F492767
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1301 | 700 | 969 | 211 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2511231156|2511827635 |
| Length | 251 |
| Sequence | ASEQFFIFTNDLNKWVFILFKAMKTGAQLVPQQPSRSRTMSLRLGDIAPDFEQDSSAGKIRFHEWLGDSWGVLFSHPADFTPVCTTELGLTAKLKDEFAQRGVKAIALSVDPVDSHHKWIEDINETQNAVVNFPILADADRKVSDLYDLIHPNASDTLTVRSLFVIDPNKKIRLTITYPASTGRNFNEILRVIDSLQLTDNYKVATPANWQDGDEVVIVPSLKDEEELKQRFPKGYRAVKPYLRLTPQPNR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 4 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 5 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 6 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 7 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 8 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 9 | 2511231000 | Chryseobacterium populi CF314 | Isolate | Rhizosphere |
| 10 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 11 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 12 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 13 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 14 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 15 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 16 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 17 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 18 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 19 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 20 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 21 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 22 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 23 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 24 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 25 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 26 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 27 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 28 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 29 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 30 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 31 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 32 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 33 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 34 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 35 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 36 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 37 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 38 | 2551306352 | Acinetobacter sp. GG2 | Isolate | Rhizosphere |
| 39 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 40 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 41 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 42 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 43 | 2582581281 | Chryseobacterium sp. CF284 | Isolate | Rhizosphere |
| 44 | 2582581282 | Chryseobacterium sp. CF299 | Isolate | Rhizosphere |
| 45 | 2585428045 | Chryseobacterium sp. OV705 | Isolate | Rhizosphere |
| 46 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 47 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 48 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 49 | 2585428115 | Chryseobacterium sp. YR561 | Isolate | Rhizosphere |
| 50 | 2585428187 | Chryseobacterium sp. YR460 | Isolate | Rhizosphere |
| 51 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 52 | 2588254255 | Chryseobacterium sp. YR221 | Isolate | Rhizosphere |
| 53 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 54 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 55 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 56 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 57 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 58 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 59 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 60 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 61 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 62 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 63 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 64 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 65 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 66 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 67 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 68 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 69 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 70 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 71 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 72 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 73 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 74 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 75 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 76 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 77 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 78 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 79 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 80 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 81 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 82 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 83 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 84 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 85 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 86 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 87 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 88 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 89 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 90 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 91 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 92 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 93 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 94 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 95 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 96 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 97 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 98 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 99 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 100 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 101 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 102 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 103 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 104 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 105 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 106 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 107 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 108 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 109 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 110 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 111 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 112 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 113 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 114 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 115 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 116 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 117 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 118 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 119 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 120 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 121 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 122 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 123 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 124 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 125 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 126 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 127 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 128 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 129 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 130 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 131 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 132 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 133 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 134 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 135 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 136 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 137 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 138 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 139 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 140 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 141 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 142 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 143 | 2675903507 | Acinetobacter calcoaceticus GK2 | Isolate | Unclassified |
| 144 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 145 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 146 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 147 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 148 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 149 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 150 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 151 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 152 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 153 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 154 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 155 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 156 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 157 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 158 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 159 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 160 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 161 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 162 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 163 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 164 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 165 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 166 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 167 | 2751185877 | Chryseobacterium artocarpi UTM-3 | Isolate | Rhizosphere |
| 168 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 169 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 170 | 2773857770 | Acinetobacter sp. 3636 | Isolate | Unclassified |
| 171 | 2775506739 | Chryseobacterium sp. 1335 | Isolate | Unclassified |
| 172 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 173 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 174 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 175 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 176 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 177 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 178 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 179 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 180 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 181 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 182 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 183 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 184 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 185 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 186 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 187 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 188 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 189 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 190 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 191 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 192 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 193 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 194 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 195 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 196 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 197 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 198 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 199 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 200 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 201 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 202 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 203 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 204 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 205 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 206 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 207 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 208 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 209 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 210 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 211 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 212 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 213 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 214 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 215 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 216 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 217 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 218 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 219 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 220 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 221 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 222 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 223 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 224 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 225 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 226 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 227 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 228 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 229 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 230 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 231 | 2889290771 | Chryseobacterium sp. PvR013 | Isolate | Rhizosphere |
| 232 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 233 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 234 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 235 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 236 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 237 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 238 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 239 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 240 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 241 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 242 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 243 | 2916699645 | Acinetobacter ursingii M3 | Isolate | Unclassified |
| 244 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 245 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 246 | 2919097161 | Chryseobacterium ginsenosidimutans 1394 | Isolate | Rhizosphere |
| 247 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 248 | 2919182534 | Acinetobacter calcoaceticus 2589 | Isolate | Rhizosphere |
| 249 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 250 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 251 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 252 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 253 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 254 | 2919506607 | Acinetobacter sp. 3657 | Isolate | Unclassified |
| 255 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 256 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 257 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 258 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 259 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 260 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 261 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 262 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 263 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 264 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 265 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 266 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 267 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 268 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 269 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 270 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 271 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 272 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 273 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 274 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 275 | 2941479691 | |||
| 276 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 277 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 278 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 279 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 280 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 281 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 282 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 283 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 284 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 285 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 286 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 287 | 2984572630 | Chryseobacterium sp. SORGH_AS909 | Isolate | Aerial Root |
| 288 | 2984606641 | Chryseobacterium sp. SORGH_AS1175 | Isolate | Aerial Root |
| 289 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 290 | 2993372514 | Chryseobacterium sp. SLBN-27 | Isolate | Rhizosphere |
| 291 | 2993480792 | Chryseobacterium nepalense SLBN-92 | Isolate | Rhizosphere |
| 292 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 293 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 294 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 295 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 296 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 297 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 298 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 299 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 300 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 301 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 302 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 303 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 304 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 305 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 306 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 307 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 308 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 309 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 310 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 311 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 312 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 313 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 314 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 315 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 316 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 317 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 318 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 319 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 320 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 321 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 322 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 323 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 324 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 325 | 3300004785 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 326 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 327 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 328 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 329 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 330 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 331 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 332 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 333 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 334 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 335 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 336 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 337 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 338 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 339 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 340 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 341 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 342 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 343 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 344 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 345 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 346 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 347 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 348 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 349 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 350 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 351 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 352 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 353 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 354 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 355 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 356 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 357 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 358 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 359 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 360 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 361 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 362 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 363 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 364 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 365 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 366 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 367 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 368 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 369 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 370 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 371 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 372 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 373 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 374 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 375 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 376 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 377 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 379 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 380 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 381 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 382 