
748 Ga0466959_0001340 3300045049 Bacteria 15000
749 Ga0451576_1822625 3300045051 Bacteria 629
750 Ga0466958_0097359 3300045836 Bacteria 1826
751 Ga0466958_0129077 3300045836 Bacteria 1586
752 Ga0466967_0032548 3300045976 Bacteria 4403
753 Ga0466967_0035867 3300045976 Bacteria 4226
754 Ga0466967_0308852 3300045976 Bacteria 1523
755 Ga0466967_0688094 3300045976 Bacteria 1012
756 Ga0466967_1750573 3300045976 Bacteria 619
757 Ga0495627_044613 3300046453 Bacteria 1353
758 Ga0495592_0000002 3300046454 Bacteria 209491
759 Ga0495592_0011520 3300046454 Bacteria 6693
760 Ga0495592_0522559 3300046454 Bacteria 733
761 Ga0495603_0021682 3300046455 Bacteria 3891
762 Ga0495603_0355312 3300046455 Bacteria 841
763 Ga0495603_0824119 3300046455 Bacteria 529
764 Ga0495629_0006569 3300046459 Bacteria 8616
765 Ga0495629_0048554 3300046459 Bacteria 2975
766 Ga0495629_0177987 3300046459 Bacteria 1474
767 Ga0495629_0226454 3300046459 Bacteria 1289
768 Ga0495629_0264740 3300046459 Bacteria 1181
769 Ga0495629_0767668 3300046459 Bacteria 637
770 Ga0495629_0825888 3300046459 Bacteria 610
771 Ga0495641_0007210 3300046461 Bacteria 6999
772 Ga0495641_0157368 3300046461 Bacteria 1016
773 Ga0495641_0361450 3300046461 Bacteria 657
774 Ga0495641_0579447 3300046461 Bacteria 513
775 Ga0495651_0000002 3300046462 Bacteria 209492
776 Ga0495651_0004885 3300046462 Bacteria 10252
777 Ga0495651_0023699 3300046462 Bacteria 4772
778 Ga0495651_0040760 3300046462 Bacteria 3609
779 Ga0495651_0294685 3300046462 Bacteria 1090
780 Ga0495651_0414752 3300046462 Bacteria 876
781 Ga0495653_0061535 3300046463 Bacteria 2840
782 Ga0495653_0071947 3300046463 Bacteria 2583
783 Ga0495653_0147769 3300046463 Bacteria 1645
784 Ga0495653_0190316 3300046463 Bacteria 1401
785 Ga0495653_0254613 3300046463 Bacteria 1163
786 Ga0495582_0046302 3300046473 Bacteria 2395
787 Ga0495582_0098938 3300046473 Bacteria 1632
788 Ga0495582_0134070 3300046473 Bacteria 1400
789 Ga0495582_0310631 3300046473 Bacteria 907
790 Ga0495639_0053636 3300046475 Bacteria 1837
791 Ga0495639_0086539 3300046475 Bacteria 1466
792 Ga0495639_0259570 3300046475 Bacteria 860
793 Ga0495662_0014137 3300046476 Bacteria 3884
794 Ga0495662_0048557 3300046476 Bacteria 2049
795 Ga0495662_0146170 3300046476 Bacteria 1164
796 Ga0495662_0362734 3300046476 Bacteria 712
797 Ga0495662_0487115 3300046476 Bacteria 605
798 Ga0495664_0005386 3300046477 Bacteria 7025
799 Ga0495664_0021110 3300046477 Bacteria 3761
800 Ga0495664_0048897 3300046477 Bacteria 2510
801 Ga0495664_0057880 3300046477 Bacteria 2306
802 Ga0495664_0093172 3300046477 Bacteria 1812
803 Ga0495584_0285146 3300046491 Bacteria 839
804 Ga0495594_0157535 3300046499 Bacteria 1290
805 Ga0495594_0251293 3300046499 Bacteria 1007
806 Ga0495594_0302709 3300046499 Bacteria 911
807 Ga0495608_0000118 3300046511 Bacteria 56564
808 Ga0495608_0051171 3300046511 Bacteria 2738
809 Ga0495608_0065521 3300046511 Bacteria 2379
810 Ga0495608_0106289 3300046511 Bacteria 1807
811 Ga0495608_0122677 3300046511 Bacteria 1665
812 Ga0495608_0319763 3300046511 Bacteria 959
813 Ga0495608_0383652 3300046511 Bacteria 861
814 Ga0495618_0064378 3300046514 Bacteria 2329
815 Ga0495618_0088489 3300046514 Bacteria 1980
816 Ga0495618_0135270 3300046514 Bacteria 1577
817 Ga0495618_0157402 3300046514 Bacteria 1449
818 Ga0495618_0247301 3300046514 Bacteria 1119
819 Ga0495618_0256858 3300046514 Bacteria 1095
820 Ga0495628_0042995 3300046516 Bacteria 3601
821 Ga0495628_0226748 3300046516 Bacteria 1401
822 Ga0495628_0423196 3300046516 Bacteria 970
823 Ga0495630_0023351 3300046517 Bacteria 4572
824 Ga0495630_0111057 3300046517 Bacteria 2076
825 Ga0495630_0733000 3300046517 Bacteria 756
826 Ga0495630_1079827 3300046517 Bacteria 609
827 Ga0495666_0187862 3300046526 Bacteria 952
828 Ga0495652_0001668 3300046529 Bacteria 24094
829 Ga0495652_0041720 3300046529 Bacteria 3959
830 Ga0495652_0073193 3300046529 Bacteria 2854
831 Ga0495652_0084052 3300046529 Bacteria 2618
832 Ga0495652_0142590 3300046529 Bacteria 1882
833 Ga0495652_0165787 3300046529 Bacteria 1710
834 Ga0495652_0401645 3300046529 Bacteria 970
835 Ga0495665_0001969 3300046531 Bacteria 11099
836 Ga0495665_0023344 3300046531 Bacteria 3321
837 Ga0495665_0086593 3300046531 Bacteria 1646
838 Ga0495665_0265741 3300046531 Unclassified 882
839 Ga0495640_0045512 3300046533 Bacteria 3044
840 Ga0495640_0046734 3300046533 Bacteria 2997
841 Ga0495640_0066006 3300046533 Bacteria 2441
842 Ga0495640_0108235 3300046533 Bacteria 1818
843 Ga0495640_0516737 3300046533 Bacteria 726
844 Ga0495640_0559515 3300046533 Bacteria 693
845 Ga0495586_0487291 3300046535 Bacteria 711
846 Ga0495586_0821794 3300046535 Bacteria 536
847 Ga0495587_0000013 3300046536 Bacteria 195619
848 Ga0495587_0012350 3300046536 Bacteria 5379
849 Ga0495587_0028032 3300046536 Bacteria 3428
850 Ga0495587_0034666 3300046536 Bacteria 3043
851 Ga0495587_0090843 3300046536 Bacteria 1764
852 Ga0495645_0008113 3300046543 Bacteria 7319
853 Ga0495645_0039473 3300046543 Bacteria 3443
854 Ga0495645_0100524 3300046543 Bacteria 2057
855 Ga0495645_0347432 3300046543 Bacteria 956
856 Ga0495645_0547946 3300046543 Bacteria 717
857 Ga0495645_0574319 3300046543 Bacteria 696
858 Ga0495667_0000016 3300046559 Bacteria 195635
859 Ga0495667_0006731 3300046559 Bacteria 7797
860 Ga0495667_0033211 3300046559 Bacteria 3453
861 Ga0495667_0078679 3300046559 Bacteria 2144
862 Ga0495667_0179413 3300046559 Bacteria 1359
863 Ga0495667_0280543 3300046559 Bacteria 1057
864 Ga0495634_0045516 3300046642 Bacteria 2965
865 Ga0495634_0056071 3300046642 Bacteria 2634
866 Ga0495634_0072245 3300046642 Bacteria 2269
867 Ga0495634_0288541 3300046642 Bacteria 995
868 Ga0495611_0445214 3300046648 Bacteria 591
869 Ga0495625_0064540 3300046660 Bacteria 2583
870 Ga0495625_0555473 3300046660 Bacteria 695
871 Ga0495635_0000951 3300046663 Bacteria 19107
872 Ga0495635_0067163 3300046663 Bacteria 2459
873 Ga0495635_0086387 3300046663 Bacteria 2146
874 Ga0495635_0174693 3300046663 Bacteria 1460
875 Ga0495661_0522444 3300046665 Bacteria 564
876 Ga0495588_0152958 3300046674 Bacteria 1219
877 Ga0495657_0013669 3300046675 Bacteria 5979
878 Ga0495657_0020719 3300046675 Bacteria 4727
879 Ga0495657_0054676 3300046675 Bacteria 2665
880 Ga0495657_0081640 3300046675 Bacteria 2090
881 Ga0495657_0303533 3300046675 Bacteria 952
882 Ga0495657_0548406 3300046675 Bacteria 672
883 Ga0495599_0000006 3300046678 Bacteria 283487
884 Ga0495599_0008992 3300046678 Bacteria 6084
885 Ga0495599_0089190 3300046678 Bacteria 1925
886 Ga0495599_0156415 3300046678 Bacteria 1410
887 Ga0495599_0168346 3300046678 Bacteria 1352
888 Ga0495623_0004288 3300046679 Bacteria 9388
889 Ga0495623_0020897 3300046679 Bacteria 4230
890 Ga0495623_0032320 3300046679 Bacteria 3364
891 Ga0495623_0072472 3300046679 Bacteria 2142
892 Ga0495623_0398418 3300046679 Bacteria 741
893 Ga0495646_0027864 3300046680 Bacteria 3541
894 Ga0495646_0141826 3300046680 Bacteria 1343
895 Ga0495646_0214382 3300046680 Bacteria 1043
896 Ga0495647_0050217 3300046681 Bacteria 1618
897 Ga0495647_0163558 3300046681 Bacteria 960
898 Ga0495658_0021946 3300046683 Bacteria 3371
899 Ga0495658_0052718 3300046683 Bacteria 2308
900 Ga0495658_0152745 3300046683 Bacteria 1419
901 Ga0495658_0525427 3300046683 Bacteria 757
902 Ga0495613_0051959 3300046689 Bacteria 3019
903 Ga0495613_0370426 3300046689 Bacteria 981
904 Ga0495613_0373270 3300046689 Bacteria 976
905 Ga0495613_0717199 3300046689 Bacteria 657
906 Ga0495624_0047183 3300046690 Bacteria 2737
907 Ga0495589_0403431 3300046794 Bacteria 628
908 Ga0495600_0011545 3300046809 Bacteria 5507
909 Ga0495600_0032600 3300046809 Bacteria 3381
910 Ga0495600_0033158 3300046809 Bacteria 3352
911 Ga0495600_0186529 3300046809 Bacteria 1335
912 Ga0495600_0481059 3300046809 Bacteria 765
913 Ga0495660_0271627 3300046810 Bacteria 779
914 Ga0495581_0001362 3300047315 Bacteria 13519
915 Ga0495581_0092761 3300047315 Bacteria 1752
916 Ga0495604_0000015 3300047317 Bacteria 195635
917 Ga0495604_0022292 3300047317 Bacteria 5056
918 Ga0495604_0044946 3300047317 Bacteria 3448
919 Ga0495604_0094598 3300047317 Bacteria 2208
920 Ga0495604_0101866 3300047317 Bacteria 2108
921 Ga0495604_0162014 3300047317 Bacteria 1580
922 Ga0495636_0178433 3300047318 Bacteria 963
923 Ga0495674_0004290 3300047319 Bacteria 13718
924 Ga0495674_0004688 3300047319 Bacteria 13148
925 Ga0495674_0025323 3300047319 Bacteria 5441
926 Ga0495674_0038440 3300047319 Bacteria 4295
927 Ga0495674_0248134 3300047319 Bacteria 1465
928 Ga0495674_0360696 3300047319 Bacteria 1178
929 Ga0495676_0017368 3300047321 Bacteria 6363
930 Ga0495676_0065828 3300047321 Bacteria 2811
931 Ga0495676_0135711 3300047321 Bacteria 1769
932 Ga0495680_0000380 3300047322 Bacteria 49632
933 Ga0495680_0006296 3300047322 Bacteria 11056
934 Ga0495680_0070996 3300047322 Bacteria 2652
935 Ga0495680_0071715 3300047322 Bacteria 2636
936 Ga0495680_0104904 3300047322 Bacteria 2102
937 Ga0495680_0439527 3300047322 Bacteria 894
938 Ga0495680_0622819 3300047322 Bacteria 720
939 Ga0495675_0003988 3300047444 Bacteria 8945
940 Ga0495675_0006842 3300047444 Bacteria 7000
941 Ga0495675_0470795 3300047444 Bacteria 724
942 Ga0495675_0782069 3300047444 Bacteria 529
943 Ga0495684_0048038 3300047471 Bacteria 3263
944 Ga0495684_0122951 3300047471 Bacteria 1953
945 Ga0495684_0194699 3300047471 Bacteria 1497
946 Ga0495684_0331563 3300047471 Bacteria 1085
947 Ga0495684_0482889 3300047471 Bacteria 855
948 Ga0495684_0609413 3300047471 Bacteria 735
949 Ga0495684_0722282 3300047471 Bacteria 658
950 Ga0495593_0026990 3300047673 Bacteria 3165
951 Ga0495593_0117412 3300047673 Bacteria 1355
952 Ga0495593_0149911 3300047673 Bacteria 1179
953 Ga0495602_0000013 3300048088 Bacteria 195591
954 Ga0495602_0018082 3300048088 Bacteria 7050
955 Ga0495602_0025113 3300048088 Bacteria 5771
956 Ga0495602_0048758 3300048088 Bacteria 3801
957 Ga0495602_0080716 3300048088 Bacteria 2738
958 Ga0495602_0460188 3300048088 Bacteria 896
959 Ga0495614_0009992 3300048089 Bacteria 4189
960 Ga0496100_0096952 3300048903 Bacteria 2024
961 Ga0496100_0120895 3300048903 Bacteria 1832
962 Ga0496100_0160710 3300048903 Bacteria 1610
963 Ga0496100_0209476 3300048903 Bacteria 1425
964 Ga0496100_0237026 3300048903 Bacteria 1345
965 Ga0496100_1037067 3300048903 Bacteria 646
966 Ga0496101_0091077 3300048904 Bacteria 2269
967 Ga0496101_0157565 3300048904 Bacteria 1740
968 Ga0496101_0435883 3300048904 Bacteria 1033
969 Ga0496101_0508824 3300048904 Bacteria 951
970 Ga0496102_0022401 3300048905 Bacteria 5597
971 Ga0496102_0024776 3300048905 Bacteria 5337
972 Ga0496102_0053240 3300048905 Bacteria 3689
973 Ga0496102_0162428 3300048905 Bacteria 2101
974 Ga0496102_0450266 3300048905 Bacteria 1208
975 Ga0496102_0655086 3300048905 Bacteria 973
976 Ga0496102_1015256 3300048905 Bacteria 750
977 Ga0496102_1270546 3300048905 Bacteria 655
978 Ga0496103_0090698 3300048906 Bacteria 1928
979 Ga0496103_0164217 3300048906 Bacteria 1425
980 Ga0496103_0722737 3300048906 Bacteria 631
981 Ga0496104_0006284 3300048907 Bacteria 10442
982 Ga0496104_0049400 3300048907 Bacteria 3967
983 Ga0496104_0066466 3300048907 Bacteria 3423
984 Ga0496104_0080576 3300048907 Bacteria 3104
985 Ga0496104_0138954 3300048907 Bacteria 2335
986 Ga0496104_0272209 3300048907 Bacteria 1606
987 Ga0496104_0570083 3300048907 Bacteria 1042
988 Ga0496104_0634736 3300048907 Bacteria 977
989 Ga0496104_0870787 3300048907 Bacteria 806
990 Ga0496104_1097861 3300048907 Bacteria 699
991 Ga0496105_0023882 3300048908 Bacteria 4965
992 Ga0496105_0034742 3300048908 Bacteria 4147
993 Ga0496105_0065744 3300048908 Bacteria 2993
994 Ga0496105_0106866 3300048908 Bacteria 2310
995 Ga0496105_0149922 3300048908 Bacteria 1917
996 Ga0496105_0218298 3300048908 Bacteria 1552
997 Ga0496105_0246702 3300048908 Bacteria 1448
998 Ga0496106_0059663 3300048909 Bacteria 2890
999 Ga0496106_0174668 3300048909 Bacteria 1704
1000 Ga0496106_0200870 3300048909 Bacteria 1586
1001 Ga0496106_0242032 3300048909 Bacteria 1441
1002 Ga0496106_0307272 3300048909 Bacteria 1272
1003 Ga0496106_0493837 3300048909 Bacteria 983
1004 Ga0496107_0031464 3300048910 Bacteria 3787
1005 Ga0496107_0080717 3300048910 Bacteria 2372
1006 Ga0496107_0116917 3300048910 Bacteria 1963
1007 Ga0496107_0228299 3300048910 Bacteria 1385
1008 Ga0496107_0767535 3300048910 Bacteria 707
1009 Ga0496108_0007825 3300048911 Bacteria 8661
1010 Ga0496108_0052995 3300048911 Bacteria 3401
1011 Ga0496108_0061779 3300048911 Bacteria 3154
1012 Ga0496108_0161363 3300048911 Bacteria 1937
1013 Ga0496108_0268683 3300048911 Bacteria 1484
1014 Ga0496108_0351959 3300048911 Bacteria 1285
1015 Ga0496108_0564478 3300048911 Bacteria 992
1016 Ga0496108_1092642 3300048911 Bacteria 678
1017 Ga0496109_0005951 3300048912 Bacteria 10237
1018 Ga0496109_0060553 3300048912 Bacteria 3459
1019 Ga0496109_0090785 3300048912 Bacteria 2825
1020 Ga0496109_0162520 3300048912 Bacteria 2092
1021 Ga0496109_0170415 3300048912 Bacteria 2042
1022 Ga0496109_0320644 3300048912 Bacteria 1462
1023 Ga0496109_0356687 3300048912 Bacteria 1381
1024 Ga0496109_0378985 3300048912 Bacteria 1336
1025 Ga0496109_1112199 3300048912 Bacteria 727
1026 Ga0496109_1242732 3300048912 Bacteria 681
1027 Ga0496109_1718474 3300048912 Bacteria 561
1028 Ga0496109_1725993 3300048912 Bacteria 560
1029 Ga0496109_1749669 3300048912 Bacteria 555
1030 Ga0496110_0003268 3300048913 Bacteria 12360
1031 Ga0496110_0015694 3300048913 Bacteria 6311
1032 Ga0496110_0021397 3300048913 Bacteria 5475
1033 Ga0496110_0113858 3300048913 Bacteria 2433
1034 Ga0496110_0172780 3300048913 Bacteria 1961
1035 Ga0496110_0217814 3300048913 Bacteria 1736
1036 Ga0496110_0235609 3300048913 Bacteria 1665
1037 Ga0496110_0247530 3300048913 Bacteria 1622