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 383 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 384 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 385 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 386 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 387 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 388 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 389 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 390 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 391 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 392 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 393 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 394 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 395 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 396 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 397 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 398 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 399 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 400 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 401 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 402 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 403 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 404 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 405 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 406 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 407 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 408 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 409 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 410 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 411 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 412 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 413 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 414 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 415 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 416 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 417 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 418 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 419 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 420 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 421 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 422 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 423 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 424 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 425 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 426 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 427 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 428 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 429 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 430 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 431 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 432 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 433 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 434 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 435 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 436 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 437 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 438 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 439 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 440 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 441 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 442 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 443 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 444 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 445 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 446 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 447 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 448 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 449 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 450 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 451 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 452 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 453 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 454 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 455 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 456 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 457 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 458 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 459 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 460 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 461 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 462 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 463 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 464 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 465 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 466 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 467 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 468 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 469 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 470 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 471 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 472 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 473 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 474 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 475 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 476 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 477 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 478 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 479 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 480 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 481 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 482 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 483 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 484 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 485 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 486 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 487 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 488 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 489 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 490 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 491 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 492 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 493 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 494 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 495 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 496 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 497 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 498 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 499 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 500 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 501 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 502 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 503 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 504 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 505 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 506 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 507 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 508 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 509 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 510 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 511 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 512 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 513 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 514 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 515 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 516 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 517 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 518 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 519 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 520 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 521 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 522 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 523 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 524 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 525 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 526 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 527 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 528 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 529 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 530 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 531 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 532 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 533 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 534 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 535 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 536 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 537 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 538 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 539 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 540 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 541 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 542 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 543 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 550 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 552 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 553 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 554 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 559 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 560 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 561 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 562 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 563 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 564 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 565 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 566 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 567 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 568 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 569 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 570 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 571 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 572 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 573 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 574 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 575 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 576 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 577 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 578 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 579 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 580 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 581 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 582 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 583 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 584 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 585 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 586 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 587 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 588 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 589 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 590 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 591 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 592 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 593 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 594 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 595 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 596 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 597 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 598 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 599 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 600 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 601 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 602 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 603 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 604 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 605 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 606 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 607 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 608 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 609 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 610 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 611 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 612 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 613 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 614 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 615 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 616 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 617 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 618 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 619 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 620 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 621 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 622 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 623 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 624 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 625 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 626 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 627 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 628 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 629 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 630 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 631 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 632 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 633 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 634 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 635 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 636 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 637 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 638 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 639 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 640 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 641 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 642 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 643 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 644 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 645 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 646 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 647 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 648 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 649 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 650 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 651 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 652 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 653 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 654 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 655 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 656 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 657 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 658 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 659 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 660 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 661 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 662 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 663 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 664 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 665 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 666 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 667 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 668 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 669 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 670 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 671 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
| 672 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 673 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 674 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 675 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 676 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 677 | 8033232454 | Acinetobacter radioresistens SA188 | Isolate | Unclassified |
| 678 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 679 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 680 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 681 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 682 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 683 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 684 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 685 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
| 686 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 687 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 688 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 689 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 690 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 691 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 692 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 693 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 694 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 695 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 696 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 697 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 698 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 699 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 700 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 72.71 |
| Metatranscriptomes | 1.77 |
| Isolates | 25.52 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.15 |
| Bulb | 0 |
| Endosphere | 9.84 |
| Nodule | 3.61 |
| Rhizoplane | 6.15 |
| Rhizosphere | 66.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_6468 | 2124908027 | Bacteria | 8027 |
| 2 | SwRhRL2b_contig_137706 | 2162886007 | Bacteria | 6987 |
| 3 | SwRhRL2b_contig_1872146 | 2162886007 | Bacteria | 1537 |
| 4 | JGI24741J21665_1004476 | 3300001915 | Bacteria | 3087 |
| 5 | JGI24741J21665_1008997 | 3300001915 | Bacteria | 1855 |
| 6 | JGI24740J21852_10000054 | 3300001979 | Bacteria | 36657 |
| 7 | JGI24737J22298_10117372 | 3300001990 | Bacteria | 786 |
| 8 | JGI25156J39149_1012551 | 3300002705 | Bacteria | 1853 |
| 9 | JGI25162J39368_1000154 | 3300002737 | Bacteria | 75240 |
| 10 | JGI25162J39368_1000319 | 3300002737 | Bacteria | 42383 |
| 11 | JGI25162J39368_1000474 | 3300002737 | Bacteria | 30875 |
| 12 | JGI25154J39366_1012343 | 3300002738 | Bacteria | 946 |
| 13 | JGI25163J39215_1000691 | 3300002771 | Bacteria | 8909 |
| 14 | JGI25163J39215_1004782 | 3300002771 | Bacteria | 916 |
| 15 | JGI25164J39214_1000236 | 3300002772 | Bacteria | 42383 |
| 16 | JGI25164J39214_1000674 | 3300002772 | Bacteria | 13675 |
| 17 | JGI25164J39214_1006548 | 3300002772 | Bacteria | 1218 |
| 18 | JGI25165J46597_1000239 | 3300003214 | Bacteria | 75240 |
| 19 | JGI25165J46597_1000434 | 3300003214 | Bacteria | 42383 |
| 20 | JGI25165J46597_1000600 | 3300003214 | Bacteria | 30875 |
| 21 | rootL2_10028101 | 3300003322 | Bacteria | 1039 |
| 22 | Ga0055538_1000032 | 3300003751 | Bacteria | 199718 |
| 23 | Ga0055538_1000094 | 3300003751 | Bacteria | 75240 |
| 24 | Ga0055539_1000038 | 3300003752 | Bacteria | 205053 |
| 25 | Ga0055539_1000043 | 3300003752 | Bacteria | 199718 |
| 26 | Ga0055539_1000136 | 3300003752 | Bacteria | 76284 |
| 27 | Ga0055533_1000052 | 3300003756 | Bacteria | 199718 |
| 28 | Ga0055533_1000143 | 3300003756 | Bacteria | 75240 |
| 29 | Ga0055532_1000002 | 3300003758 | Bacteria | 576000 |
| 30 | Ga0055532_1000047 | 3300003758 | Bacteria | 179201 |
| 31 | Ga0055525_1000062 | 3300003759 | Bacteria | 199718 |
| 32 | Ga0055525_1000188 | 3300003759 | Bacteria | 75240 |
| 33 | Ga0055525_1000304 | 3300003759 | Bacteria | 40731 |
| 34 | Ga0055527_1001999 | 3300003760 | Bacteria | 3715 |
| 35 | Ga0055535_1000096 | 3300003761 | Bacteria | 96196 |
| 36 | Ga0055535_1004523 | 3300003761 | Bacteria | 3348 |
| 37 | Ga0055529_1000091 | 3300003763 | Bacteria | 138369 |
| 38 | Ga0055529_1000113 | 3300003763 | Bacteria | 118574 |
| 39 | Ga0055524_1020020 | 3300003775 | Bacteria | 2268 |
| 40 | Ga0055524_1034939 | 3300003775 | Bacteria | 1379 |
| 41 | Ga0055536_1001726 | 3300003781 | Bacteria | 12927 |
| 42 | Ga0055536_1049437 | 3300003781 | Bacteria | 934 |
| 43 | Ga0055530_10000658 | 3300003791 | Bacteria | 29519 |
| 44 | Ga0055530_10002203 | 3300003791 | Bacteria | 12895 |
| 45 | Ga0055530_10002392 | 3300003791 | Bacteria | 12142 |
| 46 | Ga0055530_10007867 | 3300003791 | Bacteria | 4389 |
| 47 | Ga0055540_1000506 | 3300003792 | Bacteria | 29519 |
| 48 | Ga0055540_1001654 | 3300003792 | Bacteria | 12927 |
| 49 | Ga0055541_1000030 | 3300003841 | Bacteria | 199616 |
| 50 | Ga0055541_1000092 | 3300003841 | Bacteria | 75240 |
| 51 | Ga0055541_1003579 | 3300003841 | Bacteria | 2902 |
| 52 | Ga0058692_1011559 | 3300003856 | Bacteria | 2128 |
| 53 | Ga0058858_1283826 | 3300004785 | Bacteria | 747 |
| 54 | Ga0058859_11577485 | 3300004798 | Bacteria | 689 |
| 55 | Ga0058861_11914072 | 3300004800 | Bacteria | 688 |
| 56 | Ga0065703_1000504 | 3300005272 | Bacteria | 27344 |
| 57 | Ga0065714_10003312 | 3300005288 | Bacteria | 8289 |
| 58 | Ga0065714_10004172 | 3300005288 | Bacteria | 9076 |
| 59 | Ga0065714_10011359 | 3300005288 | Bacteria | 2582 |
| 60 | Ga0065714_10066507 | 3300005288 | Bacteria | 6721 |
| 61 | Ga0065714_10088098 | 3300005288 | Bacteria | 2032 |
| 62 | Ga0065714_10098238 | 3300005288 | Bacteria | 1716 |
| 63 | Ga0065714_10115878 | 3300005288 | Bacteria | 1408 |
| 64 | Ga0065714_10177037 | 3300005288 | Bacteria | 960 |
| 65 | Ga0065714_10264676 | 3300005288 | Bacteria | 750 |
| 66 | Ga0065704_10071355 | 3300005289 | Bacteria | 11543 |
| 67 | Ga0065704_10127589 | 3300005289 | Bacteria | 1670 |
| 68 | Ga0065704_10348031 | 3300005289 | Bacteria | 814 |
| 69 | Ga0065712_10016049 | 3300005290 | Bacteria | 2777 |
| 70 | Ga0065712_10071153 | 3300005290 | Bacteria | 5449 |
| 71 | Ga0065715_10061165 | 3300005293 | Bacteria | 959 |
| 72 | Ga0065715_10223276 | 3300005293 | Bacteria | 1236 |
| 73 | Ga0070658_10011063 | 3300005327 | Bacteria | 7232 |
| 74 | Ga0070658_10068187 | 3300005327 | Bacteria | 2908 |
| 75 | Ga0070670_100002144 | 3300005331 | Bacteria | 16199 |
| 76 | Ga0070670_100096891 | 3300005331 | Bacteria | 2537 |