1038 Ga0496110_0553970 3300048913 Bacteria 1045
1039 Ga0496110_1152180 3300048913 Bacteria 684
1040 Ga0496111_0019760 3300048914 Bacteria 4685
1041 Ga0496111_0040218 3300048914 Bacteria 3353
1042 Ga0496111_0045883 3300048914 Bacteria 3145
1043 Ga0496111_0158393 3300048914 Bacteria 1680
1044 Ga0496111_0405533 3300048914 Bacteria 1007
1045 Ga0496111_0753699 3300048914 Bacteria 706
1046 Ga0496111_0990182 3300048914 Bacteria 603
1047 Ga0496111_1044194 3300048914 Bacteria 584
1048 Ga0496112_0046948 3300048915 Bacteria 4236
1049 Ga0496112_0049008 3300048915 Bacteria 4140
1050 Ga0496112_0055755 3300048915 Bacteria 3887
1051 Ga0496112_0440117 3300048915 Bacteria 1242
1052 Ga0496112_0571420 3300048915 Bacteria 1063
1053 Ga0496112_0592331 3300048915 Bacteria 1041
1054 Ga0496112_0712197 3300048915 Bacteria 931
1055 Ga0496112_1629645 3300048915 Bacteria 558
1056 Ga0496113_0047753 3300048916 Bacteria 3182
1057 Ga0496113_0071411 3300048916 Bacteria 2640
1058 Ga0496113_0087107 3300048916 Bacteria 2400
1059 Ga0496113_0109406 3300048916 Bacteria 2149
1060 Ga0496113_0713063 3300048916 Bacteria 800
1061 Ga0496114_0003343 3300048917 Bacteria 12327
1062 Ga0496114_0036683 3300048917 Bacteria 4053
1063 Ga0496114_0068172 3300048917 Bacteria 2986
1064 Ga0496114_0071773 3300048917 Bacteria 2910
1065 Ga0496114_0256919 3300048917 Bacteria 1538
1066 Ga0496114_0322398 3300048917 Bacteria 1365
1067 Ga0496114_0349443 3300048917 Bacteria 1308
1068 Ga0496114_0453751 3300048917 Bacteria 1135
1069 Ga0496114_0467965 3300048917 Bacteria 1116
1070 Ga0496114_0650191 3300048917 Bacteria 927
1071 Ga0496114_0783348 3300048917 Bacteria 832
1072 Ga0496114_0925624 3300048917 Bacteria 753
1073 Ga0496114_0979248 3300048917 Bacteria 728
1074 Ga0496115_0010588 3300048918 Bacteria 6897
1075 Ga0496115_0054295 3300048918 Bacteria 3217
1076 Ga0496115_0075917 3300048918 Bacteria 2731
1077 Ga0496115_0079179 3300048918 Bacteria 2674
1078 Ga0496115_0119959 3300048918 Bacteria 2163
1079 Ga0496115_0626069 3300048918 Bacteria 853
1080 Ga0496115_0979343 3300048918 Bacteria 648
1081 Ga0496124_0851288 3300048927 Bacteria 559
1082 Ga0496126_0235246 3300048929 Bacteria 1533
1083 Ga0501031_0127184 3300049568 Bacteria 1665
1084 Ga0501032_0111409 3300049569 Bacteria 1811
1085 Ga0501032_0315213 3300049569 Bacteria 1010
1086 Ga0501032_0375680 3300049569 Bacteria 914
1087 Ga0501033_0127716 3300049570 Bacteria 1843
1088 Ga0501034_0028742 3300049571 Bacteria 5657
1089 Ga0501034_0173851 3300049571 Bacteria 2120
1090 Ga0501036_0001833 3300049572 Bacteria 16501
1091 Ga0501036_0003085 3300049572 Bacteria 13292
1092 Ga0501036_0028289 3300049572 Bacteria 4737
1093 Ga0501036_0129408 3300049572 Bacteria 2132
1094 Ga0501036_0134456 3300049572 Bacteria 2087
1095 Ga0501037_0023795 3300049573 Bacteria 4529
1096 Ga0501037_0046102 3300049573 Bacteria 3198
1097 Ga0501037_0283779 3300049573 Bacteria 1153
1098 Ga0501037_0507395 3300049573 Bacteria 818
1099 Ga0501038_0013190 3300049574 Bacteria 7539
1100 Ga0501038_0032357 3300049574 Bacteria 4614
1101 Ga0501038_0248146 3300049574 Bacteria 1411
1102 Ga0501038_0315980 3300049574 Bacteria 1223
1103 Ga0501038_0889827 3300049574 Bacteria 658
1104 Ga0501039_0004558 3300049575 Bacteria 10467
1105 Ga0501039_0006646 3300049575 Bacteria 8786
1106 Ga0501039_0042421 3300049575 Bacteria 3515
1107 Ga0501039_0101682 3300049575 Bacteria 2243
1108 Ga0501039_0617786 3300049575 Bacteria 849
1109 Ga0501039_0626895 3300049575 Bacteria 842
1110 Ga0501040_0002442 3300049576 Bacteria 11969
1111 Ga0501040_0073131 3300049576 Bacteria 2368
1112 Ga0501040_0252695 3300049576 Bacteria 1257
1113 Ga0501040_0844911 3300049576 Bacteria 663
1114 Ga0501041_0005387 3300049577 Bacteria 7495
1115 Ga0501041_0027338 3300049577 Bacteria 3437
1116 Ga0501041_0039296 3300049577 Bacteria 2871
1117 Ga0501041_0080711 3300049577 Bacteria 2003
1118 Ga0501042_0004218 3300049578 Bacteria 9152
1119 Ga0501042_0024551 3300049578 Bacteria 4229
1120 Ga0501042_0138765 3300049578 Bacteria 1752
1121 Ga0501042_0645690 3300049578 Bacteria 769
1122 Ga0501042_0767078 3300049578 Bacteria 702
1123 Ga0501043_0381434 3300049579 Bacteria 1067
1124 Ga0501046_0005754 3300049580 Bacteria 11064
1125 Ga0501046_0386166 3300049580 Bacteria 1013
1126 Ga0501046_0590132 3300049580 Bacteria 789
1127 Ga0501048_0009775 3300049582 Bacteria 7191
1128 Ga0501048_0013087 3300049582 Bacteria 6159
1129 Ga0501048_0524048 3300049582 Bacteria 850
1130 Ga0501067_0000382 3300049583 Bacteria 24117
1131 Ga0501067_0009572 3300049583 Bacteria 5367
1132 Ga0501067_0116040 3300049583 Bacteria 1489
1133 Ga0501068_0004453 3300049584 Bacteria 7623
1134 Ga0501068_0020240 3300049584 Bacteria 3874
1135 Ga0501068_0062744 3300049584 Bacteria 2260
1136 Ga0501068_0115856 3300049584 Bacteria 1669
1137 Ga0501068_0141160 3300049584 Bacteria 1510
1138 Ga0501069_0005381 3300049585 Bacteria 6661
1139 Ga0501069_0039409 3300049585 Bacteria 2610
1140 Ga0501069_0062466 3300049585 Bacteria 2080
1141 Ga0501069_0083486 3300049585 Bacteria 1801
1142 Ga0501069_0201971 3300049585 Bacteria 1152
1143 Ga0501069_0228945 3300049585 Bacteria 1082
1144 Ga0501069_0312625 3300049585 Bacteria 922
1145 Ga0501069_0421527 3300049585 Bacteria 791
1146 Ga0501069_0746635 3300049585 Bacteria 592
1147 Ga0501070_0004353 3300049586 Bacteria 12175
1148 Ga0501070_0026463 3300049586 Bacteria 4865
1149 Ga0501070_0075851 3300049586 Bacteria 2783
1150 Ga0501070_0091797 3300049586 Bacteria 2513
1151 Ga0501070_0668076 3300049586 Bacteria 824
1152 Ga0501070_0678817 3300049586 Bacteria 816
1153 Ga0501071_0001717 3300049587 Bacteria 12856
1154 Ga0501071_0002819 3300049587 Bacteria 10704
1155 Ga0501071_0029553 3300049587 Bacteria 3869
1156 Ga0501071_0062679 3300049587 Bacteria 2694
1157 Ga0501071_0092690 3300049587 Bacteria 2221
1158 Ga0501071_0097306 3300049587 Bacteria 2167
1159 Ga0501071_0191434 3300049587 Bacteria 1534
1160 Ga0501071_0271560 3300049587 Bacteria 1282
1161 Ga0501071_0746152 3300049587 Bacteria 754
1162 Ga0501071_0834196 3300049587 Bacteria 711
1163 Ga0501071_0958275 3300049587 Bacteria 661
1164 Ga0501072_0009579 3300049588 Bacteria 7367
1165 Ga0501072_0043272 3300049588 Bacteria 3539
1166 Ga0501072_0055163 3300049588 Bacteria 3132
1167 Ga0501072_0070118 3300049588 Bacteria 2768
1168 Ga0501072_0098812 3300049588 Bacteria 2320
1169 Ga0501072_0203043 3300049588 Bacteria 1580
1170 Ga0501072_0377979 3300049588 Bacteria 1124
1171 Ga0501073_0102195 3300049589 Bacteria 1990
1172 Ga0501073_0150349 3300049589 Bacteria 1614
1173 Ga0501073_0181516 3300049589 Bacteria 1456
1174 Ga0501073_0565183 3300049589 Bacteria 786
1175 Ga0501074_0002178 3300049590 Bacteria 13583
1176 Ga0501074_0008865 3300049590 Bacteria 7291
1177 Ga0501074_0023126 3300049590 Bacteria 4520
1178 Ga0501074_0511077 3300049590 Bacteria 851
1179 Ga0501074_0650417 3300049590 Bacteria 745
1180 Ga0501075_0002567 3300049591 Bacteria 12107
1181 Ga0501075_0024262 3300049591 Bacteria 4444
1182 Ga0501075_0204727 3300049591 Bacteria 1505
1183 Ga0501075_0356944 3300049591 Bacteria 1114
1184 Ga0501076_0000957 3300049592 Bacteria 18872
1185 Ga0501076_0026818 3300049592 Bacteria 4465
1186 Ga0501076_0133401 3300049592 Bacteria 2015
1187 Ga0501076_0295786 3300049592 Bacteria 1327
1188 Ga0501076_0406570 3300049592 Bacteria 1120
1189 Ga0501077_0013639 3300049593 Bacteria 5095
1190 Ga0501077_0057592 3300049593 Bacteria 2467
1191 Ga0501077_0096725 3300049593 Bacteria 1871
1192 Ga0501077_0129440 3300049593 Bacteria 1600
1193 Ga0501077_0267466 3300049593 Bacteria 1087
1194 Ga0501217_091592 3300049661 Bacteria 854
1195 Ga0501079_0010125 3300049741 Bacteria 7157
1196 Ga0501079_0019109 3300049741 Bacteria 5235
1197 Ga0501079_0028841 3300049741 Bacteria 4260
1198 Ga0501080_0010636 3300049742 Bacteria 8422
1199 Ga0501080_0060935 3300049742 Bacteria 3513
1200 Ga0501080_0212235 3300049742 Bacteria 1774
1201 Ga0501080_0229452 3300049742 Bacteria 1697
1202 Ga0501080_1839218 3300049742 Bacteria 508
1203 Ga0501081_0013990 3300049743 Bacteria 5283
1204 Ga0501081_0021363 3300049743 Bacteria 4319
1205 Ga0501081_0111088 3300049743 Bacteria 1945
1206 Ga0501083_0014766 3300049744 Bacteria 5462
1207 Ga0501083_0031209 3300049744 Bacteria 3657
1208 Ga0501083_0339164 3300049744 Bacteria 977
1209 Ga0501083_0397170 3300049744 Bacteria 897
1210 Ga0501035_0024974 3300049822 Bacteria 5480
1211 Ga0501035_0236917 3300049822 Bacteria 1554
1212 Ga0501035_0314736 3300049822 Bacteria 1316
1213 Ga0501044_0124816 3300049823 Bacteria 2572
1214 Ga0501044_1129366 3300049823 Bacteria 652
1215 Ga0501045_0018574 3300049824 Bacteria 4946
1216 Ga0501045_0098567 3300049824 Bacteria 2162
1217 Ga0501045_0109937 3300049824 Bacteria 2043
1218 Ga0501045_0111861 3300049824 Bacteria 2025
1219 Ga0501045_0448667 3300049824 Bacteria 959
1220 Ga0501045_0625999 3300049824 Bacteria 796
1221 nmdc:mga03n38_10189_c1 3300050490 Bacteria 3449
1222 nmdc:mga03n38_395751_c1 3300050490 Bacteria 760
1223 nmdc:mga00v17_392432_c1 3300050491 Bacteria 902
1224 nmdc:mga0yw44_117112_c1 3300050492 Bacteria 1713
1225 nmdc:mga0yw44_165066_c1 3300050492 Bacteria 1451
1226 nmdc:mga0yw44_22863_c1 3300050492 Bacteria 3513
1227 nmdc:mga0yw44_231534_c1 3300050492 Bacteria 1226
1228 nmdc:mga0yw44_3281_c1 3300050492 Bacteria 7145
1229 nmdc:mga0yw44_357696_c1 3300050492 Bacteria 983
1230 nmdc:mga0yw44_464888_c1 3300050492 Bacteria 858
1231 nmdc:mga0yw44_476548_c1 3300050492 Bacteria 846
1232 nmdc:mga0yw44_616125_c1 3300050492 Bacteria 738
1233 nmdc:mga06z11_107251_c1 3300050494 Bacteria 1541
1234 nmdc:mga06z11_2444_c1 3300050494 Bacteria 7086
1235 nmdc:mga06z11_494636_c1 3300050494 Bacteria 741
1236 nmdc:mga04h51_3789_c1 3300050495 Bacteria 3709
1237 nmdc:mga04h51_43339_c1 3300050495 Bacteria 1480
1238 nmdc:mga07m45_72710_c1 3300050496 Bacteria 1958
1239 nmdc:mga05p37_10551_c1 3300050507 Bacteria 10956
1240 nmdc:mga05p37_19038_c1 3300050507 Bacteria 8304
1241 nmdc:mga09592_156197_c1 3300050508 Bacteria 1969
1242 nmdc:mga09592_288856_c1 3300050508 Bacteria 1422
1243 nmdc:mga09592_52831_c1 3300050508 Bacteria 3430
1244 nmdc:mga06r32_3633_c1 3300050510 Bacteria 13772
1245 nmdc:mga06r32_49313_c1 3300050510 Bacteria 4026
1246 nmdc:mga06r32_88950_c1 3300050510 Bacteria 3015
1247 nmdc:mga08y16_18189_c1 3300050511 Bacteria 7405
1248 nmdc:mga08y16_245409_c1 3300050511 Bacteria 1850
1249 nmdc:mga0n895_152227_c1 3300050512 Bacteria 2343
1250 nmdc:mga0n895_156223_c1 3300050512 Bacteria 2312
1251 nmdc:mga0n895_63600_c1 3300050512 Bacteria 3649
1252 nmdc:mga0rr50_164390_c1 3300050513 Bacteria 1804
1253 nmdc:mga0rr50_204116_c1 3300050513 Bacteria 1626
1254 nmdc:mga0rr50_768257_c1 3300050513 Bacteria 822
1255 nmdc:mga08x19_163958_c1 3300050514 Bacteria 1510
1256 nmdc:mga08x19_175129_c1 3300050514 Bacteria 1462
1257 nmdc:mga08x19_183086_c1 3300050514 Bacteria 1431
1258 nmdc:mga08x19_208364_c1 3300050514 Bacteria 1342
1259 nmdc:mga08x19_26758_c1 3300050514 Bacteria 3601
1260 nmdc:mga0a205_158924_c1 3300050515 Bacteria 2158
1261 nmdc:mga0a205_229960_c1 3300050515 Bacteria 1738
1262 nmdc:mga0a205_5778_c1 3300050515 Bacteria 11153
1263 Ga0495601_0040098 3300053077 Bacteria 2932
1264 Ga0495601_0075852 3300053077 Bacteria 2152
1265 Ga0495601_0092166 3300053077 Bacteria 1951
1266 Ga0495601_0165723 3300053077 Bacteria 1444
1267 Ga0495601_0454182 3300053077 Bacteria 829
1268 Ga0495601_0760863 3300053077 Bacteria 616
1269 Ga0495612_0022915 3300053078 Bacteria 2503
1270 Ga0495612_0035151 3300053078 Bacteria 2030
1271 Ga0495612_0054437 3300053078 Bacteria 1648
1272 Ga0495612_0162106 3300053078 Bacteria 977
1273 Ga0495655_0002842 3300053083 Bacteria 2789
1274 Ga0495595_0000870 3300053084 Bacteria 11578
1275 Ga0495595_0019025 3300053084 Bacteria 2975
1276 Ga0495595_0670675 3300053084 Bacteria 531
1277 Ga0495619_0065148 3300053085 Bacteria 2430
1278 Ga0495619_0075191 3300053085 Bacteria 2266
1279 Ga0495619_0117849 3300053085 Bacteria 1819
1280 Ga0495619_0179981 3300053085 Bacteria 1463
1281 Ga0495619_0428009 3300053085 Bacteria 913
1282 Ga0500641_0173549 3300053096 Bacteria 927
1283 Ga0500655_084918 3300053133 Bacteria 654
1284 Ga0500577_0011798 3300053142 Bacteria 2619
1285 Ga0501084_0008213 3300054114 Bacteria 8613
1286 Ga0501084_0019762 3300054114 Bacteria 5613
1287 Ga0501084_0358220 3300054114 Bacteria 1232
1288 Ga0501084_0601180 3300054114 Bacteria 929
1289 Ga0501084_0722588 3300054114 Bacteria 840
1290 Ga0501084_0865538 3300054114 Bacteria 760
1291 Ga0501084_1487743 3300054114 Bacteria 567
1292 Ga0501082_0021382 3300060353 Bacteria 5581
1293 Ga0501082_0106842 3300060353 Bacteria 2421
1294 Ga0501082_0125486 3300060353 Bacteria 2226
1295 Ga0501082_0725145 3300060353 Bacteria 870
1296 Ga0501082_0905567 3300060353 Bacteria 771
1297 Ga0530510_0007943 3300061734 Bacteria 7404
1298 Ga0530510_0048443 3300061734 Bacteria 3071
1299 Ga0530510_0160742 3300061734 Bacteria 1661
1300 Ga0530510_0834385 3300061734 Bacteria 704

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049578 Ga0501042_0024551 Ga0501042_0024551_644_1075 116
2 3300049575 Ga0501039_0617786 Ga0501039_0617786_55_486 119
3 3300049577 Ga0501041_0080711 Ga0501041_0080711_1078_1509 119
4 3300049742 Ga0501080_1839218 Ga0501080_1839218_60_491 119
5 3300060353 Ga0501082_0725145 Ga0501082_0725145_141_572 119
6 3300005441 Ga0070700_100252036 Ga0070700_1002520362 120
7 3300005615 Ga0070702_100107794 Ga0070702_1001077942 120
8 3300042006 Ga0439432_179066 Ga0439432_179066_31_447 120
9 3300046794 Ga0495589_0403431 Ga0495589_0403431_174_581 120
10 3300005328 Ga0070676_10449508 Ga0070676_104495081 121
11 3300005329 Ga0070683_100486318 Ga0070683_1004863182 121
12 3300005345 Ga0070692_10216071 Ga0070692_102160711 121
13 3300005347 Ga0070668_100332598 Ga0070668_1003325982 121
14 3300005365 Ga0070688_100568670 Ga0070688_1005686701 121