| 77 | Ga0070680_100175563 | 3300005336 | Bacteria | 1804 |
| 78 | Ga0070660_100388857 | 3300005339 | Bacteria | 1152 |
| 79 | Ga0070661_100000126 | 3300005344 | Bacteria | 63357 |
| 80 | Ga0070661_100001535 | 3300005344 | Bacteria | 16078 |
| 81 | Ga0070668_100317372 | 3300005347 | Bacteria | 1311 |
| 82 | Ga0070669_100000187 | 3300005353 | Bacteria | 53997 |
| 83 | Ga0070669_100000481 | 3300005353 | Bacteria | 30338 |
| 84 | Ga0070669_100312294 | 3300005353 | Bacteria | 1267 |
| 85 | Ga0070675_100808153 | 3300005354 | Bacteria | 857 |
| 86 | Ga0070674_100406308 | 3300005356 | Bacteria | 1114 |
| 87 | Ga0070659_100001468 | 3300005366 | Bacteria | 16982 |
| 88 | Ga0070659_100111253 | 3300005366 | Bacteria | 2211 |
| 89 | Ga0070710_10468505 | 3300005437 | Bacteria | 857 |
| 90 | Ga0070711_100003206 | 3300005439 | Bacteria | 9495 |
| 91 | Ga0070663_100000012 | 3300005455 | Bacteria | 144773 |
| 92 | Ga0070662_100000101 | 3300005457 | Bacteria | 47097 |
| 93 | Ga0070707_100137876 | 3300005468 | Bacteria | 2373 |
| 94 | Ga0070699_100101826 | 3300005518 | Bacteria | 2518 |
| 95 | Ga0070679_100019496 | 3300005530 | Bacteria | 6596 |
| 96 | Ga0070679_100031842 | 3300005530 | Bacteria | 5214 |
| 97 | Ga0068853_100000187 | 3300005539 | Bacteria | 43749 |
| 98 | Ga0068853_100155478 | 3300005539 | Bacteria | 2060 |
| 99 | Ga0070665_100000991 | 3300005548 | Bacteria | 35979 |
| 100 | Ga0070665_100905468 | 3300005548 | Bacteria | 895 |
| 101 | Ga0070664_100000045 | 3300005564 | Bacteria | 74810 |
| 102 | Ga0070664_100000491 | 3300005564 | Bacteria | 29927 |
| 103 | Ga0070664_100036041 | 3300005564 | Bacteria | 4154 |
| 104 | Ga0068857_100038455 | 3300005577 | Bacteria | 4237 |
| 105 | Ga0068854_100000127 | 3300005578 | Bacteria | 52256 |
| 106 | Ga0068854_100005297 | 3300005578 | Bacteria | 8140 |
| 107 | Ga0068856_100000035 | 3300005614 | Bacteria | 124192 |
| 108 | Ga0068851_10000007 | 3300005834 | Bacteria | 244101 |
| 109 | Ga0068863_100079116 | 3300005841 | Bacteria | 3114 |
| 110 | Ga0068863_100476334 | 3300005841 | Bacteria | 1227 |
| 111 | Ga0068860_100029014 | 3300005843 | Bacteria | 5323 |
| 112 | Ga0081538_10002039 | 3300005981 | Bacteria | 20160 |
| 113 | Ga0075365_10207462 | 3300006038 | Bacteria | 1373 |
| 114 | Ga0075365_10384063 | 3300006038 | Bacteria | 991 |
| 115 | Ga0075365_10426461 | 3300006038 | Bacteria | 936 |
| 116 | Ga0075368_10142611 | 3300006042 | Bacteria | 999 |
| 117 | Ga0075368_10195228 | 3300006042 | Bacteria | 856 |
| 118 | Ga0075363_100153465 | 3300006048 | Bacteria | 1301 |
| 119 | Ga0075364_10021870 | 3300006051 | Bacteria | 4033 |
| 120 | Ga0075364_10077774 | 3300006051 | Bacteria | 2190 |
| 121 | Ga0075364_10118442 | 3300006051 | Bacteria | 1771 |
| 122 | Ga0075364_10232689 | 3300006051 | Bacteria | 1251 |
| 123 | Ga0075432_10008747 | 3300006058 | Bacteria | 3454 |
| 124 | Ga0075432_10035996 | 3300006058 | Bacteria | 1720 |
| 125 | Ga0075432_10090677 | 3300006058 | Bacteria | 1118 |
| 126 | Ga0075432_10101492 | 3300006058 | Bacteria | 1063 |
| 127 | Ga0075362_10017681 | 3300006177 | Bacteria | 2941 |
| 128 | Ga0075362_10083436 | 3300006177 | Bacteria | 1475 |
| 129 | Ga0075362_10204581 | 3300006177 | Bacteria | 962 |
| 130 | Ga0075362_10215922 | 3300006177 | Bacteria | 936 |
| 131 | Ga0075367_10034341 | 3300006178 | Bacteria | 2929 |
| 132 | Ga0075367_10432556 | 3300006178 | Bacteria | 833 |
| 133 | Ga0075366_10063498 | 3300006195 | Bacteria | 2195 |
| 134 | Ga0075366_10214640 | 3300006195 | Bacteria | 1172 |
| 135 | Ga0075436_100056271 | 3300006914 | Bacteria | 2717 |
| 136 | Ga0075436_100212610 | 3300006914 | Bacteria | 1371 |
| 137 | Ga0075436_100215555 | 3300006914 | Bacteria | 1361 |
| 138 | Ga0075436_100279006 | 3300006914 | Bacteria | 1194 |
| 139 | Ga0075436_100337469 | 3300006914 | Bacteria | 1084 |
| 140 | Ga0099823_1000086 | 3300006944 | Bacteria | 44633 |
| 141 | Ga0099823_1036036 | 3300006944 | Bacteria | 3825 |
| 142 | Ga0079104_1000424 | 3300006946 | Bacteria | 48276 |
| 143 | Ga0079104_1000718 | 3300006946 | Bacteria | 29917 |
| 144 | Ga0079104_1009624 | 3300006946 | Bacteria | 3259 |
| 145 | Ga0099826_10016562 | 3300006948 | Bacteria | 5567 |
| 146 | Ga0075435_100174648 | 3300007076 | Bacteria | 1814 |
| 147 | Ga0105251_10000274 | 3300009011 | Bacteria | 51694 |
| 148 | Ga0105251_10000828 | 3300009011 | Bacteria | 27688 |
| 149 | Ga0105251_10001027 | 3300009011 | Bacteria | 24511 |
| 150 | Ga0105251_10003921 | 3300009011 | Bacteria | 10569 |
| 151 | Ga0105251_10012768 | 3300009011 | Bacteria | 4734 |
| 152 | Ga0105251_10030044 | 3300009011 | Bacteria | 2732 |
| 153 | Ga0105251_10147962 | 3300009011 | Bacteria | 1061 |
| 154 | Ga0105244_10002564 | 3300009036 | Bacteria | 13641 |
| 155 | Ga0105244_10004785 | 3300009036 | Bacteria | 9202 |
| 156 | Ga0105244_10006019 | 3300009036 | Bacteria | 7946 |
| 157 | Ga0105244_10028370 | 3300009036 | Bacteria | 3003 |
| 158 | Ga0105244_10068499 | 3300009036 | Bacteria | 1773 |
| 159 | Ga0105244_10184439 | 3300009036 | Bacteria | 989 |
| 160 | Ga0105250_10000191 | 3300009092 | Bacteria | 52429 |
| 161 | Ga0105250_10013949 | 3300009092 | Bacteria | 3309 |
| 162 | Ga0105250_10035745 | 3300009092 | Bacteria | 1994 |
| 163 | Ga0105250_10201902 | 3300009092 | Bacteria | 839 |
| 164 | Ga0105240_10252669 | 3300009093 | Bacteria | 2038 |
| 165 | Ga0105240_10365136 | 3300009093 | Bacteria | 1634 |
| 166 | Ga0111539_10695785 | 3300009094 | Bacteria | 1183 |
| 167 | Ga0105247_10686781 | 3300009101 | Bacteria | 769 |
| 168 | Ga0105243_10000418 | 3300009148 | Bacteria | 44790 |
| 169 | Ga0105243_10002911 | 3300009148 | Bacteria | 14171 |
| 170 | Ga0105243_10003724 | 3300009148 | Bacteria | 12232 |
| 171 | Ga0105243_10005562 | 3300009148 | Bacteria | 9815 |
| 172 | Ga0105243_10011149 | 3300009148 | Bacteria | 6799 |
| 173 | Ga0105243_10030328 | 3300009148 | Bacteria | 4162 |
| 174 | Ga0105242_10001499 | 3300009176 | Bacteria | 18352 |
| 175 | Ga0105237_10001509 | 3300009545 | Bacteria | 30588 |
| 176 | Ga0105237_10426342 | 3300009545 | Bacteria | 1332 |
| 177 | Ga0105249_10006152 | 3300009553 | Bacteria | 10410 |
| 178 | Ga0105249_10483838 | 3300009553 | Bacteria | 1281 |
| 179 | Ga0105239_10422536 | 3300010375 | Bacteria | 1510 |
| 180 | Ga0105246_10021610 | 3300011119 | Bacteria | 4143 |
| 181 | Ga0157373_10004396 | 3300013100 | Bacteria | 10624 |
| 182 | Ga0157373_10006454 | 3300013100 | Bacteria | 8758 |
| 183 | Ga0157373_10042510 | 3300013100 | Bacteria | 3248 |
| 184 | Ga0157373_10080342 | 3300013100 | Bacteria | 2299 |
| 185 | Ga0157373_10126273 | 3300013100 | Bacteria | 1799 |
| 186 | Ga0157371_10000609 | 3300013102 | Bacteria | 42602 |
| 187 | Ga0157371_10003267 | 3300013102 | Bacteria | 14869 |
| 188 | Ga0157371_10010705 | 3300013102 | Bacteria | 7121 |
| 189 | Ga0157370_10000025 | 3300013104 | Bacteria | 158865 |
| 190 | Ga0157370_10026152 | 3300013104 | Bacteria | 5765 |
| 191 | Ga0157370_10068885 | 3300013104 | Bacteria | 3343 |
| 192 | Ga0157370_10101418 | 3300013104 | Bacteria | 2696 |
| 193 | Ga0157370_10134402 | 3300013104 | Bacteria | 2306 |
| 194 | Ga0157370_10160617 | 3300013104 | Bacteria | 2091 |
| 195 | Ga0157370_10225054 | 3300013104 | Bacteria | 1737 |
| 196 | Ga0157370_10636936 | 3300013104 | Bacteria | 975 |
| 197 | Ga0157369_10002004 | 3300013105 | Bacteria | 24531 |
| 198 | Ga0157369_10020339 | 3300013105 | Bacteria | 7420 |
| 199 | Ga0157369_10087691 | 3300013105 | Bacteria | 3323 |
| 200 | Ga0157369_10506551 | 3300013105 | Bacteria | 1249 |
| 201 | Ga0163162_10704382 | 3300013306 | Bacteria | 1131 |
| 202 | Ga0157372_10000227 | 3300013307 | Bacteria | 62661 |
| 203 | Ga0157372_10181212 | 3300013307 | Bacteria | 2438 |
| 204 | Ga0157372_10321758 | 3300013307 | Bacteria | 1801 |
| 205 | Ga0157375_10079061 | 3300013308 | Bacteria | 3323 |
| 206 | Ga0157375_10080456 | 3300013308 | Bacteria | 3296 |
| 207 | Ga0163163_10166706 | 3300014325 | Bacteria | 2249 |
| 208 | Ga0157380_10035816 | 3300014326 | Bacteria | 3836 |
| 209 | Ga0182008_10000293 | 3300014497 | Bacteria | 39393 |
| 210 | Ga0182008_10032172 | 3300014497 | Bacteria | 2636 |
| 211 | Ga0182008_10036046 | 3300014497 | Bacteria | 2476 |
| 212 | Ga0182008_10051729 | 3300014497 | Bacteria | 2037 |
| 213 | Ga0182008_10081816 | 3300014497 | Bacteria | 1589 |
| 214 | Ga0157376_10194707 | 3300014969 | Bacteria | 1861 |
| 215 | Ga0182006_1001907 | 3300015261 | Bacteria | 11876 |
| 216 | Ga0182006_1002075 | 3300015261 | Bacteria | 11207 |
| 217 | Ga0182006_1011903 | 3300015261 | Bacteria | 3810 |
| 218 | Ga0182006_1017384 | 3300015261 | Bacteria | 3056 |
| 219 | Ga0182006_1023480 | 3300015261 | Bacteria | 2554 |
| 220 | Ga0182006_1036303 | 3300015261 | Bacteria | 1960 |
| 221 | Ga0182006_1059376 | 3300015261 | Bacteria | 1448 |
| 222 | Ga0182006_1097929 | 3300015261 | Bacteria | 1045 |
| 223 | Ga0182007_10000284 | 3300015262 | Bacteria | 33721 |
| 224 | Ga0182007_10012189 | 3300015262 | Bacteria | 3319 |
| 225 | Ga0182007_10020719 | 3300015262 | Bacteria | 2345 |
| 226 | Ga0182007_10029870 | 3300015262 | Bacteria | 1865 |
| 227 | Ga0182005_1001150 | 3300015265 | Bacteria | 10975 |
| 228 | Ga0163161_10004577 | 3300017792 | Bacteria | 9628 |
| 229 | Ga0163161_10005887 | 3300017792 | Bacteria | 8506 |
| 230 | Ga0163161_10022215 | 3300017792 | Bacteria | 4465 |
| 231 | Ga0163161_10151888 | 3300017792 | Bacteria | 1760 |
| 232 | Ga0197907_10062933 | 3300020069 | Bacteria | 670 |
| 233 | Ga0197907_10109288 | 3300020069 | Bacteria | 1864 |
| 234 | Ga0206356_10469082 | 3300020070 | Bacteria | 2760 |
| 235 | Ga0206349_1210075 | 3300020075 | Bacteria | 2829 |
| 236 | Ga0206355_1608568 | 3300020076 | Bacteria | 914 |
| 237 | Ga0206351_10301792 | 3300020077 | Bacteria | 6724 |
| 238 | Ga0206350_10572994 | 3300020080 | Bacteria | 817 |
| 239 | Ga0206350_11061825 | 3300020080 | Bacteria | 817 |
| 240 | Ga0154015_1353180 | 3300020610 | Bacteria | 9097 |
| 241 | Ga0213872_10000305 | 3300021361 | Bacteria | 41889 |
| 242 | Ga0213872_10010123 | 3300021361 | Bacteria | 4498 |
| 243 | Ga0224712_10006729 | 3300022467 | Bacteria | 3301 |
| 244 | Ga0224712_10128930 | 3300022467 | Bacteria | 1103 |
| 245 | Ga0209435_100821 | 3300025206 | Bacteria | 4907 |
| 246 | Ga0209760_100027 | 3300025207 | Bacteria | 153290 |
| 247 | Ga0209760_100149 | 3300025207 | Bacteria | 43212 |
| 248 | Ga0209760_100681 | 3300025207 | Bacteria | 5379 |
| 249 | Ga0209784_100003 | 3300025224 | Bacteria | 1379451 |
| 250 | Ga0209784_100007 | 3300025224 | Bacteria | 747715 |
| 251 | Ga0209784_100010 | 3300025224 | Bacteria | 683664 |
| 252 | Ga0209784_100441 | 3300025224 | Bacteria | 17844 |
| 253 | Ga0209566_100002 | 3300025225 | Bacteria | 2614868 |
| 254 | Ga0209566_100008 | 3300025225 | Bacteria | 683664 |
| 255 | Ga0209566_100009 | 3300025225 | Bacteria | 554018 |
| 256 | Ga0209674_100008 | 3300025226 | Bacteria | 1076909 |
| 257 | Ga0209674_100019 | 3300025226 | Bacteria | 683664 |
| 258 | Ga0209674_100021 | 3300025226 | Bacteria | 629811 |
| 259 | Ga0209672_100235 | 3300025228 | Bacteria | 42143 |
| 260 | Ga0209147_100002 | 3300025229 | Bacteria | 2158988 |
| 261 | Ga0209147_100009 | 3300025229 | Bacteria | 747409 |
| 262 | Ga0209563_100004 | 3300025230 | Bacteria | 1814108 |
| 263 | Ga0209563_100018 | 3300025230 | Bacteria | 747850 |
| 264 | Ga0209563_100021 | 3300025230 | Bacteria | 683764 |
| 265 | Ga0209563_100026 | 3300025230 | Bacteria | 559453 |
| 266 | Ga0207427_100005 | 3300025231 | Bacteria | 797999 |
| 267 | Ga0207427_100006 | 3300025231 | Bacteria | 785415 |
| 268 | Ga0207427_100342 | 3300025231 | Bacteria | 30270 |
| 269 | Ga0209437_100013 | 3300025233 | Bacteria | 785457 |
| 270 | Ga0209437_100018 | 3300025233 | Bacteria | 694400 |
| 271 | Ga0209437_100019 | 3300025233 | Bacteria | 683764 |
| 272 | Ga0209437_104041 | 3300025233 | Bacteria | 2603 |
| 273 | Ga0209258_100002 | 3300025242 | Bacteria | 2158988 |
| 274 | Ga0209258_100169 | 3300025242 | Bacteria | 145227 |
| 275 | Ga0209258_100177 | 3300025242 | Bacteria | 140714 |
| 276 | Ga0209646_1000184 | 3300025246 | Bacteria | 78423 |
| 277 | Ga0209026_1012445 | 3300025250 | Bacteria | 1483 |
| 278 | Ga0209677_100011 | 3300025253 | Bacteria | 683664 |
| 279 | Ga0209677_100012 | 3300025253 | Bacteria | 554018 |
| 280 | Ga0209677_100013 | 3300025253 | Bacteria | 548200 |
| 281 | Ga0209148_1002932 | 3300025254 | Bacteria | 5175 |
| 282 | Ga0209148_1003831 | 3300025254 | Bacteria | 3924 |
| 283 | Ga0209759_1000399 | 3300025256 | Bacteria | 53437 |
| 284 | Ga0209759_1004392 | 3300025256 | Bacteria | 5287 |
| 285 | Ga0209759_1005052 | 3300025256 | Bacteria | 4733 |
| 286 | Ga0209759_1005073 | 3300025256 | Bacteria | 4715 |
| 287 | Ga0209759_1016653 | 3300025256 | Bacteria | 1845 |
| 288 | Ga0209233_1000021 | 3300025261 | Bacteria | 798078 |
| 289 | Ga0209233_1000022 | 3300025261 | Bacteria | 785415 |
| 290 | Ga0209233_1000025 | 3300025261 | Bacteria | 683764 |
| 291 | Ga0209565_1009039 | 3300025263 | Bacteria | 2563 |
| 292 | Ga0209565_1025325 | 3300025263 | Bacteria | 1200 |
| 293 | Ga0209455_1000021 | 3300025272 | Bacteria | 699993 |
| 294 | Ga0209455_1000108 | 3300025272 | Bacteria | 193021 |
| 295 | Ga0209675_1003233 | 3300025291 | Bacteria | 7869 |
| 296 | Ga0209676_1000030 | 3300025292 | Bacteria | 506421 |
| 297 | Ga0209676_1000041 | 3300025292 | Bacteria | 424583 |
| 298 | Ga0209676_1000510 | 3300025292 | Bacteria | 61272 |
| 299 | Ga0209676_1002546 | 3300025292 | Bacteria | 12662 |
| 300 | Ga0209676_1003117 | 3300025292 | Bacteria | 10646 |
| 301 | Ga0209025_1000040 | 3300025294 | Bacteria | 376228 |
| 302 | Ga0209025_1000524 | 3300025294 | Bacteria | 73057 |
| 303 | Ga0209050_1000024 | 3300025298 | Bacteria | 533389 |
| 304 | Ga0209050_1000518 | 3300025298 | Bacteria | 64332 |
| 305 | Ga0209050_1000647 | 3300025298 | Bacteria | 54000 |
| 306 | Ga0209256_1000149 | 3300025299 | Bacteria | 146390 |
| 307 | Ga0209051_1000023 | 3300025303 | Bacteria | 437371 |
| 308 | Ga0209051_1000721 | 3300025303 | Bacteria | 36119 |
| 309 | Ga0209051_1005515 | 3300025303 | Bacteria | 7377 |
| 310 | Ga0209051_1009026 | 3300025303 | Bacteria | 5192 |
| 311 | Ga0207656_10000006 | 3300025321 | Bacteria | 395044 |
| 312 | Ga0207696_1000078 | 3300025711 | Bacteria | 207623 |
| 313 | Ga0207696_1000145 | 3300025711 | Bacteria | 122321 |
| 314 | Ga0207696_1008153 | 3300025711 | Bacteria | 4036 |
| 315 | Ga0207696_1021631 | 3300025711 | Bacteria | 2057 |
| 316 | Ga0207696_1046209 | 3300025711 | Bacteria | 1256 |
| 317 | Ga0207696_1068504 | 3300025711 | Bacteria | 990 |
| 318 | Ga0207655_1000014 | 3300025728 | Bacteria | 607124 |
| 319 | Ga0207655_1000018 | 3300025728 | Bacteria | 537129 |
| 320 | Ga0207655_1000202 | 3300025728 | Bacteria | 103907 |
| 321 | Ga0207655_1000309 | 3300025728 | Bacteria | 72910 |
| 322 | Ga0207655_1000388 | 3300025728 | Bacteria | 61513 |
| 323 | Ga0207655_1001315 | 3300025728 | Bacteria | 23457 |
| 324 | Ga0207655_1007901 | 3300025728 | Bacteria | 6830 |
| 325 | Ga0207655_1015714 | 3300025728 | Bacteria | 4189 |
| 326 | Ga0207655_1024451 | 3300025728 | Bacteria | 2960 |
| 327 | Ga0207655_1028654 | 3300025728 | Bacteria | 2623 |
| 328 | Ga0207655_1035454 | 3300025728 | Bacteria | 2227 |
| 329 | Ga0207655_1054242 | 3300025728 | Bacteria | 1595 |
| 330 | Ga0207713_1000010 | 3300025735 | Bacteria | 528374 |
| 331 | Ga0207713_1000815 | 3300025735 | Bacteria | 28847 |
| 332 | Ga0207713_1001109 | 3300025735 | Bacteria | 23001 |
| 333 | Ga0207713_1001785 | 3300025735 | Bacteria | 16465 |
| 334 | Ga0207713_1003196 | 3300025735 | Bacteria | 11322 |
| 335 | Ga0207713_1003415 | 3300025735 | Bacteria | 10847 |
| 336 | Ga0207713_1004607 | 3300025735 | Bacteria | 8904 |
| 337 | Ga0207713_1006691 | 3300025735 | Bacteria | 6970 |
| 338 | Ga0207713_1018033 | 3300025735 | Bacteria | 3509 |
| 339 | Ga0207705_10301653 | 3300025909 | Unclassified | 1229 |
| 340 | Ga0207654_10102260 | 3300025911 | Bacteria | 1767 |
| 341 | Ga0207695_10001515 | 3300025913 | Bacteria | 38585 |
| 342 | Ga0207695_10306689 | 3300025913 | Bacteria | 1478 |
| 343 | Ga0207695_10524193 | 3300025913 | Bacteria | 1066 |
| 344 | Ga0207671_10000131 | 3300025914 | Bacteria | 116866 |
| 345 | Ga0207663_10057951 | 3300025916 | Bacteria | 2442 |
| 346 | Ga0207660_10176502 | 3300025917 | Bacteria | 1657 |
| 347 | Ga0207657_10350363 | 3300025919 | Bacteria | 1164 |
| 348 | Ga0207649_10000012 | 3300025920 | Bacteria | 265674 |
| 349 | Ga0207649_10000370 | 3300025920 | Bacteria | 33558 |
| 350 | Ga0207652_10048901 | 3300025921 | Bacteria | 3617 |
| 351 | Ga0207652_10174749 | 3300025921 | Bacteria | 1929 |
| 352 | Ga0207681_10000099 | 3300025923 | Bacteria | 73220 |
| 353 | Ga0207681_10000699 | 3300025923 | Bacteria | 22008 |
| 354 | Ga0207681_10223433 | 3300025923 | Bacteria | 1458 |
| 355 | Ga0207694_10182929 | 3300025924 | Bacteria | 1700 |
| 356 | Ga0207650_10000518 | 3300025925 | Bacteria | 31804 |
| 357 | Ga0207650_10000571 | 3300025925 | Bacteria | 29738 |
| 358 | Ga0207644_10272424 | 3300025931 | Bacteria | 1357 |
| 359 | Ga0207706_10000580 | 3300025933 | Bacteria | 38973 |
| 360 | Ga0207686_10000319 | 3300025934 | Bacteria | 34615 |
| 361 | Ga0207709_10000068 | 3300025935 | Bacteria | 188511 |
| 362 | Ga0207709_10000071 | 3300025935 | Bacteria | 181156 |
| 363 | Ga0207709_10000337 | 3300025935 | Bacteria | 49221 |
| 364 | Ga0207709_10001011 | 3300025935 | Bacteria | 20847 |
| 365 | Ga0207709_10003583 | 3300025935 | Bacteria | 9174 |
| 366 | Ga0207709_10017354 | 3300025935 | Bacteria | 4017 |
| 367 | Ga0207709_10021142 | 3300025935 | Bacteria | 3681 |
| 368 | Ga0207709_10032812 | 3300025935 | Bacteria | 3044 |
| 369 | Ga0207665_10131458 | 3300025939 | Bacteria | 1777 |
| 370 | Ga0207711_10063414 | 3300025941 | Bacteria | 3190 |
| 371 | Ga0207661_10001162 | 3300025944 | Bacteria | 17574 |
| 372 | Ga0207679_10000001 | 3300025945 | Bacteria | 777444 |
| 373 | Ga0207679_10000015 | 3300025945 | Bacteria | 265674 |
| 374 | Ga0207712_10014475 | 3300025961 | Bacteria | 5076 |
| 375 | Ga0207668_10161126 | 3300025972 | Bacteria | 1748 |
| 376 | Ga0207668_10363741 | 3300025972 | Bacteria | 1213 |
| 377 | Ga0207640_10000119 | 3300025981 | Bacteria | 59745 |
| 378 | Ga0207640_10046142 | 3300025981 | Bacteria | 2802 |
| 379 | Ga0207639_10000775 | 3300026041 | Bacteria | 21763 |
| 380 | Ga0207678_10000004 | 3300026067 | Bacteria | 196743 |
| 381 | Ga0207702_10000029 | 3300026078 | Bacteria | 181652 |
| 382 | Ga0207641_10064155 | 3300026088 | Bacteria | 3139 |
| 383 | Ga0207674_10012679 | 3300026116 | Bacteria | 9417 |
| 384 | Ga0209281_1000016 | 3300027111 | Bacteria | 588107 |
| 385 | Ga0209281_1000019 | 3300027111 | Bacteria | 576164 |
| 386 | Ga0209281_1004114 | 3300027111 | Bacteria | 4465 |
| 387 | Ga0209281_1005332 | 3300027111 | Bacteria | 3595 |
| 388 | Ga0209389_1000049 | 3300027296 | Bacteria | 114702 |
| 389 | Ga0209389_1064164 | 3300027296 | Bacteria | 2183 |
| 390 | Ga0209371_1000106 | 3300027312 | Bacteria | 146212 |
| 391 | Ga0207428_10066564 | 3300027907 | Bacteria | 2839 |
| 392 | Ga0207428_10101827 | 3300027907 | Bacteria | 2219 |
| 393 | Ga0207428_10157003 | 3300027907 | Bacteria | 1730 |
| 394 | Ga0207428_10391467 | 3300027907 | Bacteria | 1018 |
| 395 | Ga0207428_10582031 | 3300027907 | Bacteria | 808 |
| 396 | Ga0207428_10589663 | 3300027907 | Bacteria | 802 |
| 397 | Ga0207428_10670186 | 3300027907 | Bacteria | 743 |
| 398 | Ga0268266_10002872 | 3300028379 | Bacteria | 17907 |
| 399 | Ga0268264_10020980 | 3300028381 | Bacteria | 5337 |
| 400 | Ga0268264_10043130 | 3300028381 | Bacteria | 3737 |
| 401 | Ga0265319_1000174 | 3300028563 | Bacteria | 48778 |
| 402 | Ga0265334_10033035 | 3300028573 | Bacteria | 2061 |
| 403 | Ga0307517_10238794 | 3300028786 | Bacteria | 1081 |
| 404 | Ga0307515_10000577 | 3300028794 | Bacteria | 86068 |
| 405 | Ga0265338_10005327 | 3300028800 | Bacteria | 16841 |
| 406 | Ga0268256_1000077 | 3300030500 | Bacteria | 177593 |
| 407 | Ga0307511_10068564 | 3300030521 | Bacteria | 2618 |
| 408 | Ga0316177_1038918 | 3300030731 | Bacteria | 3622 |
| 409 | Ga0316177_1204046 | 3300030731 | Bacteria | 799 |
| 410 | Ga0314311_1263845 | 3300030733 | Bacteria | 6278 |
| 411 | Ga0316179_1012631 | 3300030734 | Bacteria | 5035 |
| 412 | Ga0265330_10114871 | 3300031235 | Bacteria | 1148 |
| 413 | Ga0265332_10064810 | 3300031238 | Bacteria | 1560 |
| 414 | Ga0265325_10012992 | 3300031241 | Bacteria | 4749 |
| 415 | Ga0265339_10001794 | 3300031249 | Bacteria | 15795 |
| 416 | Ga0265327_10153912 | 3300031251 | Bacteria | 1066 |
| 417 | Ga0265316_10005455 | 3300031344 | Bacteria | 12352 |
| 418 | Ga0307513_10077668 | 3300031456 | Bacteria | 3437 |
| 419 | Ga0307509_10116479 | 3300031507 | Bacteria | 2661 |
| 420 | Ga0307408_100000019 | 3300031548 | Bacteria | 344502 |
| 421 | Ga0307408_100001975 | 3300031548 | Bacteria | 14793 |
| 422 | Ga0307408_100007309 | 3300031548 | Bacteria | 7307 |
| 423 | Ga0307408_100007499 | 3300031548 | Bacteria | 7214 |
| 424 | Ga0307408_100020706 | 3300031548 | Bacteria | 4443 |
| 425 | Ga0307408_100030188 | 3300031548 | Bacteria | 3762 |
| 426 | Ga0307408_100043515 | 3300031548 | Bacteria | 3195 |
| 427 | Ga0307408_100162778 | 3300031548 | Bacteria | 1773 |
| 428 | Ga0307514_10023189 | 3300031649 | Bacteria | 5038 |
| 429 | Ga0265314_10000002 | 3300031711 | Bacteria | 2092193 |
| 430 | Ga0307405_10002527 | 3300031731 | Bacteria | 8097 |
| 431 | Ga0307405_10025146 | 3300031731 | Bacteria | 3413 |
| 432 | Ga0307413_10136681 | 3300031824 | Bacteria | 1686 |
| 433 | Ga0307406_10007961 | 3300031901 | Bacteria | 5902 |
| 434 | Ga0307406_10052248 | 3300031901 | Bacteria | 2598 |
| 435 | Ga0307407_10061619 | 3300031903 | Bacteria | 2193 |
| 436 | Ga0307407_10135947 | 3300031903 | Bacteria | 1579 |
| 437 | Ga0307412_10000155 | 3300031911 | Bacteria | 48968 |
| 438 | Ga0307412_10001478 | 3300031911 | Bacteria | 13061 |
| 439 | Ga0307412_10018416 | 3300031911 | Bacteria | 4201 |
| 440 | Ga0307412_10020333 | 3300031911 | Bacteria | 4038 |
| 441 | Ga0307412_10027487 | 3300031911 | Bacteria | 3547 |
| 442 | Ga0307412_10098134 | 3300031911 | Bacteria | 2065 |
| 443 | Ga0307412_10571708 | 3300031911 | Bacteria | 952 |
| 444 | Ga0307412_10725525 | 3300031911 | Bacteria | 855 |
| 445 | Ga0307409_100066516 | 3300031995 | Bacteria | 2842 |
| 446 | Ga0307409_100080210 | 3300031995 | Bacteria | 2633 |
| 447 | Ga0307416_100563229 | 3300032002 | Bacteria | 1214 |
| 448 | Ga0307414_10000041 | 3300032004 | Bacteria | 144783 |
| 449 | Ga0307414_10001579 | 3300032004 | Bacteria | 11830 |
| 450 | Ga0307414_10003999 | 3300032004 | Bacteria | 7958 |
| 451 | Ga0307414_10059474 | 3300032004 | Bacteria | 2698 |
| 452 | Ga0307414_10067128 | 3300032004 | Bacteria | 2567 |
| 453 | Ga0307414_10254278 | 3300032004 | Bacteria | 1462 |
| 454 | Ga0307414_10843689 | 3300032004 | Bacteria | 837 |
| 455 | Ga0307414_11077526 | 3300032004 | Bacteria | 741 |
| 456 | Ga0307411_10007711 | 3300032005 | Bacteria | 5512 |
| 457 | Ga0307411_10110186 | 3300032005 | Bacteria | 1968 |
| 458 | Ga0307411_11119578 | 3300032005 | Bacteria | 710 |
| 459 | Ga0307415_100117470 | 3300032126 | Bacteria | 1987 |
| 460 | Ga0395900_0001438 | 3300037418 | Bacteria | 28413 |
| 461 | Ga0395898_0326538 | 3300037466 | Bacteria | 1463 |
| 462 | Ga0395905_0316328 | 3300037471 | Bacteria | 1450 |
| 463 | Ga0395901_0522027 | 3300038443 | Bacteria | 1206 |
| 464 | Ga0237819_01092 | 3300038705 | Bacteria | 7986 |
| 465 | Ga0436365_1128753 | 3300039437 | Bacteria | 1310 |
| 466 | Ga0436361_0662862 | 3300039447 | Bacteria | 13181 |
| 467 | Ga0436361_1088302 | 3300039447 | Bacteria | 21721 |
| 468 | Ga0439436_0001261 | 3300041404 | Bacteria | 7227 |
| 469 | Ga0439438_000413 | 3300041405 | Bacteria | 19264 |
| 470 | Ga0439438_002141 | 3300041405 | Bacteria | 8507 |
| 471 | Ga0439438_003418 | 3300041405 | Bacteria | 6424 |
| 472 | Ga0439438_006264 | 3300041405 | Bacteria | 4228 |
| 473 | Ga0439438_006353 | 3300041405 | Bacteria | 4185 |
| 474 | Ga0439438_010630 | 3300041405 | Bacteria | 2899 |
| 475 | Ga0439438_011185 | 3300041405 | Bacteria | 2805 |
| 476 | Ga0439438_011922 | 3300041405 | Bacteria | 2686 |
| 477 | Ga0439438_016210 | 3300041405 | Bacteria | 2170 |
| 478 | Ga0439438_044230 | 3300041405 | Bacteria | 1147 |
| 479 | Ga0439438_044369 | 3300041405 | Bacteria | 1145 |
| 480 | Ga0439447_000185 | 3300041407 | Bacteria | 22086 |
| 481 | Ga0439447_001317 | 3300041407 | Bacteria | 9029 |
| 482 | Ga0439447_004258 | 3300041407 | Bacteria | 4959 |
| 483 | Ga0439447_004487 | 3300041407 | Bacteria | 4788 |
| 484 | Ga0439447_005893 | 3300041407 | Bacteria | 4027 |
| 485 | Ga0439447_006591 | 3300041407 | Bacteria | 3753 |
| 486 | Ga0439447_010479 | 3300041407 | Bacteria | 2748 |
| 487 | Ga0439466_0000460 | 3300041411 | Bacteria | 15548 |
| 488 | Ga0439466_0002029 | 3300041411 | Bacteria | 7942 |
| 489 | Ga0439466_0006648 | 3300041411 | Bacteria | 4390 |
| 490 | Ga0439466_0007338 | 3300041411 | Bacteria | 4175 |
| 491 | Ga0439466_0013865 | 3300041411 | Bacteria | 2945 |
| 492 | Ga0439466_0015107 | 3300041411 | Bacteria | 2806 |
| 493 | Ga0439466_0016538 | 3300041411 | Bacteria | 2664 |
| 494 | Ga0439466_0018278 | 3300041411 | Bacteria | 2516 |
| 495 | Ga0439466_0025288 | 3300041411 | Bacteria | 2073 |
| 496 | Ga0439466_0028941 | 3300041411 | Bacteria | 1908 |
| 497 | Ga0439466_0041300 | 3300041411 | Bacteria | 1539 |
| 498 | Ga0439465_0000298 | 3300041413 | Bacteria | 13971 |
| 499 | Ga0439431_0006104 | 3300041997 | Bacteria | 2660 |
| 500 | Ga0439445_0000755 | 3300042004 | Bacteria | 6784 |
| 501 | Ga0439445_0007805 | 3300042004 | Bacteria | 2492 |
| 502 | Ga0439432_000797 | 3300042006 | Bacteria | 11779 |
| 503 | Ga0439432_002776 | 3300042006 | Bacteria | 6527 |
| 504 | Ga0439432_003848 | 3300042006 | Bacteria | 5533 |
| 505 | Ga0439432_005322 | 3300042006 | Bacteria | 4645 |
| 506 | Ga0439432_015589 | 3300042006 | Bacteria | 2564 |
| 507 | Ga0439432_015972 | 3300042006 | Bacteria | 2529 |
| 508 | Ga0439432_016716 | 3300042006 | Bacteria | 2467 |
| 509 | Ga0439432_045898 | 3300042006 | Bacteria | 1373 |
| 510 | Ga0439432_073626 | 3300042006 | Bacteria | 1039 |
| 511 | Ga0439451_001405 | 3300042009 | Bacteria | 4759 |
| 512 | Ga0439451_006121 | 3300042009 | Bacteria | 2459 |
| 513 | Ga0439451_014709 | 3300042009 | Bacteria | 1578 |
| 514 | Ga0439451_018243 | 3300042009 | Bacteria | 1415 |
| 515 | Ga0439452_000354 | 3300042010 | Bacteria | 28113 |
| 516 | Ga0439452_000769 | 3300042010 | Bacteria | 15322 |
| 517 | Ga0439452_000864 | 3300042010 | Bacteria | 14004 |
| 518 | Ga0439452_004376 | 3300042010 | Bacteria | 4748 |
| 519 | Ga0439452_010875 | 3300042010 | Bacteria | 2632 |
| 520 | Ga0439452_020001 | 3300042010 | Bacteria | 1761 |
| 521 | Ga0439452_025050 | 3300042010 | Bacteria | 1517 |
| 522 | Ga0439456_000043 | 3300042013 | Bacteria | 45603 |
| 523 | Ga0439456_000444 | 3300042013 | Bacteria | 9140 |
| 524 | Ga0439456_006434 | 3300042013 | Bacteria | 2399 |
| 525 | Ga0439463_000618 | 3300042016 | Bacteria | 9853 |
| 526 | Ga0439463_001239 | 3300042016 | Bacteria | 6828 |
| 527 | Ga0439463_002794 | 3300042016 | Bacteria | 4429 |
| 528 | Ga0439463_031436 | 3300042016 | Bacteria | 1339 |
| 529 | Ga0450911_000118 | 3300042115 | Bacteria | 31744 |
| 530 | Ga0450911_000515 | 3300042115 | Bacteria | 12209 |
| 531 | Ga0450911_000943 | 3300042115 | Bacteria | 7611 |
| 532 | Ga0450911_001271 | 3300042115 | Bacteria | 6029 |
| 533 | Ga0450911_009389 | 3300042115 | Bacteria | 1371 |
| 534 | Ga0450919_002285 | 3300042121 | Bacteria | 2483 |
| 535 | Ga0450920_003501 | 3300042122 | Bacteria | 2723 |
| 536 | Ga0450921_008231 | 3300042123 | Bacteria | 843 |
| 537 | Ga0450922_000114 | 3300042124 | Bacteria | 7857 |
| 538 | Ga0450922_000386 | 3300042124 | Bacteria | 4730 |
| 539 | Ga0450923_003986 | 3300042125 | Bacteria | 2282 |
| 540 | Ga0450923_050833 | 3300042125 | Bacteria | 890 |
| 541 | Ga0450890_000259 | 3300042127 | Bacteria | 7780 |
| 542 | Ga0450902_003798 | 3300042137 | Bacteria | 2227 |
| 543 | Ga0450902_016646 | 3300042137 | Bacteria | 1199 |
| 544 | Ga0450902_031180 | 3300042137 | Bacteria | 897 |
| 545 | Ga0450903_001100 | 3300042138 | Bacteria | 5135 |
| 546 | Ga0450903_002913 | 3300042138 | Bacteria | 2989 |
| 547 | Ga0450904_001416 | 3300042139 | Bacteria | 3395 |
| 548 | Ga0450906_000802 | 3300042145 | Bacteria | 6878 |
| 549 | Ga0450906_006857 | 3300042145 | Bacteria | 2278 |
| 550 | Ga0450907_000322 | 3300042146 | Bacteria | 15515 |
| 551 | Ga0450907_001362 | 3300042146 | Bacteria | 5388 |
| 552 | Ga0450907_001620 | 3300042146 | Bacteria | 4721 |
| 553 | Ga0450910_000704 | 3300042147 | Bacteria | 4003 |
| 554 | Ga0450910_013822 | 3300042147 | Bacteria | 1177 |
| 555 | Ga0439446_0000162 | 3300042156 | Bacteria | 11674 |
| 556 | Ga0439446_0002703 | 3300042156 | Bacteria | 4288 |
| 557 | Ga0450908_000612 | 3300042184 | Bacteria | 6837 |
| 558 | Ga0450908_001252 | 3300042184 | Bacteria | 4911 |
| 559 | Ga0450909_004087 | 3300042185 | Bacteria | 2079 |
| 560 | Ga0439434_0000151 | 3300042435 | Bacteria | 18441 |
| 561 | Ga0439434_0001524 | 3300042435 | Bacteria | 6664 |
| 562 | Ga0439434_0052588 | 3300042435 | Bacteria | 1265 |
| 563 | Ga0439460_0000441 | 3300042461 | Bacteria | 8883 |
| 564 | Ga0439460_0000521 | 3300042461 | Bacteria | 8350 |
| 565 | Ga0439460_0004619 | 3300042461 | Bacteria | 3360 |
| 566 | Ga0439460_0029891 | 3300042461 | Bacteria | 1545 |
| 567 | Ga0439460_0155461 | 3300042461 | Bacteria | 765 |
| 568 | Ga0450893_0004391 | 3300042532 | Bacteria | 2247 |
| 569 | Ga0450901_002284 | 3300042533 | Bacteria | 2089 |
| 570 | Ga0439440_0000802 | 3300042993 | Bacteria | 5441 |
| 571 | Ga0495617_001375 | 3300046452 | Bacteria | 10746 |
| 572 | Ga0495617_001612 | 3300046452 | Bacteria | 9739 |
| 573 | Ga0495617_014525 | 3300046452 | Bacteria | 2676 |
| 574 | Ga0495617_022087 | 3300046452 | Bacteria | 2150 |
| 575 | Ga0495627_003332 | 3300046453 | Bacteria | 7141 |
| 576 | Ga0495627_012631 | 3300046453 | Bacteria | 2991 |
| 577 | Ga0495627_037720 | 3300046453 | Bacteria | 1498 |
| 578 | Ga0495603_0017024 | 3300046455 | Bacteria | 4398 |
| 579 | Ga0495590_0002290 | 3300046457 | Bacteria | 7982 |
| 580 | Ga0495590_0002876 | 3300046457 | Bacteria | 7088 |
| 581 | Ga0495590_0005412 | 3300046457 | Bacteria | 5069 |
| 582 | Ga0495590_0084334 | 3300046457 | Bacteria | 1120 |
| 583 | Ga0495591_000463 | 3300046458 | Bacteria | 32629 |
| 584 | Ga0495591_004255 | 3300046458 | Bacteria | 7087 |
| 585 | Ga0495591_004969 | 3300046458 | Bacteria | 6294 |
| 586 | Ga0495591_009434 | 3300046458 | Bacteria | 3882 |
| 587 | Ga0495591_026079 | 3300046458 | Bacteria | 1823 |
| 588 | Ga0495591_031318 | 3300046458 | Bacteria | 1597 |
| 589 | Ga0495591_034228 | 3300046458 | Bacteria | 1497 |
| 590 | Ga0495591_037868 | 3300046458 | Bacteria | 1392 |
| 591 | Ga0495591_059346 | 3300046458 | Bacteria | 1020 |
| 592 | Ga0495638_0017183 | 3300046460 | Bacteria | 4830 |
| 593 | Ga0495638_0020816 | 3300046460 | Bacteria | 4332 |
| 594 | Ga0495638_0020892 | 3300046460 | Bacteria | 4322 |
| 595 | Ga0495638_0052858 | 3300046460 | Bacteria | 2529 |
| 596 | Ga0495638_0067462 | 3300046460 | Bacteria | 2196 |
| 597 | Ga0495638_0093596 | 3300046460 | Bacteria | 1807 |
| 598 | Ga0495638_0135217 | 3300046460 | Bacteria | 1444 |
| 599 | Ga0495638_0136514 | 3300046460 | Bacteria | 1435 |
| 600 | Ga0495653_0005988 | 3300046463 | Bacteria | 9953 |
| 601 | Ga0495650_0004305 | 3300046471 | Bacteria | 9819 |
| 602 | Ga0495650_0004442 | 3300046471 | Bacteria | 9600 |
| 603 | Ga0495650_0006511 | 3300046471 | Bacteria | 7257 |
| 604 | Ga0495650_0049781 | 3300046471 | Bacteria | 1737 |
| 605 | Ga0495605_0002791 | 3300046474 | Bacteria | 10633 |
| 606 | Ga0495605_0012263 | 3300046474 | Bacteria | 4758 |
| 607 | Ga0495605_0016231 | 3300046474 | Bacteria | 4033 |
| 608 | Ga0495605_0029228 | 3300046474 | Bacteria | 2839 |
| 609 | Ga0495605_0035624 | 3300046474 | Bacteria | 2514 |
| 610 | Ga0495605_0057448 | 3300046474 | Bacteria | 1872 |
| 611 | Ga0495639_0000444 | 3300046475 | Bacteria | 19714 |
| 612 | Ga0495664_0283043 | 3300046477 | Bacteria | 1002 |
| 613 | Ga0495584_0001930 | 3300046491 | Bacteria | 11930 |
| 614 | Ga0495584_0006526 | 3300046491 | Bacteria | 6097 |
| 615 | Ga0495584_0009316 | 3300046491 | Bacteria | 5058 |
| 616 | Ga0495584_0010251 | 3300046491 | Bacteria | 4814 |
| 617 | Ga0495584_0010587 | 3300046491 | Bacteria | 4737 |
| 618 | Ga0495584_0011913 | 3300046491 | Bacteria | 4445 |
| 619 | Ga0495584_0011929 | 3300046491 | Bacteria | 4442 |
| 620 | Ga0495585_0002921 | 3300046492 | Bacteria | 11833 |
| 621 | Ga0495585_0004927 | 3300046492 | Bacteria | 8540 |
| 622 | Ga0495585_0005380 | 3300046492 | Bacteria | 8077 |
| 623 | Ga0495585_0016691 | 3300046492 | Bacteria | 4253 |
| 624 | Ga0495585_0079802 | 3300046492 | Bacteria | 1774 |
| 625 | Ga0495585_0083975 | 3300046492 | Bacteria | 1723 |
| 626 | Ga0495585_0114606 | 3300046492 | Bacteria | 1430 |
| 627 | Ga0495596_0002695 | 3300046500 | Bacteria | 9364 |
| 628 | Ga0495607_0006796 | 3300046501 | Bacteria | 7990 |
| 629 | Ga0495607_0006981 | 3300046501 | Bacteria | 7863 |
| 630 | Ga0495607_0007583 | 3300046501 | Bacteria | 7488 |
| 631 | Ga0495607_0014785 | 3300046501 | Bacteria | 5074 |
| 632 | Ga0495607_0028506 | 3300046501 | Bacteria | 3445 |
| 633 | Ga0495607_0055584 | 3300046501 | Bacteria | 2276 |
| 634 | Ga0495607_0060380 | 3300046501 | Bacteria | 2158 |
| 635 | Ga0495607_0065116 | 3300046501 | Bacteria | 2056 |
| 636 | Ga0495607_0065776 | 3300046501 | Bacteria | 2042 |
| 637 | Ga0495607_0222531 | 3300046501 | Bacteria | 922 |
| 638 | Ga0495583_0002807 | 3300046506 | Bacteria | 14274 |
| 639 | Ga0495583_0005217 | 3300046506 | Bacteria | 8922 |
| 640 | Ga0495606_0000177 | 3300046507 | Bacteria | 112843 |
| 641 | Ga0495606_0009768 | 3300046507 | Bacteria | 8067 |
| 642 | Ga0495606_0021409 | 3300046507 | Bacteria | 4735 |
| 643 | Ga0495606_0025720 | 3300046507 | Bacteria | 4208 |
| 644 | Ga0495606_0026432 | 3300046507 | Bacteria | 4138 |
| 645 | Ga0495606_0037403 | 3300046507 | Bacteria | 3297 |
| 646 | Ga0495606_0038442 | 3300046507 | Bacteria | 3237 |
| 647 | Ga0495606_0068766 | 3300046507 | Bacteria | 2239 |
| 648 | Ga0495606_0111488 | 3300046507 | Bacteria | 1649 |
| 649 | Ga0495610_0003101 | 3300046512 | Bacteria | 13241 |
| 650 | Ga0495610_0007353 | 3300046512 | Bacteria | 7353 |
| 651 | Ga0495610_0007859 | 3300046512 | Bacteria | 7014 |
| 652 | Ga0495610_0015192 | 3300046512 | Bacteria | 4486 |
| 653 | Ga0495610_0018566 | 3300046512 | Bacteria | 3922 |
| 654 | Ga0495610_0047645 | 3300046512 | Bacteria | 2107 |
| 655 | Ga0495610_0086259 | 3300046512 | Bacteria | 1430 |
| 656 | Ga0495610_0188096 | 3300046512 | Bacteria | 854 |
| 657 | Ga0495616_0005418 | 3300046513 | Bacteria | 7861 |
| 658 | Ga0495616_0015338 | 3300046513 | Bacteria | 4260 |
| 659 | Ga0495616_0018417 | 3300046513 | Bacteria | 3833 |
| 660 | Ga0495616_0022030 | 3300046513 | Bacteria | 3444 |
| 661 | Ga0495616_0035602 | 3300046513 | Bacteria | 2574 |
| 662 | Ga0495616_0083868 | 3300046513 | Bacteria | 1519 |
| 663 | Ga0495620_0000039 | 3300046515 | Bacteria | 112877 |
| 664 | Ga0495620_0006831 | 3300046515 | Bacteria | 6235 |
| 665 | Ga0495620_0047560 | 3300046515 | Bacteria | 1845 |
| 666 | Ga0495630_0008413 | 3300046517 | Bacteria | 7398 |
| 667 | Ga0495631_0002026 | 3300046518 | Bacteria | 11793 |
| 668 | Ga0495631_0015598 | 3300046518 | Bacteria | 3636 |
| 669 | Ga0495631_0030329 | 3300046518 | Bacteria | 2454 |
| 670 | Ga0495632_0001966 | 3300046519 | Bacteria | 16344 |
| 671 | Ga0495632_0003351 | 3300046519 | Bacteria | 11416 |
| 672 | Ga0495632_0003817 | 3300046519 | Bacteria | 10487 |
| 673 | Ga0495632_0008689 | 3300046519 | Bacteria | 6199 |
| 674 | Ga0495632_0013762 | 3300046519 | Bacteria | 4603 |
| 675 | Ga0495632_0026572 | 3300046519 | Bacteria | 3045 |
| 676 | Ga0495632_0043247 | 3300046519 | Bacteria | 2252 |
| 677 | Ga0495632_0049112 | 3300046519 | Bacteria | 2087 |
| 678 | Ga0495632_0104722 | 3300046519 | Bacteria | 1331 |
| 679 | Ga0495637_0000393 | 3300046520 | Bacteria | 32465 |
| 680 | Ga0495637_0002680 | 3300046520 | Bacteria | 9721 |
| 681 | Ga0495637_0003136 | 3300046520 | Bacteria | 8823 |
| 682 | Ga0495637_0003862 | 3300046520 | Bacteria | 7862 |
| 683 | Ga0495637_0028791 | 3300046520 | Bacteria | 2477 |
| 684 | Ga0495637_0030539 | 3300046520 | Bacteria | 2390 |
| 685 | Ga0495637_0038598 | 3300046520 | Bacteria | 2066 |
| 686 | Ga0495637_0040801 | 3300046520 | Bacteria | 1995 |
| 687 | Ga0495637_0051080 | 3300046520 | Bacteria | 1732 |
| 688 | Ga0495637_0078430 | 3300046520 | Bacteria | 1320 |
| 689 | Ga0495637_0078500 | 3300046520 | Bacteria | 1319 |
| 690 | Ga0495637_0129801 | 3300046520 | Bacteria | 963 |
| 691 | Ga0495643_0001673 | 3300046522 | Bacteria | 19405 |
| 692 | Ga0495643_0009672 | 3300046522 | Bacteria | 5968 |
| 693 | Ga0495643_0012882 | 3300046522 | Bacteria | 5030 |
| 694 | Ga0495643_0171255 | 3300046522 | Bacteria | 1061 |
| 695 | Ga0495643_0177923 | 3300046522 | Bacteria | 1035 |
| 696 | Ga0495644_0000975 | 3300046523 | Bacteria | 11863 |
| 697 | Ga0495644_0005130 | 3300046523 | Bacteria | 5127 |
| 698 | Ga0495644_0049038 | 3300046523 | Bacteria | 1586 |
| 699 | Ga0495648_0000960 | 3300046524 | Bacteria | 29754 |
| 700 | Ga0495648_0011440 | 3300046524 | Bacteria | 6684 |
| 701 | Ga0495648_0019242 | 3300046524 | Bacteria | 4809 |
| 702 | Ga0495648_0044392 | 3300046524 | Bacteria | 2775 |
| 703 | Ga0495648_0064927 | 3300046524 | Bacteria | 2148 |
| 704 | Ga0495648_0065311 | 3300046524 | Bacteria | 2140 |
| 705 | Ga0495648_0131296 | 3300046524 | Bacteria | 1331 |
| 706 | Ga0495648_0146757 | 3300046524 | Bacteria | 1235 |
| 707 | Ga0495648_0158352 | 3300046524 | Bacteria | 1173 |
| 708 | Ga0495648_0208269 | 3300046524 | Bacteria | 973 |
| 709 | Ga0495666_0004351 | 3300046526 | Bacteria | 7147 |
| 710 | Ga0495642_0000237 | 3300046528 | Bacteria | 31221 |
| 711 | Ga0495642_0000270 | 3300046528 | Bacteria | 29305 |
| 712 | Ga0495642_0012208 | 3300046528 | Bacteria | 3310 |
| 713 | Ga0495654_0003373 | 3300046530 | Bacteria | 9838 |
| 714 | Ga0495654_0006226 | 3300046530 | Bacteria | 6800 |
| 715 | Ga0495654_0013941 | 3300046530 | Bacteria | 4288 |
| 716 | Ga0495654_0014836 | 3300046530 | Bacteria | 4141 |
| 717 | Ga0495654_0016049 | 3300046530 | Bacteria | 3967 |
| 718 | Ga0495654_0016726 | 3300046530 | Bacteria | 3867 |
| 719 | Ga0495654_0019909 | 3300046530 | Bacteria | 3503 |
| 720 | Ga0495654_0056165 | 3300046530 | Bacteria | 1904 |
| 721 | Ga0495654_0093612 | 3300046530 | Bacteria | 1391 |
| 722 | Ga0495654_0128740 | 3300046530 | Bacteria | 1138 |
| 723 | Ga0495609_0006042 | 3300046538 | Bacteria | 6240 |
| 724 | Ga0495609_0007083 | 3300046538 | Bacteria | 5643 |
| 725 | Ga0495609_0008362 | 3300046538 | Bacteria | 5071 |
| 726 | Ga0495609_0068506 | 3300046538 | Bacteria | 1561 |
| 727 | Ga0495609_0095384 | 3300046538 | Bacteria | 1291 |
| 728 | Ga0495597_0008969 | 3300046542 | Bacteria | 4983 |
| 729 | Ga0495597_0029685 | 3300046542 | Bacteria | 2496 |
| 730 | Ga0495597_0034222 | 3300046542 | Bacteria | 2296 |
| 731 | Ga0495597_0039639 | 3300046542 | Bacteria | 2109 |
| 732 | Ga0495597_0077882 | 3300046542 | Bacteria | 1420 |
| 733 | Ga0495622_0005331 | 3300046557 | Bacteria | 5969 |
| 734 | Ga0495622_0007157 | 3300046557 | Bacteria | 5184 |
| 735 | Ga0495622_0037419 | 3300046557 | Bacteria | 2260 |
| 736 | Ga0495633_0009466 | 3300046558 | Bacteria | 5376 |
| 737 | Ga0495633_0018776 | 3300046558 | Bacteria | 3506 |
| 738 | Ga0495633_0051670 | 3300046558 | Bacteria | 1936 |
| 739 | Ga0495633_0060047 | 3300046558 | Bacteria | 1782 |
| 740 | Ga0495668_0002528 | 3300046616 | Bacteria | 14911 |
| 741 | Ga0495668_0055166 | 3300046616 | Bacteria | 2194 |
| 742 | Ga0495611_0002529 | 3300046648 | Bacteria | 8315 |
| 743 | Ga0495625_0000501 | 3300046660 | Bacteria | 58243 |
| 744 | Ga0495625_0040982 | 3300046660 | Bacteria | 3372 |
| 745 | Ga0495625_0053539 | 3300046660 | Bacteria | 2885 |
| 746 | Ga0495625_0089581 | 3300046660 | Bacteria | 2129 |
| 747 | Ga0495625_0144246 | 3300046660 | Bacteria | 1604 |
| 748 | Ga0495625_0180050 | 3300046660 | Bacteria | 1406 |
| 749 | Ga0495659_0001738 | 3300046664 | Bacteria | 7248 |
| 750 | Ga0495661_0000061 | 3300046665 | Bacteria | 130811 |
| 751 | Ga0495661_0007575 | 3300046665 | Bacteria | 7564 |
| 752 | Ga0495661_0022508 | 3300046665 | Bacteria | 4100 |
| 753 | Ga0495661_0032339 | 3300046665 | Bacteria | 3307 |
| 754 | Ga0495661_0044113 | 3300046665 | Bacteria | 2736 |
| 755 | Ga0495661_0050582 | 3300046665 | Bacteria | 2515 |
| 756 | Ga0495661_0071447 | 3300046665 | Bacteria | 2028 |
| 757 | Ga0495588_0037096 | 3300046674 | Bacteria | 2475 |
| 758 | Ga0495588_0107113 | 3300046674 | Bacteria | 1471 |
| 759 | Ga0495623_0009150 | 3300046679 | Bacteria | 6426 |
| 760 | Ga0495669_0060742 | 3300046684 | Bacteria | 1709 |
| 761 | Ga0495613_0028910 | 3300046689 | Bacteria | 4123 |
| 762 | Ga0495670_0007368 | 3300046691 | Bacteria | 5407 |
| 763 | Ga0495670_0032832 | 3300046691 | Bacteria | 2581 |
| 764 | Ga0495670_0045971 | 3300046691 | Bacteria | 2180 |
| 765 | Ga0495670_0079658 | 3300046691 | Bacteria | 1667 |
| 766 | Ga0495671_0000805 | 3300046692 | Bacteria | 22397 |
| 767 | Ga0495671_0002987 | 3300046692 | Bacteria | 10508 |
| 768 | Ga0495671_0066941 | 3300046692 | Bacteria | 1767 |
| 769 | Ga0495671_0264954 | 3300046692 | Bacteria | 828 |
| 770 | Ga0495649_0000531 | 3300046694 | Bacteria | 32369 |
| 771 | Ga0495649_0001245 | 3300046694 | Bacteria | 19590 |
| 772 | Ga0495649_0003048 | 3300046694 | Bacteria | 11493 |
| 773 | Ga0495649_0003710 | 3300046694 | Bacteria | 10160 |
| 774 | Ga0495649_0012270 | 3300046694 | Bacteria | 4993 |
| 775 | Ga0495649_0018586 | 3300046694 | Bacteria | 3908 |
| 776 | Ga0495649_0051485 | 3300046694 | Bacteria | 2232 |
| 777 | Ga0495649_0078880 | 3300046694 | Bacteria | 1761 |
| 778 | Ga0495649_0088332 | 3300046694 | Bacteria | 1653 |
| 779 | Ga0495589_0002695 | 3300046794 | Bacteria | 9817 |
| 780 | Ga0495589_0012290 | 3300046794 | Bacteria | 4438 |
| 781 | Ga0495589_0015306 | 3300046794 | Bacteria | 3948 |
| 782 | Ga0495589_0037613 | 3300046794 | Bacteria | 2424 |
| 783 | Ga0495589_0046040 | 3300046794 | Bacteria | 2165 |
| 784 | Ga0495660_0029689 | 3300046810 | Bacteria | 3083 |
| 785 | Ga0495660_0037406 | 3300046810 | Bacteria | 2702 |
| 786 | Ga0495660_0070082 | 3300046810 | Bacteria | 1862 |
| 787 | Ga0495660_0085758 | 3300046810 | Bacteria | 1645 |
| 788 | Ga0495660_0113005 | 3300046810 | Bacteria | 1383 |
| 789 | Ga0495660_0190575 | 3300046810 | Bacteria | 985 |
| 790 | Ga0495581_0003592 | 3300047315 | Bacteria | 8918 |
| 791 | Ga0495581_0236406 | 3300047315 | Bacteria | 1069 |
| 792 | Ga0495636_0002667 | 3300047318 | Bacteria | 6887 |
| 793 | Ga0495636_0014338 | 3300047318 | Bacteria | 3150 |
| 794 | Ga0495636_0014946 | 3300047318 | Bacteria | 3090 |
| 795 | Ga0495672_0004415 | 3300047320 | Bacteria | 11531 |
| 796 | Ga0495672_0005033 | 3300047320 | Bacteria | 10571 |
| 797 | Ga0495672_0012539 | 3300047320 | Bacteria | 5910 |
| 798 | Ga0495672_0017611 | 3300047320 | Bacteria | 4775 |
| 799 | Ga0495672_0025576 | 3300047320 | Bacteria | 3774 |
| 800 | Ga0495672_0028180 | 3300047320 | Bacteria | 3557 |
| 801 | Ga0495672_0028941 | 3300047320 | Bacteria | 3496 |
| 802 | Ga0495672_0068702 | 3300047320 | Bacteria | 2013 |
| 803 | Ga0495672_0098395 | 3300047320 | Bacteria | 1591 |
| 804 | Ga0495672_0142219 | 3300047320 | Bacteria | 1252 |
| 805 | Ga0495672_0282460 | 3300047320 | Bacteria | 793 |
| 806 | Ga0495676_0008681 | 3300047321 | Bacteria | 9302 |
| 807 | Ga0495680_0018582 | 3300047322 | Bacteria | 5893 |
| 808 | Ga0495680_0075397 | 3300047322 | Bacteria | 2559 |
| 809 | Ga0495683_0000207 | 3300047323 | Bacteria | 55998 |
| 810 | Ga0495683_0002916 | 3300047323 | Bacteria | 10128 |
| 811 | Ga0495683_0003871 | 3300047323 | Bacteria | 8617 |
| 812 | Ga0495683_0038518 | 3300047323 | Bacteria | 2420 |
| 813 | Ga0495683_0042127 | 3300047323 | Bacteria | 2302 |
| 814 | Ga0495687_005908 | 3300047443 | Bacteria | 7654 |
| 815 | Ga0495687_012488 | 3300047443 | Bacteria | 4486 |
| 816 | Ga0495687_028666 | 3300047443 | Bacteria | 2586 |
| 817 | Ga0495675_0018497 | 3300047444 | Bacteria | 4422 |
| 818 | Ga0495677_0001738 | 3300047445 | Bacteria | 8726 |
| 819 | Ga0495679_005828 | 3300047446 | Bacteria | 5416 |
| 820 | Ga0495679_016669 | 3300047446 | Bacteria | 2652 |
| 821 | Ga0495673_0002875 | 3300047469 | Bacteria | 11711 |
| 822 | Ga0495673_0009659 | 3300047469 | Bacteria | 5318 |
| 823 | Ga0495673_0013229 | 3300047469 | Bacteria | 4343 |
| 824 | Ga0495673_0022816 | 3300047469 | Bacteria | 3059 |
| 825 | Ga0495673_0029293 | 3300047469 | Bacteria | 2599 |
| 826 | Ga0495673_0042856 | 3300047469 | Bacteria | 2028 |
| 827 | Ga0495673_0234113 | 3300047469 | Bacteria | 675 |
| 828 | Ga0495681_0001573 | 3300047470 | Bacteria | 16993 |
| 829 | Ga0495681_0004171 | 3300047470 | Bacteria | 9931 |
| 830 | Ga0495681_0005234 | 3300047470 | Bacteria | 8713 |
| 831 | Ga0495681_0006018 | 3300047470 | Bacteria | 8031 |
| 832 | Ga0495681_0007812 | 3300047470 | Bacteria | 6773 |
| 833 | Ga0495681_0034316 | 3300047470 | Bacteria | 2529 |
| 834 | Ga0495681_0041884 | 3300047470 | Bacteria | 2220 |
| 835 | Ga0495681_0050152 | 3300047470 | Bacteria | 1968 |
| 836 | Ga0495681_0066529 | 3300047470 | Bacteria | 1644 |
| 837 | Ga0495684_0006237 | 3300047471 | Bacteria | 9265 |