15 3300005466 Ga0070685_10185609 Ga0070685_101856091 121
16 3300005544 Ga0070686_100211937 Ga0070686_1002119372 121
17 3300005616 Ga0068852_100554744 Ga0068852_1005547441 121
18 3300005618 Ga0068864_100330553 Ga0068864_1003305532 121
19 3300005719 Ga0068861_100134863 Ga0068861_1001348633 121
20 3300009148 Ga0105243_10266705 Ga0105243_102667052 121
21 3300011119 Ga0105246_10112396 Ga0105246_101123963 121
22 3300013105 Ga0157369_10869833 Ga0157369_108698332 121
23 3300025933 Ga0207706_11412657 Ga0207706_114126571 121
24 3300005471 Ga0070698_100208288 Ga0070698_1002082882 122
25 3300017792 Ga0163161_10090775 Ga0163161_100907751 122
26 3300025901 Ga0207688_10031839 Ga0207688_100318392 122
27 3300025908 Ga0207643_10052970 Ga0207643_100529701 122
28 3300025940 Ga0207691_10447246 Ga0207691_104472461 122
29 3300025961 Ga0207712_11126959 Ga0207712_111269591 122
30 3300026067 Ga0207678_10086770 Ga0207678_100867702 122
31 3300026095 Ga0207676_10851780 Ga0207676_108517802 122
32 3300026118 Ga0207675_100407249 Ga0207675_1004072493 122
33 3300005337 Ga0070682_100894847 Ga0070682_1008948472 123
34 3300005435 Ga0070714_100945911 Ga0070714_1009459112 123
35 3300005436 Ga0070713_100619129 Ga0070713_1006191292 123
36 3300005436 Ga0070713_100828923 Ga0070713_1008289232 123
37 3300005437 Ga0070710_10080114 Ga0070710_100801141 123
38 3300005437 Ga0070710_10082152 Ga0070710_100821523 123
39 3300005445 Ga0070708_100378205 Ga0070708_1003782053 123
40 3300005445 Ga0070708_101339038 Ga0070708_1013390381 123
41 3300005467 Ga0070706_101280916 Ga0070706_1012809161 123
42 3300005468 Ga0070707_100140049 Ga0070707_1001400493 123
43 3300005468 Ga0070707_100334056 Ga0070707_1003340562 123
44 3300005471 Ga0070698_100217971 Ga0070698_1002179713 123
45 3300005535 Ga0070684_101102541 Ga0070684_1011025412 123
46 3300005535 Ga0070684_101511698 Ga0070684_1015116981 123
47 3300005546 Ga0070696_100995253 Ga0070696_1009952531 123
48 3300005614 Ga0068856_100494913 Ga0068856_1004949132 123
49 3300005618 Ga0068864_102075519 Ga0068864_1020755191 123
50 3300005841 Ga0068863_101112080 Ga0068863_1011120802 123
51 3300006028 Ga0070717_10849863 Ga0070717_108498632 123
52 3300006163 Ga0070715_10150720 Ga0070715_101507201 123
53 3300006173 Ga0070716_100396081 Ga0070716_1003960812 123
54 3300006237 Ga0097621_100129981 Ga0097621_1001299812 123
55 3300006871 Ga0075434_101648579 Ga0075434_1016485792 123
56 3300006914 Ga0075436_100197433 Ga0075436_1001974332 123
57 3300007076 Ga0075435_100941926 Ga0075435_1009419262 123
58 3300007076 Ga0075435_101694831 Ga0075435_1016948311 123
59 3300007788 Ga0099795_10098003 Ga0099795_100980033 123
60 3300010159 Ga0099796_10501394 Ga0099796_105013941 123
61 3300013104 Ga0157370_10957626 Ga0157370_109576261 123
62 3300013105 Ga0157369_10811746 Ga0157369_108117462 123
63 3300013307 Ga0157372_13214530 Ga0157372_132145302 123
64 3300014325 Ga0163163_11023422 Ga0163163_110234222 123
65 3300021388 Ga0213875_10225645 Ga0213875_102256452 123
66 3300025898 Ga0207692_10040547 Ga0207692_100405472 123
67 3300025898 Ga0207692_10127797 Ga0207692_101277972 123
68 3300025906 Ga0207699_10210466 Ga0207699_102104663 123
69 3300025915 Ga0207693_10101953 Ga0207693_101019532 123
70 3300025922 Ga0207646_10408755 Ga0207646_104087552 123
71 3300025928 Ga0207700_10090102 Ga0207700_100901022 123
72 3300025928 Ga0207700_10225360 Ga0207700_102253602 123
73 3300025928 Ga0207700_10258258 Ga0207700_102582582 123
74 3300025929 Ga0207664_10044030 Ga0207664_100440303 123
75 3300025929 Ga0207664_10141108 Ga0207664_101411083 123
76 3300025929 Ga0207664_10207160 Ga0207664_102071603 123
77 3300025929 Ga0207664_11591660 Ga0207664_115916602 123
78 3300025939 Ga0207665_10043834 Ga0207665_100438344 123
79 3300026041 Ga0207639_11460252 Ga0207639_114602522 123
80 3300026078 Ga0207702_10258128 Ga0207702_102581282 123
81 3300026078 Ga0207702_10332251 Ga0207702_103322512 123
82 3300026088 Ga0207641_10592259 Ga0207641_105922592 123
83 3300026088 Ga0207641_11008885 Ga0207641_110088852 123
84 3300026095 Ga0207676_12201735 Ga0207676_122017352 123
85 3300027512 Ga0209179_1048912 Ga0209179_10489122 123
86 3300031995 Ga0307409_101224718 Ga0307409_1012247181 123
87 3300035083 Ga0373926_0019617 Ga0373926_0019617_703_1092 123
88 3300035089 Ga0373944_0020636 Ga0373944_0020636_1462_1851 123
89 3300035111 Ga0373923_0098372 Ga0373923_0098372_846_1235 123
90 3300035113 Ga0373936_0013843 Ga0373936_0013843_1229_1618 123
91 3300035116 Ga0373945_0031841 Ga0373945_0031841_1154_1543 123
92 3300035170 Ga0373943_0018410 Ga0373943_0018410_990_1379 123
93 3300035171 Ga0373946_0005624 Ga0373946_0005624_2904_3293 123
94 3300035172 Ga0373955_0120408 Ga0373955_0120408_255_644 123
95 3300035410 Ga0373924_0173346 Ga0373924_0173346_37_426 123
96 3300035692 Ga0373935_0030337 Ga0373935_0030337_1131_1520 123
97 3300035692 Ga0373935_0470873 Ga0373935_0470873_281_670 123
98 3300035695 Ga0373927_0016408 Ga0373927_0016408_4254_4643 123
99 3300035695 Ga0373927_0210505 Ga0373927_0210505_392_799 123
100 3300035695 Ga0373927_0514303 Ga0373927_0514303_159_548 123
101 3300035725 Ga0373947_0004746 Ga0373947_0004746_1141_1530 123
102 3300037068 Ga0373925_0007907 Ga0373925_0007907_1249_1638 123
103 3300037068 Ga0373925_0060902 Ga0373925_0060902_330_719 123
104 3300037068 Ga0373925_1003582 Ga0373925_1003582_153_542 123
105 3300037853 Ga0436364_0002994 Ga0436364_0002994_268_657 123
106 3300037853 Ga0436364_1505134 Ga0436364_1505134_522_911 123
107 3300039437 Ga0436365_1465630 Ga0436365_1465630_1413_1802 123
108 3300039450 Ga0436363_0317523 Ga0436363_0317523_327_716 123
109 3300039450 Ga0436363_0964495 Ga0436363_0964495_912_1301 123
110 3300044694 Ga0466963_0070988 Ga0466963_0070988_748_1137 123
111 3300045976 Ga0466967_0035867 Ga0466967_0035867_1887_2276 123
112 3300046461 Ga0495641_0361450 Ga0495641_0361450_141_557 123
113 3300046463 Ga0495653_0071947 Ga0495653_0071947_1113_1502 123
114 3300046477 Ga0495664_0048897 Ga0495664_0048897_1131_1520 123
115 3300046511 Ga0495608_0065521 Ga0495608_0065521_777_1166 123
116 3300046514 Ga0495618_0157402 Ga0495618_0157402_909_1298 123
117 3300046529 Ga0495652_0073193 Ga0495652_0073193_1035_1424 123
118 3300046531 Ga0495665_0086593 Ga0495665_0086593_1239_1628 123
119 3300046533 Ga0495640_0066006 Ga0495640_0066006_1216_1605 123
120 3300046536 Ga0495587_0090843 Ga0495587_0090843_304_693 123
121 3300046543 Ga0495645_0574319 Ga0495645_0574319_144_533 123
122 3300046559 Ga0495667_0033211 Ga0495667_0033211_1250_1639 123
123 3300046663 Ga0495635_0000951 Ga0495635_0000951_17498_17887 123
124 3300046675 Ga0495657_0081640 Ga0495657_0081640_1153_1542 123
125 3300046678 Ga0495599_0089190 Ga0495599_0089190_1175_1564 123
126 3300046680 Ga0495646_0141826 Ga0495646_0141826_856_1245 123
127 3300046689 Ga0495613_0370426 Ga0495613_0370426_492_881 123
128 3300046690 Ga0495624_0047183 Ga0495624_0047183_1248_1637 123
129 3300046809 Ga0495600_0481059 Ga0495600_0481059_196_585 123
130 3300047315 Ga0495581_0092761 Ga0495581_0092761_695_1084 123
131 3300047319 Ga0495674_0004290 Ga0495674_0004290_137_526 123
132 3300047321 Ga0495676_0065828 Ga0495676_0065828_1124_1513 123
133 3300047322 Ga0495680_0071715 Ga0495680_0071715_1462_1851 123
134 3300047471 Ga0495684_0048038 Ga0495684_0048038_1267_1656 123
135 3300047673 Ga0495593_0117412 Ga0495593_0117412_353_742 123
136 3300048088 Ga0495602_0460188 Ga0495602_0460188_248_637 123
137 3300048903 Ga0496100_0237026 Ga0496100_0237026_846_1241 123
138 3300048907 Ga0496104_0006284 Ga0496104_0006284_1656_2051 123
139 3300048909 Ga0496106_0174668 Ga0496106_0174668_170_565 123
140 3300048918 Ga0496115_0054295 Ga0496115_0054295_2432_2827 123
141 3300048918 Ga0496115_0626069 Ga0496115_0626069_96_488 123
142 3300050512 nmdc:mga0n895_152227_c1 nmdc:mga0n895_152227_c1_401_790 123
143 3300050514 nmdc:mga08x19_163958_c1 nmdc:mga08x19_163958_c1_661_1050 123
144 3300053077 Ga0495601_0454182 Ga0495601_0454182_288_677 123
145 3300053078 Ga0495612_0162106 Ga0495612_0162106_439_828 123
146 3300005343 Ga0070687_100443252 Ga0070687_1004432521 124
147 3300005441 Ga0070700_100527007 Ga0070700_1005270071 124
148 3300005456 Ga0070678_100072244 Ga0070678_1000722443 124
149 3300005471 Ga0070698_100002455 Ga0070698_1000024554 124
150 3300005719 Ga0068861_100156966 Ga0068861_1001569662 124
151 3300005985 Ga0081539_10024753 Ga0081539_100247534 124
152 3300009094 Ga0111539_10103607 Ga0111539_101036073 124
153 3300009177 Ga0105248_11484331 Ga0105248_114843312 124
154 3300014326 Ga0157380_10210439 Ga0157380_102104392 124
155 3300025893 Ga0207682_10251010 Ga0207682_102510101 124
156 3300025914 Ga0207671_11485792 Ga0207671_114857922 124
157 3300025918 Ga0207662_10807407 Ga0207662_108074072 124
158 3300025922 Ga0207646_11634991 Ga0207646_116349912 124
159 3300025937 Ga0207669_10510203 Ga0207669_105102032 124
160 3300025972 Ga0207668_10811464 Ga0207668_108114642 124
161 3300026075 Ga0207708_10032894 Ga0207708_100328944 124
162 3300026089 Ga0207648_10255716 Ga0207648_102557161 124
163 3300026121 Ga0207683_10213656 Ga0207683_102136562 124
164 3300028794 Ga0307515_10707349 Ga0307515_107073492 124
165 3300032002 Ga0307416_101705438 Ga0307416_1017054381 124
166 3300041452 Ga0451793_0398120 Ga0451793_0398120_88_480 124
167 3300044694 Ga0466963_0348456 Ga0466963_0348456_515_901 124
168 3300046810 Ga0495660_0271627 Ga0495660_0271627_316_705 124
169 3300048912 Ga0496109_1718474 Ga0496109_1718474_108_494 124
170 3300049586 Ga0501070_0678817 Ga0501070_0678817_22_408 124
171 3300049661 Ga0501217_091592 Ga0501217_091592_437_826 124
172 3300050511 nmdc:mga08y16_245409_c1 nmdc:mga08y16_245409_c1_687_1076 124
173 3300061734 Ga0530510_0834385 Ga0530510_0834385_299_685 124
174 3300005356 Ga0070674_100399266 Ga0070674_1003992661 125
175 3300005356 Ga0070674_100400167 Ga0070674_1004001672 125
176 3300005434 Ga0070709_10014787 Ga0070709_100147873 125
177 3300005434 Ga0070709_10033111 Ga0070709_100331113 125
178 3300005435 Ga0070714_100035649 Ga0070714_1000356492 125
179 3300005435 Ga0070714_100097337 Ga0070714_1000973372 125
180 3300005435 Ga0070714_101267374 Ga0070714_1012673742 125
181 3300005436 Ga0070713_100024410 Ga0070713_1000244103 125
182 3300005437 Ga0070710_10001197 Ga0070710_100011973 125
183 3300005437 Ga0070710_10049041 Ga0070710_100490413 125
184 3300005439 Ga0070711_100012377 Ga0070711_1000123774 125
185 3300005439 Ga0070711_100039016 Ga0070711_1000390162 125
186 3300005440 Ga0070705_100481022 Ga0070705_1004810221 125
187 3300005445 Ga0070708_100049685 Ga0070708_1000496851 125
188 3300005445 Ga0070708_100579662 Ga0070708_1005796621 125
189 3300005467 Ga0070706_100010370 Ga0070706_1000103705 125
190 3300005468 Ga0070707_100001899 Ga0070707_10000189913 125
191 3300005468 Ga0070707_100003928 Ga0070707_1000039285 125
192 3300005468 Ga0070707_100597461 Ga0070707_1005974612 125
193 3300005471 Ga0070698_100001711 Ga0070698_10000171112 125
194 3300005471 Ga0070698_100002555 Ga0070698_10000255513 125
195 3300005471 Ga0070698_100047863 Ga0070698_1000478634 125
196 3300005471 Ga0070698_100173179 Ga0070698_1001731792 125
197 3300005518 Ga0070699_100519747 Ga0070699_1005197472 125
198 3300005536 Ga0070697_100090792 Ga0070697_1000907923 125
199 3300005536 Ga0070697_100239195 Ga0070697_1002391952 125
200 3300005614 Ga0068856_100510916 Ga0068856_1005109162 125
201 3300005985 Ga0081539_10000301 Ga0081539_1000030170 125
202 3300006028 Ga0070717_10049807 Ga0070717_100498072 125
203 3300006028 Ga0070717_10123360 Ga0070717_101233602 125
204 3300006028 Ga0070717_10164326 Ga0070717_101643262 125
205 3300006028 Ga0070717_10740744 Ga0070717_107407442 125
206 3300006028 Ga0070717_11215088 Ga0070717_112150882 125
207 3300006038 Ga0075365_10245973 Ga0075365_102459732 125
208 3300006042 Ga0075368_10095287 Ga0075368_100952873 125
209 3300006048 Ga0075363_100005297 Ga0075363_1000052976 125
210 3300006051 Ga0075364_10041025 Ga0075364_100410253 125
211 3300006051 Ga0075364_10043016 Ga0075364_100430163 125
212 3300006163 Ga0070715_10001650 Ga0070715_100016503 125
213 3300006163 Ga0070715_10091351 Ga0070715_100913512 125
214 3300006173 Ga0070716_100001590 Ga0070716_1000015908 125
215 3300006173 Ga0070716_100017725 Ga0070716_1000177252 125
216 3300006175 Ga0070712_100148949 Ga0070712_1001489491 125
217 3300006175 Ga0070712_100841093 Ga0070712_1008410932 125
218 3300006178 Ga0075367_10133488 Ga0075367_101334883 125
219 3300006914 Ga0075436_100033822 Ga0075436_1000338223 125
220 3300006914 Ga0075436_100155302 Ga0075436_1001553022 125
221 3300007076 Ga0075435_100077280 Ga0075435_1000772803 125
222 3300007788 Ga0099795_10168808 Ga0099795_101688082 125
223 3300009177 Ga0105248_11473615 Ga0105248_114736151 125
224 3300009553 Ga0105249_12363079 Ga0105249_123630792 125
225 3300010159 Ga0099796_10175098 Ga0099796_101750982 125
226 3300014326 Ga0157380_10521427 Ga0157380_105214271 125
227 3300020069 Ga0197907_10263981 Ga0197907_102639813 125
228 3300020070 Ga0206356_11853272 Ga0206356_118532723 125
229 3300020075 Ga0206349_1420320 Ga0206349_14203203 125
230 3300020077 Ga0206351_10212896 Ga0206351_102128963 125
231 3300020078 Ga0206352_10642632 Ga0206352_106426323 125
232 3300020080 Ga0206350_10114685 Ga0206350_101146853 125
233 3300020081 Ga0206354_11197999 Ga0206354_111979993 125
234 3300020082 Ga0206353_10745009 Ga0206353_107450093 125
235 3300022467 Ga0224712_10035100 Ga0224712_100351003 125
236 3300025898 Ga0207692_10000912 Ga0207692_1000091212 125
237 3300025898 Ga0207692_10004830 Ga0207692_100048304 125
238 3300025898 Ga0207692_10900639 Ga0207692_109006392 125
239 3300025905 Ga0207685_10011678 Ga0207685_100116782 125
240 3300025906 Ga0207699_10007237 Ga0207699_100072374 125
241 3300025906 Ga0207699_10035153 Ga0207699_100351532 125
242 3300025910 Ga0207684_10007287 Ga0207684_100072875 125
243 3300025910 Ga0207684_10031813 Ga0207684_100318131 125
244 3300025912 Ga0207707_10286151 Ga0207707_102861512 125
245 3300025915 Ga0207693_10016510 Ga0207693_100165102 125
246 3300025915 Ga0207693_10374507 Ga0207693_103745072 125
247 3300025916 Ga0207663_10036973 Ga0207663_100369732 125
248 3300025922 Ga0207646_10001319 Ga0207646_100013194 125
249 3300025922 Ga0207646_10008213 Ga0207646_100082132 125
250 3300025923 Ga0207681_10410275 Ga0207681_104102752 125
251 3300025928 Ga0207700_10008201 Ga0207700_100082014 125
252 3300025928 Ga0207700_10105655 Ga0207700_101056553 125
253 3300025928 Ga0207700_10723817 Ga0207700_107238172 125
254 3300025929 Ga0207664_10001557 Ga0207664_100015576 125
255 3300025929 Ga0207664_10018816 Ga0207664_100188164 125
256 3300025929 Ga0207664_10144057 Ga0207664_101440573 125
257 3300025939 Ga0207665_10003665 Ga0207665_100036653 125
258 3300025939 Ga0207665_10004055 Ga0207665_100040552 125
259 3300025945 Ga0207679_10133516 Ga0207679_101335163 125
260 3300027866 Ga0209813_10036283 Ga0209813_100362832 125
261 3300028794 Ga0307515_10034004 Ga0307515_100340043 125
262 3300031241 Ga0265325_10548580 Ga0265325_105485802 125
263 3300031456 Ga0307513_10075382 Ga0307513_100753824 125
264 3300031727 Ga0316576_10118391 Ga0316576_101183912 125
265 3300031838 Ga0307518_10225066 Ga0307518_102250662 125
266 3300031901 Ga0307406_10963659 Ga0307406_109636592 125
267 3300033179 Ga0307507_10384818 Ga0307507_103848182 125
268 3300035086 Ga0373934_0018287 Ga0373934_0018287_755_1147 125
269 3300035089 Ga0373944_0089003 Ga0373944_0089003_284_676 125
270 3300035111 Ga0373923_0042500 Ga0373923_0042500_184_576 125
271 3300035113 Ga0373936_0007751 Ga0373936_0007751_2175_2567 125
272 3300035116 Ga0373945_0185091 Ga0373945_0185091_390_782 125
273 3300035117 Ga0373953_0012841 Ga0373953_0012841_1534_1926 125
274 3300035118 Ga0373954_0473104 Ga0373954_0473104_19_411 125
275 3300035119 Ga0373956_0000574 Ga0373956_0000574_10346_10738 125
276 3300035120 Ga0373957_0002235 Ga0373957_0002235_5055_5447 125
277 3300035171 Ga0373946_0600150 Ga0373946_0600150_59_451 125
278 3300035172 Ga0373955_0170575 Ga0373955_0170575_147_539 125
279 3300035410 Ga0373924_0001940 Ga0373924_0001940_6366_6758 125
280 3300035692 Ga0373935_0053930 Ga0373935_0053930_119_511 125
281 3300035692 Ga0373935_0195239 Ga0373935_0195239_267_659 125
282 3300035695 Ga0373927_1159178 Ga0373927_1159178_53_445 125
283 3300035725 Ga0373947_0179599 Ga0373947_0179599_146_538 125
284 3300035725 Ga0373947_0183317 Ga0373947_0183317_380_772 125
285 3300036401 Ga0373937_0007847 Ga0373937_0007847_5482_5874 125
286 3300036712 Ga0316584_0007960 Ga0316584_0007960_6071_6463 125
287 3300037068 Ga0373925_0018948 Ga0373925_0018948_3404_3796 125
288 3300037068 Ga0373925_0250231 Ga0373925_0250231_384_776 125
289 3300037312 Ga0395899_0015944 Ga0395899_0015944_3677_4066 125
290 3300037418 Ga0395900_0162786 Ga0395900_0162786_1847_2236 125
291 3300037466 Ga0395898_0120237 Ga0395898_0120237_827_1216 125
292 3300037853 Ga0436364_1027047 Ga0436364_1027047_302_691 125
293 3300038443 Ga0395901_0186337 Ga0395901_0186337_351_740 125
294 3300041405 Ga0439438_065533 Ga0439438_065533_205_603 125
295 3300041453 Ga0451797_1229019 Ga0451797_1229019_534_932 125
296 3300041491 Ga0451833_0553474 Ga0451833_0553474_657_1049 125
297 3300041509 Ga0451843_0494901 Ga0451843_0494901_243_641 125
298 3300042007 Ga0439449_0140643 Ga0439449_0140643_195_587 125
299 3300044656 Ga0466969_0129901 Ga0466969_0129901_567_956 125
300 3300044684 Ga0466966_0006938 Ga0466966_0006938_2385_2774 125
301 3300044693 Ga0466961_0066816 Ga0466961_0066816_1410_1799 125
302 3300044694 Ga0466963_0028890 Ga0466963_0028890_174_563 125
303 3300044719 Ga0466971_0047103 Ga0466971_0047103_1148_1537 125
304 3300044901 Ga0466960_0003052 Ga0466960_0003052_5280_5675 125
305 3300045049 Ga0466959_0001340 Ga0466959_0001340_1253_1642 125
306 3300045836 Ga0466958_0129077 Ga0466958_0129077_1116_1505 125
307 3300046454 Ga0495592_0522559 Ga0495592_0522559_19_411 125
308 3300046459 Ga0495629_0006569 Ga0495629_0006569_8047_8439 125
309 3300046462 Ga0495651_0414752 Ga0495651_0414752_206_598 125
310 3300046463 Ga0495653_0254613 Ga0495653_0254613_19_411 125
311 3300046473 Ga0495582_0098938 Ga0495582_0098938_172_564 125
312 3300046475 Ga0495639_0086539 Ga0495639_0086539_421_813 125
313 3300046476 Ga0495662_0014137 Ga0495662_0014137_1443_1835 125
314 3300046476 Ga0495662_0146170 Ga0495662_0146170_35_427 125
315 3300046477 Ga0495664_0005386 Ga0495664_0005386_6611_7003 125
316 3300046477 Ga0495664_0093172 Ga0495664_0093172_444_836 125
317 3300046499 Ga0495594_0302709 Ga0495594_0302709_103_495 125
318 3300046511 Ga0495608_0122677 Ga0495608_0122677_525_917 125
319 3300046514 Ga0495618_0135270 Ga0495618_0135270_1039_1431 125
320 3300046514 Ga0495618_0247301 Ga0495618_0247301_407_799 125
321 3300046516 Ga0495628_0226748 Ga0495628_0226748_184_576 125
322 3300046517 Ga0495630_0023351 Ga0495630_0023351_2133_2525 125
323 3300046517 Ga0495630_1079827 Ga0495630_1079827_14_406 125
324 3300046529 Ga0495652_0142590 Ga0495652_0142590_1172_1564 125
325 3300046531 Ga0495665_0023344 Ga0495665_0023344_1862_2254 125
326 3300046533 Ga0495640_0045512 Ga0495640_0045512_1635_2027 125
327 3300046536 Ga0495587_0012350 Ga0495587_0012350_561_953 125
328 3300046543 Ga0495645_0039473 Ga0495645_0039473_1573_1965 125
329 3300046543 Ga0495645_0347432 Ga0495645_0347432_286_678 125
330 3300046559 Ga0495667_0179413 Ga0495667_0179413_561_953 125
331 3300046642 Ga0495634_0072245 Ga0495634_0072245_1599_1991 125
332 3300046642 Ga0495634_0288541 Ga0495634_0288541_465_857 125
333 3300046663 Ga0495635_0067163 Ga0495635_0067163_1315_1707 125
334 3300046675 Ga0495657_0013669 Ga0495657_0013669_5136_5528 125
335 3300046678 Ga0495599_0008992 Ga0495599_0008992_4058_4450 125
336 3300046678 Ga0495599_0156415 Ga0495599_0156415_187_579 125
337 3300046679 Ga0495623_0020897 Ga0495623_0020897_19_411 125
338 3300046680 Ga0495646_0027864 Ga0495646_0027864_1315_1707 125
339 3300046681 Ga0495647_0050217 Ga0495647_0050217_445_837 125
340 3300046683 Ga0495658_0052718 Ga0495658_0052718_311_703 125
341 3300046689 Ga0495613_0051959 Ga0495613_0051959_2221_2613 125
342 3300046809 Ga0495600_0011545 Ga0495600_0011545_4555_4947 125
343 3300047315 Ga0495581_0001362 Ga0495581_0001362_9282_9674 125
344 3300047317 Ga0495604_0094598 Ga0495604_0094598_407_799 125
345 3300047319 Ga0495674_0025323 Ga0495674_0025323_3918_4310 125
346 3300047319 Ga0495674_0038440 Ga0495674_0038440_19_411 125
347 3300047322 Ga0495680_0439527 Ga0495680_0439527_30_422 125
348 3300047444 Ga0495675_0470795 Ga0495675_0470795_279_671 125
349 3300047471 Ga0495684_0331563 Ga0495684_0331563_250_645 125
350 3300047471 Ga0495684_0609413 Ga0495684_0609413_325_717 125
351 3300047673 Ga0495593_0149911 Ga0495593_0149911_290_682 125
352 3300048088 Ga0495602_0048758 Ga0495602_0048758_30_422 125
353 3300048089 Ga0495614_0009992 Ga0495614_0009992_1750_2142 125
354 3300048908 Ga0496105_0149922 Ga0496105_0149922_1114_1500 125
355 3300048911 Ga0496108_0052995 Ga0496108_0052995_1399_1785 125
356 3300048912 Ga0496109_0162520 Ga0496109_0162520_1496_1882 125
357 3300048913 Ga0496110_0015694 Ga0496110_0015694_5875_6261 125
358 3300048914 Ga0496111_1044194 Ga0496111_1044194_182_568 125
359 3300048917 Ga0496114_0322398 Ga0496114_0322398_724_1122 125
360 3300048927 Ga0496124_0851288 Ga0496124_0851288_93_485 125
361 3300049569 Ga0501032_0315213 Ga0501032_0315213_520_909 125
362 3300049572 Ga0501036_0134456 Ga0501036_0134456_688_1089 125
363 3300049575 Ga0501039_0101682 Ga0501039_0101682_634_1035 125
364 3300049576 Ga0501040_0844911 Ga0501040_0844911_75_467 125
365 3300049578 Ga0501042_0645690 Ga0501042_0645690_172_570 125
366 3300049579 Ga0501043_0381434 Ga0501043_0381434_361_762 125
367 3300049585 Ga0501069_0201971 Ga0501069_0201971_448_846 125
368 3300049586 Ga0501070_0668076 Ga0501070_0668076_220_618 125
369 3300049587 Ga0501071_0834196 Ga0501071_0834196_10_408 125
370 3300049588 Ga0501072_0377979 Ga0501072_0377979_274_672 125
371 3300049590 Ga0501074_0511077 Ga0501074_0511077_53_475 125
372 3300049592 Ga0501076_0133401 Ga0501076_0133401_941_1342 125
373 3300049592 Ga0501076_0406570 Ga0501076_0406570_599_997 125
374 3300049824 Ga0501045_0111861 Ga0501045_0111861_512_913 125
375 3300050490 nmdc:mga03n38_395751_c1 nmdc:mga03n38_395751_c1_317_715 125
376 3300050492 nmdc:mga0yw44_117112_c1 nmdc:mga0yw44_117112_c1_157_555 125
377 3300050492 nmdc:mga0yw44_464888_c1 nmdc:mga0yw44_464888_c1_398_796 125
378 3300050492 nmdc:mga0yw44_476548_c1 nmdc:mga0yw44_476548_c1_383_775 125
379 3300050494 nmdc:mga06z11_494636_c1 nmdc:mga06z11_494636_c1_80_478 125
380 3300050495 nmdc:mga04h51_43339_c1 nmdc:mga04h51_43339_c1_427_825 125
381 3300050513 nmdc:mga0rr50_768257_c1 nmdc:mga0rr50_768257_c1_318_728 125
382 3300050514 nmdc:mga08x19_175129_c1 nmdc:mga08x19_175129_c1_334_726 125
383 3300050514 nmdc:mga08x19_26758_c1 nmdc:mga08x19_26758_c1_1947_2339 125
384 3300050515 nmdc:mga0a205_5778_c1 nmdc:mga0a205_5778_c1_9705_10097 125
385 3300053077 Ga0495601_0040098 Ga0495601_0040098_2325_2717 125
386 3300053077 Ga0495601_0165723 Ga0495601_0165723_584_976 125
387 3300053078 Ga0495612_0022915 Ga0495612_0022915_1822_2214 125
388 3300053078 Ga0495612_0035151 Ga0495612_0035151_722_1114 125
389 3300053084 Ga0495595_0000870 Ga0495595_0000870_5861_6253 125
390 3300053085 Ga0495619_0075191 Ga0495619_0075191_1314_1706 125
391 3300053096 Ga0500641_0173549 Ga0500641_0173549_155_553 125
392 3300053133 Ga0500655_084918 Ga0500655_084918_194_613 125
393 3300053142 Ga0500577_0011798 Ga0500577_0011798_633_1043 125
394 3300054114 Ga0501084_0865538 Ga0501084_0865538_289_687 125
395 iso_pu_bacteria 2751185734 2753073186 125
396 3300005330 Ga0070690_100373213 Ga0070690_1003732131 126
397 3300005337 Ga0070682_100111907 Ga0070682_1001119072 126
398 3300005338 Ga0068868_100410383 Ga0068868_1004103831 126
399 3300005367 Ga0070667_100068859 Ga0070667_1000688592 126
400 3300005367 Ga0070667_102079382 Ga0070667_1020793821 126
401 3300005434 Ga0070709_10738358 Ga0070709_107383581 126
402 3300005434 Ga0070709_11184572 Ga0070709_111845721 126
403 3300005435 Ga0070714_100867473 Ga0070714_1008674732 126
404 3300005439 Ga0070711_100115544 Ga0070711_1001155442 126
405 3300005439 Ga0070711_100773522 Ga0070711_1007735221 126
406 3300005439 Ga0070711_100924372 Ga0070711_1009243722 126
407 3300005456 Ga0070678_100762303 Ga0070678_1007623032 126
408 3300005456 Ga0070678_101746513 Ga0070678_1017465131 126
409 3300005459 Ga0068867_101656836 Ga0068867_1016568362 126
410 3300005468 Ga0070707_100274731 Ga0070707_1002747312 126
411 3300005518 Ga0070699_100201261 Ga0070699_1002012612 126
412 3300005535 Ga0070684_101536258 Ga0070684_1015362582 126
413 3300005544 Ga0070686_101846560 Ga0070686_1018465601 126
414 3300005547 Ga0070693_100100839 Ga0070693_1001008391 126
415 3300005549 Ga0070704_101301940 Ga0070704_1013019401 126
416 3300005577 Ga0068857_101750470 Ga0068857_1017504701 126
417 3300005614 Ga0068856_100285392 Ga0068856_1002853923 126
418 3300005616 Ga0068852_101043018 Ga0068852_1010430182 126
419 3300005843 Ga0068860_100000882 Ga0068860_10000088227 126
420 3300005983 Ga0081540_1001512 Ga0081540_100151218 126
421 3300006028 Ga0070717_11435594 Ga0070717_114355942 126
422 3300006048 Ga0075363_100092171 Ga0075363_1000921712 126
423 3300006048 Ga0075363_100755052 Ga0075363_1007550521 126
424 3300006163 Ga0070715_10015521 Ga0070715_100155212 126
425 3300006173 Ga0070716_100056395 Ga0070716_1000563952 126
426 3300006173 Ga0070716_100194324 Ga0070716_1001943242 126
427 3300006175 Ga0070712_101048767 Ga0070712_1010487671 126
428 3300006844 Ga0075428_100050071 Ga0075428_1000500714 126
429 3300006852 Ga0075433_10043688 Ga0075433_100436883 126
430 3300006852 Ga0075433_10123849 Ga0075433_101238492 126
431 3300006871 Ga0075434_100037030 Ga0075434_1000370302 126
432 3300006881 Ga0068865_101273494 Ga0068865_1012734942 126
433 3300006914 Ga0075436_100055144 Ga0075436_1000551442 126
434 3300006914 Ga0075436_100124083 Ga0075436_1001240833 126
435 3300007076 Ga0075435_100186502 Ga0075435_1001865022 126
436 3300009094 Ga0111539_10072443 Ga0111539_100724432 126
437 3300009098 Ga0105245_10072114 Ga0105245_100721142 126
438 3300009098 Ga0105245_10186295 Ga0105245_101862951 126
439 3300009101 Ga0105247_10489185 Ga0105247_104891852 126
440 3300009147 Ga0114129_10043767 Ga0114129_100437673 126
441 3300009174 Ga0105241_10177292 Ga0105241_101772922 126
442 3300009177 Ga0105248_10078501 Ga0105248_100785012 126
443 3300009551 Ga0105238_10126613 Ga0105238_101266132 126
444 3300012492 Ga0157335_1021832 Ga0157335_10218321 126
445 3300013105 Ga0157369_11686805 Ga0157369_116868051 126
446 3300013306 Ga0163162_10602930 Ga0163162_106029302 126
447 3300013307 Ga0157372_12987023 Ga0157372_129870232 126
448 3300013308 Ga0157375_10005642 Ga0157375_100056422 126
449 3300014325 Ga0163163_10042895 Ga0163163_100428952 126
450 3300014745 Ga0157377_10426788 Ga0157377_104267882 126
451 3300025900 Ga0207710_10245670 Ga0207710_102456701 126
452 3300025905 Ga0207685_10443350 Ga0207685_104433501 126
453 3300025906 Ga0207699_10119325 Ga0207699_101193253 126
454 3300025912 Ga0207707_11542043 Ga0207707_115420431 126
455 3300025915 Ga0207693_10510811 Ga0207693_105108112 126
456 3300025916 Ga0207663_10460420 Ga0207663_104604202 126
457 3300025922 Ga0207646_10367305 Ga0207646_103673052 126
458 3300025924 Ga0207694_11573758 Ga0207694_115737581 126
459 3300025927 Ga0207687_10027986 Ga0207687_100279863 126
460 3300025928 Ga0207700_10134647 Ga0207700_101346473 126
461 3300025928 Ga0207700_10688514 Ga0207700_106885142 126