| 838 | Ga0495686_0000127 | 3300047472 | Bacteria | 156278 |
| 839 | Ga0495686_0008952 | 3300047472 | Bacteria | 7270 |
| 840 | Ga0495686_0022085 | 3300047472 | Bacteria | 4213 |
| 841 | Ga0495626_0000678 | 3300048091 | Bacteria | 32578 |
| 842 | Ga0495626_0003052 | 3300048091 | Bacteria | 10994 |
| 843 | Ga0495626_0003444 | 3300048091 | Bacteria | 10139 |
| 844 | Ga0495626_0003637 | 3300048091 | Bacteria | 9810 |
| 845 | Ga0495626_0014645 | 3300048091 | Bacteria | 4036 |
| 846 | Ga0495626_0018953 | 3300048091 | Bacteria | 3444 |
| 847 | Ga0495626_0036940 | 3300048091 | Bacteria | 2324 |
| 848 | Ga0496102_0168949 | 3300048905 | Bacteria | 2059 |
| 849 | Ga0496102_0260550 | 3300048905 | Bacteria | 1635 |
| 850 | Ga0496103_0044661 | 3300048906 | Bacteria | 2731 |
| 851 | Ga0496108_0239453 | 3300048911 | Bacteria | 1578 |
| 852 | Ga0496108_0639818 | 3300048911 | Bacteria | 925 |
| 853 | Ga0496109_0179782 | 3300048912 | Bacteria | 1986 |
| 854 | Ga0496110_0049069 | 3300048913 | Bacteria | 3702 |
| 855 | Ga0496110_0049528 | 3300048913 | Bacteria | 3685 |
| 856 | Ga0496110_0309836 | 3300048913 | Bacteria | 1438 |
| 857 | Ga0496110_0707054 | 3300048913 | Bacteria | 909 |
| 858 | Ga0496111_0032978 | 3300048914 | Bacteria | 3693 |
| 859 | Ga0496111_0213673 | 3300048914 | Bacteria | 1433 |
| 860 | Ga0496114_0007131 | 3300048917 | Bacteria | 8815 |
| 861 | Ga0496114_0391165 | 3300048917 | Bacteria | 1231 |
| 862 | Ga0496116_0000670 | 3300048919 | Bacteria | 44682 |
| 863 | Ga0496116_0029466 | 3300048919 | Bacteria | 3956 |
| 864 | Ga0496117_0002093 | 3300048920 | Bacteria | 26276 |
| 865 | Ga0496117_0002217 | 3300048920 | Bacteria | 25149 |
| 866 | Ga0496117_0003858 | 3300048920 | Bacteria | 17058 |
| 867 | Ga0496117_0006799 | 3300048920 | Bacteria | 11402 |
| 868 | Ga0496117_0013238 | 3300048920 | Bacteria | 7210 |
| 869 | Ga0496117_0043602 | 3300048920 | Bacteria | 3260 |
| 870 | Ga0496117_0155598 | 3300048920 | Bacteria | 1346 |
| 871 | Ga0496118_0001842 | 3300048921 | Bacteria | 30363 |
| 872 | Ga0496118_0037855 | 3300048921 | Bacteria | 3874 |
| 873 | Ga0496118_0041256 | 3300048921 | Bacteria | 3657 |
| 874 | Ga0496118_0054999 | 3300048921 | Bacteria | 3008 |
| 875 | Ga0496118_0074123 | 3300048921 | Bacteria | 2434 |
| 876 | Ga0496118_0145066 | 3300048921 | Bacteria | 1496 |
| 877 | Ga0496119_0000229 | 3300048922 | Bacteria | 78634 |
| 878 | Ga0496119_0059214 | 3300048922 | Bacteria | 2302 |
| 879 | Ga0496119_0223052 | 3300048922 | Bacteria | 963 |
| 880 | Ga0496120_0001476 | 3300048923 | Bacteria | 27987 |
| 881 | Ga0496121_0001246 | 3300048924 | Bacteria | 44184 |
| 882 | Ga0496121_0032444 | 3300048924 | Bacteria | 4746 |
| 883 | Ga0496121_0180633 | 3300048924 | Bacteria | 1523 |
| 884 | Ga0496121_0214588 | 3300048924 | Bacteria | 1360 |
| 885 | Ga0496122_0000590 | 3300048925 | Bacteria | 74565 |
| 886 | Ga0496122_0001846 | 3300048925 | Bacteria | 32295 |
| 887 | Ga0496122_0002049 | 3300048925 | Bacteria | 29920 |
| 888 | Ga0496122_0009159 | 3300048925 | Bacteria | 10484 |
| 889 | Ga0496122_0021605 | 3300048925 | Bacteria | 5754 |
| 890 | Ga0496122_0076098 | 3300048925 | Bacteria | 2363 |
| 891 | Ga0496123_0000088 | 3300048926 | Bacteria | 180478 |
| 892 | Ga0496123_0002062 | 3300048926 | Bacteria | 25924 |
| 893 | Ga0496123_0033910 | 3300048926 | Bacteria | 3666 |
| 894 | Ga0496123_0060313 | 3300048926 | Bacteria | 2447 |
| 895 | Ga0496123_0092130 | 3300048926 | Bacteria | 1795 |
| 896 | Ga0496124_0003431 | 3300048927 | Bacteria | 19406 |
| 897 | Ga0496124_0014858 | 3300048927 | Bacteria | 7501 |
| 898 | Ga0496124_0020430 | 3300048927 | Bacteria | 6118 |
| 899 | Ga0496124_0117519 | 3300048927 | Bacteria | 2130 |
| 900 | Ga0496124_0167101 | 3300048927 | Bacteria | 1708 |
| 901 | Ga0496124_0224873 | 3300048927 | Bacteria | 1408 |
| 902 | Ga0496124_0440525 | 3300048927 | Bacteria | 891 |
| 903 | Ga0496125_0001017 | 3300048928 | Bacteria | 43607 |
| 904 | Ga0496125_0006232 | 3300048928 | Bacteria | 12973 |
| 905 | Ga0496125_0012694 | 3300048928 | Bacteria | 8338 |
| 906 | Ga0496125_0014635 | 3300048928 | Bacteria | 7626 |
| 907 | Ga0496125_0029631 | 3300048928 | Bacteria | 4914 |
| 908 | Ga0496125_0041485 | 3300048928 | Bacteria | 3932 |
| 909 | Ga0496125_0074765 | 3300048928 | Bacteria | 2626 |
| 910 | Ga0496125_0264565 | 3300048928 | Bacteria | 1075 |
| 911 | Ga0496126_0167615 | 3300048929 | Bacteria | 1873 |
| 912 | Ga0496126_0346797 | 3300048929 | Bacteria | 1215 |
| 913 | Ga0495678_005047 | 3300049459 | Bacteria | 7423 |
| 914 | Ga0495678_011637 | 3300049459 | Bacteria | 4203 |
| 915 | Ga0495678_015508 | 3300049459 | Bacteria | 3502 |
| 916 | Ga0495678_017639 | 3300049459 | Bacteria | 3227 |
| 917 | Ga0495678_018354 | 3300049459 | Bacteria | 3147 |
| 918 | Ga0495678_028700 | 3300049459 | Bacteria | 2344 |
| 919 | Ga0495678_114535 | 3300049459 | Bacteria | 914 |
| 920 | Ga0495682_0000124 | 3300049460 | Bacteria | 67600 |
| 921 | Ga0495682_0003137 | 3300049460 | Bacteria | 7471 |
| 922 | Ga0501300_004266 | 3300049523 | Bacteria | 2121 |
| 923 | Ga0501303_000992 | 3300049526 | Bacteria | 2127 |
| 924 | Ga0501033_0091253 | 3300049570 | Bacteria | 2228 |
| 925 | Ga0501034_0000101 | 3300049571 | Bacteria | 158656 |
| 926 | Ga0501038_0466971 | 3300049574 | Bacteria | 969 |
| 927 | Ga0501046_0215662 | 3300049580 | Bacteria | 1423 |
| 928 | Ga0501070_0972403 | 3300049586 | Bacteria | 659 |
| 929 | Ga0501209_000112 | 3300049656 | Bacteria | 8525 |
| 930 | Ga0501222_004934 | 3300049662 | Bacteria | 1808 |
| 931 | Ga0501227_047146 | 3300049665 | Bacteria | 1079 |
| 932 | Ga0501251_000381 | 3300049681 | Bacteria | 3953 |
| 933 | Ga0501083_0076214 | 3300049744 | Bacteria | 2226 |
| 934 | Ga0501241_000003 | 3300049758 | Bacteria | 178857 |
| 935 | Ga0501241_009560 | 3300049758 | Bacteria | 1765 |
| 936 | Ga0501269_000126 | 3300049766 | Bacteria | 24145 |
| 937 | Ga0501280_000401 | 3300049776 | Bacteria | 10423 |
| 938 | Ga0501282_002303 | 3300049778 | Bacteria | 2095 |
| 939 | Ga0501035_0011403 | 3300049822 | Bacteria | 8240 |
| 940 | Ga0501044_0000396 | 3300049823 | Bacteria | 54058 |
| 941 | Ga0501044_0025147 | 3300049823 | Bacteria | 6313 |
| 942 | Ga0501044_0097323 | 3300049823 | Bacteria | 2964 |
| 943 | Ga0501226_002989 | 3300049853 | Bacteria | 2029 |
| 944 | nmdc:mga03683_69492_c1 | 3300050489 | Bacteria | 1503 |
| 945 | nmdc:mga03683_74871_c1 | 3300050489 | Bacteria | 1453 |
| 946 | nmdc:mga00v17_46197_c1 | 3300050491 | Bacteria | 2634 |
| 947 | nmdc:mga00v17_98480_c1 | 3300050491 | Bacteria | 1844 |
| 948 | nmdc:mga0k408_134424_c1 | 3300050493 | Bacteria | 1469 |
| 949 | nmdc:mga0k408_76008_c1 | 3300050493 | Bacteria | 1963 |
| 950 | nmdc:mga07m45_218950_c1 | 3300050496 | Bacteria | 1107 |
| 951 | nmdc:mga09592_392247_c1 | 3300050508 | Bacteria | 1200 |
| 952 | nmdc:mga0qj67_81770_c1 | 3300050509 | Bacteria | 2590 |
| 953 | nmdc:mga0rr50_1060650_c1 | 3300050513 | Bacteria | 690 |
| 954 | nmdc:mga08x19_200157_c1 | 3300050514 | Bacteria | 1369 |
| 955 | nmdc:mga08x19_48891_c1 | 3300050514 | Bacteria | 2711 |
| 956 | Ga0500618_002135 | 3300053125 | Bacteria | 7802 |
| 957 | Ga0500659_0002113 | 3300053135 | Bacteria | 12131 |
| 958 | Ga0500573_0133974 | 3300053140 | Bacteria | 1370 |
| 959 | Ga0500636_0004580 | 3300053177 | Bacteria | 7841 |
| 960 | Ga0590075_029884 | 3300059424 | Bacteria | 1379 |
| 961 | Ga0587084_003707 | 3300059477 | Bacteria | 1698 |
| 962 | Ga0587073_0005079 | 3300059492 | Bacteria | 1935 |
| 963 | Ga0587088_001545 | 3300059508 | Bacteria | 2412 |
| 964 | Ga0587091_004577 | 3300059511 | Bacteria | 1825 |
| 965 | Ga0587101_040959 | 3300059623 | Bacteria | 764 |
| 966 | Ga0587067_000901 | 3300059640 | Bacteria | 2962 |
| 967 | Ga0587068_004107 | 3300059641 | Bacteria | 1907 |
| 968 | Ga0587072_000193 | 3300059643 | Bacteria | 5362 |
| 969 | Ga0587105_006430 | 3300059651 | Bacteria | 807 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049586 | Ga0501070_0972403 | Ga0501070_0972403_25_579 | 174 |
| 2 | 3300004785 | Ga0058858_1283826 | Ga0058858_12838261 | 200 |
| 3 | 3300004798 | Ga0058859_11577485 | Ga0058859_115774851 | 200 |
| 4 | 3300005354 | Ga0070675_100808153 | Ga0070675_1008081531 | 200 |
| 5 | 3300014326 | Ga0157380_10035816 | Ga0157380_100358162 | 200 |
| 6 | 3300046520 | Ga0495637_0030539 | Ga0495637_0030539_203_808 | 200 |
| 7 | 3300021361 | Ga0213872_10010123 | Ga0213872_100101234 | 202 |
| 8 | 3300039447 | Ga0436361_0662862 | Ga0436361_0662862_9032_9670 | 202 |
| 9 | 3300005339 | Ga0070660_100388857 | Ga0070660_1003888571 | 203 |
| 10 | 3300005366 | Ga0070659_100001468 | Ga0070659_10000146823 | 203 |
| 11 | 3300015261 | Ga0182006_1059376 | Ga0182006_10593761 | 203 |
| 12 | 3300015262 | Ga0182007_10020719 | Ga0182007_100207192 | 203 |
| 13 | 3300025919 | Ga0207657_10350363 | Ga0207657_103503631 | 203 |
| 14 | 3300048927 | Ga0496124_0117519 | Ga0496124_0117519_1396_2013 | 205 |
| 15 | 3300021361 | Ga0213872_10000305 | Ga0213872_1000030529 | 206 |
| 16 | 3300039447 | Ga0436361_1088302 | Ga0436361_1088302_8944_9588 | 206 |
| 17 | 3300005336 | Ga0070680_100175563 | Ga0070680_1001755633 | 207 |
| 18 | 3300005530 | Ga0070679_100031842 | Ga0070679_1000318425 | 207 |
| 19 | 3300022467 | Ga0224712_10128930 | Ga0224712_101289302 | 207 |
| 20 | 3300025917 | Ga0207660_10176502 | Ga0207660_101765023 | 207 |
| 21 | 3300025921 | Ga0207652_10048901 | Ga0207652_100489013 | 207 |
| 22 | iso_pu_bacteria | 2511231000 | 2511232913 | 207 |
| 23 | iso_pu_bacteria | 2582581281 | 2585157611 | 207 |
| 24 | iso_pu_bacteria | 2582581282 | 2585162009 | 207 |
| 25 | iso_pu_bacteria | 2585428045 | 2587679339 | 207 |
| 26 | iso_pu_bacteria | 2585428115 | 2587945138 | 207 |
| 27 | iso_pu_bacteria | 2585428187 | 2588232752 | 207 |
| 28 | iso_pu_bacteria | 2588254255 | 2590601741 | 207 |
| 29 | iso_pu_bacteria | 2738541283 | 2738757183 | 207 |
| 30 | iso_pu_bacteria | 2775506739 | 2775671778 | 207 |
| 31 | iso_pu_bacteria | 2889290771 | 2889295075 | 207 |
| 32 | iso_pu_bacteria | 2916699645 | 2916701249 | 207 |
| 33 | iso_pu_bacteria | 2919097161 | 2919098783 | 207 |
| 34 | iso_pu_bacteria | 2984572630 | 2984573315 | 207 |
| 35 | iso_pu_bacteria | 2984606641 | 2984606750 | 207 |
| 36 | iso_pu_bacteria | 2993372514 | 2993376204 | 207 |
| 37 | iso_pu_bacteria | 2993480792 | 2993483018 | 207 |
| 38 | iso_pu_bacteria | 8001845381 | 8001850399 | 207 |
| 39 | 3300004800 | Ga0058861_11914072 | Ga0058861_119140721 | 208 |
| 40 | 3300032004 | Ga0307414_10003999 | Ga0307414_100039992 | 208 |
| 41 | 3300042004 | Ga0439445_0000755 | Ga0439445_0000755_4410_5036 | 208 |
| 42 | 3300042115 | Ga0450911_000118 | Ga0450911_000118_20042_20668 | 208 |
| 43 | 3300049744 | Ga0501083_0076214 | Ga0501083_0076214_1562_2188 | 208 |
| 44 | iso_pu_bacteria | 2501025501 | 2501074536 | 208 |
| 45 | iso_pu_bacteria | 2501025502 | 2501081780 | 208 |
| 46 | iso_pu_bacteria | 2501025504 | 2501408103 | 208 |
| 47 | iso_pu_bacteria | 2510917013 | 2511085715 | 208 |
| 48 | iso_pu_bacteria | 2510917014 | 2511095842 | 208 |
| 49 | iso_pu_bacteria | 2510917015 | 2511103405 | 208 |
| 50 | iso_pu_bacteria | 2511231004 | 2511254853 | 208 |
| 51 | iso_pu_bacteria | 2511231006 | 2511266839 | 208 |
| 52 | iso_pu_bacteria | 2511231007 | 2511273379 | 208 |
| 53 | iso_pu_bacteria | 2511231008 | 2511275091 | 208 |
| 54 | iso_pu_bacteria | 2511231010 | 2511288463 | 208 |
| 55 | iso_pu_bacteria | 2511231011 | 2511297751 | 208 |
| 56 | iso_pu_bacteria | 2511231012 | 2511302815 | 208 |
| 57 | iso_pu_bacteria | 2511231014 | 2511314409 | 208 |
| 58 | iso_pu_bacteria | 2511231015 | 2511317233 | 208 |
| 59 | iso_pu_bacteria | 2511231016 | 2511328008 | 208 |
| 60 | iso_pu_bacteria | 2511231017 | 2511329671 | 208 |
| 61 | iso_pu_bacteria | 2511231018 | 2511336832 | 208 |
| 62 | iso_pu_bacteria | 2511231019 | 2511344794 | 208 |
| 63 | iso_pu_bacteria | 2511231020 | 2511349559 | 208 |
| 64 | iso_pu_bacteria | 2511231021 | 2511359286 | 208 |
| 65 | iso_pu_bacteria | 2511231022 | 2511360896 | 208 |
| 66 | iso_pu_bacteria | 2511231023 | 2511370997 | 208 |
| 67 | iso_pu_bacteria | 2511231031 | 2511413465 | 208 |
| 68 | iso_pu_bacteria | 2512047018 | 2512326675 | 208 |
| 69 | iso_pu_bacteria | 2512047030 | 2512347575 | 208 |
| 70 | iso_pu_bacteria | 2513237082 | 2513556244 | 208 |
| 71 | iso_pu_bacteria | 2513237083 | 2513561403 | 208 |
| 72 | iso_pu_bacteria | 2513237150 | 2513955815 | 208 |
| 73 | iso_pu_bacteria | 2513237165 | 2514041219 | 208 |
| 74 | iso_pu_bacteria | 2515154122 | 2515679381 | 208 |
| 75 | iso_pu_bacteria | 2515154189 | 2516020806 | 208 |
| 76 | iso_pu_bacteria | 2551306352 | 2552747170 | 208 |
| 77 | iso_pu_bacteria | 2554235132 | 2554813850 | 208 |
| 78 | iso_pu_bacteria | 2554235231 | 2555245584 | 208 |
| 79 | iso_pu_bacteria | 2554235341 | 2555672837 | 208 |
| 80 | iso_pu_bacteria | 2582580891 | 2583795723 | 208 |
| 81 | iso_pu_bacteria | 2585428057 | 2587729069 | 208 |
| 82 | iso_pu_bacteria | 2585428058 | 2587733638 | 208 |
| 83 | iso_pu_bacteria | 2588253510 | 2588294030 | 208 |
| 84 | iso_pu_bacteria | 2596583598 | 2597029136 | 208 |
| 85 | iso_pu_bacteria | 2597489887 | 2597860882 | 208 |
| 86 | iso_pu_bacteria | 2597489888 | 2597866631 | 208 |
| 87 | iso_pu_bacteria | 2597489889 | 2597872487 | 208 |
| 88 | iso_pu_bacteria | 2599185160 | 2599355958 | 208 |
| 89 | iso_pu_bacteria | 2599185161 | 2599362640 | 208 |
| 90 | iso_pu_bacteria | 2599185162 | 2599369054 | 208 |
| 91 | iso_pu_bacteria | 2599185163 | 2599375749 | 208 |
| 92 | iso_pu_bacteria | 2599185164 | 2599381064 | 208 |
| 93 | iso_pu_bacteria | 2599185165 | 2599387420 | 208 |
| 94 | iso_pu_bacteria | 2599185166 | 2599394607 | 208 |
| 95 | iso_pu_bacteria | 2599185167 | 2599400539 | 208 |
| 96 | iso_pu_bacteria | 2599185168 | 2599406372 | 208 |
| 97 | iso_pu_bacteria | 2599185178 | 2599445754 | 208 |
| 98 | iso_pu_bacteria | 2599185179 | 2599449863 | 208 |
| 99 | iso_pu_bacteria | 2599185181 | 2599462792 | 208 |
| 100 | iso_pu_bacteria | 2599185182 | 2599467785 | 208 |
| 101 | iso_pu_bacteria | 2599185185 | 2599485883 | 208 |
| 102 | iso_pu_bacteria | 2599185186 | 2599491809 | 208 |
| 103 | iso_pu_bacteria | 2599185188 | 2599500262 | 208 |
| 104 | iso_pu_bacteria | 2599185189 | 2599505752 | 208 |
| 105 | iso_pu_bacteria | 2599185190 | 2599511937 | 208 |
| 106 | iso_pu_bacteria | 2599185191 | 2599516921 | 208 |
| 107 | iso_pu_bacteria | 2599185212 | 2599614431 | 208 |
| 108 | iso_pu_bacteria | 2599185248 | 2599768146 | 208 |
| 109 | iso_pu_bacteria | 2599185257 | 2599804665 | 208 |
| 110 | iso_pu_bacteria | 2599185288 | 2599879037 | 208 |
| 111 | iso_pu_bacteria | 2599185289 | 2599885581 | 208 |
| 112 | iso_pu_bacteria | 2599185290 | 2599892701 | 208 |
| 113 | iso_pu_bacteria | 2599185291 | 2599897295 | 208 |
| 114 | iso_pu_bacteria | 2599185300 | 2599930714 | 208 |
| 115 | iso_pu_bacteria | 2599185302 | 2599942348 | 208 |
| 116 | iso_pu_bacteria | 2599185303 | 2599951451 | 208 |
| 117 | iso_pu_bacteria | 2599185304 | 2599954239 | 208 |
| 118 | iso_pu_bacteria | 2599185305 | 2599961917 | 208 |
| 119 | iso_pu_bacteria | 2599185306 | 2599965939 | 208 |
| 120 | iso_pu_bacteria | 2599185308 | 2599980902 | 208 |
| 121 | iso_pu_bacteria | 2599185309 | 2599982918 | 208 |
| 122 | iso_pu_bacteria | 2599185310 | 2599988332 | 208 |
| 123 | iso_pu_bacteria | 2599185311 | 2599993992 | 208 |
| 124 | iso_pu_bacteria | 2599185312 | 2599999127 | 208 |
| 125 | iso_pu_bacteria | 2599185313 | 2600004309 | 208 |
| 126 | iso_pu_bacteria | 2599185314 | 2600014778 | 208 |
| 127 | iso_pu_bacteria | 2599185315 | 2600020402 | 208 |
| 128 | iso_pu_bacteria | 2599185316 | 2600026338 | 208 |
| 129 | iso_pu_bacteria | 2599185317 | 2600032085 | 208 |
| 130 | iso_pu_bacteria | 2599185318 | 2600035975 | 208 |
| 131 | iso_pu_bacteria | 2599185319 | 2600042339 | 208 |
| 132 | iso_pu_bacteria | 2599185320 | 2600046657 | 208 |
| 133 | iso_pu_bacteria | 2599185321 | 2600054920 | 208 |
| 134 | iso_pu_bacteria | 2599185322 | 2600061049 | 208 |
| 135 | iso_pu_bacteria | 2599185323 | 2600066367 | 208 |
| 136 | iso_pu_bacteria | 2599185324 | 2600071868 | 208 |
| 137 | iso_pu_bacteria | 2599185325 | 2600076536 | 208 |
| 138 | iso_pu_bacteria | 2599185356 | 2600215418 | 208 |
| 139 | iso_pu_bacteria | 2600254930 | 2600358988 | 208 |
| 140 | iso_pu_bacteria | 2600254931 | 2600363547 | 208 |
| 141 | iso_pu_bacteria | 2600254954 | 2600442701 | 208 |
| 142 | iso_pu_bacteria | 2600255067 | 2600810596 | 208 |
| 143 | iso_pu_bacteria | 2600255296 | 2601693445 | 208 |
| 144 | iso_pu_bacteria | 2600255313 | 2601775584 | 208 |
| 145 | iso_pu_bacteria | 2600255318 | 2601798559 | 208 |
| 146 | iso_pu_bacteria | 2603880185 | 2606077453 | 208 |
| 147 | iso_pu_bacteria | 2603880199 | 2606129301 | 208 |
| 148 | iso_pu_bacteria | 2606217733 | 2608380998 | 208 |
| 149 | iso_pu_bacteria | 2619619299 | 2621296846 | 208 |
| 150 | iso_pu_bacteria | 2623620443 | 2624483412 | 208 |
| 151 | iso_pu_bacteria | 2623620446 | 2624494933 | 208 |
| 152 | iso_pu_bacteria | 2643221565 | 2643842964 | 208 |
| 153 | iso_pu_bacteria | 2643221571 | 2643872264 | 208 |
| 154 | iso_pu_bacteria | 2643221589 | 2643955634 | 208 |
| 155 | iso_pu_bacteria | 2643221592 | 2643967133 | 208 |
| 156 | iso_pu_bacteria | 2643221602 | 2644020428 | 208 |
| 157 | iso_pu_bacteria | 2643221625 | 2644139963 | 208 |
| 158 | iso_pu_bacteria | 2643221633 | 2644184478 | 208 |
| 159 | iso_pu_bacteria | 2643221648 | 2644271203 | 208 |
| 160 | iso_pu_bacteria | 2643221650 | 2644283227 | 208 |
| 161 | iso_pu_bacteria | 2643221713 | 2644620168 | 208 |
| 162 | iso_pu_bacteria | 2651869719 | 2652545895 | 208 |
| 163 | iso_pu_bacteria | 2667528170 | 2671089555 | 208 |
| 164 | iso_pu_bacteria | 2667528171 | 2671099280 | 208 |
| 165 | iso_pu_bacteria | 2667528176 | 2671128583 | 208 |
| 166 | iso_pu_bacteria | 2671180172 | 2671771672 | 208 |
| 167 | iso_pu_bacteria | 2675903420 | 2677897131 | 208 |
| 168 | iso_pu_bacteria | 2675903507 | 2678232431 | 208 |
| 169 | iso_pu_bacteria | 2675903515 | 2678266149 | 208 |
| 170 | iso_pu_bacteria | 2713897148 | 2715749831 | 208 |
| 171 | iso_pu_bacteria | 2713897149 | 2715754847 | 208 |
| 172 | iso_pu_bacteria | 2718217725 | 2718636613 | 208 |
| 173 | iso_pu_bacteria | 2721755607 | 2723251366 | 208 |
| 174 | iso_pu_bacteria | 2721755763 | 2723879185 | 208 |
| 175 | iso_pu_bacteria | 2728369097 | 2729145215 | 208 |
| 176 | iso_pu_bacteria | 2738541265 | 2738671666 | 208 |
| 177 | iso_pu_bacteria | 2738541282 | 2738750060 | 208 |
| 178 | iso_pu_bacteria | 2738541294 | 2738807253 | 208 |
| 179 | iso_pu_bacteria | 2738541303 | 2738859100 | 208 |
| 180 | iso_pu_bacteria | 2738541309 | 2738894613 | 208 |
| 181 | iso_pu_bacteria | 2738543004 | 2739199059 | 208 |
| 182 | iso_pu_bacteria | 2738543015 | 2739259000 | 208 |
| 183 | iso_pu_bacteria | 2738543025 | 2739312505 | 208 |
| 184 | iso_pu_bacteria | 2740892503 | 2743740423 | 208 |
| 185 | iso_pu_bacteria | 2744054620 | 2745007381 | 208 |
| 186 | iso_pu_bacteria | 2751185846 | 2753568868 | 208 |
| 187 | iso_pu_bacteria | 2773857670 | 2774118377 | 208 |
| 188 | iso_pu_bacteria | 2773857673 | 2774135568 | 208 |
| 189 | iso_pu_bacteria | 2773857770 | 2774438933 | 208 |
| 190 | iso_pu_bacteria | 2784132063 | 2784261818 | 208 |
| 191 | iso_pu_bacteria | 2784132072 | 2784313575 | 208 |
| 192 | iso_pu_bacteria | 2791355520 | 2794593838 | 208 |
| 193 | iso_pu_bacteria | 2806310737 | 2807410793 | 208 |
| 194 | iso_pu_bacteria | 2806310745 | 2807459134 | 208 |
| 195 | iso_pu_bacteria | 2808606361 | 2808855693 | 208 |
| 196 | iso_pu_bacteria | 2808606376 | 2808926512 | 208 |
| 197 | iso_pu_bacteria | 2808606377 | 2808928442 | 208 |
| 198 | iso_pu_bacteria | 2808606378 | 2808935470 | 208 |
| 199 | iso_pu_bacteria | 2808606380 | 2808948673 | 208 |
| 200 | iso_pu_bacteria | 2808606381 | 2808950375 | 208 |
| 201 | iso_pu_bacteria | 2808606382 | 2808959843 | 208 |
| 202 | iso_pu_bacteria | 2808606383 | 2808964078 | 208 |
| 203 | iso_pu_bacteria | 2808606384 | 2808972238 | 208 |
| 204 | iso_pu_bacteria | 2808606385 | 2808976149 | 208 |
| 205 | iso_pu_bacteria | 2808606388 | 2808993249 | 208 |
| 206 | iso_pu_bacteria | 2808606389 | 2808999086 | 208 |
| 207 | iso_pu_bacteria | 2808606390 | 2809006844 | 208 |
| 208 | iso_pu_bacteria | 2808606391 | 2809013982 | 208 |
| 209 | iso_pu_bacteria | 2808606445 | 2809217186 | 208 |
| 210 | iso_pu_bacteria | 2811994881 | 2812369980 | 208 |
| 211 | iso_pu_bacteria | 2816332298 | 2817494041 | 208 |
| 212 | iso_pu_bacteria | 2818991436 | 2819543874 | 208 |
| 213 | iso_pu_bacteria | 2818991450 | 2819620916 | 208 |
| 214 | iso_pu_bacteria | 2818991456 | 2819655131 | 208 |
| 215 | iso_pu_bacteria | 2818991464 | 2819704402 | 208 |
| 216 | iso_pu_bacteria | 2825651385 | 2825655094 | 208 |
| 217 | iso_pu_bacteria | 2834028612 | 2834030950 | 208 |
| 218 | iso_pu_bacteria | 2834641062 | 2834641405 | 208 |
| 219 | iso_pu_bacteria | 2842324504 | 2842331292 | 208 |
| 220 | iso_pu_bacteria | 2842348783 | 2842355631 | 208 |
| 221 | iso_pu_bacteria | 2842454564 | 2842462065 | 208 |
| 222 | iso_pu_bacteria | 2842805378 | 2842807760 | 208 |
| 223 | iso_pu_bacteria | 2842826826 | 2842831285 | 208 |
| 224 | iso_pu_bacteria | 2842832357 | 2842833460 | 208 |
| 225 | iso_pu_bacteria | 2842837860 | 2842837899 | 208 |
| 226 | iso_pu_bacteria | 2842843487 | 2842845690 | 208 |
| 227 | iso_pu_bacteria | 2842854478 | 2842855622 | 208 |
| 228 | iso_pu_bacteria | 2844665904 | 2844667089 | 208 |
| 229 | iso_pu_bacteria | 2852612431 | 2852616351 | 208 |
| 230 | iso_pu_bacteria | 2852657418 | 2852659677 | 208 |
| 231 | iso_pu_bacteria | 2852667396 | 2852671319 | 208 |
| 232 | iso_pu_bacteria | 2860339153 | 2860341714 | 208 |
| 233 | iso_pu_bacteria | 2860867994 | 2860873028 | 208 |
| 234 | iso_pu_bacteria | 2878029506 | 2878035354 | 208 |
| 235 | iso_pu_bacteria | 2880230671 | 2880235995 | 208 |
| 236 | iso_pu_bacteria | 2883087390 | 2883095167 | 208 |
| 237 | iso_pu_bacteria | 2885266251 | 2885268084 | 208 |
| 238 | iso_pu_bacteria | 2885270888 | 2885277258 | 208 |
| 239 | iso_pu_bacteria | 2900577576 | 2900582067 | 208 |
| 240 | iso_pu_bacteria | 2902682994 | 2902683399 | 208 |
| 241 | iso_pu_bacteria | 2904483920 | 2904484007 | 208 |
| 242 | iso_pu_bacteria | 2904518522 | 2904518957 | 208 |
| 243 | iso_pu_bacteria | 2904550169 | 2904551328 | 208 |
| 244 | iso_pu_bacteria | 2908446538 | 2908452581 | 208 |
| 245 | iso_pu_bacteria | 2912963787 | 2912968858 | 208 |
| 246 | iso_pu_bacteria | 2913036834 | 2913042530 | 208 |
| 247 | iso_pu_bacteria | 2917070673 | 2917076734 | 208 |
| 248 | iso_pu_bacteria | 2919063839 | 2919065516 | 208 |
| 249 | iso_pu_bacteria | 2919155634 | 2919159589 | 208 |
| 250 | iso_pu_bacteria | 2919182534 | 2919185659 | 208 |