462 3300025929 Ga0207664_10368204 Ga0207664_103682042 126
463 3300025929 Ga0207664_10487623 Ga0207664_104876232 126
464 3300025938 Ga0207704_10419398 Ga0207704_104193982 126
465 3300025939 Ga0207665_10606864 Ga0207665_106068642 126
466 3300025939 Ga0207665_10617002 Ga0207665_106170022 126
467 3300025941 Ga0207711_11283892 Ga0207711_112838921 126
468 3300025986 Ga0207658_10043437 Ga0207658_100434372 126
469 3300026067 Ga0207678_10547758 Ga0207678_105477581 126
470 3300026078 Ga0207702_10432726 Ga0207702_104327261 126
471 3300026121 Ga0207683_10087374 Ga0207683_100873743 126
472 3300026121 Ga0207683_11213061 Ga0207683_112130611 126
473 3300027907 Ga0207428_10114133 Ga0207428_101141332 126
474 3300028666 Ga0265336_10013374 Ga0265336_100133743 126
475 3300028800 Ga0265338_10001861 Ga0265338_1000186128 126
476 3300031235 Ga0265330_10218835 Ga0265330_102188352 126
477 3300031241 Ga0265325_10140511 Ga0265325_101405112 126
478 3300031727 Ga0316576_10249759 Ga0316576_102497592 126
479 3300031852 Ga0307410_11638336 Ga0307410_116383361 126
480 3300031995 Ga0307409_102770322 Ga0307409_1027703221 126
481 3300034819 Ga0373958_0160707 Ga0373958_0160707_74_472 126
482 3300035084 Ga0373928_0009595 Ga0373928_0009595_1026_1424 126
483 3300035086 Ga0373934_0000025 Ga0373934_0000025_52_450 126
484 3300035086 Ga0373934_0020746 Ga0373934_0020746_438_836 126
485 3300035088 Ga0373940_0291128 Ga0373940_0291128_134_532 126
486 3300035091 Ga0373951_0122561 Ga0373951_0122561_11_409 126
487 3300035092 Ga0373952_0016920 Ga0373952_0016920_31_429 126
488 3300035111 Ga0373923_0229013 Ga0373923_0229013_316_714 126
489 3300035113 Ga0373936_0208675 Ga0373936_0208675_415_813 126
490 3300035114 Ga0373939_0285111 Ga0373939_0285111_137_535 126
491 3300035115 Ga0373941_0512986 Ga0373941_0512986_69_467 126
492 3300035116 Ga0373945_0265668 Ga0373945_0265668_146_544 126
493 3300035117 Ga0373953_0000883 Ga0373953_0000883_316_714 126
494 3300035118 Ga0373954_0012176 Ga0373954_0012176_1821_2219 126
495 3300035119 Ga0373956_0000119 Ga0373956_0000119_26902_27300 126
496 3300035119 Ga0373956_0019935 Ga0373956_0019935_528_926 126
497 3300035120 Ga0373957_0000264 Ga0373957_0000264_10265_10663 126
498 3300035120 Ga0373957_0090508 Ga0373957_0090508_632_1030 126
499 3300035170 Ga0373943_0683442 Ga0373943_0683442_91_489 126
500 3300035171 Ga0373946_0046854 Ga0373946_0046854_774_1172 126
501 3300035172 Ga0373955_0000149 Ga0373955_0000149_35_433 126
502 3300035172 Ga0373955_0027059 Ga0373955_0027059_146_544 126
503 3300035691 Ga0373931_0031311 Ga0373931_0031311_340_738 126
504 3300035692 Ga0373935_0216645 Ga0373935_0216645_305_703 126
505 3300035695 Ga0373927_0053687 Ga0373927_0053687_1899_2297 126
506 3300035724 Ga0373933_0000001 Ga0373933_0000001_209025_209423 126
507 3300035724 Ga0373933_0004044 Ga0373933_0004044_3565_3963 126
508 3300036401 Ga0373937_0003722 Ga0373937_0003722_8937_9335 126
509 3300036401 Ga0373937_0008016 Ga0373937_0008016_3832_4230 126
510 3300037068 Ga0373925_0052242 Ga0373925_0052242_1426_1824 126
511 3300037068 Ga0373925_1551390 Ga0373925_1551390_50_448 126
512 3300041451 Ga0451791_1151347 Ga0451791_1151347_48_437 126
513 3300041509 Ga0451843_0318951 Ga0451843_0318951_143_532 126
514 3300041512 Ga0451853_1218569 Ga0451853_1218569_90_482 126
515 3300042006 Ga0439432_023800 Ga0439432_023800_474_863 126
516 3300044694 Ga0466963_0200758 Ga0466963_0200758_605_1000 126
517 3300044765 Ga0466970_0041029 Ga0466970_0041029_989_1387 126
518 3300044901 Ga0466960_0032770 Ga0466960_0032770_1546_1935 126
519 3300045976 Ga0466967_0308852 Ga0466967_0308852_142_552 126
520 3300046454 Ga0495592_0000002 Ga0495592_0000002_209055_209453 126
521 3300046454 Ga0495592_0011520 Ga0495592_0011520_5516_5914 126
522 3300046455 Ga0495603_0021682 Ga0495603_0021682_623_1021 126
523 3300046455 Ga0495603_0355312 Ga0495603_0355312_19_438 126
524 3300046459 Ga0495629_0048554 Ga0495629_0048554_653_1051 126
525 3300046459 Ga0495629_0177987 Ga0495629_0177987_653_1051 126
526 3300046459 Ga0495629_0264740 Ga0495629_0264740_390_785 126
527 3300046461 Ga0495641_0007210 Ga0495641_0007210_110_508 126
528 3300046461 Ga0495641_0579447 Ga0495641_0579447_29_424 126
529 3300046462 Ga0495651_0000002 Ga0495651_0000002_41_439 126
530 3300046462 Ga0495651_0004885 Ga0495651_0004885_3430_3828 126
531 3300046462 Ga0495651_0294685 Ga0495651_0294685_38_436 126
532 3300046463 Ga0495653_0061535 Ga0495653_0061535_828_1226 126
533 3300046463 Ga0495653_0147769 Ga0495653_0147769_434_832 126
534 3300046473 Ga0495582_0046302 Ga0495582_0046302_830_1228 126
535 3300046473 Ga0495582_0134070 Ga0495582_0134070_629_1027 126
536 3300046473 Ga0495582_0310631 Ga0495582_0310631_207_602 126
537 3300046475 Ga0495639_0053636 Ga0495639_0053636_1284_1682 126
538 3300046475 Ga0495639_0259570 Ga0495639_0259570_336_734 126
539 3300046476 Ga0495662_0048557 Ga0495662_0048557_836_1234 126
540 3300046477 Ga0495664_0021110 Ga0495664_0021110_1039_1437 126
541 3300046511 Ga0495608_0000118 Ga0495608_0000118_56_454 126
542 3300046511 Ga0495608_0051171 Ga0495608_0051171_416_814 126
543 3300046514 Ga0495618_0064378 Ga0495618_0064378_423_821 126
544 3300046514 Ga0495618_0088489 Ga0495618_0088489_1273_1671 126
545 3300046516 Ga0495628_0042995 Ga0495628_0042995_394_792 126
546 3300046517 Ga0495630_0111057 Ga0495630_0111057_1532_1930 126
547 3300046526 Ga0495666_0187862 Ga0495666_0187862_26_424 126
548 3300046529 Ga0495652_0001668 Ga0495652_0001668_23661_24059 126
549 3300046529 Ga0495652_0084052 Ga0495652_0084052_606_1004 126
550 3300046531 Ga0495665_0001969 Ga0495665_0001969_10490_10888 126
551 3300046533 Ga0495640_0046734 Ga0495640_0046734_103_501 126
552 3300046533 Ga0495640_0516737 Ga0495640_0516737_16_414 126
553 3300046535 Ga0495586_0487291 Ga0495586_0487291_10_408 126
554 3300046536 Ga0495587_0000013 Ga0495587_0000013_195186_195584 126
555 3300046536 Ga0495587_0028032 Ga0495587_0028032_689_1087 126
556 3300046543 Ga0495645_0008113 Ga0495645_0008113_4580_4978 126
557 3300046543 Ga0495645_0100524 Ga0495645_0100524_1511_1909 126
558 3300046559 Ga0495667_0000016 Ga0495667_0000016_195191_195589 126
559 3300046559 Ga0495667_0280543 Ga0495667_0280543_288_686 126
560 3300046642 Ga0495634_0045516 Ga0495634_0045516_1925_2323 126
561 3300046642 Ga0495634_0056071 Ga0495634_0056071_2206_2604 126
562 3300046663 Ga0495635_0086387 Ga0495635_0086387_162_560 126
563 3300046663 Ga0495635_0174693 Ga0495635_0174693_362_760 126
564 3300046674 Ga0495588_0152958 Ga0495588_0152958_711_1109 126
565 3300046675 Ga0495657_0054676 Ga0495657_0054676_97_495 126
566 3300046678 Ga0495599_0000006 Ga0495599_0000006_209473_209871 126
567 3300046678 Ga0495599_0168346 Ga0495599_0168346_689_1087 126
568 3300046679 Ga0495623_0004288 Ga0495623_0004288_48_446 126
569 3300046679 Ga0495623_0032320 Ga0495623_0032320_204_602 126
570 3300046680 Ga0495646_0214382 Ga0495646_0214382_358_756 126
571 3300046681 Ga0495647_0163558 Ga0495647_0163558_340_738 126
572 3300046683 Ga0495658_0525427 Ga0495658_0525427_335_733 126
573 3300046689 Ga0495613_0373270 Ga0495613_0373270_158_556 126
574 3300046809 Ga0495600_0032600 Ga0495600_0032600_39_437 126
575 3300046809 Ga0495600_0033158 Ga0495600_0033158_1929_2327 126
576 3300047317 Ga0495604_0000015 Ga0495604_0000015_195172_195570 126
577 3300047317 Ga0495604_0044946 Ga0495604_0044946_2383_2781 126
578 3300047317 Ga0495604_0101866 Ga0495604_0101866_316_714 126
579 3300047319 Ga0495674_0248134 Ga0495674_0248134_425_823 126
580 3300047319 Ga0495674_0360696 Ga0495674_0360696_416_814 126
581 3300047321 Ga0495676_0135711 Ga0495676_0135711_65_463 126
582 3300047322 Ga0495680_0000380 Ga0495680_0000380_31_429 126
583 3300047322 Ga0495680_0070996 Ga0495680_0070996_316_714 126
584 3300047322 Ga0495680_0104904 Ga0495680_0104904_763_1161 126
585 3300047444 Ga0495675_0003988 Ga0495675_0003988_20_418 126
586 3300047444 Ga0495675_0006842 Ga0495675_0006842_42_440 126
587 3300047471 Ga0495684_0122951 Ga0495684_0122951_1132_1530 126
588 3300047471 Ga0495684_0722282 Ga0495684_0722282_113_511 126
589 3300048088 Ga0495602_0000013 Ga0495602_0000013_195169_195567 126
590 3300048088 Ga0495602_0080716 Ga0495602_0080716_416_814 126
591 3300048904 Ga0496101_0435883 Ga0496101_0435883_547_948 126
592 3300048904 Ga0496101_0508824 Ga0496101_0508824_315_716 126
593 3300048905 Ga0496102_0022401 Ga0496102_0022401_4051_4470 126
594 3300048905 Ga0496102_0053240 Ga0496102_0053240_2863_3264 126
595 3300048905 Ga0496102_1015256 Ga0496102_1015256_323_721 126
596 3300048906 Ga0496103_0164217 Ga0496103_0164217_304_705 126
597 3300048907 Ga0496104_0049400 Ga0496104_0049400_147_548 126
598 3300048907 Ga0496104_0080576 Ga0496104_0080576_1950_2369 126
599 3300048907 Ga0496104_0570083 Ga0496104_0570083_452_850 126
600 3300048908 Ga0496105_0023882 Ga0496105_0023882_3919_4338 126
601 3300048908 Ga0496105_0034742 Ga0496105_0034742_374_772 126
602 3300048908 Ga0496105_0106866 Ga0496105_0106866_1747_2145 126
603 3300048908 Ga0496105_0218298 Ga0496105_0218298_276_677 126
604 3300048909 Ga0496106_0200870 Ga0496106_0200870_219_620 126
605 3300048909 Ga0496106_0493837 Ga0496106_0493837_360_758 126
606 3300048910 Ga0496107_0031464 Ga0496107_0031464_1204_1602 126
607 3300048910 Ga0496107_0080717 Ga0496107_0080717_410_811 126
608 3300048910 Ga0496107_0116917 Ga0496107_0116917_1477_1878 126
609 3300048910 Ga0496107_0228299 Ga0496107_0228299_23_490 126
610 3300048910 Ga0496107_0767535 Ga0496107_0767535_11_430 126
611 3300048911 Ga0496108_0061779 Ga0496108_0061779_107_505 126
612 3300048911 Ga0496108_0161363 Ga0496108_0161363_157_576 126
613 3300048912 Ga0496109_0060553 Ga0496109_0060553_1031_1450 126
614 3300048912 Ga0496109_0090785 Ga0496109_0090785_2099_2497 126
615 3300048912 Ga0496109_0170415 Ga0496109_0170415_1041_1526 126
616 3300048912 Ga0496109_1112199 Ga0496109_1112199_61_462 126
617 3300048913 Ga0496110_0217814 Ga0496110_0217814_1062_1463 126
618 3300048913 Ga0496110_0235609 Ga0496110_0235609_203_622 126
619 3300048913 Ga0496110_0553970 Ga0496110_0553970_213_635 126
620 3300048914 Ga0496111_0040218 Ga0496111_0040218_2087_2506 126
621 3300048914 Ga0496111_0753699 Ga0496111_0753699_49_450 126
622 3300048914 Ga0496111_0990182 Ga0496111_0990182_31_429 126
623 3300048915 Ga0496112_0049008 Ga0496112_0049008_725_1144 126
624 3300048916 Ga0496113_0047753 Ga0496113_0047753_1882_2280 126
625 3300048916 Ga0496113_0087107 Ga0496113_0087107_1110_1529 126
626 3300048916 Ga0496113_0109406 Ga0496113_0109406_690_1112 126
627 3300048917 Ga0496114_0003343 Ga0496114_0003343_6302_6703 126
628 3300048917 Ga0496114_0036683 Ga0496114_0036683_765_1184 126
629 3300048917 Ga0496114_0068172 Ga0496114_0068172_2538_2939 126
630 3300048917 Ga0496114_0453751 Ga0496114_0453751_356_748 126
631 3300048917 Ga0496114_0650191 Ga0496114_0650191_438_839 126
632 3300048917 Ga0496114_0925624 Ga0496114_0925624_166_564 126
633 3300048917 Ga0496114_0979248 Ga0496114_0979248_55_447 126
634 3300048918 Ga0496115_0010588 Ga0496115_0010588_4894_5295 126
635 3300048918 Ga0496115_0079179 Ga0496115_0079179_695_1093 126
636 3300048918 Ga0496115_0119959 Ga0496115_0119959_198_599 126
637 3300049568 Ga0501031_0127184 Ga0501031_0127184_1174_1590 126
638 3300049572 Ga0501036_0129408 Ga0501036_0129408_132_548 126
639 3300049578 Ga0501042_0767078 Ga0501042_0767078_159_575 126
640 3300049585 Ga0501069_0421527 Ga0501069_0421527_322_714 126
641 3300049589 Ga0501073_0565183 Ga0501073_0565183_177_572 126
642 3300049590 Ga0501074_0650417 Ga0501074_0650417_110_505 126
643 3300049822 Ga0501035_0236917 Ga0501035_0236917_896_1291 126
644 3300050492 nmdc:mga0yw44_165066_c1 nmdc:mga0yw44_165066_c1_541_939 126
645 3300050492 nmdc:mga0yw44_357696_c1 nmdc:mga0yw44_357696_c1_49_450 126
646 3300050507 nmdc:mga05p37_10551_c1 nmdc:mga05p37_10551_c1_5984_6382 126
647 3300050511 nmdc:mga08y16_18189_c1 nmdc:mga08y16_18189_c1_6232_6630 126
648 3300050512 nmdc:mga0n895_156223_c1 nmdc:mga0n895_156223_c1_1644_2042 126
649 3300050512 nmdc:mga0n895_63600_c1 nmdc:mga0n895_63600_c1_1002_1400 126
650 3300050513 nmdc:mga0rr50_164390_c1 nmdc:mga0rr50_164390_c1_868_1266 126
651 3300050513 nmdc:mga0rr50_204116_c1 nmdc:mga0rr50_204116_c1_39_437 126
652 3300050514 nmdc:mga08x19_208364_c1 nmdc:mga08x19_208364_c1_830_1228 126
653 3300050515 nmdc:mga0a205_158924_c1 nmdc:mga0a205_158924_c1_361_759 126
654 3300050515 nmdc:mga0a205_229960_c1 nmdc:mga0a205_229960_c1_1174_1572 126
655 3300053077 Ga0495601_0075852 Ga0495601_0075852_1733_2131 126
656 3300053077 Ga0495601_0092166 Ga0495601_0092166_1428_1826 126
657 3300053078 Ga0495612_0054437 Ga0495612_0054437_1163_1561 126
658 3300053084 Ga0495595_0019025 Ga0495595_0019025_2468_2866 126
659 3300053085 Ga0495619_0065148 Ga0495619_0065148_1831_2229 126
660 3300054114 Ga0501084_0722588 Ga0501084_0722588_244_630 126
661 iso_pu_bacteria 2643221641 2644230412 126
662 3300001990 JGI24737J22298_10158422 JGI24737J22298_101584222 127
663 3300005327 Ga0070658_10059220 Ga0070658_100592203 127
664 3300005327 Ga0070658_10090323 Ga0070658_100903233 127
665 3300005329 Ga0070683_100039111 Ga0070683_1000391113 127
666 3300005329 Ga0070683_100110191 Ga0070683_1001101912 127
667 3300005329 Ga0070683_100308211 Ga0070683_1003082113 127
668 3300005330 Ga0070690_100505520 Ga0070690_1005055201 127
669 3300005334 Ga0068869_100114192 Ga0068869_1001141922 127
670 3300005334 Ga0068869_101400194 Ga0068869_1014001942 127
671 3300005337 Ga0070682_100069703 Ga0070682_1000697032 127
672 3300005338 Ga0068868_100168751 Ga0068868_1001687513 127
673 3300005338 Ga0068868_100323109 Ga0068868_1003231092 127
674 3300005339 Ga0070660_101366104 Ga0070660_1013661041 127
675 3300005343 Ga0070687_100263292 Ga0070687_1002632922 127