| 251 | iso_pu_bacteria | 2919385768 | 2919389189 | 208 |
| 252 | iso_pu_bacteria | 2919456309 | 2919457548 | 208 |
| 253 | iso_pu_bacteria | 2919481497 | 2919485659 | 208 |
| 254 | iso_pu_bacteria | 2919487758 | 2919488166 | 208 |
| 255 | iso_pu_bacteria | 2919501602 | 2919505870 | 208 |
| 256 | iso_pu_bacteria | 2919506607 | 2919507348 | 208 |
| 257 | iso_pu_bacteria | 2919527303 | 2919529955 | 208 |
| 258 | iso_pu_bacteria | 2919697872 | 2919700575 | 208 |
| 259 | iso_pu_bacteria | 2923153595 | 2923159516 | 208 |
| 260 | iso_pu_bacteria | 2923519811 | 2923524066 | 208 |
| 261 | iso_pu_bacteria | 2923586266 | 2923589000 | 208 |
| 262 | iso_pu_bacteria | 2926063275 | 2926067853 | 208 |
| 263 | iso_pu_bacteria | 2928058823 | 2928063501 | 208 |
| 264 | iso_pu_bacteria | 2928108538 | 2928109718 | 208 |
| 265 | iso_pu_bacteria | 2928135762 | 2928136828 | 208 |
| 266 | iso_pu_bacteria | 2928503688 | 2928506356 | 208 |
| 267 | iso_pu_bacteria | 2929144301 | 2929149921 | 208 |
| 268 | iso_pu_bacteria | 2929189879 | 2929195151 | 208 |
| 269 | iso_pu_bacteria | 2931369376 | 2931372639 | 208 |
| 270 | iso_pu_bacteria | 2931390751 | 2931396410 | 208 |
| 271 | iso_pu_bacteria | 2931396565 | 2931398079 | 208 |
| 272 | iso_pu_bacteria | 2935353572 | 2935358299 | 208 |
| 273 | iso_pu_bacteria | 2939636861 | 2939640805 | 208 |
| 274 | iso_pu_bacteria | 2939651529 | 2939654198 | 208 |
| 275 | iso_pu_bacteria | 2945928738 | 2945930909 | 208 |
| 276 | iso_pu_bacteria | 2945961074 | 2945966856 | 208 |
| 277 | iso_pu_bacteria | 2946006987 | 2946013285 | 208 |
| 278 | iso_pu_bacteria | 2946027586 | 2946027903 | 208 |
| 279 | iso_pu_bacteria | 2947233263 | 2947234423 | 208 |
| 280 | iso_pu_bacteria | 2969304461 | 2969310174 | 208 |
| 281 | iso_pu_bacteria | 2974289157 | 2974294078 | 208 |
| 282 | iso_pu_bacteria | 2984286254 | 2984286600 | 208 |
| 283 | iso_pu_bacteria | 2988728565 | 2988731464 | 208 |
| 284 | iso_pu_bacteria | 2998139840 | 2998145398 | 208 |
| 285 | iso_pu_bacteria | 3007395558 | 3007399398 | 208 |
| 286 | iso_pu_bacteria | 3007419365 | 3007419817 | 208 |
| 287 | iso_pu_bacteria | 3007614139 | 3007618533 | 208 |
| 288 | iso_pu_bacteria | 3007718800 | 3007721756 | 208 |
| 289 | iso_pu_bacteria | 3007803356 | 3007806009 | 208 |
| 290 | iso_pu_bacteria | 3007855910 | 3007859193 | 208 |
| 291 | iso_pu_bacteria | 3007866637 | 3007866778 | 208 |
| 292 | iso_pu_bacteria | 3007872151 | 3007873996 | 208 |
| 293 | iso_pu_bacteria | 637000220 | 637323274 | 208 |
| 294 | iso_pu_bacteria | 642555113 | 642620339 | 208 |
| 295 | iso_pu_bacteria | 644736347 | 644748624 | 208 |
| 296 | iso_pu_bacteria | 8003400568 | 8003403686 | 208 |
| 297 | iso_pu_bacteria | 8003955200 | 8003957546 | 208 |
| 298 | iso_pu_bacteria | 8015687852 | 8015693615 | 208 |
| 299 | iso_pu_bacteria | 8019769354 | 8019769768 | 208 |
| 300 | iso_pu_bacteria | 8019775933 | 8019777682 | 208 |
| 301 | iso_pu_bacteria | 8029995093 | 8029995504 | 208 |
| 302 | iso_pu_bacteria | 8033232454 | 8033233534 | 208 |
| 303 | iso_pu_bacteria | 8039098773 | 8039099254 | 208 |
| 304 | iso_pu_bacteria | 8052494512 | 8052499746 | 208 |
| 305 | iso_pu_bacteria | 8054285046 | 8054285727 | 208 |
| 306 | iso_pu_bacteria | 8054347763 | 8054349582 | 208 |
| 307 | iso_pu_bacteria | 8054503363 | 8054508934 | 208 |
| 308 | iso_pu_bacteria | 8054929484 | 8054934078 | 208 |
| 309 | iso_pu_bacteria | 8055266321 | 8055266663 | 208 |
| 310 | iso_pu_bacteria | 8055301274 | 8055305205 | 208 |
| 311 | iso_pu_bacteria | 8055817908 | 8055823903 | 208 |
| 312 | iso_pu_bacteria | 8055878733 | 8055881244 | 208 |
| 313 | iso_pu_bacteria | 8056115690 | 8056116520 | 208 |
| 314 | iso_pu_bacteria | 8056120720 | 8056125704 | 208 |
| 315 | iso_pu_bacteria | 8056125926 | 8056131605 | 208 |
| 316 | iso_pu_bacteria | 8056131705 | 8056137309 | 208 |
| 317 | iso_pu_bacteria | 8056137416 | 8056142774 | 208 |
| 318 | iso_pu_bacteria | 8056143049 | 8056148771 | 208 |
| 319 | iso_pu_bacteria | 8056148874 | 8056151494 | 208 |
| 320 | iso_pu_bacteria | 8056155041 | 8056160851 | 208 |
| 321 | iso_pu_bacteria | 8056161164 | 8056163632 | 208 |
| 322 | iso_pu_bacteria | 8056166840 | 8056171307 | 208 |
| 323 | iso_pu_bacteria | 8056172158 | 8056177408 | 208 |
| 324 | iso_pu_bacteria | 8056177738 | 8056182000 | 208 |
| 325 | iso_pu_bacteria | 8056569372 | 8056570465 | 208 |
| 326 | 3300005548 | Ga0070665_100000991 | Ga0070665_10000099123 | 209 |
| 327 | 3300007076 | Ga0075435_100174648 | Ga0075435_1001746481 | 209 |
| 328 | 3300014969 | Ga0157376_10194707 | Ga0157376_101947072 | 209 |
| 329 | 3300028379 | Ga0268266_10002872 | Ga0268266_100028728 | 209 |
| 330 | 3300031235 | Ga0265330_10114871 | Ga0265330_101148712 | 209 |
| 331 | 3300031241 | Ga0265325_10012992 | Ga0265325_100129923 | 209 |
| 332 | 3300042461 | Ga0439460_0155461 | Ga0439460_0155461_10_669 | 209 |
| 333 | 3300046689 | Ga0495613_0028910 | Ga0495613_0028910_1323_1982 | 209 |
| 334 | 3300047315 | Ga0495581_0236406 | Ga0495581_0236406_53_712 | 209 |
| 335 | 3300048905 | Ga0496102_0168949 | Ga0496102_0168949_1265_1960 | 209 |
| 336 | 3300049570 | Ga0501033_0091253 | Ga0501033_0091253_767_1426 | 209 |
| 337 | 3300049823 | Ga0501044_0025147 | Ga0501044_0025147_560_1219 | 209 |
| 338 | 3300050509 | nmdc:mga0qj67_81770_c1 | nmdc:mga0qj67_81770_c1_1078_1737 | 209 |
| 339 | 3300050513 | nmdc:mga0rr50_1060650_c1 | nmdc:mga0rr50_1060650_c1_20_676 | 209 |
| 340 | iso_pu_bacteria | 2547132374 | 2548498785 | 209 |
| 341 | iso_pu_bacteria | 2585428062 | 2587759088 | 209 |
| 342 | iso_pu_bacteria | 2599185292 | 2599903396 | 209 |
| 343 | iso_pu_bacteria | 2643221609 | 2644061796 | 209 |
| 344 | iso_pu_bacteria | 2643221611 | 2644073616 | 209 |
| 345 | iso_pu_bacteria | 2643221621 | 2644122310 | 209 |
| 346 | iso_pu_bacteria | 2643221683 | 2644468160 | 209 |
| 347 | iso_pu_bacteria | 2643221717 | 2644647773 | 209 |
| 348 | iso_pu_bacteria | 2738541277 | 2738717724 | 209 |
| 349 | iso_pu_bacteria | 2738541307 | 2738879335 | 209 |
| 350 | iso_pu_bacteria | 2738543012 | 2739242940 | 209 |
| 351 | iso_pu_bacteria | 2738543019 | 2739278410 | 209 |
| 352 | iso_pu_bacteria | 2816332133 | 2816475903 | 209 |
| 353 | iso_pu_bacteria | 2842733646 | 2842735036 | 209 |
| 354 | iso_pu_bacteria | 2855730933 | 2855736493 | 209 |
| 355 | iso_pu_bacteria | 2855767633 | 2855773430 | 209 |
| 356 | iso_pu_bacteria | 2857537821 | 2857542613 | 209 |
| 357 | iso_pu_bacteria | 2857542790 | 2857546701 | 209 |
| 358 | iso_pu_bacteria | 2858950400 | 2858955539 | 209 |
| 359 | iso_pu_bacteria | 2881412998 | 2881418614 | 209 |
| 360 | iso_pu_bacteria | 2881927736 | 2881930836 | 209 |
| 361 | iso_pu_bacteria | 2895511927 | 2895514832 | 209 |
| 362 | iso_pu_bacteria | 2904449895 | 2904455769 | 209 |
| 363 | iso_pu_bacteria | 2904456579 | 2904457800 | 209 |
| 364 | iso_pu_bacteria | 2928084124 | 2928084328 | 209 |
| 365 | iso_pu_bacteria | 2928115317 | 2928119921 | 209 |
| 366 | iso_pu_bacteria | 2941479691 | 2941482161 | 209 |
| 367 | iso_pu_bacteria | 2945909444 | 2945911596 | 209 |
| 368 | iso_pu_bacteria | 2945972063 | 2945977440 | 209 |
| 369 | iso_pu_bacteria | 2945984333 | 2945986063 | 209 |
| 370 | 3300005439 | Ga0070711_100003206 | Ga0070711_1000032067 | 210 |
| 371 | 3300005518 | Ga0070699_100101826 | Ga0070699_1001018263 | 210 |
| 372 | 3300005530 | Ga0070679_100019496 | Ga0070679_1000194963 | 210 |
| 373 | 3300005981 | Ga0081538_10002039 | Ga0081538_1000203912 | 210 |
| 374 | 3300006038 | Ga0075365_10207462 | Ga0075365_102074621 | 210 |
| 375 | 3300006042 | Ga0075368_10142611 | Ga0075368_101426111 | 210 |
| 376 | 3300025916 | Ga0207663_10057951 | Ga0207663_100579512 | 210 |
| 377 | 3300032005 | Ga0307411_10110186 | Ga0307411_101101862 | 210 |
| 378 | 3300032126 | Ga0307415_100117470 | Ga0307415_1001174701 | 210 |
| 379 | 3300039437 | Ga0436365_1128753 | Ga0436365_1128753_668_1300 | 210 |
| 380 | 3300046477 | Ga0495664_0283043 | Ga0495664_0283043_22_657 | 210 |
| 381 | 3300049574 | Ga0501038_0466971 | Ga0501038_0466971_293_925 | 210 |
| 382 | 3300049580 | Ga0501046_0215662 | Ga0501046_0215662_537_1169 | 210 |
| 383 | 3300049823 | Ga0501044_0097323 | Ga0501044_0097323_1966_2598 | 210 |
| 384 | 3300053177 | Ga0500636_0004580 | Ga0500636_0004580_4649_5281 | 210 |
| 385 | 3300059424 | Ga0590075_029884 | Ga0590075_029884_496_1128 | 210 |
| 386 | iso_pu_bacteria | 2857576091 | 2857579944 | 210 |
| 387 | 2162886007 | SwRhRL2b_contig_1872146 | SwRhRL2b_0454.00000680 | 211 |
| 388 | 3300005437 | Ga0070710_10468505 | Ga0070710_104685051 | 211 |
| 389 | 3300005841 | Ga0068863_100079116 | Ga0068863_1000791161 | 211 |
| 390 | 3300005841 | Ga0068863_100476334 | Ga0068863_1004763342 | 211 |
| 391 | 3300005843 | Ga0068860_100029014 | Ga0068860_1000290146 | 211 |
| 392 | 3300009094 | Ga0111539_10695785 | Ga0111539_106957852 | 211 |
| 393 | 3300009101 | Ga0105247_10686781 | Ga0105247_106867811 | 211 |
| 394 | 3300009545 | Ga0105237_10426342 | Ga0105237_104263422 | 211 |
| 395 | 3300010375 | Ga0105239_10422536 | Ga0105239_104225362 | 211 |
| 396 | 3300013100 | Ga0157373_10126273 | Ga0157373_101262732 | 211 |
| 397 | 3300014325 | Ga0163163_10166706 | Ga0163163_101667063 | 211 |
| 398 | 3300017792 | Ga0163161_10004577 | Ga0163161_1000457710 | 211 |
| 399 | 3300020069 | Ga0197907_10062933 | Ga0197907_100629331 | 211 |
| 400 | 3300025728 | Ga0207655_1000018 | Ga0207655_1000018115 | 211 |
| 401 | 3300025921 | Ga0207652_10174749 | Ga0207652_101747492 | 211 |
| 402 | 3300025924 | Ga0207694_10182929 | Ga0207694_101829293 | 211 |
| 403 | 3300025935 | Ga0207709_10001011 | Ga0207709_1000101113 | 211 |
| 404 | 3300025939 | Ga0207665_10131458 | Ga0207665_101314583 | 211 |
| 405 | 3300025944 | Ga0207661_10001162 | Ga0207661_100011626 | 211 |
| 406 | 3300025972 | Ga0207668_10161126 | Ga0207668_101611262 | 211 |
| 407 | 3300026088 | Ga0207641_10064155 | Ga0207641_100641554 | 211 |
| 408 | 3300028381 | Ga0268264_10020980 | Ga0268264_100209806 | 211 |
| 409 | 3300028381 | Ga0268264_10043130 | Ga0268264_100431303 | 211 |
| 410 | 3300030731 | Ga0316177_1204046 | Ga0316177_12040461 | 211 |
| 411 | 3300031911 | Ga0307412_10000155 | Ga0307412_1000015511 | 211 |
| 412 | 3300031911 | Ga0307412_10001478 | Ga0307412_1000147812 | 211 |
| 413 | 3300032004 | Ga0307414_10000041 | Ga0307414_1000004199 | 211 |
| 414 | 3300041413 | Ga0439465_0000298 | Ga0439465_0000298_11557_12192 | 211 |
| 415 | 3300042006 | Ga0439432_015972 | Ga0439432_015972_28_663 | 211 |
| 416 | 3300046519 | Ga0495632_0013762 | Ga0495632_0013762_1161_1796 | 211 |
| 417 | 3300046530 | Ga0495654_0006226 | Ga0495654_0006226_4467_5102 | 211 |
| 418 | 3300046558 | Ga0495633_0018776 | Ga0495633_0018776_2754_3389 | 211 |
| 419 | 3300046660 | Ga0495625_0000501 | Ga0495625_0000501_5713_6348 | 211 |
| 420 | 3300047472 | Ga0495686_0000127 | Ga0495686_0000127_14625_15260 | 211 |
| 421 | 3300047472 | Ga0495686_0022085 | Ga0495686_0022085_84_719 | 211 |
| 422 | 3300048905 | Ga0496102_0260550 | Ga0496102_0260550_317_952 | 211 |
| 423 | 3300048906 | Ga0496103_0044661 | Ga0496103_0044661_329_964 | 211 |
| 424 | 3300048911 | Ga0496108_0239453 | Ga0496108_0239453_813_1448 | 211 |
| 425 | 3300048911 | Ga0496108_0639818 | Ga0496108_0639818_18_653 | 211 |
| 426 | 3300048912 | Ga0496109_0179782 | Ga0496109_0179782_1230_1865 | 211 |
| 427 | 3300048913 | Ga0496110_0049069 | Ga0496110_0049069_79_714 | 211 |
| 428 | 3300048914 | Ga0496111_0032978 | Ga0496111_0032978_1813_2448 | 211 |
| 429 | 3300048917 | Ga0496114_0391165 | Ga0496114_0391165_487_1122 | 211 |
| 430 | 3300048925 | Ga0496122_0001846 | Ga0496122_0001846_26351_26986 | 211 |
| 431 | 3300048925 | Ga0496122_0002049 | Ga0496122_0002049_27928_28563 | 211 |
| 432 | 3300048925 | Ga0496122_0021605 | Ga0496122_0021605_2504_3139 | 211 |
| 433 | 3300048926 | Ga0496123_0002062 | Ga0496123_0002062_1228_1863 | 211 |
| 434 | 3300048926 | Ga0496123_0060313 | Ga0496123_0060313_1298_1933 | 211 |
| 435 | 3300048928 | Ga0496125_0006232 | Ga0496125_0006232_1383_2018 | 211 |
| 436 | 3300048928 | Ga0496125_0264565 | Ga0496125_0264565_183_818 | 211 |
| 437 | 3300049523 | Ga0501300_004266 | Ga0501300_004266_1155_1790 | 211 |
| 438 | 3300049526 | Ga0501303_000992 | Ga0501303_000992_1182_1817 | 211 |
| 439 | 3300049681 | Ga0501251_000381 | Ga0501251_000381_2523_3158 | 211 |
| 440 | 3300049758 | Ga0501241_000003 | Ga0501241_000003_20735_21370 | 211 |
| 441 | 3300049766 | Ga0501269_000126 | Ga0501269_000126_16390_17025 | 211 |
| 442 | 3300049776 | Ga0501280_000401 | Ga0501280_000401_1323_1958 | 211 |
| 443 | 3300049778 | Ga0501282_002303 | Ga0501282_002303_898_1533 | 211 |
| 444 | 3300050493 | nmdc:mga0k408_76008_c1 | nmdc:mga0k408_76008_c1_994_1629 | 211 |
| 445 | 3300050508 | nmdc:mga09592_392247_c1 | nmdc:mga09592_392247_c1_168_803 | 211 |
| 446 | 3300053140 | Ga0500573_0133974 | Ga0500573_0133974_694_1329 | 211 |
| 447 | iso_pu_bacteria | 2751185877 | 2753673307 | 211 |
| 448 | 2124908027 | MRS2a_Contig_6468 | MRS2a_00353290 | 212 |
| 449 | 2162886007 | SwRhRL2b_contig_137706 | SwRhRL2b_0777.00000320 | 212 |
| 450 | 3300001915 | JGI24741J21665_1004476 | JGI24741J21665_10044762 | 212 |
| 451 | 3300001915 | JGI24741J21665_1008997 | JGI24741J21665_10089972 | 212 |
| 452 | 3300001979 | JGI24740J21852_10000054 | JGI24740J21852_1000005415 | 212 |
| 453 | 3300001990 | JGI24737J22298_10117372 | JGI24737J22298_101173721 | 212 |
| 454 | 3300002705 | JGI25156J39149_1012551 | JGI25156J39149_10125512 | 212 |
| 455 | 3300002737 | JGI25162J39368_1000154 | JGI25162J39368_100015456 | 212 |
| 456 | 3300002737 | JGI25162J39368_1000319 | JGI25162J39368_100031910 | 212 |
| 457 | 3300002737 | JGI25162J39368_1000474 | JGI25162J39368_10004749 | 212 |
| 458 | 3300002738 | JGI25154J39366_1012343 | JGI25154J39366_10123431 | 212 |
| 459 | 3300002771 | JGI25163J39215_1000691 | JGI25163J39215_100069110 | 212 |
| 460 | 3300002771 | JGI25163J39215_1004782 | JGI25163J39215_10047821 | 212 |
| 461 | 3300002772 | JGI25164J39214_1000236 | JGI25164J39214_100023610 | 212 |
| 462 | 3300002772 | JGI25164J39214_1000674 | JGI25164J39214_10006749 | 212 |
| 463 | 3300002772 | JGI25164J39214_1006548 | JGI25164J39214_10065481 | 212 |
| 464 | 3300003214 | JGI25165J46597_1000239 | JGI25165J46597_100023932 | 212 |
| 465 | 3300003214 | JGI25165J46597_1000434 | JGI25165J46597_100043410 | 212 |
| 466 | 3300003214 | JGI25165J46597_1000600 | JGI25165J46597_10006009 | 212 |
| 467 | 3300003322 | rootL2_10028101 | rootL2_100281011 | 212 |
| 468 | 3300003751 | Ga0055538_1000032 | Ga0055538_1000032136 | 212 |
| 469 | 3300003751 | Ga0055538_1000094 | Ga0055538_100009432 | 212 |
| 470 | 3300003752 | Ga0055539_1000038 | Ga0055539_100003867 | 212 |
| 471 | 3300003752 | Ga0055539_1000043 | Ga0055539_1000043136 | 212 |
| 472 | 3300003752 | Ga0055539_1000136 | Ga0055539_100013632 | 212 |
| 473 | 3300003756 | Ga0055533_1000052 | Ga0055533_1000052136 | 212 |
| 474 | 3300003756 | Ga0055533_1000143 | Ga0055533_100014356 | 212 |
| 475 | 3300003758 | Ga0055532_1000002 | Ga0055532_1000002487 | 212 |
| 476 | 3300003758 | Ga0055532_1000047 | Ga0055532_1000047116 | 212 |
| 477 | 3300003759 | Ga0055525_1000062 | Ga0055525_1000062136 | 212 |
| 478 | 3300003759 | Ga0055525_1000188 | Ga0055525_100018856 | 212 |
| 479 | 3300003759 | Ga0055525_1000304 | Ga0055525_100030441 | 212 |
| 480 | 3300003760 | Ga0055527_1001999 | Ga0055527_10019992 | 212 |
| 481 | 3300003761 | Ga0055535_1000096 | Ga0055535_100009645 | 212 |
| 482 | 3300003761 | Ga0055535_1004523 | Ga0055535_10045232 | 212 |
| 483 | 3300003763 | Ga0055529_1000091 | Ga0055529_100009145 | 212 |
| 484 | 3300003763 | Ga0055529_1000113 | Ga0055529_100011357 | 212 |
| 485 | 3300003775 | Ga0055524_1020020 | Ga0055524_10200201 | 212 |
| 486 | 3300003775 | Ga0055524_1034939 | Ga0055524_10349392 | 212 |
| 487 | 3300003781 | Ga0055536_1001726 | Ga0055536_10017269 | 212 |
| 488 | 3300003781 | Ga0055536_1049437 | Ga0055536_10494371 | 212 |
| 489 | 3300003791 | Ga0055530_10000658 | Ga0055530_1000065822 | 212 |
| 490 | 3300003791 | Ga0055530_10002203 | Ga0055530_100022036 | 212 |
| 491 | 3300003791 | Ga0055530_10002392 | Ga0055530_100023924 | 212 |
| 492 | 3300003791 | Ga0055530_10007867 | Ga0055530_100078674 | 212 |
| 493 | 3300003792 | Ga0055540_1000506 | Ga0055540_100050622 | 212 |
| 494 | 3300003792 | Ga0055540_1001654 | Ga0055540_10016544 | 212 |
| 495 | 3300003841 | Ga0055541_1000030 | Ga0055541_1000030136 | 212 |
| 496 | 3300003841 | Ga0055541_1000092 | Ga0055541_100009256 | 212 |
| 497 | 3300003841 | Ga0055541_1003579 | Ga0055541_10035792 | 212 |
| 498 | 3300003856 | Ga0058692_1011559 | Ga0058692_10115592 | 212 |
| 499 | 3300005272 | Ga0065703_1000504 | Ga0065703_10005042 | 212 |
| 500 | 3300005288 | Ga0065714_10003312 | Ga0065714_1000331210 | 212 |
| 501 | 3300005288 | Ga0065714_10004172 | Ga0065714_100041729 | 212 |
| 502 | 3300005288 | Ga0065714_10011359 | Ga0065714_100113591 | 212 |
| 503 | 3300005288 | Ga0065714_10066507 | Ga0065714_100665076 | 212 |
| 504 | 3300005288 | Ga0065714_10088098 | Ga0065714_100880981 | 212 |
| 505 | 3300005288 | Ga0065714_10098238 | Ga0065714_100982381 | 212 |
| 506 | 3300005288 | Ga0065714_10115878 | Ga0065714_101158781 | 212 |
| 507 | 3300005288 | Ga0065714_10177037 | Ga0065714_101770371 | 212 |
| 508 | 3300005288 | Ga0065714_10264676 | Ga0065714_102646761 | 212 |
| 509 | 3300005289 | Ga0065704_10071355 | Ga0065704_100713559 | 212 |
| 510 | 3300005289 | Ga0065704_10127589 | Ga0065704_101275892 | 212 |
| 511 | 3300005289 | Ga0065704_10348031 | Ga0065704_103480311 | 212 |
| 512 | 3300005290 | Ga0065712_10016049 | Ga0065712_100160491 | 212 |
| 513 | 3300005290 | Ga0065712_10071153 | Ga0065712_100711533 | 212 |
| 514 | 3300005293 | Ga0065715_10061165 | Ga0065715_100611651 | 212 |
| 515 | 3300005293 | Ga0065715_10223276 | Ga0065715_102232761 | 212 |
| 516 | 3300005327 | Ga0070658_10011063 | Ga0070658_100110637 | 212 |
| 517 | 3300005327 | Ga0070658_10068187 | Ga0070658_100681873 | 212 |
| 518 | 3300005331 | Ga0070670_100002144 | Ga0070670_10000214410 | 212 |
| 519 | 3300005331 | Ga0070670_100096891 | Ga0070670_1000968913 | 212 |
| 520 | 3300005344 | Ga0070661_100000126 | Ga0070661_1000001268 | 212 |
| 521 | 3300005344 | Ga0070661_100001535 | Ga0070661_1000015354 | 212 |
| 522 | 3300005347 | Ga0070668_100317372 | Ga0070668_1003173722 | 212 |
| 523 | 3300005353 | Ga0070669_100000187 | Ga0070669_10000018714 | 212 |
| 524 | 3300005353 | Ga0070669_100000481 | Ga0070669_1000004819 | 212 |
| 525 | 3300005353 | Ga0070669_100312294 | Ga0070669_1003122941 | 212 |
| 526 | 3300005356 | Ga0070674_100406308 | Ga0070674_1004063081 | 212 |
| 527 | 3300005366 | Ga0070659_100111253 | Ga0070659_1001112532 | 212 |
| 528 | 3300005455 | Ga0070663_100000012 | Ga0070663_10000001242 | 212 |
| 529 | 3300005457 | Ga0070662_100000101 | Ga0070662_10000010140 | 212 |
| 530 | 3300005468 | Ga0070707_100137876 | Ga0070707_1001378763 | 212 |
| 531 | 3300005539 | Ga0068853_100000187 | Ga0068853_10000018710 | 212 |
| 532 | 3300005539 | Ga0068853_100155478 | Ga0068853_1001554782 | 212 |
| 533 | 3300005548 | Ga0070665_100905468 | Ga0070665_1009054681 | 212 |
| 534 | 3300005564 | Ga0070664_100000045 | Ga0070664_10000004516 | 212 |
| 535 | 3300005564 | Ga0070664_100000491 | Ga0070664_10000049124 | 212 |
| 536 | 3300005564 | Ga0070664_100036041 | Ga0070664_1000360412 | 212 |
| 537 | 3300005577 | Ga0068857_100038455 | Ga0068857_1000384556 | 212 |
| 538 | 3300005578 | Ga0068854_100000127 | Ga0068854_10000012744 | 212 |
| 539 | 3300005578 | Ga0068854_100005297 | Ga0068854_1000052977 | 212 |
| 540 | 3300005614 | Ga0068856_100000035 | Ga0068856_10000003567 | 212 |
| 541 | 3300005834 | Ga0068851_10000007 | Ga0068851_1000000738 | 212 |
| 542 | 3300006038 | Ga0075365_10384063 | Ga0075365_103840632 | 212 |
| 543 | 3300006038 | Ga0075365_10426461 | Ga0075365_104264612 | 212 |
| 544 | 3300006042 | Ga0075368_10195228 | Ga0075368_101952281 | 212 |
| 545 | 3300006048 | Ga0075363_100153465 | Ga0075363_1001534652 | 212 |
| 546 | 3300006051 | Ga0075364_10021870 | Ga0075364_100218703 | 212 |
| 547 | 3300006051 | Ga0075364_10077774 | Ga0075364_100777741 | 212 |
| 548 | 3300006051 | Ga0075364_10118442 | Ga0075364_101184422 | 212 |
| 549 | 3300006051 | Ga0075364_10232689 | Ga0075364_102326892 | 212 |
| 550 | 3300006058 | Ga0075432_10008747 | Ga0075432_100087473 | 212 |
| 551 | 3300006058 | Ga0075432_10035996 | Ga0075432_100359961 | 212 |
| 552 | 3300006058 | Ga0075432_10090677 | Ga0075432_100906771 | 212 |
| 553 | 3300006058 | Ga0075432_10101492 | Ga0075432_101014921 | 212 |
| 554 | 3300006177 | Ga0075362_10017681 | Ga0075362_100176814 | 212 |
| 555 | 3300006177 | Ga0075362_10083436 | Ga0075362_100834362 | 212 |
| 556 | 3300006177 | Ga0075362_10204581 | Ga0075362_102045811 | 212 |
| 557 | 3300006177 | Ga0075362_10215922 | Ga0075362_102159222 | 212 |
| 558 | 3300006178 | Ga0075367_10034341 | Ga0075367_100343412 | 212 |
| 559 | 3300006178 | Ga0075367_10432556 | Ga0075367_104325561 | 212 |
| 560 | 3300006195 | Ga0075366_10063498 | Ga0075366_100634983 | 212 |
| 561 | 3300006195 | Ga0075366_10214640 | Ga0075366_102146401 | 212 |
| 562 | 3300006914 | Ga0075436_100056271 | Ga0075436_1000562711 | 212 |
| 563 | 3300006914 | Ga0075436_100212610 | Ga0075436_1002126101 | 212 |
| 564 | 3300006914 | Ga0075436_100215555 | Ga0075436_1002155551 | 212 |
| 565 | 3300006914 | Ga0075436_100279006 | Ga0075436_1002790062 | 212 |
| 566 | 3300006914 | Ga0075436_100337469 | Ga0075436_1003374692 | 212 |
| 567 | 3300006944 | Ga0099823_1000086 | Ga0099823_100008623 | 212 |
| 568 | 3300006944 | Ga0099823_1036036 | Ga0099823_10360362 | 212 |
| 569 | 3300006946 | Ga0079104_1000424 | Ga0079104_100042437 | 212 |
| 570 | 3300006946 | Ga0079104_1000718 | Ga0079104_100071820 | 212 |
| 571 | 3300006946 | Ga0079104_1009624 | Ga0079104_10096243 | 212 |
| 572 | 3300006948 | Ga0099826_10016562 | Ga0099826_100165624 | 212 |
| 573 | 3300009011 | Ga0105251_10000274 | Ga0105251_1000027416 | 212 |
| 574 | 3300009011 | Ga0105251_10000828 | Ga0105251_100008287 | 212 |
| 575 | 3300009011 | Ga0105251_10001027 | Ga0105251_1000102715 | 212 |
| 576 | 3300009011 | Ga0105251_10003921 | Ga0105251_100039213 | 212 |
| 577 | 3300009011 | Ga0105251_10012768 | Ga0105251_100127681 | 212 |
| 578 | 3300009011 | Ga0105251_10030044 | Ga0105251_100300442 | 212 |
| 579 | 3300009011 | Ga0105251_10147962 | Ga0105251_101479621 | 212 |
| 580 | 3300009036 | Ga0105244_10002564 | Ga0105244_1000256410 | 212 |
| 581 | 3300009036 | Ga0105244_10004785 | Ga0105244_100047852 | 212 |
| 582 | 3300009036 | Ga0105244_10006019 | Ga0105244_100060193 | 212 |
| 583 | 3300009036 | Ga0105244_10028370 | Ga0105244_100283702 | 212 |
| 584 | 3300009036 | Ga0105244_10068499 | Ga0105244_100684992 | 212 |