676 3300005345 Ga0070692_10042979 Ga0070692_100429793 127
677 3300005345 Ga0070692_10052824 Ga0070692_100528243 127
678 3300005354 Ga0070675_102227321 Ga0070675_1022273211 127
679 3300005365 Ga0070688_100697478 Ga0070688_1006974781 127
680 3300005366 Ga0070659_100002813 Ga0070659_1000028137 127
681 3300005366 Ga0070659_100084399 Ga0070659_1000843992 127
682 3300005366 Ga0070659_100129965 Ga0070659_1001299651 127
683 3300005367 Ga0070667_100085200 Ga0070667_1000852002 127
684 3300005456 Ga0070678_100786703 Ga0070678_1007867032 127
685 3300005456 Ga0070678_101310509 Ga0070678_1013105091 127
686 3300005466 Ga0070685_10132006 Ga0070685_101320062 127
687 3300005535 Ga0070684_100004679 Ga0070684_1000046793 127
688 3300005535 Ga0070684_100178423 Ga0070684_1001784231 127
689 3300005539 Ga0068853_100054483 Ga0068853_1000544833 127
690 3300005543 Ga0070672_100197908 Ga0070672_1001979082 127
691 3300005563 Ga0068855_100721681 Ga0068855_1007216812 127
692 3300005577 Ga0068857_100412843 Ga0068857_1004128432 127
693 3300005614 Ga0068856_100030983 Ga0068856_1000309837 127
694 3300005615 Ga0070702_100043779 Ga0070702_1000437793 127
695 3300005618 Ga0068864_100144978 Ga0068864_1001449783 127
696 3300005618 Ga0068864_100589373 Ga0068864_1005893731 127
697 3300005840 Ga0068870_10805173 Ga0068870_108051731 127
698 3300005842 Ga0068858_100156339 Ga0068858_1001563392 127
699 3300006038 Ga0075365_10083948 Ga0075365_100839483 127
700 3300006163 Ga0070715_10022717 Ga0070715_100227174 127
701 3300006237 Ga0097621_100435582 Ga0097621_1004355822 127
702 3300006237 Ga0097621_101603898 Ga0097621_1016038981 127
703 3300009098 Ga0105245_10033266 Ga0105245_100332661 127
704 3300009098 Ga0105245_11551034 Ga0105245_115510341 127
705 3300009098 Ga0105245_11731961 Ga0105245_117319611 127
706 3300009148 Ga0105243_10102438 Ga0105243_101024382 127
707 3300009148 Ga0105243_10883563 Ga0105243_108835632 127
708 3300009174 Ga0105241_11432238 Ga0105241_114322382 127
709 3300009176 Ga0105242_10059768 Ga0105242_100597682 127
710 3300009176 Ga0105242_11073203 Ga0105242_110732032 127
711 3300009553 Ga0105249_10094482 Ga0105249_100944823 127
712 3300009553 Ga0105249_10649552 Ga0105249_106495522 127
713 3300009553 Ga0105249_10984586 Ga0105249_109845862 127
714 3300010375 Ga0105239_10003866 Ga0105239_100038663 127
715 3300011119 Ga0105246_10099446 Ga0105246_100994462 127
716 3300011119 Ga0105246_10191818 Ga0105246_101918182 127
717 3300011119 Ga0105246_10344305 Ga0105246_103443052 127
718 3300011119 Ga0105246_11390842 Ga0105246_113908421 127
719 3300013102 Ga0157371_10032175 Ga0157371_100321752 127
720 3300013102 Ga0157371_10058612 Ga0157371_100586123 127
721 3300013104 Ga0157370_10784106 Ga0157370_107841062 127
722 3300013105 Ga0157369_10010796 Ga0157369_100107967 127
723 3300013105 Ga0157369_10252582 Ga0157369_102525823 127
724 3300013105 Ga0157369_10262232 Ga0157369_102622322 127
725 3300013296 Ga0157374_11462394 Ga0157374_114623941 127
726 3300013306 Ga0163162_10388021 Ga0163162_103880211 127
727 3300013306 Ga0163162_11800444 Ga0163162_118004442 127
728 3300013307 Ga0157372_10003827 Ga0157372_1000382715 127
729 3300013307 Ga0157372_10572686 Ga0157372_105726862 127
730 3300013307 Ga0157372_11041619 Ga0157372_110416191 127
731 3300013308 Ga0157375_10006629 Ga0157375_100066297 127
732 3300013308 Ga0157375_10814001 Ga0157375_108140012 127
733 3300014497 Ga0182008_10089423 Ga0182008_100894232 127
734 3300014968 Ga0157379_10038769 Ga0157379_100387694 127
735 3300014968 Ga0157379_11195035 Ga0157379_111950351 127
736 3300014969 Ga0157376_10363778 Ga0157376_103637782 127
737 3300025901 Ga0207688_10226399 Ga0207688_102263992 127
738 3300025904 Ga0207647_10171147 Ga0207647_101711472 127
739 3300025905 Ga0207685_10009391 Ga0207685_100093912 127
740 3300025908 Ga0207643_10110487 Ga0207643_101104872 127
741 3300025909 Ga0207705_10083637 Ga0207705_100836372 127
742 3300025909 Ga0207705_10147116 Ga0207705_101471163 127
743 3300025918 Ga0207662_10019269 Ga0207662_100192693 127
744 3300025918 Ga0207662_10220927 Ga0207662_102209273 127
745 3300025919 Ga0207657_10084314 Ga0207657_100843143 127
746 3300025919 Ga0207657_10302809 Ga0207657_103028092 127
747 3300025921 Ga0207652_10785101 Ga0207652_107851012 127
748 3300025927 Ga0207687_10012913 Ga0207687_100129131 127
749 3300025932 Ga0207690_10011248 Ga0207690_100112484 127
750 3300025935 Ga0207709_10058737 Ga0207709_100587373 127
751 3300025936 Ga0207670_11104346 Ga0207670_111043462 127
752 3300025938 Ga0207704_10662430 Ga0207704_106624302 127
753 3300025940 Ga0207691_10061400 Ga0207691_100614003 127
754 3300025942 Ga0207689_10860342 Ga0207689_108603422 127
755 3300025944 Ga0207661_10008501 Ga0207661_100085014 127
756 3300025944 Ga0207661_10051113 Ga0207661_100511133 127
757 3300025944 Ga0207661_10072555 Ga0207661_100725553 127
758 3300025949 Ga0207667_10468545 Ga0207667_104685452 127
759 3300025960 Ga0207651_10463972 Ga0207651_104639722 127
760 3300025961 Ga0207712_10095250 Ga0207712_100952503 127
761 3300025961 Ga0207712_10198365 Ga0207712_101983652 127
762 3300025986 Ga0207658_10175811 Ga0207658_101758113 127
763 3300026023 Ga0207677_10782812 Ga0207677_107828121 127
764 3300026035 Ga0207703_10275635 Ga0207703_102756352 127
765 3300026041 Ga0207639_10734902 Ga0207639_107349022 127
766 3300026078 Ga0207702_10012578 Ga0207702_100125789 127
767 3300026078 Ga0207702_10806956 Ga0207702_108069561 127
768 3300026095 Ga0207676_10428034 Ga0207676_104280342 127
769 3300026095 Ga0207676_10774922 Ga0207676_107749222 127
770 3300026116 Ga0207674_10063146 Ga0207674_100631464 127
771 3300026121 Ga0207683_10047551 Ga0207683_100475513 127
772 3300026121 Ga0207683_11607668 Ga0207683_116076681 127
773 3300026142 Ga0207698_11815532 Ga0207698_118155321 127
774 3300028379 Ga0268266_10639544 Ga0268266_106395442 127
775 3300028379 Ga0268266_11933246 Ga0268266_119332462 127
776 3300031852 Ga0307410_10417753 Ga0307410_104177532 127
777 3300031901 Ga0307406_10690906 Ga0307406_106909062 127
778 3300031903 Ga0307407_10263087 Ga0307407_102630872 127
779 3300031995 Ga0307409_100244769 Ga0307409_1002447692 127
780 3300032002 Ga0307416_100233044 Ga0307416_1002330443 127
781 3300032004 Ga0307414_10918830 Ga0307414_109188302 127
782 3300032126 Ga0307415_100267361 Ga0307415_1002673612 127
783 3300032126 Ga0307415_102556235 Ga0307415_1025562351 127
784 3300035086 Ga0373934_0012177 Ga0373934_0012177_1020_1421 127
785 3300035086 Ga0373934_0019874 Ga0373934_0019874_322_723 127
786 3300035111 Ga0373923_0704767 Ga0373923_0704767_56_457 127
787 3300035117 Ga0373953_0103602 Ga0373953_0103602_676_1077 127
788 3300035118 Ga0373954_0338081 Ga0373954_0338081_42_443 127
789 3300035119 Ga0373956_0073902 Ga0373956_0073902_862_1263 127
790 3300035119 Ga0373956_0174461 Ga0373956_0174461_300_701 127
791 3300035172 Ga0373955_0013651 Ga0373955_0013651_870_1271 127
792 3300035172 Ga0373955_0817298 Ga0373955_0817298_40_441 127
793 3300035410 Ga0373924_0179529 Ga0373924_0179529_98_499 127
794 3300035410 Ga0373924_0181776 Ga0373924_0181776_432_833 127
795 3300035724 Ga0373933_0074097 Ga0373933_0074097_210_611 127
796 3300036401 Ga0373937_0027495 Ga0373937_0027495_3823_4224 127
797 3300036401 Ga0373937_0378438 Ga0373937_0378438_822_1223 127
798 3300037068 Ga0373925_0814952 Ga0373925_0814952_36_455 127
799 3300037312 Ga0395899_0717072 Ga0395899_0717072_28_432 127
800 3300037471 Ga0395905_0272425 Ga0395905_0272425_712_1161 127
801 3300038443 Ga0395901_0086751 Ga0395901_0086751_1307_1756 127
802 3300038443 Ga0395901_0186072 Ga0395901_0186072_372_785 127
803 3300041496 Ga0451839_1549090 Ga0451839_1549090_81_470 127
804 3300044694 Ga0466963_0265612 Ga0466963_0265612_448_852 127
805 3300044694 Ga0466963_0440355 Ga0466963_0440355_92_490 127
806 3300044706 Ga0466964_0712213 Ga0466964_0712213_142_546 127
807 3300044901 Ga0466960_0014114 Ga0466960_0014114_2108_2500 127
808 3300044901 Ga0466960_0801468 Ga0466960_0801468_88_486 127
809 3300045051 Ga0451576_1822625 Ga0451576_1822625_44_442 127
810 3300046461 Ga0495641_0157368 Ga0495641_0157368_443_841 127
811 3300046462 Ga0495651_0023699 Ga0495651_0023699_2162_2563 127
812 3300046462 Ga0495651_0040760 Ga0495651_0040760_868_1269 127
813 3300046511 Ga0495608_0319763 Ga0495608_0319763_164_565 127
814 3300046511 Ga0495608_0383652 Ga0495608_0383652_291_692 127
815 3300046517 Ga0495630_0733000 Ga0495630_0733000_41_442 127
816 3300046529 Ga0495652_0041720 Ga0495652_0041720_1078_1479 127
817 3300046529 Ga0495652_0401645 Ga0495652_0401645_346_747 127
818 3300046536 Ga0495587_0034666 Ga0495587_0034666_721_1122 127
819 3300046559 Ga0495667_0006731 Ga0495667_0006731_2935_3336 127
820 3300046675 Ga0495657_0020719 Ga0495657_0020719_2163_2564 127
821 3300046675 Ga0495657_0548406 Ga0495657_0548406_181_582 127
822 3300046679 Ga0495623_0072472 Ga0495623_0072472_1391_1792 127
823 3300046809 Ga0495600_0186529 Ga0495600_0186529_734_1135 127
824 3300047317 Ga0495604_0022292 Ga0495604_0022292_3246_3647 127
825 3300047322 Ga0495680_0006296 Ga0495680_0006296_953_1354 127
826 3300047444 Ga0495675_0782069 Ga0495675_0782069_13_414 127
827 3300047471 Ga0495684_0194699 Ga0495684_0194699_240_641 127
828 3300048088 Ga0495602_0018082 Ga0495602_0018082_2132_2533 127
829 3300048088 Ga0495602_0025113 Ga0495602_0025113_2702_3103 127
830 3300048903 Ga0496100_0160710 Ga0496100_0160710_1116_1511 127
831 3300048903 Ga0496100_1037067 Ga0496100_1037067_133_564 127
832 3300048905 Ga0496102_0024776 Ga0496102_0024776_3885_4283 127
833 3300048905 Ga0496102_0450266 Ga0496102_0450266_131_529 127
834 3300048905 Ga0496102_1270546 Ga0496102_1270546_231_620 127
835 3300048907 Ga0496104_0138954 Ga0496104_0138954_271_660 127
836 3300048907 Ga0496104_0272209 Ga0496104_0272209_301_696 127
837 3300048907 Ga0496104_0634736 Ga0496104_0634736_189_674 127
838 3300048909 Ga0496106_0242032 Ga0496106_0242032_550_948 127
839 3300048911 Ga0496108_0351959 Ga0496108_0351959_183_569 127
840 3300048911 Ga0496108_1092642 Ga0496108_1092642_259_648 127
841 3300048912 Ga0496109_0005951 Ga0496109_0005951_5377_5775 127
842 3300048912 Ga0496109_1242732 Ga0496109_1242732_99_494 127
843 3300048913 Ga0496110_0003268 Ga0496110_0003268_4903_5301 127
844 3300048913 Ga0496110_0247530 Ga0496110_0247530_720_1115 127
845 3300048913 Ga0496110_1152180 Ga0496110_1152180_274_663 127
846 3300048914 Ga0496111_0045883 Ga0496111_0045883_1735_2133 127
847 3300048914 Ga0496111_0405533 Ga0496111_0405533_325_720 127
848 3300048917 Ga0496114_0256919 Ga0496114_0256919_210_608 127
849 3300048917 Ga0496114_0349443 Ga0496114_0349443_154_543 127
850 3300048917 Ga0496114_0467965 Ga0496114_0467965_380_796 127
851 3300049569 Ga0501032_0375680 Ga0501032_0375680_218_616 127
852 3300049571 Ga0501034_0028742 Ga0501034_0028742_1097_1495 127
853 3300049571 Ga0501034_0173851 Ga0501034_0173851_356_754 127
854 3300049573 Ga0501037_0507395 Ga0501037_0507395_173_580 127
855 3300049574 Ga0501038_0248146 Ga0501038_0248146_246_644 127
856 3300049574 Ga0501038_0315980 Ga0501038_0315980_339_737 127
857 3300049574 Ga0501038_0889827 Ga0501038_0889827_22_423 127
858 3300049575 Ga0501039_0626895 Ga0501039_0626895_261_650 127
859 3300049583 Ga0501067_0000382 Ga0501067_0000382_5640_6038 127
860 3300049583 Ga0501067_0009572 Ga0501067_0009572_740_1138 127
861 3300049584 Ga0501068_0004453 Ga0501068_0004453_3951_4349 127
862 3300049584 Ga0501068_0020240 Ga0501068_0020240_1870_2268 127
863 3300049585 Ga0501069_0005381 Ga0501069_0005381_2871_3269 127
864 3300049585 Ga0501069_0039409 Ga0501069_0039409_273_671 127
865 3300049585 Ga0501069_0083486 Ga0501069_0083486_651_1049 127
866 3300049586 Ga0501070_0004353 Ga0501070_0004353_365_763 127
867 3300049586 Ga0501070_0026463 Ga0501070_0026463_3902_4300 127
868 3300049586 Ga0501070_0075851 Ga0501070_0075851_1607_2005 127
869 3300049587 Ga0501071_0062679 Ga0501071_0062679_1669_2067 127
870 3300049587 Ga0501071_0092690 Ga0501071_0092690_283_681 127
871 3300049588 Ga0501072_0043272 Ga0501072_0043272_1974_2372 127
872 3300049588 Ga0501072_0203043 Ga0501072_0203043_694_1092 127
873 3300049589 Ga0501073_0102195 Ga0501073_0102195_666_1064 127
874 3300049589 Ga0501073_0181516 Ga0501073_0181516_93_491 127
875 3300049590 Ga0501074_0002178 Ga0501074_0002178_5552_5950 127
876 3300049590 Ga0501074_0008865 Ga0501074_0008865_5803_6201 127
877 3300049590 Ga0501074_0023126 Ga0501074_0023126_3422_3820 127
878 3300049593 Ga0501077_0013639 Ga0501077_0013639_1800_2198 127
879 3300049593 Ga0501077_0267466 Ga0501077_0267466_80_478 127
880 3300049741 Ga0501079_0019109 Ga0501079_0019109_994_1392 127
881 3300049741 Ga0501079_0028841 Ga0501079_0028841_3611_4009 127
882 3300049742 Ga0501080_0010636 Ga0501080_0010636_6481_6879 127
883 3300049742 Ga0501080_0229452 Ga0501080_0229452_731_1129 127
884 3300049744 Ga0501083_0014766 Ga0501083_0014766_2390_2788 127
885 3300049744 Ga0501083_0031209 Ga0501083_0031209_2662_3060 127
886 3300049823 Ga0501044_1129366 Ga0501044_1129366_122_520 127
887 3300050492 nmdc:mga0yw44_22863_c1 nmdc:mga0yw44_22863_c1_1738_2136 127
888 3300053085 Ga0495619_0117849 Ga0495619_0117849_830_1231 127
889 3300054114 Ga0501084_0008213 Ga0501084_0008213_5598_5996 127
890 3300060353 Ga0501082_0106842 Ga0501082_0106842_124_522 127
891 iso_pu_bacteria 2622736626 2623589196 127
892 iso_pu_bacteria 2855683550 2855683841 127
893 3300005327 Ga0070658_10163053 Ga0070658_101630532 128
894 3300005327 Ga0070658_10466784 Ga0070658_104667842 128
895 3300005329 Ga0070683_101069937 Ga0070683_1010699372 128
896 3300005329 Ga0070683_101101973 Ga0070683_1011019731 128
897 3300005329 Ga0070683_101625839 Ga0070683_1016258391 128
898 3300005339 Ga0070660_100071828 Ga0070660_1000718282 128
899 3300005344 Ga0070661_100231882 Ga0070661_1002318823 128
900 3300005366 Ga0070659_100098643 Ga0070659_1000986432 128
901 3300005435 Ga0070714_100179288 Ga0070714_1001792883 128
902 3300005436 Ga0070713_100120547 Ga0070713_1001205472 128
903 3300005439 Ga0070711_101301472 Ga0070711_1013014721 128
904 3300005445 Ga0070708_100447613 Ga0070708_1004476131 128
905 3300005455 Ga0070663_100057000 Ga0070663_1000570005 128
906 3300005458 Ga0070681_10571108 Ga0070681_105711082 128
907 3300005466 Ga0070685_10335037 Ga0070685_103350371 128
908 3300005467 Ga0070706_100064133 Ga0070706_1000641333 128
909 3300005467 Ga0070706_100132282 Ga0070706_1001322823 128
910 3300005468 Ga0070707_100087282 Ga0070707_1000872823 128
911 3300005468 Ga0070707_100478268 Ga0070707_1004782683 128
912 3300005471 Ga0070698_100001616 Ga0070698_10000161617 128
913 3300005530 Ga0070679_100074111 Ga0070679_1000741113 128
914 3300005530 Ga0070679_100190272 Ga0070679_1001902723 128
915 3300005535 Ga0070684_100137835 Ga0070684_1001378352 128
916 3300005535 Ga0070684_101494394 Ga0070684_1014943941 128
917 3300005564 Ga0070664_100939371 Ga0070664_1009393712 128
918 3300005564 Ga0070664_101505778 Ga0070664_1015057782 128
919 3300005564 Ga0070664_101861055 Ga0070664_1018610552 128
920 3300005577 Ga0068857_101049042 Ga0068857_1010490421 128
921 3300005614 Ga0068856_102630625 Ga0068856_1026306251 128
922 3300005617 Ga0068859_100678381 Ga0068859_1006783812 128
923 3300005617 Ga0068859_102550143 Ga0068859_1025501431 128
924 3300005618 Ga0068864_100001246 Ga0068864_1000012468 128
925 3300005843 Ga0068860_102674595 Ga0068860_1026745951 128
926 3300006038 Ga0075365_10005082 Ga0075365_100050823 128
927 3300006038 Ga0075365_10058909 Ga0075365_100589092 128
928 3300006038 Ga0075365_10529473 Ga0075365_105294732 128
929 3300006042 Ga0075368_10007644 Ga0075368_100076444 128
930 3300006048 Ga0075363_100003533 Ga0075363_1000035336 128
931 3300006048 Ga0075363_100004855 Ga0075363_1000048553 128
932 3300006051 Ga0075364_10094991 Ga0075364_100949912 128
933 3300006178 Ga0075367_10004312 Ga0075367_100043123 128
934 3300006353 Ga0075370_10087195 Ga0075370_100871952 128
935 3300006914 Ga0075436_100017016 Ga0075436_1000170162 128
936 3300006931 Ga0097620_100678423 Ga0097620_1006784232 128
937 3300006931 Ga0097620_102550192 Ga0097620_1025501921 128
938 3300009094 Ga0111539_11452492 Ga0111539_114524921 128
939 3300009148 Ga0105243_10096341 Ga0105243_100963412 128
940 3300009545 Ga0105237_10380082 Ga0105237_103800822 128
941 3300009551 Ga0105238_10545302 Ga0105238_105453022 128
942 3300010375 Ga0105239_10025711 Ga0105239_100257113 128
943 3300011119 Ga0105246_11069884 Ga0105246_110698841 128
944 3300013307 Ga0157372_10192118 Ga0157372_101921183 128
945 3300020082 Ga0206353_10402442 Ga0206353_104024421 128
946 3300025904 Ga0207647_10031995 Ga0207647_100319953 128
947 3300025909 Ga0207705_10158850 Ga0207705_101588502 128
948 3300025909 Ga0207705_10410237 Ga0207705_104102372 128
949 3300025910 Ga0207684_10290658 Ga0207684_102906581 128
950 3300025912 Ga0207707_10584468 Ga0207707_105844682 128
951 3300025914 Ga0207671_10136199 Ga0207671_101361992 128
952 3300025915 Ga0207693_10021973 Ga0207693_100219732 128
953 3300025919 Ga0207657_10082537 Ga0207657_100825373 128
954 3300025920 Ga0207649_10154646 Ga0207649_101546462 128
955 3300025920 Ga0207649_10565395 Ga0207649_105653951 128
956 3300025921 Ga0207652_10128741 Ga0207652_101287412 128
957 3300025922 Ga0207646_11194662 Ga0207646_111946622 128
958 3300025926 Ga0207659_10790512 Ga0207659_107905121 128
959 3300025928 Ga0207700_10134288 Ga0207700_101342882 128
960 3300025929 Ga0207664_10134335 Ga0207664_101343353 128
961 3300025929 Ga0207664_10251096 Ga0207664_102510963 128
962 3300025932 Ga0207690_11770413 Ga0207690_117704131 128
963 3300025935 Ga0207709_10154800 Ga0207709_101548002 128
964 3300025941 Ga0207711_10379105 Ga0207711_103791052 128
965 3300025945 Ga0207679_10312853 Ga0207679_103128532 128
966 3300026035 Ga0207703_10935928 Ga0207703_109359282 128
967 3300026067 Ga0207678_10138196 Ga0207678_101381962 128
968 3300026067 Ga0207678_10296012 Ga0207678_102960121 128
969 3300026095 Ga0207676_10005287 Ga0207676_100052872 128
970 3300026116 Ga0207674_10292423 Ga0207674_102924232 128
971 3300027866 Ga0209813_10003830 Ga0209813_100038303 128
972 3300028379 Ga0268266_10013813 Ga0268266_100138136 128
973 3300028381 Ga0268264_10300571 Ga0268264_103005711 128
974 3300031824 Ga0307413_11793260 Ga0307413_117932602 128
975 3300031995 Ga0307409_100017289 Ga0307409_1000172895 128
976 3300031995 Ga0307409_100052238 Ga0307409_1000522383 128
977 3300031995 Ga0307409_101723084 Ga0307409_1017230841 128
978 3300032126 Ga0307415_100064890 Ga0307415_1000648904 128
979 3300035083 Ga0373926_0018669 Ga0373926_0018669_1672_2073 128
980 3300035089 Ga0373944_0139883 Ga0373944_0139883_149_535 128
981 3300035117 Ga0373953_0135916 Ga0373953_0135916_615_1028 128
982 3300035170 Ga0373943_0099509 Ga0373943_0099509_521_934 128
983 3300035171 Ga0373946_0689580 Ga0373946_0689580_75_461 128
984 3300035171 Ga0373946_0692906 Ga0373946_0692906_96_509 128
985 3300035695 Ga0373927_0479793 Ga0373927_0479793_32_445 128
986 3300035724 Ga0373933_0305448 Ga0373933_0305448_499_912 128
987 3300035725 Ga0373947_0000001 Ga0373947_0000001_20257_20658 128
988 3300035725 Ga0373947_0203473 Ga0373947_0203473_672_1058 128
989 3300036401 Ga0373937_0678904 Ga0373937_0678904_421_834 128
990 3300037068 Ga0373925_0692281 Ga0373925_0692281_329_742 128
991 3300037418 Ga0395900_1567802 Ga0395900_1567802_18_413 128
992 3300037466 Ga0395898_0110468 Ga0395898_0110468_185_580 128
993 3300038443 Ga0395901_0011041 Ga0395901_0011041_4382_4777 128
994 3300041460 Ga0451802_1521807 Ga0451802_1521807_46_450 128
995 3300041512 Ga0451853_0618515 Ga0451853_0618515_137_544 128
996 3300042439 Ga0439464_0020493 Ga0439464_0020493_475_870 128
997 3300042993 Ga0439440_0173765 Ga0439440_0173765_22_417 128
998 3300044683 Ga0466965_0443774 Ga0466965_0443774_67_468 128
999 3300044683 Ga0466965_0771583 Ga0466965_0771583_84_485 128
1000 3300044684 Ga0466966_0028740 Ga0466966_0028740_2595_2999 128
1001 3300044693 Ga0466961_0060596 Ga0466961_0060596_869_1258 128
1002 3300044693 Ga0466961_0508529 Ga0466961_0508529_28_429 128
1003 3300044901 Ga0466960_0206374 Ga0466960_0206374_513_926 128
1004 3300044901 Ga0466960_0437836 Ga0466960_0437836_44_445 128
1005 3300045976 Ga0466967_0688094 Ga0466967_0688094_146_541 128
1006 3300045976 Ga0466967_1750573 Ga0466967_1750573_45_440 128
1007 3300046459 Ga0495629_0767668 Ga0495629_0767668_189_602 128
1008 3300046463 Ga0495653_0190316 Ga0495653_0190316_189_593 128
1009 3300046476 Ga0495662_0362734 Ga0495662_0362734_55_441 128
1010 3300046476 Ga0495662_0487115 Ga0495662_0487115_53_466 128
1011 3300046477 Ga0495664_0057880 Ga0495664_0057880_1369_1782 128
1012 3300046491 Ga0495584_0285146 Ga0495584_0285146_51_467 128
1013 3300046511 Ga0495608_0106289 Ga0495608_0106289_163_570 128
1014 3300046514 Ga0495618_0256858 Ga0495618_0256858_583_996 128
1015 3300046516 Ga0495628_0423196 Ga0495628_0423196_212_625 128
1016 3300046529 Ga0495652_0165787 Ga0495652_0165787_1220_1633 128
1017 3300046531 Ga0495665_0265741 Ga0495665_0265741_388_798 128
1018 3300046533 Ga0495640_0108235 Ga0495640_0108235_1293_1706 128
1019 3300046533 Ga0495640_0559515 Ga0495640_0559515_143_529 128
1020 3300046543 Ga0495645_0547946 Ga0495645_0547946_154_567 128
1021 3300046559 Ga0495667_0078679 Ga0495667_0078679_900_1304 128
1022 3300046675 Ga0495657_0303533 Ga0495657_0303533_391_798 128
1023 3300046679 Ga0495623_0398418 Ga0495623_0398418_116_529 128
1024 3300046683 Ga0495658_0021946 Ga0495658_0021946_2072_2482 128
1025 3300046683 Ga0495658_0152745 Ga0495658_0152745_606_1016 128
1026 3300046689 Ga0495613_0717199 Ga0495613_0717199_91_498 128
1027 3300047317 Ga0495604_0162014 Ga0495604_0162014_480_893 128
1028 3300047318 Ga0495636_0178433 Ga0495636_0178433_285_701 128
1029 3300047319 Ga0495674_0004688 Ga0495674_0004688_3601_4014 128
1030 3300047321 Ga0495676_0017368 Ga0495676_0017368_5149_5559 128
1031 3300047322 Ga0495680_0622819 Ga0495680_0622819_163_567 128
1032 3300047471 Ga0495684_0482889 Ga0495684_0482889_151_564 128
1033 3300047673 Ga0495593_0026990 Ga0495593_0026990_1062_1448 128
1034 3300048903 Ga0496100_0120895 Ga0496100_0120895_256_654 128
1035 3300048904 Ga0496101_0091077 Ga0496101_0091077_1452_1859 128
1036 3300048905 Ga0496102_0655086 Ga0496102_0655086_433_840 128
1037 3300048906 Ga0496103_0722737 Ga0496103_0722737_37_444 128
1038 3300048907 Ga0496104_0066466 Ga0496104_0066466_635_1021 128
1039 3300048907 Ga0496104_0870787 Ga0496104_0870787_174_569 128
1040 3300048907 Ga0496104_1097861 Ga0496104_1097861_80_466 128
1041 3300048908 Ga0496105_0065744 Ga0496105_0065744_2529_2915 128
1042 3300048908 Ga0496105_0246702 Ga0496105_0246702_620_1027 128
1043 3300048911 Ga0496108_0007825 Ga0496108_0007825_771_1157 128
1044 3300048912 Ga0496109_0356687 Ga0496109_0356687_943_1329 128
1045 3300048913 Ga0496110_0021397 Ga0496110_0021397_797_1183 128
1046 3300048913 Ga0496110_0172780 Ga0496110_0172780_844_1251 128
1047 3300048914 Ga0496111_0019760 Ga0496111_0019760_3090_3476 128
1048 3300048915 Ga0496112_0571420 Ga0496112_0571420_42_428 128
1049 3300048915 Ga0496112_0592331 Ga0496112_0592331_476_871 128
1050 3300048915 Ga0496112_1629645 Ga0496112_1629645_43_438 128
1051 3300048916 Ga0496113_0071411 Ga0496113_0071411_362_748 128
1052 3300048917 Ga0496114_0071773 Ga0496114_0071773_1071_1478 128
1053 3300048918 Ga0496115_0075917 Ga0496115_0075917_102_509 128
1054 3300048918 Ga0496115_0979343 Ga0496115_0979343_200_586 128
1055 3300048929 Ga0496126_0235246 Ga0496126_0235246_1039_1467 128
1056 3300049572 Ga0501036_0003085 Ga0501036_0003085_6143_6556 128
1057 3300049573 Ga0501037_0023795 Ga0501037_0023795_1201_1614 128
1058 3300049574 Ga0501038_0013190 Ga0501038_0013190_3933_4346 128
1059 3300049575 Ga0501039_0004558 Ga0501039_0004558_7742_8155 128
1060 3300049576 Ga0501040_0002442 Ga0501040_0002442_7697_8110 128
1061 3300049577 Ga0501041_0005387 Ga0501041_0005387_4267_4680 128
1062 3300049578 Ga0501042_0004218 Ga0501042_0004218_2124_2537 128
1063 3300049580 Ga0501046_0590132 Ga0501046_0590132_351_764 128
1064 3300049582 Ga0501048_0013087 Ga0501048_0013087_3125_3538 128
1065 3300049584 Ga0501068_0115856 Ga0501068_0115856_195_608 128
1066 3300049585 Ga0501069_0062466 Ga0501069_0062466_1230_1643 128
1067 3300049585 Ga0501069_0228945 Ga0501069_0228945_678_1067 128
1068 3300049586 Ga0501070_0091797 Ga0501070_0091797_1049_1462 128
1069 3300049587 Ga0501071_0001717 Ga0501071_0001717_12394_12807 128
1070 3300049587 Ga0501071_0746152 Ga0501071_0746152_225_632 128
1071 3300049587 Ga0501071_0958275 Ga0501071_0958275_148_552 128
1072 3300049588 Ga0501072_0009579 Ga0501072_0009579_2766_3179 128
1073 3300049591 Ga0501075_0024262 Ga0501075_0024262_2943_3356 128
1074 3300049592 Ga0501076_0026818 Ga0501076_0026818_104_517 128
1075 3300049593 Ga0501077_0096725 Ga0501077_0096725_1072_1485 128
1076 3300049742 Ga0501080_0212235 Ga0501080_0212235_1300_1713 128
1077 3300049743 Ga0501081_0111088 Ga0501081_0111088_780_1193 128
1078 3300049822 Ga0501035_0314736 Ga0501035_0314736_385_798 128
1079 3300049823 Ga0501044_0124816 Ga0501044_0124816_16_429 128
1080 3300049824 Ga0501045_0109937 Ga0501045_0109937_643_1056 128
1081 3300049824 Ga0501045_0625999 Ga0501045_0625999_359_763 128
1082 3300050490 nmdc:mga03n38_10189_c1 nmdc:mga03n38_10189_c1_1195_1590 128
1083 3300050491 nmdc:mga00v17_392432_c1 nmdc:mga00v17_392432_c1_100_495 128
1084 3300050492 nmdc:mga0yw44_231534_c1 nmdc:mga0yw44_231534_c1_267_674 128
1085 3300050492 nmdc:mga0yw44_3281_c1 nmdc:mga0yw44_3281_c1_2159_2554 128
1086 3300050492 nmdc:mga0yw44_616125_c1 nmdc:mga0yw44_616125_c1_24_419 128
1087 3300050494 nmdc:mga06z11_107251_c1 nmdc:mga06z11_107251_c1_400_795 128
1088 3300050494 nmdc:mga06z11_2444_c1 nmdc:mga06z11_2444_c1_465_860 128
1089 3300050495 nmdc:mga04h51_3789_c1 nmdc:mga04h51_3789_c1_2181_2576 128
1090 3300050496 nmdc:mga07m45_72710_c1 nmdc:mga07m45_72710_c1_793_1200 128
1091 3300050514 nmdc:mga08x19_183086_c1 nmdc:mga08x19_183086_c1_611_1006 128
1092 3300053077 Ga0495601_0760863 Ga0495601_0760863_137_550 128
1093 3300053084 Ga0495595_0670675 Ga0495595_0670675_109_516 128
1094 3300054114 Ga0501084_0019762 Ga0501084_0019762_4021_4434 128
1095 3300060353 Ga0501082_0021382 Ga0501082_0021382_1126_1539 128
1096 3300061734 Ga0530510_0160742 Ga0530510_0160742_74_487 128
1097 3300001979 JGI24740J21852_10010206 JGI24740J21852_100102063 129
1098 3300001979 JGI24740J21852_10017166 JGI24740J21852_100171663 129
1099 3300001989 JGI24739J22299_10020441 JGI24739J22299_100204413 129
1100 3300001990 JGI24737J22298_10011107 JGI24737J22298_100111071 129
1101 3300002067 JGI24735J21928_10024929 JGI24735J21928_100249293 129
1102 3300005338 Ga0068868_100300720 Ga0068868_1003007202 129
1103 3300005341 Ga0070691_10469820 Ga0070691_104698201 129
1104 3300005367 Ga0070667_100614762 Ga0070667_1006147622 129
1105 3300005456 Ga0070678_100207646 Ga0070678_1002076462 129
1106 3300005457 Ga0070662_101616961 Ga0070662_1016169611 129
1107 3300005530 Ga0070679_100077816 Ga0070679_1000778162 129
1108 3300005539 Ga0068853_101208724 Ga0068853_1012087242 129
1109 3300005543 Ga0070672_101367062 Ga0070672_1013670621 129
1110 3300005546 Ga0070696_100566953 Ga0070696_1005669531 129
1111 3300005547 Ga0070693_100116170 Ga0070693_1001161701 129
1112 3300005563 Ga0068855_101822240 Ga0068855_1018222401 129
1113 3300005577 Ga0068857_100739220 Ga0068857_1007392201 129
1114 3300005578 Ga0068854_100900007 Ga0068854_1009000072 129
1115 3300005615 Ga0070702_100077130 Ga0070702_1000771302 129
1116 3300005616 Ga0068852_100216176 Ga0068852_1002161762 129
1117 3300005616 Ga0068852_101935503 Ga0068852_1019355031 129