| 585 | 3300009036 | Ga0105244_10184439 | Ga0105244_101844391 | 212 |
| 586 | 3300009092 | Ga0105250_10000191 | Ga0105250_1000019118 | 212 |
| 587 | 3300009092 | Ga0105250_10013949 | Ga0105250_100139494 | 212 |
| 588 | 3300009092 | Ga0105250_10035745 | Ga0105250_100357451 | 212 |
| 589 | 3300009092 | Ga0105250_10201902 | Ga0105250_102019021 | 212 |
| 590 | 3300009093 | Ga0105240_10252669 | Ga0105240_102526692 | 212 |
| 591 | 3300009093 | Ga0105240_10365136 | Ga0105240_103651362 | 212 |
| 592 | 3300009148 | Ga0105243_10000418 | Ga0105243_1000041810 | 212 |
| 593 | 3300009148 | Ga0105243_10002911 | Ga0105243_1000291110 | 212 |
| 594 | 3300009148 | Ga0105243_10003724 | Ga0105243_100037248 | 212 |
| 595 | 3300009148 | Ga0105243_10005562 | Ga0105243_100055622 | 212 |
| 596 | 3300009148 | Ga0105243_10011149 | Ga0105243_100111492 | 212 |
| 597 | 3300009148 | Ga0105243_10030328 | Ga0105243_100303284 | 212 |
| 598 | 3300009176 | Ga0105242_10001499 | Ga0105242_1000149917 | 212 |
| 599 | 3300009545 | Ga0105237_10001509 | Ga0105237_1000150923 | 212 |
| 600 | 3300009553 | Ga0105249_10006152 | Ga0105249_100061523 | 212 |
| 601 | 3300009553 | Ga0105249_10483838 | Ga0105249_104838381 | 212 |
| 602 | 3300011119 | Ga0105246_10021610 | Ga0105246_100216101 | 212 |
| 603 | 3300013100 | Ga0157373_10004396 | Ga0157373_1000439612 | 212 |
| 604 | 3300013100 | Ga0157373_10006454 | Ga0157373_100064542 | 212 |
| 605 | 3300013100 | Ga0157373_10042510 | Ga0157373_100425102 | 212 |
| 606 | 3300013100 | Ga0157373_10080342 | Ga0157373_100803421 | 212 |
| 607 | 3300013102 | Ga0157371_10000609 | Ga0157371_1000060931 | 212 |
| 608 | 3300013102 | Ga0157371_10003267 | Ga0157371_100032679 | 212 |
| 609 | 3300013102 | Ga0157371_10010705 | Ga0157371_100107053 | 212 |
| 610 | 3300013104 | Ga0157370_10000025 | Ga0157370_10000025126 | 212 |
| 611 | 3300013104 | Ga0157370_10026152 | Ga0157370_100261523 | 212 |
| 612 | 3300013104 | Ga0157370_10068885 | Ga0157370_100688852 | 212 |
| 613 | 3300013104 | Ga0157370_10101418 | Ga0157370_101014182 | 212 |
| 614 | 3300013104 | Ga0157370_10134402 | Ga0157370_101344021 | 212 |
| 615 | 3300013104 | Ga0157370_10160617 | Ga0157370_101606172 | 212 |
| 616 | 3300013104 | Ga0157370_10225054 | Ga0157370_102250542 | 212 |
| 617 | 3300013104 | Ga0157370_10636936 | Ga0157370_106369361 | 212 |
| 618 | 3300013105 | Ga0157369_10002004 | Ga0157369_1000200415 | 212 |
| 619 | 3300013105 | Ga0157369_10020339 | Ga0157369_100203399 | 212 |
| 620 | 3300013105 | Ga0157369_10087691 | Ga0157369_100876913 | 212 |
| 621 | 3300013105 | Ga0157369_10506551 | Ga0157369_105065512 | 212 |
| 622 | 3300013306 | Ga0163162_10704382 | Ga0163162_107043821 | 212 |
| 623 | 3300013307 | Ga0157372_10000227 | Ga0157372_1000022738 | 212 |
| 624 | 3300013307 | Ga0157372_10181212 | Ga0157372_101812122 | 212 |
| 625 | 3300013307 | Ga0157372_10321758 | Ga0157372_103217581 | 212 |
| 626 | 3300013308 | Ga0157375_10079061 | Ga0157375_100790612 | 212 |
| 627 | 3300013308 | Ga0157375_10080456 | Ga0157375_100804562 | 212 |
| 628 | 3300014497 | Ga0182008_10000293 | Ga0182008_1000029333 | 212 |
| 629 | 3300014497 | Ga0182008_10032172 | Ga0182008_100321721 | 212 |
| 630 | 3300014497 | Ga0182008_10036046 | Ga0182008_100360462 | 212 |
| 631 | 3300014497 | Ga0182008_10051729 | Ga0182008_100517291 | 212 |
| 632 | 3300014497 | Ga0182008_10081816 | Ga0182008_100818162 | 212 |
| 633 | 3300015261 | Ga0182006_1001907 | Ga0182006_10019075 | 212 |
| 634 | 3300015261 | Ga0182006_1002075 | Ga0182006_10020755 | 212 |
| 635 | 3300015261 | Ga0182006_1011903 | Ga0182006_10119033 | 212 |
| 636 | 3300015261 | Ga0182006_1017384 | Ga0182006_10173843 | 212 |
| 637 | 3300015261 | Ga0182006_1023480 | Ga0182006_10234802 | 212 |
| 638 | 3300015261 | Ga0182006_1036303 | Ga0182006_10363031 | 212 |
| 639 | 3300015261 | Ga0182006_1097929 | Ga0182006_10979291 | 212 |
| 640 | 3300015262 | Ga0182007_10000284 | Ga0182007_100002849 | 212 |
| 641 | 3300015262 | Ga0182007_10012189 | Ga0182007_100121891 | 212 |
| 642 | 3300015262 | Ga0182007_10029870 | Ga0182007_100298701 | 212 |
| 643 | 3300015265 | Ga0182005_1001150 | Ga0182005_10011506 | 212 |
| 644 | 3300017792 | Ga0163161_10005887 | Ga0163161_100058875 | 212 |
| 645 | 3300017792 | Ga0163161_10022215 | Ga0163161_100222154 | 212 |
| 646 | 3300017792 | Ga0163161_10151888 | Ga0163161_101518881 | 212 |
| 647 | 3300020069 | Ga0197907_10109288 | Ga0197907_101092882 | 212 |
| 648 | 3300020070 | Ga0206356_10469082 | Ga0206356_104690825 | 212 |
| 649 | 3300020075 | Ga0206349_1210075 | Ga0206349_12100755 | 212 |
| 650 | 3300020076 | Ga0206355_1608568 | Ga0206355_16085681 | 212 |
| 651 | 3300020077 | Ga0206351_10301792 | Ga0206351_1030179210 | 212 |
| 652 | 3300020080 | Ga0206350_10572994 | Ga0206350_105729941 | 212 |
| 653 | 3300020080 | Ga0206350_11061825 | Ga0206350_110618251 | 212 |
| 654 | 3300020610 | Ga0154015_1353180 | Ga0154015_13531806 | 212 |
| 655 | 3300022467 | Ga0224712_10006729 | Ga0224712_100067293 | 212 |
| 656 | 3300025206 | Ga0209435_100821 | Ga0209435_1008213 | 212 |
| 657 | 3300025207 | Ga0209760_100027 | Ga0209760_100027108 | 212 |
| 658 | 3300025207 | Ga0209760_100149 | Ga0209760_10014932 | 212 |
| 659 | 3300025207 | Ga0209760_100681 | Ga0209760_1006812 | 212 |
| 660 | 3300025224 | Ga0209784_100003 | Ga0209784_100003227 | 212 |
| 661 | 3300025224 | Ga0209784_100007 | Ga0209784_100007380 | 212 |
| 662 | 3300025224 | Ga0209784_100010 | Ga0209784_100010327 | 212 |
| 663 | 3300025224 | Ga0209784_100441 | Ga0209784_10044116 | 212 |
| 664 | 3300025225 | Ga0209566_100002 | Ga0209566_1000021270 | 212 |
| 665 | 3300025225 | Ga0209566_100008 | Ga0209566_100008327 | 212 |
| 666 | 3300025225 | Ga0209566_100009 | Ga0209566_100009380 | 212 |
| 667 | 3300025226 | Ga0209674_100008 | Ga0209674_100008919 | 212 |
| 668 | 3300025226 | Ga0209674_100019 | Ga0209674_100019327 | 212 |
| 669 | 3300025226 | Ga0209674_100021 | Ga0209674_100021380 | 212 |
| 670 | 3300025228 | Ga0209672_100235 | Ga0209672_10023530 | 212 |
| 671 | 3300025229 | Ga0209147_100002 | Ga0209147_1000022016 | 212 |
| 672 | 3300025229 | Ga0209147_100009 | Ga0209147_100009380 | 212 |
| 673 | 3300025230 | Ga0209563_100004 | Ga0209563_100004683 | 212 |
| 674 | 3300025230 | Ga0209563_100018 | Ga0209563_100018380 | 212 |
| 675 | 3300025230 | Ga0209563_100021 | Ga0209563_100021327 | 212 |
| 676 | 3300025230 | Ga0209563_100026 | Ga0209563_10002666 | 212 |
| 677 | 3300025231 | Ga0207427_100005 | Ga0207427_100005332 | 212 |
| 678 | 3300025231 | Ga0207427_100006 | Ga0207427_100006440 | 212 |
| 679 | 3300025231 | Ga0207427_100342 | Ga0207427_10034222 | 212 |
| 680 | 3300025233 | Ga0209437_100013 | Ga0209437_100013440 | 212 |
| 681 | 3300025233 | Ga0209437_100018 | Ga0209437_100018242 | 212 |
| 682 | 3300025233 | Ga0209437_100019 | Ga0209437_100019327 | 212 |
| 683 | 3300025233 | Ga0209437_104041 | Ga0209437_1040412 | 212 |
| 684 | 3300025242 | Ga0209258_100002 | Ga0209258_1000022016 | 212 |
| 685 | 3300025242 | Ga0209258_100169 | Ga0209258_100169103 | 212 |
| 686 | 3300025242 | Ga0209258_100177 | Ga0209258_10017787 | 212 |
| 687 | 3300025246 | Ga0209646_1000184 | Ga0209646_100018419 | 212 |
| 688 | 3300025250 | Ga0209026_1012445 | Ga0209026_10124452 | 212 |
| 689 | 3300025253 | Ga0209677_100011 | Ga0209677_100011327 | 212 |
| 690 | 3300025253 | Ga0209677_100012 | Ga0209677_100012380 | 212 |
| 691 | 3300025253 | Ga0209677_100013 | Ga0209677_100013306 | 212 |
| 692 | 3300025254 | Ga0209148_1002932 | Ga0209148_10029325 | 212 |
| 693 | 3300025254 | Ga0209148_1003831 | Ga0209148_10038315 | 212 |
| 694 | 3300025256 | Ga0209759_1000399 | Ga0209759_100039945 | 212 |
| 695 | 3300025256 | Ga0209759_1004392 | Ga0209759_10043923 | 212 |
| 696 | 3300025256 | Ga0209759_1005052 | Ga0209759_10050524 | 212 |
| 697 | 3300025256 | Ga0209759_1005073 | Ga0209759_10050732 | 212 |
| 698 | 3300025256 | Ga0209759_1016653 | Ga0209759_10166532 | 212 |
| 699 | 3300025261 | Ga0209233_1000021 | Ga0209233_1000021332 | 212 |
| 700 | 3300025261 | Ga0209233_1000022 | Ga0209233_1000022440 | 212 |
| 701 | 3300025261 | Ga0209233_1000025 | Ga0209233_1000025327 | 212 |
| 702 | 3300025263 | Ga0209565_1009039 | Ga0209565_10090395 | 212 |
| 703 | 3300025263 | Ga0209565_1025325 | Ga0209565_10253251 | 212 |
| 704 | 3300025272 | Ga0209455_1000021 | Ga0209455_1000021603 | 212 |
| 705 | 3300025272 | Ga0209455_1000108 | Ga0209455_100010845 | 212 |
| 706 | 3300025291 | Ga0209675_1003233 | Ga0209675_10032331 | 212 |
| 707 | 3300025292 | Ga0209676_1000030 | Ga0209676_1000030269 | 212 |
| 708 | 3300025292 | Ga0209676_1000041 | Ga0209676_1000041172 | 212 |
| 709 | 3300025292 | Ga0209676_1000510 | Ga0209676_100051011 | 212 |
| 710 | 3300025292 | Ga0209676_1002546 | Ga0209676_10025465 | 212 |
| 711 | 3300025292 | Ga0209676_1003117 | Ga0209676_10031174 | 212 |
| 712 | 3300025294 | Ga0209025_1000040 | Ga0209025_1000040139 | 212 |
| 713 | 3300025294 | Ga0209025_1000524 | Ga0209025_100052415 | 212 |
| 714 | 3300025298 | Ga0209050_1000024 | Ga0209050_1000024171 | 212 |
| 715 | 3300025298 | Ga0209050_1000518 | Ga0209050_100051835 | 212 |
| 716 | 3300025298 | Ga0209050_1000647 | Ga0209050_100064726 | 212 |
| 717 | 3300025299 | Ga0209256_1000149 | Ga0209256_100014954 | 212 |
| 718 | 3300025303 | Ga0209051_1000023 | Ga0209051_100002387 | 212 |
| 719 | 3300025303 | Ga0209051_1000721 | Ga0209051_10007219 | 212 |
| 720 | 3300025303 | Ga0209051_1005515 | Ga0209051_10055154 | 212 |
| 721 | 3300025303 | Ga0209051_1009026 | Ga0209051_10090261 | 212 |
| 722 | 3300025321 | Ga0207656_10000006 | Ga0207656_1000000664 | 212 |
| 723 | 3300025711 | Ga0207696_1000078 | Ga0207696_1000078185 | 212 |
| 724 | 3300025711 | Ga0207696_1000145 | Ga0207696_100014573 | 212 |
| 725 | 3300025711 | Ga0207696_1008153 | Ga0207696_10081532 | 212 |
| 726 | 3300025711 | Ga0207696_1021631 | Ga0207696_10216312 | 212 |
| 727 | 3300025711 | Ga0207696_1046209 | Ga0207696_10462092 | 212 |
| 728 | 3300025711 | Ga0207696_1068504 | Ga0207696_10685041 | 212 |
| 729 | 3300025728 | Ga0207655_1000014 | Ga0207655_1000014433 | 212 |
| 730 | 3300025728 | Ga0207655_1000202 | Ga0207655_100020241 | 212 |
| 731 | 3300025728 | Ga0207655_1000309 | Ga0207655_100030968 | 212 |
| 732 | 3300025728 | Ga0207655_1000388 | Ga0207655_100038841 | 212 |
| 733 | 3300025728 | Ga0207655_1001315 | Ga0207655_10013157 | 212 |
| 734 | 3300025728 | Ga0207655_1007901 | Ga0207655_10079011 | 212 |
| 735 | 3300025728 | Ga0207655_1015714 | Ga0207655_10157142 | 212 |
| 736 | 3300025728 | Ga0207655_1024451 | Ga0207655_10244511 | 212 |
| 737 | 3300025728 | Ga0207655_1028654 | Ga0207655_10286542 | 212 |
| 738 | 3300025728 | Ga0207655_1035454 | Ga0207655_10354542 | 212 |
| 739 | 3300025728 | Ga0207655_1054242 | Ga0207655_10542422 | 212 |
| 740 | 3300025735 | Ga0207713_1000010 | Ga0207713_1000010319 | 212 |
| 741 | 3300025735 | Ga0207713_1000815 | Ga0207713_10008159 | 212 |
| 742 | 3300025735 | Ga0207713_1001109 | Ga0207713_10011098 | 212 |
| 743 | 3300025735 | Ga0207713_1001785 | Ga0207713_10017856 | 212 |
| 744 | 3300025735 | Ga0207713_1003196 | Ga0207713_100319610 | 212 |
| 745 | 3300025735 | Ga0207713_1003415 | Ga0207713_10034153 | 212 |
| 746 | 3300025735 | Ga0207713_1004607 | Ga0207713_10046077 | 212 |
| 747 | 3300025735 | Ga0207713_1006691 | Ga0207713_10066919 | 212 |
| 748 | 3300025735 | Ga0207713_1018033 | Ga0207713_10180332 | 212 |
| 749 | 3300025909 | Ga0207705_10301653 | Ga0207705_103016532 | 212 |
| 750 | 3300025911 | Ga0207654_10102260 | Ga0207654_101022602 | 212 |
| 751 | 3300025913 | Ga0207695_10001515 | Ga0207695_100015153 | 212 |
| 752 | 3300025913 | Ga0207695_10306689 | Ga0207695_103066892 | 212 |
| 753 | 3300025913 | Ga0207695_10524193 | Ga0207695_105241932 | 212 |
| 754 | 3300025914 | Ga0207671_10000131 | Ga0207671_1000013141 | 212 |
| 755 | 3300025920 | Ga0207649_10000012 | Ga0207649_10000012106 | 212 |
| 756 | 3300025920 | Ga0207649_10000370 | Ga0207649_1000037023 | 212 |
| 757 | 3300025923 | Ga0207681_10000099 | Ga0207681_1000009936 | 212 |
| 758 | 3300025923 | Ga0207681_10000699 | Ga0207681_1000069915 | 212 |
| 759 | 3300025923 | Ga0207681_10223433 | Ga0207681_102234332 | 212 |
| 760 | 3300025925 | Ga0207650_10000518 | Ga0207650_100005189 | 212 |
| 761 | 3300025925 | Ga0207650_10000571 | Ga0207650_1000057122 | 212 |
| 762 | 3300025931 | Ga0207644_10272424 | Ga0207644_102724242 | 212 |
| 763 | 3300025933 | Ga0207706_10000580 | Ga0207706_1000058033 | 212 |
| 764 | 3300025934 | Ga0207686_10000319 | Ga0207686_1000031929 | 212 |
| 765 | 3300025935 | Ga0207709_10000068 | Ga0207709_1000006876 | 212 |
| 766 | 3300025935 | Ga0207709_10000071 | Ga0207709_1000007122 | 212 |
| 767 | 3300025935 | Ga0207709_10000337 | Ga0207709_1000033730 | 212 |
| 768 | 3300025935 | Ga0207709_10003583 | Ga0207709_100035836 | 212 |
| 769 | 3300025935 | Ga0207709_10017354 | Ga0207709_100173545 | 212 |
| 770 | 3300025935 | Ga0207709_10021142 | Ga0207709_100211422 | 212 |
| 771 | 3300025935 | Ga0207709_10032812 | Ga0207709_100328122 | 212 |
| 772 | 3300025941 | Ga0207711_10063414 | Ga0207711_100634143 | 212 |
| 773 | 3300025945 | Ga0207679_10000001 | Ga0207679_10000001610 | 212 |
| 774 | 3300025945 | Ga0207679_10000015 | Ga0207679_10000015106 | 212 |
| 775 | 3300025961 | Ga0207712_10014475 | Ga0207712_100144754 | 212 |
| 776 | 3300025972 | Ga0207668_10363741 | Ga0207668_103637411 | 212 |
| 777 | 3300025981 | Ga0207640_10000119 | Ga0207640_1000011949 | 212 |
| 778 | 3300025981 | Ga0207640_10046142 | Ga0207640_100461422 | 212 |
| 779 | 3300026041 | Ga0207639_10000775 | Ga0207639_100007756 | 212 |
| 780 | 3300026067 | Ga0207678_10000004 | Ga0207678_1000000485 | 212 |
| 781 | 3300026078 | Ga0207702_10000029 | Ga0207702_10000029108 | 212 |
| 782 | 3300026116 | Ga0207674_10012679 | Ga0207674_100126793 | 212 |
| 783 | 3300027111 | Ga0209281_1000016 | Ga0209281_1000016313 | 212 |
| 784 | 3300027111 | Ga0209281_1000019 | Ga0209281_1000019220 | 212 |
| 785 | 3300027111 | Ga0209281_1004114 | Ga0209281_10041141 | 212 |
| 786 | 3300027111 | Ga0209281_1005332 | Ga0209281_10053322 | 212 |
| 787 | 3300027296 | Ga0209389_1000049 | Ga0209389_100004946 | 212 |
| 788 | 3300027296 | Ga0209389_1064164 | Ga0209389_10641643 | 212 |
| 789 | 3300027312 | Ga0209371_1000106 | Ga0209371_100010665 | 212 |
| 790 | 3300027907 | Ga0207428_10066564 | Ga0207428_100665641 | 212 |
| 791 | 3300027907 | Ga0207428_10101827 | Ga0207428_101018273 | 212 |
| 792 | 3300027907 | Ga0207428_10157003 | Ga0207428_101570031 | 212 |
| 793 | 3300027907 | Ga0207428_10391467 | Ga0207428_103914671 | 212 |
| 794 | 3300027907 | Ga0207428_10582031 | Ga0207428_105820311 | 212 |
| 795 | 3300027907 | Ga0207428_10589663 | Ga0207428_105896631 | 212 |
| 796 | 3300027907 | Ga0207428_10670186 | Ga0207428_106701861 | 212 |
| 797 | 3300028563 | Ga0265319_1000174 | Ga0265319_100017424 | 212 |
| 798 | 3300028573 | Ga0265334_10033035 | Ga0265334_100330353 | 212 |
| 799 | 3300028786 | Ga0307517_10238794 | Ga0307517_102387941 | 212 |
| 800 | 3300028794 | Ga0307515_10000577 | Ga0307515_100005773 | 212 |
| 801 | 3300028800 | Ga0265338_10005327 | Ga0265338_1000532717 | 212 |
| 802 | 3300030500 | Ga0268256_1000077 | Ga0268256_100007765 | 212 |
| 803 | 3300030521 | Ga0307511_10068564 | Ga0307511_100685643 | 212 |
| 804 | 3300030731 | Ga0316177_1038918 | Ga0316177_10389184 | 212 |
| 805 | 3300030733 | Ga0314311_1263845 | Ga0314311_12638454 | 212 |
| 806 | 3300030734 | Ga0316179_1012631 | Ga0316179_10126315 | 212 |
| 807 | 3300031238 | Ga0265332_10064810 | Ga0265332_100648102 | 212 |
| 808 | 3300031249 | Ga0265339_10001794 | Ga0265339_100017943 | 212 |
| 809 | 3300031251 | Ga0265327_10153912 | Ga0265327_101539121 | 212 |
| 810 | 3300031344 | Ga0265316_10005455 | Ga0265316_100054558 | 212 |
| 811 | 3300031456 | Ga0307513_10077668 | Ga0307513_100776682 | 212 |
| 812 | 3300031507 | Ga0307509_10116479 | Ga0307509_101164792 | 212 |
| 813 | 3300031548 | Ga0307408_100000019 | Ga0307408_100000019222 | 212 |
| 814 | 3300031548 | Ga0307408_100001975 | Ga0307408_1000019759 | 212 |
| 815 | 3300031548 | Ga0307408_100007309 | Ga0307408_1000073092 | 212 |
| 816 | 3300031548 | Ga0307408_100007499 | Ga0307408_1000074994 | 212 |
| 817 | 3300031548 | Ga0307408_100020706 | Ga0307408_1000207064 | 212 |
| 818 | 3300031548 | Ga0307408_100030188 | Ga0307408_1000301883 | 212 |
| 819 | 3300031548 | Ga0307408_100043515 | Ga0307408_1000435152 | 212 |
| 820 | 3300031548 | Ga0307408_100162778 | Ga0307408_1001627782 | 212 |
| 821 | 3300031649 | Ga0307514_10023189 | Ga0307514_100231892 | 212 |
| 822 | 3300031711 | Ga0265314_10000002 | Ga0265314_10000002709 | 212 |
| 823 | 3300031731 | Ga0307405_10002527 | Ga0307405_100025276 | 212 |
| 824 | 3300031731 | Ga0307405_10025146 | Ga0307405_100251463 | 212 |
| 825 | 3300031824 | Ga0307413_10136681 | Ga0307413_101366811 | 212 |
| 826 | 3300031901 | Ga0307406_10007961 | Ga0307406_100079615 | 212 |
| 827 | 3300031901 | Ga0307406_10052248 | Ga0307406_100522482 | 212 |
| 828 | 3300031903 | Ga0307407_10061619 | Ga0307407_100616192 | 212 |
| 829 | 3300031903 | Ga0307407_10135947 | Ga0307407_101359471 | 212 |
| 830 | 3300031911 | Ga0307412_10018416 | Ga0307412_100184162 | 212 |
| 831 | 3300031911 | Ga0307412_10020333 | Ga0307412_100203332 | 212 |
| 832 | 3300031911 | Ga0307412_10027487 | Ga0307412_100274873 | 212 |
| 833 | 3300031911 | Ga0307412_10098134 | Ga0307412_100981342 | 212 |
| 834 | 3300031911 | Ga0307412_10571708 | Ga0307412_105717081 | 212 |
| 835 | 3300031911 | Ga0307412_10725525 | Ga0307412_107255251 | 212 |
| 836 | 3300031995 | Ga0307409_100066516 | Ga0307409_1000665162 | 212 |
| 837 | 3300031995 | Ga0307409_100080210 | Ga0307409_1000802102 | 212 |
| 838 | 3300032002 | Ga0307416_100563229 | Ga0307416_1005632292 | 212 |
| 839 | 3300032004 | Ga0307414_10001579 | Ga0307414_100015791 | 212 |
| 840 | 3300032004 | Ga0307414_10059474 | Ga0307414_100594741 | 212 |
| 841 | 3300032004 | Ga0307414_10067128 | Ga0307414_100671281 | 212 |
| 842 | 3300032004 | Ga0307414_10254278 | Ga0307414_102542782 | 212 |
| 843 | 3300032004 | Ga0307414_10843689 | Ga0307414_108436891 | 212 |
| 844 | 3300032004 | Ga0307414_11077526 | Ga0307414_110775261 | 212 |
| 845 | 3300032005 | Ga0307411_10007711 | Ga0307411_100077112 | 212 |
| 846 | 3300032005 | Ga0307411_11119578 | Ga0307411_111195781 | 212 |
| 847 | 3300037418 | Ga0395900_0001438 | Ga0395900_0001438_24512_25162 | 212 |
| 848 | 3300037466 | Ga0395898_0326538 | Ga0395898_0326538_515_1156 | 212 |
| 849 | 3300037471 | Ga0395905_0316328 | Ga0395905_0316328_211_849 | 212 |
| 850 | 3300038443 | Ga0395901_0522027 | Ga0395901_0522027_247_888 | 212 |
| 851 | 3300038705 | Ga0237819_01092 | Ga0237819_01092_3735_4373 | 212 |
| 852 | 3300041404 | Ga0439436_0001261 | Ga0439436_0001261_4907_5545 | 212 |
| 853 | 3300041405 | Ga0439438_000413 | Ga0439438_000413_17985_18623 | 212 |
| 854 | 3300041405 | Ga0439438_002141 | Ga0439438_002141_6020_6658 | 212 |
| 855 | 3300041405 | Ga0439438_003418 | Ga0439438_003418_3612_4250 | 212 |
| 856 | 3300041405 | Ga0439438_006264 | Ga0439438_006264_1032_1670 | 212 |
| 857 | 3300041405 | Ga0439438_006353 | Ga0439438_006353_2642_3280 | 212 |
| 858 | 3300041405 | Ga0439438_010630 | Ga0439438_010630_1563_2270 | 212 |
| 859 | 3300041405 | Ga0439438_011185 | Ga0439438_011185_1952_2590 | 212 |
| 860 | 3300041405 | Ga0439438_011922 | Ga0439438_011922_1088_1726 | 212 |
| 861 | 3300041405 | Ga0439438_016210 | Ga0439438_016210_872_1510 | 212 |
| 862 | 3300041405 | Ga0439438_044230 | Ga0439438_044230_257_895 | 212 |
| 863 | 3300041405 | Ga0439438_044369 | Ga0439438_044369_251_889 | 212 |
| 864 | 3300041407 | Ga0439447_000185 | Ga0439447_000185_8549_9187 | 212 |
| 865 | 3300041407 | Ga0439447_001317 | Ga0439447_001317_5818_6456 | 212 |
| 866 | 3300041407 | Ga0439447_004258 | Ga0439447_004258_3217_3855 | 212 |
| 867 | 3300041407 | Ga0439447_004487 | Ga0439447_004487_965_1603 | 212 |
| 868 | 3300041407 | Ga0439447_005893 | Ga0439447_005893_967_1605 | 212 |
| 869 | 3300041407 | Ga0439447_006591 | Ga0439447_006591_1999_2637 | 212 |
| 870 | 3300041407 | Ga0439447_010479 | Ga0439447_010479_1477_2184 | 212 |
| 871 | 3300041411 | Ga0439466_0000460 | Ga0439466_0000460_6604_7242 | 212 |
| 872 | 3300041411 | Ga0439466_0002029 | Ga0439466_0002029_2528_3166 | 212 |
| 873 | 3300041411 | Ga0439466_0006648 | Ga0439466_0006648_3547_4185 | 212 |
| 874 | 3300041411 | Ga0439466_0007338 | Ga0439466_0007338_2187_2825 | 212 |
| 875 | 3300041411 | Ga0439466_0013865 | Ga0439466_0013865_1141_1779 | 212 |
| 876 | 3300041411 | Ga0439466_0015107 | Ga0439466_0015107_1741_2379 | 212 |
| 877 | 3300041411 | Ga0439466_0016538 | Ga0439466_0016538_1494_2201 | 212 |
| 878 | 3300041411 | Ga0439466_0018278 | Ga0439466_0018278_668_1306 | 212 |
| 879 | 3300041411 | Ga0439466_0025288 | Ga0439466_0025288_1146_1784 | 212 |
| 880 | 3300041411 | Ga0439466_0028941 | Ga0439466_0028941_884_1525 | 212 |
| 881 | 3300041411 | Ga0439466_0041300 | Ga0439466_0041300_369_1007 | 212 |
| 882 | 3300041997 | Ga0439431_0006104 | Ga0439431_0006104_1351_2058 | 212 |
| 883 | 3300042004 | Ga0439445_0007805 | Ga0439445_0007805_668_1306 | 212 |
| 884 | 3300042006 | Ga0439432_000797 | Ga0439432_000797_4955_5593 | 212 |
| 885 | 3300042006 | Ga0439432_002776 | Ga0439432_002776_4084_4722 | 212 |
| 886 | 3300042006 | Ga0439432_003848 | Ga0439432_003848_1151_1789 | 212 |
| 887 | 3300042006 | Ga0439432_005322 | Ga0439432_005322_1355_1993 | 212 |
| 888 | 3300042006 | Ga0439432_015589 | Ga0439432_015589_1220_1858 | 212 |
| 889 | 3300042006 | Ga0439432_016716 | Ga0439432_016716_1581_2288 | 212 |
| 890 | 3300042006 | Ga0439432_045898 | Ga0439432_045898_418_1056 | 212 |
| 891 | 3300042006 | Ga0439432_073626 | Ga0439432_073626_272_910 | 212 |
| 892 | 3300042009 | Ga0439451_001405 | Ga0439451_001405_3175_3813 | 212 |
| 893 | 3300042009 | Ga0439451_006121 | Ga0439451_006121_692_1330 | 212 |
| 894 | 3300042009 | Ga0439451_014709 | Ga0439451_014709_762_1400 | 212 |
| 895 | 3300042009 | Ga0439451_018243 | Ga0439451_018243_540_1178 | 212 |
| 896 | 3300042010 | Ga0439452_000354 | Ga0439452_000354_24146_24784 | 212 |
| 897 | 3300042010 | Ga0439452_000769 | Ga0439452_000769_7924_8562 | 212 |
| 898 | 3300042010 | Ga0439452_000864 | Ga0439452_000864_6795_7433 | 212 |
| 899 | 3300042010 | Ga0439452_004376 | Ga0439452_004376_940_1578 | 212 |
| 900 | 3300042010 | Ga0439452_010875 | Ga0439452_010875_634_1272 | 212 |
| 901 | 3300042010 | Ga0439452_020001 | Ga0439452_020001_617_1255 | 212 |
| 902 | 3300042010 | Ga0439452_025050 | Ga0439452_025050_272_910 | 212 |
| 903 | 3300042013 | Ga0439456_000043 | Ga0439456_000043_16961_17599 | 212 |
| 904 | 3300042013 | Ga0439456_000444 | Ga0439456_000444_5513_6151 | 212 |
| 905 | 3300042013 | Ga0439456_006434 | Ga0439456_006434_122_760 | 212 |