1118 3300005618 Ga0068864_100320018 Ga0068864_1003200182 129
1119 3300005718 Ga0068866_10515481 Ga0068866_105154811 129
1120 3300005719 Ga0068861_101157354 Ga0068861_1011573542 129
1121 3300005844 Ga0068862_101143751 Ga0068862_1011437511 129
1122 3300005937 Ga0081455_10651712 Ga0081455_106517121 129
1123 3300005981 Ga0081538_10219542 Ga0081538_102195421 129
1124 3300005983 Ga0081540_1062927 Ga0081540_10629272 129
1125 3300006028 Ga0070717_10255088 Ga0070717_102550883 129
1126 3300006844 Ga0075428_100000550 Ga0075428_10000055032 129
1127 3300006844 Ga0075428_100081782 Ga0075428_1000817823 129
1128 3300006846 Ga0075430_100057812 Ga0075430_1000578123 129
1129 3300006847 Ga0075431_100023822 Ga0075431_1000238224 129
1130 3300006847 Ga0075431_100058441 Ga0075431_1000584414 129
1131 3300006847 Ga0075431_100365358 Ga0075431_1003653581 129
1132 3300006847 Ga0075431_100993604 Ga0075431_1009936042 129
1133 3300006880 Ga0075429_100018659 Ga0075429_1000186593 129
1134 3300006880 Ga0075429_100317502 Ga0075429_1003175022 129
1135 3300006880 Ga0075429_100484070 Ga0075429_1004840702 129
1136 3300006881 Ga0068865_100349561 Ga0068865_1003495612 129
1137 3300009011 Ga0105251_10178502 Ga0105251_101785022 129
1138 3300009098 Ga0105245_10277400 Ga0105245_102774002 129
1139 3300009098 Ga0105245_11322891 Ga0105245_113228912 129
1140 3300009101 Ga0105247_10397408 Ga0105247_103974082 129
1141 3300009147 Ga0114129_10000517 Ga0114129_1000051728 129
1142 3300009147 Ga0114129_10198170 Ga0114129_101981703 129
1143 3300009147 Ga0114129_10671994 Ga0114129_106719942 129
1144 3300009148 Ga0105243_10321852 Ga0105243_103218521 129
1145 3300009148 Ga0105243_10345484 Ga0105243_103454843 129
1146 3300009177 Ga0105248_10210452 Ga0105248_102104523 129
1147 3300009177 Ga0105248_10286706 Ga0105248_102867063 129
1148 3300009551 Ga0105238_10430481 Ga0105238_104304811 129
1149 3300009551 Ga0105238_11575637 Ga0105238_115756372 129
1150 3300010375 Ga0105239_10192247 Ga0105239_101922472 129
1151 3300013102 Ga0157371_10836853 Ga0157371_108368532 129
1152 3300013105 Ga0157369_11351227 Ga0157369_113512272 129
1153 3300013307 Ga0157372_10176399 Ga0157372_101763992 129
1154 3300014325 Ga0163163_10080236 Ga0163163_100802363 129
1155 3300014326 Ga0157380_13002027 Ga0157380_130020271 129
1156 3300017792 Ga0163161_10160926 Ga0163161_101609262 129
1157 3300025900 Ga0207710_10062505 Ga0207710_100625053 129
1158 3300025901 Ga0207688_10456119 Ga0207688_104561192 129
1159 3300025904 Ga0207647_10008271 Ga0207647_100082715 129
1160 3300025921 Ga0207652_10426884 Ga0207652_104268841 129
1161 3300025927 Ga0207687_10788875 Ga0207687_107888751 129
1162 3300025928 Ga0207700_10505543 Ga0207700_105055432 129
1163 3300025932 Ga0207690_10217220 Ga0207690_102172202 129
1164 3300025933 Ga0207706_10644213 Ga0207706_106442131 129
1165 3300025934 Ga0207686_10076344 Ga0207686_100763442 129
1166 3300025935 Ga0207709_10116483 Ga0207709_101164832 129
1167 3300025938 Ga0207704_10296751 Ga0207704_102967512 129
1168 3300025938 Ga0207704_11277059 Ga0207704_112770591 129
1169 3300025941 Ga0207711_10256991 Ga0207711_102569912 129
1170 3300025944 Ga0207661_10139064 Ga0207661_101390643 129
1171 3300025949 Ga0207667_12007063 Ga0207667_120070631 129
1172 3300025961 Ga0207712_10521195 Ga0207712_105211951 129
1173 3300025972 Ga0207668_11328029 Ga0207668_113280291 129
1174 3300025986 Ga0207658_10064828 Ga0207658_100648282 129
1175 3300026023 Ga0207677_11094463 Ga0207677_110944632 129
1176 3300026088 Ga0207641_10096432 Ga0207641_100964322 129
1177 3300026116 Ga0207674_10292033 Ga0207674_102920332 129
1178 3300026118 Ga0207675_100527475 Ga0207675_1005274752 129
1179 3300026118 Ga0207675_101194659 Ga0207675_1011946591 129
1180 3300026121 Ga0207683_10357003 Ga0207683_103570032 129
1181 3300026121 Ga0207683_10842318 Ga0207683_108423181 129
1182 3300026142 Ga0207698_10538837 Ga0207698_105388372 129
1183 3300031730 Ga0307516_10996578 Ga0307516_109965781 129
1184 3300031731 Ga0307405_10114164 Ga0307405_101141642 129
1185 3300031901 Ga0307406_10073532 Ga0307406_100735322 129
1186 3300031903 Ga0307407_11249620 Ga0307407_112496201 129
1187 3300031911 Ga0307412_10380771 Ga0307412_103807712 129
1188 3300031995 Ga0307409_100347823 Ga0307409_1003478232 129
1189 3300031995 Ga0307409_100536796 Ga0307409_1005367961 129
1190 3300032002 Ga0307416_100118123 Ga0307416_1001181232 129
1191 3300032126 Ga0307415_100028523 Ga0307415_1000285231 129
1192 3300035170 Ga0373943_0700673 Ga0373943_0700673_190_588 129
1193 3300037312 Ga0395899_0000961 Ga0395899_0000961_3103_3513 129
1194 3300037418 Ga0395900_0078565 Ga0395900_0078565_824_1219 129
1195 3300037418 Ga0395900_0651599 Ga0395900_0651599_121_522 129
1196 3300037466 Ga0395898_0066518 Ga0395898_0066518_223_618 129
1197 3300037466 Ga0395898_1816070 Ga0395898_1816070_70_471 129
1198 3300037471 Ga0395905_0048592 Ga0395905_0048592_1365_1760 129
1199 3300037853 Ga0436364_0106996 Ga0436364_0106996_5080_5559 129
1200 3300038443 Ga0395901_0048023 Ga0395901_0048023_1281_1676 129
1201 3300041407 Ga0439447_025027 Ga0439447_025027_751_1152 129
1202 3300041512 Ga0451853_0045329 Ga0451853_0045329_113_511 129
1203 3300044694 Ga0466963_0902858 Ga0466963_0902858_78_476 129
1204 3300044842 Ga0466957_0064436 Ga0466957_0064436_849_1271 129
1205 3300045836 Ga0466958_0097359 Ga0466958_0097359_334_756 129
1206 3300045976 Ga0466967_0032548 Ga0466967_0032548_3304_3732 129
1207 3300046453 Ga0495627_044613 Ga0495627_044613_599_988 129
1208 3300046455 Ga0495603_0824119 Ga0495603_0824119_92_481 129
1209 3300046459 Ga0495629_0226454 Ga0495629_0226454_254_658 129
1210 3300046459 Ga0495629_0825888 Ga0495629_0825888_141_551 129
1211 3300046499 Ga0495594_0157535 Ga0495594_0157535_77_481 129
1212 3300046499 Ga0495594_0251293 Ga0495594_0251293_595_987 129
1213 3300046535 Ga0495586_0821794 Ga0495586_0821794_12_413 129
1214 3300046648 Ga0495611_0445214 Ga0495611_0445214_77_466 129
1215 3300046660 Ga0495625_0064540 Ga0495625_0064540_933_1322 129
1216 3300046660 Ga0495625_0555473 Ga0495625_0555473_101_490 129
1217 3300046665 Ga0495661_0522444 Ga0495661_0522444_138_527 129
1218 3300048903 Ga0496100_0096952 Ga0496100_0096952_1418_1816 129
1219 3300048903 Ga0496100_0209476 Ga0496100_0209476_219_623 129
1220 3300048904 Ga0496101_0157565 Ga0496101_0157565_692_1090 129
1221 3300048905 Ga0496102_0162428 Ga0496102_0162428_1687_2085 129
1222 3300048906 Ga0496103_0090698 Ga0496103_0090698_785_1183 129
1223 3300048909 Ga0496106_0059663 Ga0496106_0059663_677_1075 129
1224 3300048909 Ga0496106_0307272 Ga0496106_0307272_232_636 129
1225 3300048911 Ga0496108_0268683 Ga0496108_0268683_612_1043 129
1226 3300048911 Ga0496108_0564478 Ga0496108_0564478_358_756 129
1227 3300048912 Ga0496109_0320644 Ga0496109_0320644_443_832 129
1228 3300048912 Ga0496109_0378985 Ga0496109_0378985_760_1158 129
1229 3300048912 Ga0496109_1725993 Ga0496109_1725993_84_488 129
1230 3300048912 Ga0496109_1749669 Ga0496109_1749669_156_545 129
1231 3300048913 Ga0496110_0113858 Ga0496110_0113858_253_651 129
1232 3300048914 Ga0496111_0158393 Ga0496111_0158393_761_1159 129
1233 3300048915 Ga0496112_0046948 Ga0496112_0046948_1763_2167 129
1234 3300048915 Ga0496112_0055755 Ga0496112_0055755_1724_2128 129
1235 3300048915 Ga0496112_0440117 Ga0496112_0440117_431_883 129
1236 3300048915 Ga0496112_0712197 Ga0496112_0712197_506_904 129
1237 3300048916 Ga0496113_0713063 Ga0496113_0713063_53_442 129
1238 3300048917 Ga0496114_0783348 Ga0496114_0783348_412_810 129
1239 3300049569 Ga0501032_0111409 Ga0501032_0111409_1057_1464 129
1240 3300049570 Ga0501033_0127716 Ga0501033_0127716_685_1092 129
1241 3300049572 Ga0501036_0001833 Ga0501036_0001833_11192_11599 129
1242 3300049572 Ga0501036_0028289 Ga0501036_0028289_3195_3599 129
1243 3300049573 Ga0501037_0046102 Ga0501037_0046102_2766_3170 129
1244 3300049573 Ga0501037_0283779 Ga0501037_0283779_375_782 129
1245 3300049574 Ga0501038_0032357 Ga0501038_0032357_3753_4160 129
1246 3300049575 Ga0501039_0006646 Ga0501039_0006646_7362_7766 129
1247 3300049575 Ga0501039_0042421 Ga0501039_0042421_1218_1625 129
1248 3300049576 Ga0501040_0073131 Ga0501040_0073131_592_999 129
1249 3300049576 Ga0501040_0252695 Ga0501040_0252695_196_600 129
1250 3300049577 Ga0501041_0027338 Ga0501041_0027338_1724_2128 129
1251 3300049577 Ga0501041_0039296 Ga0501041_0039296_368_775 129
1252 3300049578 Ga0501042_0138765 Ga0501042_0138765_1332_1736 129
1253 3300049580 Ga0501046_0005754 Ga0501046_0005754_3732_4139 129
1254 3300049580 Ga0501046_0386166 Ga0501046_0386166_346_738 129
1255 3300049582 Ga0501048_0009775 Ga0501048_0009775_2055_2462 129
1256 3300049582 Ga0501048_0524048 Ga0501048_0524048_297_698 129
1257 3300049583 Ga0501067_0116040 Ga0501067_0116040_1068_1466 129
1258 3300049584 Ga0501068_0062744 Ga0501068_0062744_653_1057 129
1259 3300049584 Ga0501068_0141160 Ga0501068_0141160_353_760 129
1260 3300049585 Ga0501069_0312625 Ga0501069_0312625_71_478 129
1261 3300049585 Ga0501069_0746635 Ga0501069_0746635_176_580 129
1262 3300049587 Ga0501071_0002819 Ga0501071_0002819_6219_6626 129
1263 3300049587 Ga0501071_0029553 Ga0501071_0029553_3452_3856 129
1264 3300049587 Ga0501071_0097306 Ga0501071_0097306_1288_1677 129
1265 3300049587 Ga0501071_0191434 Ga0501071_0191434_51_449 129
1266 3300049587 Ga0501071_0271560 Ga0501071_0271560_858_1265 129
1267 3300049588 Ga0501072_0055163 Ga0501072_0055163_1327_1731 129
1268 3300049588 Ga0501072_0070118 Ga0501072_0070118_493_891 129
1269 3300049588 Ga0501072_0098812 Ga0501072_0098812_871_1278 129
1270 3300049589 Ga0501073_0150349 Ga0501073_0150349_887_1291 129
1271 3300049591 Ga0501075_0002567 Ga0501075_0002567_4964_5371 129
1272 3300049591 Ga0501075_0204727 Ga0501075_0204727_1071_1475 129
1273 3300049591 Ga0501075_0356944 Ga0501075_0356944_175_573 129
1274 3300049592 Ga0501076_0000957 Ga0501076_0000957_12367_12774 129
1275 3300049592 Ga0501076_0295786 Ga0501076_0295786_706_1104 129
1276 3300049593 Ga0501077_0057592 Ga0501077_0057592_13_417 129
1277 3300049593 Ga0501077_0129440 Ga0501077_0129440_1037_1444 129
1278 3300049741 Ga0501079_0010125 Ga0501079_0010125_5628_6035 129
1279 3300049742 Ga0501080_0060935 Ga0501080_0060935_458_865 129
1280 3300049743 Ga0501081_0013990 Ga0501081_0013990_29_433 129
1281 3300049743 Ga0501081_0021363 Ga0501081_0021363_3162_3569 129
1282 3300049744 Ga0501083_0339164 Ga0501083_0339164_24_428 129
1283 3300049744 Ga0501083_0397170 Ga0501083_0397170_21_428 129
1284 3300049822 Ga0501035_0024974 Ga0501035_0024974_524_931 129
1285 3300049824 Ga0501045_0018574 Ga0501045_0018574_800_1204 129
1286 3300049824 Ga0501045_0098567 Ga0501045_0098567_1132_1539 129
1287 3300049824 Ga0501045_0448667 Ga0501045_0448667_84_485 129
1288 3300050507 nmdc:mga05p37_19038_c1 nmdc:mga05p37_19038_c1_4278_4667 129
1289 3300050508 nmdc:mga09592_156197_c1 nmdc:mga09592_156197_c1_459_860 129
1290 3300050508 nmdc:mga09592_288856_c1 nmdc:mga09592_288856_c1_947_1348 129
1291 3300050508 nmdc:mga09592_52831_c1 nmdc:mga09592_52831_c1_2496_2885 129
1292 3300050510 nmdc:mga06r32_3633_c1 nmdc:mga06r32_3633_c1_7321_7728 129
1293 3300050510 nmdc:mga06r32_49313_c1 nmdc:mga06r32_49313_c1_2438_2872 129
1294 3300050510 nmdc:mga06r32_88950_c1 nmdc:mga06r32_88950_c1_541_930 129
1295 3300053083 Ga0495655_0002842 Ga0495655_0002842_894_1283 129
1296 3300053085 Ga0495619_0179981 Ga0495619_0179981_415_822 129
1297 3300053085 Ga0495619_0428009 Ga0495619_0428009_114_524 129
1298 3300054114 Ga0501084_0358220 Ga0501084_0358220_184_591 129
1299 3300054114 Ga0501084_0601180 Ga0501084_0601180_73_480 129
1300 3300054114 Ga0501084_1487743 Ga0501084_1487743_63_455 129
1301 3300060353 Ga0501082_0125486 Ga0501082_0125486_1035_1442 129
1302 3300060353 Ga0501082_0905567 Ga0501082_0905567_70_474 129
1303 3300061734 Ga0530510_0007943 Ga0530510_0007943_3291_3695 129
1304 3300061734 Ga0530510_0048443 Ga0530510_0048443_624_1031 129
1305 iso_pu_bacteria 2643221567 2643849902 129
1306 iso_pu_bacteria 2643221624 2644135904 129

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

54

126

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mtu-assembly1.cif.gz_A beta-alanyl-coa:ammonia lyase from clostridium propionicum 0.9357 5 126
1wlu-assembly1.cif.gz_A crystal structure of tt0310 protein from thermus thermophilus hb8 0.9145 9 127
2qq2-assembly2.cif.gz_F crystal structure of c-terminal domain of human acyl-coa thioesterase 7 0.9108 9 126
5egj-assembly1.cif.gz_A the structural and biochemical characterization of acyl-coa hydrolase mutant asn28ala from staphylococcus aureus in complex with coenzyme a 0.9092 9 126
2f41-assembly2.cif.gz_D crystal structure of fapr- a global regulator of fatty acid biosynthesis in b. subtilis 0.9092 9 124
ID Description Score Start End Superfamily
4mzqB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9382 5 126 3.10.129.10
1wluA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9145 9 127 3.10.129.10
af_Q9VMA4_280_435_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9093 9 125 3.10.129.10
5egjA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9092 9 126 3.10.129.10
af_E9QJN3_178_320_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8996 9 126 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A7V9GXC8-F1-model_v4 3-aminobutyryl-CoA ammonia-lyase 0.9983 6 127 GO:0016829
AF-A0A132MT96-F1-model_v4 3-aminobutyryl-CoA ammonia-lyase (EC 4.3.1.14) 0.998 6 129 GO:0016787
GO:0047459
AF-A0A4S8PJQ6-F1-model_v4 3-aminobutyryl-CoA ammonia-lyase 0.9965 6 127 GO:0016787
GO:0016829
AF-A0A850DDA6-F1-model_v4 deleted 0.9959 1 129
AF-A0A6J4LAS1-F1-model_v4 3-aminobutyryl-CoA ammonia-lyase (EC 4.3.1.14) 0.9946 6 127 GO:0047459

Feature Viewer

pLDDT pTM Quality
96.04 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map