| 906 | 3300042016 | Ga0439463_000618 | Ga0439463_000618_6535_7173 | 212 |
| 907 | 3300042016 | Ga0439463_001239 | Ga0439463_001239_1799_2437 | 212 |
| 908 | 3300042016 | Ga0439463_002794 | Ga0439463_002794_2863_3501 | 212 |
| 909 | 3300042016 | Ga0439463_031436 | Ga0439463_031436_421_1059 | 212 |
| 910 | 3300042115 | Ga0450911_000515 | Ga0450911_000515_5116_5754 | 212 |
| 911 | 3300042115 | Ga0450911_000943 | Ga0450911_000943_1814_2452 | 212 |
| 912 | 3300042115 | Ga0450911_001271 | Ga0450911_001271_4946_5584 | 212 |
| 913 | 3300042115 | Ga0450911_009389 | Ga0450911_009389_28_666 | 212 |
| 914 | 3300042121 | Ga0450919_002285 | Ga0450919_002285_719_1357 | 212 |
| 915 | 3300042122 | Ga0450920_003501 | Ga0450920_003501_1714_2352 | 212 |
| 916 | 3300042123 | Ga0450921_008231 | Ga0450921_008231_146_784 | 212 |
| 917 | 3300042124 | Ga0450922_000114 | Ga0450922_000114_1494_2132 | 212 |
| 918 | 3300042124 | Ga0450922_000386 | Ga0450922_000386_1876_2514 | 212 |
| 919 | 3300042125 | Ga0450923_003986 | Ga0450923_003986_656_1294 | 212 |
| 920 | 3300042125 | Ga0450923_050833 | Ga0450923_050833_85_723 | 212 |
| 921 | 3300042127 | Ga0450890_000259 | Ga0450890_000259_1807_2445 | 212 |
| 922 | 3300042137 | Ga0450902_003798 | Ga0450902_003798_191_829 | 212 |
| 923 | 3300042137 | Ga0450902_016646 | Ga0450902_016646_32_670 | 212 |
| 924 | 3300042137 | Ga0450902_031180 | Ga0450902_031180_11_649 | 212 |
| 925 | 3300042138 | Ga0450903_001100 | Ga0450903_001100_3111_3749 | 212 |
| 926 | 3300042138 | Ga0450903_002913 | Ga0450903_002913_1985_2623 | 212 |
| 927 | 3300042139 | Ga0450904_001416 | Ga0450904_001416_2344_2982 | 212 |
| 928 | 3300042145 | Ga0450906_000802 | Ga0450906_000802_330_968 | 212 |
| 929 | 3300042145 | Ga0450906_006857 | Ga0450906_006857_1369_2007 | 212 |
| 930 | 3300042146 | Ga0450907_000322 | Ga0450907_000322_7214_7852 | 212 |
| 931 | 3300042146 | Ga0450907_001362 | Ga0450907_001362_2065_2703 | 212 |
| 932 | 3300042146 | Ga0450907_001620 | Ga0450907_001620_686_1324 | 212 |
| 933 | 3300042147 | Ga0450910_000704 | Ga0450910_000704_372_1010 | 212 |
| 934 | 3300042147 | Ga0450910_013822 | Ga0450910_013822_473_1111 | 212 |
| 935 | 3300042156 | Ga0439446_0000162 | Ga0439446_0000162_1324_1962 | 212 |
| 936 | 3300042156 | Ga0439446_0002703 | Ga0439446_0002703_1224_1862 | 212 |
| 937 | 3300042184 | Ga0450908_000612 | Ga0450908_000612_1514_2152 | 212 |
| 938 | 3300042184 | Ga0450908_001252 | Ga0450908_001252_3812_4450 | 212 |
| 939 | 3300042185 | Ga0450909_004087 | Ga0450909_004087_245_883 | 212 |
| 940 | 3300042435 | Ga0439434_0000151 | Ga0439434_0000151_7386_8024 | 212 |
| 941 | 3300042435 | Ga0439434_0001524 | Ga0439434_0001524_5351_5989 | 212 |
| 942 | 3300042435 | Ga0439434_0052588 | Ga0439434_0052588_103_741 | 212 |
| 943 | 3300042461 | Ga0439460_0000441 | Ga0439460_0000441_2363_3001 | 212 |
| 944 | 3300042461 | Ga0439460_0000521 | Ga0439460_0000521_5914_6552 | 212 |
| 945 | 3300042461 | Ga0439460_0004619 | Ga0439460_0004619_776_1414 | 212 |
| 946 | 3300042461 | Ga0439460_0029891 | Ga0439460_0029891_627_1265 | 212 |
| 947 | 3300042532 | Ga0450893_0004391 | Ga0450893_0004391_338_976 | 212 |
| 948 | 3300042533 | Ga0450901_002284 | Ga0450901_002284_1328_1966 | 212 |
| 949 | 3300042993 | Ga0439440_0000802 | Ga0439440_0000802_1869_2507 | 212 |
| 950 | 3300046452 | Ga0495617_001375 | Ga0495617_001375_7905_8543 | 212 |
| 951 | 3300046452 | Ga0495617_001612 | Ga0495617_001612_7672_8310 | 212 |
| 952 | 3300046452 | Ga0495617_014525 | Ga0495617_014525_1108_1746 | 212 |
| 953 | 3300046452 | Ga0495617_022087 | Ga0495617_022087_567_1205 | 212 |
| 954 | 3300046453 | Ga0495627_003332 | Ga0495627_003332_4835_5473 | 212 |
| 955 | 3300046453 | Ga0495627_012631 | Ga0495627_012631_1126_1764 | 212 |
| 956 | 3300046453 | Ga0495627_037720 | Ga0495627_037720_691_1329 | 212 |
| 957 | 3300046455 | Ga0495603_0017024 | Ga0495603_0017024_3503_4141 | 212 |
| 958 | 3300046457 | Ga0495590_0002290 | Ga0495590_0002290_6099_6737 | 212 |
| 959 | 3300046457 | Ga0495590_0002876 | Ga0495590_0002876_5238_5876 | 212 |
| 960 | 3300046457 | Ga0495590_0005412 | Ga0495590_0005412_1347_1985 | 212 |
| 961 | 3300046457 | Ga0495590_0084334 | Ga0495590_0084334_275_913 | 212 |
| 962 | 3300046458 | Ga0495591_000463 | Ga0495591_000463_25300_25938 | 212 |
| 963 | 3300046458 | Ga0495591_004255 | Ga0495591_004255_1500_2138 | 212 |
| 964 | 3300046458 | Ga0495591_004969 | Ga0495591_004969_4759_5397 | 212 |
| 965 | 3300046458 | Ga0495591_009434 | Ga0495591_009434_963_1601 | 212 |
| 966 | 3300046458 | Ga0495591_026079 | Ga0495591_026079_215_853 | 212 |
| 967 | 3300046458 | Ga0495591_031318 | Ga0495591_031318_142_780 | 212 |
| 968 | 3300046458 | Ga0495591_034228 | Ga0495591_034228_774_1412 | 212 |
| 969 | 3300046458 | Ga0495591_037868 | Ga0495591_037868_248_886 | 212 |
| 970 | 3300046458 | Ga0495591_059346 | Ga0495591_059346_313_951 | 212 |
| 971 | 3300046460 | Ga0495638_0017183 | Ga0495638_0017183_2100_2738 | 212 |
| 972 | 3300046460 | Ga0495638_0020816 | Ga0495638_0020816_325_963 | 212 |
| 973 | 3300046460 | Ga0495638_0020892 | Ga0495638_0020892_3508_4146 | 212 |
| 974 | 3300046460 | Ga0495638_0052858 | Ga0495638_0052858_759_1397 | 212 |
| 975 | 3300046460 | Ga0495638_0067462 | Ga0495638_0067462_312_950 | 212 |
| 976 | 3300046460 | Ga0495638_0093596 | Ga0495638_0093596_1063_1701 | 212 |
| 977 | 3300046460 | Ga0495638_0135217 | Ga0495638_0135217_260_898 | 212 |
| 978 | 3300046460 | Ga0495638_0136514 | Ga0495638_0136514_690_1328 | 212 |
| 979 | 3300046463 | Ga0495653_0005988 | Ga0495653_0005988_8085_8723 | 212 |
| 980 | 3300046471 | Ga0495650_0004305 | Ga0495650_0004305_8179_8817 | 212 |
| 981 | 3300046471 | Ga0495650_0004442 | Ga0495650_0004442_1139_1777 | 212 |
| 982 | 3300046471 | Ga0495650_0006511 | Ga0495650_0006511_5920_6558 | 212 |
| 983 | 3300046471 | Ga0495650_0049781 | Ga0495650_0049781_815_1453 | 212 |
| 984 | 3300046474 | Ga0495605_0002791 | Ga0495605_0002791_4169_4807 | 212 |
| 985 | 3300046474 | Ga0495605_0012263 | Ga0495605_0012263_1605_2243 | 212 |
| 986 | 3300046474 | Ga0495605_0016231 | Ga0495605_0016231_1550_2188 | 212 |
| 987 | 3300046474 | Ga0495605_0029228 | Ga0495605_0029228_982_1620 | 212 |
| 988 | 3300046474 | Ga0495605_0035624 | Ga0495605_0035624_945_1583 | 212 |
| 989 | 3300046474 | Ga0495605_0057448 | Ga0495605_0057448_338_976 | 212 |
| 990 | 3300046475 | Ga0495639_0000444 | Ga0495639_0000444_10197_10835 | 212 |
| 991 | 3300046491 | Ga0495584_0001930 | Ga0495584_0001930_3519_4157 | 212 |
| 992 | 3300046491 | Ga0495584_0006526 | Ga0495584_0006526_1875_2513 | 212 |
| 993 | 3300046491 | Ga0495584_0009316 | Ga0495584_0009316_3746_4384 | 212 |
| 994 | 3300046491 | Ga0495584_0010251 | Ga0495584_0010251_3527_4165 | 212 |
| 995 | 3300046491 | Ga0495584_0010587 | Ga0495584_0010587_650_1288 | 212 |
| 996 | 3300046491 | Ga0495584_0011913 | Ga0495584_0011913_3386_4024 | 212 |
| 997 | 3300046491 | Ga0495584_0011929 | Ga0495584_0011929_2841_3479 | 212 |
| 998 | 3300046492 | Ga0495585_0002921 | Ga0495585_0002921_3461_4099 | 212 |
| 999 | 3300046492 | Ga0495585_0004927 | Ga0495585_0004927_1950_2588 | 212 |
| 1000 | 3300046492 | Ga0495585_0005380 | Ga0495585_0005380_813_1451 | 212 |
| 1001 | 3300046492 | Ga0495585_0016691 | Ga0495585_0016691_3357_3995 | 212 |
| 1002 | 3300046492 | Ga0495585_0079802 | Ga0495585_0079802_875_1513 | 212 |
| 1003 | 3300046492 | Ga0495585_0083975 | Ga0495585_0083975_1069_1707 | 212 |
| 1004 | 3300046492 | Ga0495585_0114606 | Ga0495585_0114606_508_1146 | 212 |
| 1005 | 3300046500 | Ga0495596_0002695 | Ga0495596_0002695_7724_8362 | 212 |
| 1006 | 3300046501 | Ga0495607_0006796 | Ga0495607_0006796_5919_6557 | 212 |
| 1007 | 3300046501 | Ga0495607_0006981 | Ga0495607_0006981_7152_7790 | 212 |
| 1008 | 3300046501 | Ga0495607_0007583 | Ga0495607_0007583_4513_5151 | 212 |
| 1009 | 3300046501 | Ga0495607_0014785 | Ga0495607_0014785_1534_2172 | 212 |
| 1010 | 3300046501 | Ga0495607_0028506 | Ga0495607_0028506_2534_3172 | 212 |
| 1011 | 3300046501 | Ga0495607_0055584 | Ga0495607_0055584_1153_1791 | 212 |
| 1012 | 3300046501 | Ga0495607_0060380 | Ga0495607_0060380_1096_1734 | 212 |
| 1013 | 3300046501 | Ga0495607_0065116 | Ga0495607_0065116_202_840 | 212 |
| 1014 | 3300046501 | Ga0495607_0065776 | Ga0495607_0065776_778_1416 | 212 |
| 1015 | 3300046501 | Ga0495607_0222531 | Ga0495607_0222531_207_845 | 212 |
| 1016 | 3300046506 | Ga0495583_0002807 | Ga0495583_0002807_5863_6501 | 212 |
| 1017 | 3300046506 | Ga0495583_0005217 | Ga0495583_0005217_5886_6524 | 212 |
| 1018 | 3300046507 | Ga0495606_0000177 | Ga0495606_0000177_62335_62973 | 212 |
| 1019 | 3300046507 | Ga0495606_0009768 | Ga0495606_0009768_3693_4331 | 212 |
| 1020 | 3300046507 | Ga0495606_0021409 | Ga0495606_0021409_3181_3819 | 212 |
| 1021 | 3300046507 | Ga0495606_0025720 | Ga0495606_0025720_1984_2622 | 212 |
| 1022 | 3300046507 | Ga0495606_0026432 | Ga0495606_0026432_3427_4065 | 212 |
| 1023 | 3300046507 | Ga0495606_0037403 | Ga0495606_0037403_857_1495 | 212 |
| 1024 | 3300046507 | Ga0495606_0038442 | Ga0495606_0038442_1392_2030 | 212 |
| 1025 | 3300046507 | Ga0495606_0068766 | Ga0495606_0068766_1576_2214 | 212 |
| 1026 | 3300046507 | Ga0495606_0111488 | Ga0495606_0111488_48_686 | 212 |
| 1027 | 3300046512 | Ga0495610_0003101 | Ga0495610_0003101_7833_8471 | 212 |
| 1028 | 3300046512 | Ga0495610_0007353 | Ga0495610_0007353_5759_6397 | 212 |
| 1029 | 3300046512 | Ga0495610_0007859 | Ga0495610_0007859_64_702 | 212 |
| 1030 | 3300046512 | Ga0495610_0015192 | Ga0495610_0015192_2246_2884 | 212 |
| 1031 | 3300046512 | Ga0495610_0018566 | Ga0495610_0018566_1698_2336 | 212 |
| 1032 | 3300046512 | Ga0495610_0047645 | Ga0495610_0047645_1157_1795 | 212 |
| 1033 | 3300046512 | Ga0495610_0086259 | Ga0495610_0086259_720_1358 | 212 |
| 1034 | 3300046512 | Ga0495610_0188096 | Ga0495610_0188096_124_762 | 212 |
| 1035 | 3300046513 | Ga0495616_0005418 | Ga0495616_0005418_5785_6423 | 212 |
| 1036 | 3300046513 | Ga0495616_0015338 | Ga0495616_0015338_266_904 | 212 |
| 1037 | 3300046513 | Ga0495616_0018417 | Ga0495616_0018417_2257_2895 | 212 |
| 1038 | 3300046513 | Ga0495616_0022030 | Ga0495616_0022030_1470_2108 | 212 |
| 1039 | 3300046513 | Ga0495616_0035602 | Ga0495616_0035602_1646_2284 | 212 |
| 1040 | 3300046513 | Ga0495616_0083868 | Ga0495616_0083868_690_1328 | 212 |
| 1041 | 3300046515 | Ga0495620_0000039 | Ga0495620_0000039_22339_22977 | 212 |
| 1042 | 3300046515 | Ga0495620_0006831 | Ga0495620_0006831_4098_4736 | 212 |
| 1043 | 3300046515 | Ga0495620_0047560 | Ga0495620_0047560_1059_1697 | 212 |
| 1044 | 3300046517 | Ga0495630_0008413 | Ga0495630_0008413_5877_6515 | 212 |
| 1045 | 3300046518 | Ga0495631_0002026 | Ga0495631_0002026_3437_4075 | 212 |
| 1046 | 3300046518 | Ga0495631_0015598 | Ga0495631_0015598_2544_3182 | 212 |
| 1047 | 3300046518 | Ga0495631_0030329 | Ga0495631_0030329_623_1261 | 212 |
| 1048 | 3300046519 | Ga0495632_0001966 | Ga0495632_0001966_3508_4146 | 212 |
| 1049 | 3300046519 | Ga0495632_0003351 | Ga0495632_0003351_7325_7963 | 212 |
| 1050 | 3300046519 | Ga0495632_0003817 | Ga0495632_0003817_3519_4157 | 212 |
| 1051 | 3300046519 | Ga0495632_0008689 | Ga0495632_0008689_1584_2222 | 212 |
| 1052 | 3300046519 | Ga0495632_0026572 | Ga0495632_0026572_1187_1825 | 212 |
| 1053 | 3300046519 | Ga0495632_0043247 | Ga0495632_0043247_351_989 | 212 |
| 1054 | 3300046519 | Ga0495632_0049112 | Ga0495632_0049112_392_1030 | 212 |
| 1055 | 3300046519 | Ga0495632_0104722 | Ga0495632_0104722_93_731 | 212 |
| 1056 | 3300046520 | Ga0495637_0000393 | Ga0495637_0000393_6593_7231 | 212 |
| 1057 | 3300046520 | Ga0495637_0002680 | Ga0495637_0002680_8030_8668 | 212 |
| 1058 | 3300046520 | Ga0495637_0003136 | Ga0495637_0003136_2144_2782 | 212 |
| 1059 | 3300046520 | Ga0495637_0003862 | Ga0495637_0003862_172_810 | 212 |
| 1060 | 3300046520 | Ga0495637_0028791 | Ga0495637_0028791_1348_1986 | 212 |
| 1061 | 3300046520 | Ga0495637_0038598 | Ga0495637_0038598_1194_1832 | 212 |
| 1062 | 3300046520 | Ga0495637_0040801 | Ga0495637_0040801_1279_1917 | 212 |
| 1063 | 3300046520 | Ga0495637_0051080 | Ga0495637_0051080_537_1175 | 212 |
| 1064 | 3300046520 | Ga0495637_0078430 | Ga0495637_0078430_509_1147 | 212 |
| 1065 | 3300046520 | Ga0495637_0078500 | Ga0495637_0078500_560_1198 | 212 |
| 1066 | 3300046520 | Ga0495637_0129801 | Ga0495637_0129801_274_912 | 212 |
| 1067 | 3300046522 | Ga0495643_0001673 | Ga0495643_0001673_927_1565 | 212 |
| 1068 | 3300046522 | Ga0495643_0009672 | Ga0495643_0009672_3486_4124 | 212 |
| 1069 | 3300046522 | Ga0495643_0012882 | Ga0495643_0012882_887_1525 | 212 |
| 1070 | 3300046522 | Ga0495643_0171255 | Ga0495643_0171255_86_724 | 212 |
| 1071 | 3300046522 | Ga0495643_0177923 | Ga0495643_0177923_318_956 | 212 |
| 1072 | 3300046523 | Ga0495644_0000975 | Ga0495644_0000975_7713_8351 | 212 |
| 1073 | 3300046523 | Ga0495644_0005130 | Ga0495644_0005130_795_1433 | 212 |
| 1074 | 3300046523 | Ga0495644_0049038 | Ga0495644_0049038_216_854 | 212 |
| 1075 | 3300046524 | Ga0495648_0000960 | Ga0495648_0000960_6475_7113 | 212 |
| 1076 | 3300046524 | Ga0495648_0011440 | Ga0495648_0011440_4878_5516 | 212 |
| 1077 | 3300046524 | Ga0495648_0019242 | Ga0495648_0019242_1402_2040 | 212 |
| 1078 | 3300046524 | Ga0495648_0044392 | Ga0495648_0044392_1023_1661 | 212 |
| 1079 | 3300046524 | Ga0495648_0064927 | Ga0495648_0064927_213_851 | 212 |
| 1080 | 3300046524 | Ga0495648_0065311 | Ga0495648_0065311_511_1149 | 212 |
| 1081 | 3300046524 | Ga0495648_0131296 | Ga0495648_0131296_208_846 | 212 |
| 1082 | 3300046524 | Ga0495648_0146757 | Ga0495648_0146757_141_779 | 212 |
| 1083 | 3300046524 | Ga0495648_0158352 | Ga0495648_0158352_254_892 | 212 |
| 1084 | 3300046524 | Ga0495648_0208269 | Ga0495648_0208269_80_718 | 212 |
| 1085 | 3300046526 | Ga0495666_0004351 | Ga0495666_0004351_5980_6618 | 212 |
| 1086 | 3300046528 | Ga0495642_0000237 | Ga0495642_0000237_3498_4136 | 212 |
| 1087 | 3300046528 | Ga0495642_0000270 | Ga0495642_0000270_27711_28349 | 212 |
| 1088 | 3300046528 | Ga0495642_0012208 | Ga0495642_0012208_848_1486 | 212 |
| 1089 | 3300046530 | Ga0495654_0003373 | Ga0495654_0003373_6890_7528 | 212 |
| 1090 | 3300046530 | Ga0495654_0013941 | Ga0495654_0013941_2077_2715 | 212 |
| 1091 | 3300046530 | Ga0495654_0014836 | Ga0495654_0014836_711_1349 | 212 |
| 1092 | 3300046530 | Ga0495654_0016049 | Ga0495654_0016049_2093_2731 | 212 |
| 1093 | 3300046530 | Ga0495654_0016726 | Ga0495654_0016726_2925_3563 | 212 |
| 1094 | 3300046530 | Ga0495654_0019909 | Ga0495654_0019909_2773_3411 | 212 |
| 1095 | 3300046530 | Ga0495654_0056165 | Ga0495654_0056165_942_1580 | 212 |
| 1096 | 3300046530 | Ga0495654_0093612 | Ga0495654_0093612_363_1001 | 212 |
| 1097 | 3300046530 | Ga0495654_0128740 | Ga0495654_0128740_411_1049 | 212 |
| 1098 | 3300046538 | Ga0495609_0006042 | Ga0495609_0006042_2044_2682 | 212 |
| 1099 | 3300046538 | Ga0495609_0007083 | Ga0495609_0007083_1291_1929 | 212 |
| 1100 | 3300046538 | Ga0495609_0008362 | Ga0495609_0008362_408_1046 | 212 |
| 1101 | 3300046538 | Ga0495609_0068506 | Ga0495609_0068506_215_853 | 212 |
| 1102 | 3300046538 | Ga0495609_0095384 | Ga0495609_0095384_280_918 | 212 |
| 1103 | 3300046542 | Ga0495597_0008969 | Ga0495597_0008969_3410_4048 | 212 |
| 1104 | 3300046542 | Ga0495597_0029685 | Ga0495597_0029685_885_1523 | 212 |
| 1105 | 3300046542 | Ga0495597_0034222 | Ga0495597_0034222_547_1185 | 212 |
| 1106 | 3300046542 | Ga0495597_0039639 | Ga0495597_0039639_504_1142 | 212 |
| 1107 | 3300046542 | Ga0495597_0077882 | Ga0495597_0077882_323_961 | 212 |
| 1108 | 3300046557 | Ga0495622_0005331 | Ga0495622_0005331_506_1144 | 212 |
| 1109 | 3300046557 | Ga0495622_0007157 | Ga0495622_0007157_4026_4664 | 212 |
| 1110 | 3300046557 | Ga0495622_0037419 | Ga0495622_0037419_221_859 | 212 |
| 1111 | 3300046558 | Ga0495633_0009466 | Ga0495633_0009466_1252_1890 | 212 |
| 1112 | 3300046558 | Ga0495633_0051670 | Ga0495633_0051670_709_1347 | 212 |
| 1113 | 3300046558 | Ga0495633_0060047 | Ga0495633_0060047_484_1122 | 212 |
| 1114 | 3300046616 | Ga0495668_0002528 | Ga0495668_0002528_7665_8303 | 212 |
| 1115 | 3300046616 | Ga0495668_0055166 | Ga0495668_0055166_1476_2114 | 212 |
| 1116 | 3300046648 | Ga0495611_0002529 | Ga0495611_0002529_5307_5945 | 212 |
| 1117 | 3300046660 | Ga0495625_0040982 | Ga0495625_0040982_1962_2600 | 212 |
| 1118 | 3300046660 | Ga0495625_0053539 | Ga0495625_0053539_1300_1938 | 212 |
| 1119 | 3300046660 | Ga0495625_0089581 | Ga0495625_0089581_1207_1845 | 212 |
| 1120 | 3300046660 | Ga0495625_0144246 | Ga0495625_0144246_625_1263 | 212 |
| 1121 | 3300046660 | Ga0495625_0180050 | Ga0495625_0180050_695_1333 | 212 |
| 1122 | 3300046664 | Ga0495659_0001738 | Ga0495659_0001738_2100_2738 | 212 |
| 1123 | 3300046665 | Ga0495661_0000061 | Ga0495661_0000061_79792_80430 | 212 |
| 1124 | 3300046665 | Ga0495661_0007575 | Ga0495661_0007575_1906_2544 | 212 |
| 1125 | 3300046665 | Ga0495661_0022508 | Ga0495661_0022508_675_1313 | 212 |
| 1126 | 3300046665 | Ga0495661_0032339 | Ga0495661_0032339_1383_2021 | 212 |
| 1127 | 3300046665 | Ga0495661_0044113 | Ga0495661_0044113_998_1636 | 212 |
| 1128 | 3300046665 | Ga0495661_0050582 | Ga0495661_0050582_1140_1778 | 212 |
| 1129 | 3300046665 | Ga0495661_0071447 | Ga0495661_0071447_629_1267 | 212 |
| 1130 | 3300046674 | Ga0495588_0037096 | Ga0495588_0037096_1172_1810 | 212 |
| 1131 | 3300046674 | Ga0495588_0107113 | Ga0495588_0107113_230_868 | 212 |
| 1132 | 3300046679 | Ga0495623_0009150 | Ga0495623_0009150_4251_4889 | 212 |
| 1133 | 3300046684 | Ga0495669_0060742 | Ga0495669_0060742_160_798 | 212 |
| 1134 | 3300046691 | Ga0495670_0007368 | Ga0495670_0007368_2276_2914 | 212 |
| 1135 | 3300046691 | Ga0495670_0032832 | Ga0495670_0032832_1817_2455 | 212 |
| 1136 | 3300046691 | Ga0495670_0045971 | Ga0495670_0045971_521_1159 | 212 |
| 1137 | 3300046691 | Ga0495670_0079658 | Ga0495670_0079658_86_724 | 212 |
| 1138 | 3300046692 | Ga0495671_0000805 | Ga0495671_0000805_3481_4119 | 212 |
| 1139 | 3300046692 | Ga0495671_0002987 | Ga0495671_0002987_7726_8409 | 212 |
| 1140 | 3300046692 | Ga0495671_0066941 | Ga0495671_0066941_129_767 | 212 |
| 1141 | 3300046692 | Ga0495671_0264954 | Ga0495671_0264954_175_813 | 212 |
| 1142 | 3300046694 | Ga0495649_0000531 | Ga0495649_0000531_23912_24550 | 212 |
| 1143 | 3300046694 | Ga0495649_0001245 | Ga0495649_0001245_15311_15955 | 212 |
| 1144 | 3300046694 | Ga0495649_0003048 | Ga0495649_0003048_7760_8398 | 212 |
| 1145 | 3300046694 | Ga0495649_0003710 | Ga0495649_0003710_3521_4159 | 212 |
| 1146 | 3300046694 | Ga0495649_0012270 | Ga0495649_0012270_2775_3413 | 212 |
| 1147 | 3300046694 | Ga0495649_0018586 | Ga0495649_0018586_1578_2216 | 212 |
| 1148 | 3300046694 | Ga0495649_0051485 | Ga0495649_0051485_209_847 | 212 |
| 1149 | 3300046694 | Ga0495649_0078880 | Ga0495649_0078880_69_707 | 212 |
| 1150 | 3300046694 | Ga0495649_0088332 | Ga0495649_0088332_455_1093 | 212 |
| 1151 | 3300046794 | Ga0495589_0002695 | Ga0495589_0002695_5769_6407 | 212 |
| 1152 | 3300046794 | Ga0495589_0012290 | Ga0495589_0012290_86_724 | 212 |
| 1153 | 3300046794 | Ga0495589_0015306 | Ga0495589_0015306_86_724 | 212 |
| 1154 | 3300046794 | Ga0495589_0037613 | Ga0495589_0037613_274_912 | 212 |
| 1155 | 3300046794 | Ga0495589_0046040 | Ga0495589_0046040_789_1427 | 212 |
| 1156 | 3300046810 | Ga0495660_0029689 | Ga0495660_0029689_326_964 | 212 |
| 1157 | 3300046810 | Ga0495660_0037406 | Ga0495660_0037406_208_846 | 212 |
| 1158 | 3300046810 | Ga0495660_0070082 | Ga0495660_0070082_1150_1788 | 212 |
| 1159 | 3300046810 | Ga0495660_0085758 | Ga0495660_0085758_88_726 | 212 |
| 1160 | 3300046810 | Ga0495660_0113005 | Ga0495660_0113005_426_1064 | 212 |
| 1161 | 3300046810 | Ga0495660_0190575 | Ga0495660_0190575_259_897 | 212 |
| 1162 | 3300047315 | Ga0495581_0003592 | Ga0495581_0003592_906_1544 | 212 |
| 1163 | 3300047318 | Ga0495636_0002667 | Ga0495636_0002667_4124_4762 | 212 |
| 1164 | 3300047318 | Ga0495636_0014338 | Ga0495636_0014338_1943_2581 | 212 |
| 1165 | 3300047318 | Ga0495636_0014946 | Ga0495636_0014946_117_755 | 212 |
| 1166 | 3300047320 | Ga0495672_0004415 | Ga0495672_0004415_3715_4353 | 212 |
| 1167 | 3300047320 | Ga0495672_0005033 | Ga0495672_0005033_2136_2774 | 212 |
| 1168 | 3300047320 | Ga0495672_0012539 | Ga0495672_0012539_1171_1809 | 212 |
| 1169 | 3300047320 | Ga0495672_0017611 | Ga0495672_0017611_2613_3251 | 212 |
| 1170 | 3300047320 | Ga0495672_0025576 | Ga0495672_0025576_2392_3030 | 212 |
| 1171 | 3300047320 | Ga0495672_0028180 | Ga0495672_0028180_1231_1869 | 212 |
| 1172 | 3300047320 | Ga0495672_0028941 | Ga0495672_0028941_2044_2682 | 212 |
| 1173 | 3300047320 | Ga0495672_0068702 | Ga0495672_0068702_1057_1695 | 212 |
| 1174 | 3300047320 | Ga0495672_0098395 | Ga0495672_0098395_897_1535 | 212 |
| 1175 | 3300047320 | Ga0495672_0142219 | Ga0495672_0142219_519_1157 | 212 |
| 1176 | 3300047320 | Ga0495672_0282460 | Ga0495672_0282460_11_649 | 212 |
| 1177 | 3300047321 | Ga0495676_0008681 | Ga0495676_0008681_3236_3874 | 212 |
| 1178 | 3300047322 | Ga0495680_0018582 | Ga0495680_0018582_1024_1662 | 212 |
| 1179 | 3300047322 | Ga0495680_0075397 | Ga0495680_0075397_567_1205 | 212 |
| 1180 | 3300047323 | Ga0495683_0000207 | Ga0495683_0000207_52013_52651 | 212 |
| 1181 | 3300047323 | Ga0495683_0002916 | Ga0495683_0002916_3777_4415 | 212 |
| 1182 | 3300047323 | Ga0495683_0003871 | Ga0495683_0003871_285_923 | 212 |
| 1183 | 3300047323 | Ga0495683_0038518 | Ga0495683_0038518_1119_1757 | 212 |
| 1184 | 3300047323 | Ga0495683_0042127 | Ga0495683_0042127_309_947 | 212 |
| 1185 | 3300047443 | Ga0495687_005908 | Ga0495687_005908_4515_5153 | 212 |
| 1186 | 3300047443 | Ga0495687_012488 | Ga0495687_012488_3505_4143 | 212 |
| 1187 | 3300047443 | Ga0495687_028666 | Ga0495687_028666_1607_2245 | 212 |
| 1188 | 3300047444 | Ga0495675_0018497 | Ga0495675_0018497_3494_4132 | 212 |
| 1189 | 3300047445 | Ga0495677_0001738 | Ga0495677_0001738_64_702 | 212 |
| 1190 | 3300047446 | Ga0495679_005828 | Ga0495679_005828_1383_2021 | 212 |
| 1191 | 3300047446 | Ga0495679_016669 | Ga0495679_016669_353_991 | 212 |
| 1192 | 3300047469 | Ga0495673_0002875 | Ga0495673_0002875_3424_4062 | 212 |
| 1193 | 3300047469 | Ga0495673_0009659 | Ga0495673_0009659_966_1604 | 212 |
| 1194 | 3300047469 | Ga0495673_0013229 | Ga0495673_0013229_3356_3994 | 212 |
| 1195 | 3300047469 | Ga0495673_0022816 | Ga0495673_0022816_2091_2729 | 212 |
| 1196 | 3300047469 | Ga0495673_0029293 | Ga0495673_0029293_1035_1673 | 212 |
| 1197 | 3300047469 | Ga0495673_0042856 | Ga0495673_0042856_562_1200 | 212 |
| 1198 | 3300047469 | Ga0495673_0234113 | Ga0495673_0234113_22_660 | 212 |
| 1199 | 3300047470 | Ga0495681_0001573 | Ga0495681_0001573_16025_16663 | 212 |
| 1200 | 3300047470 | Ga0495681_0004171 | Ga0495681_0004171_7746_8384 | 212 |
| 1201 | 3300047470 | Ga0495681_0005234 | Ga0495681_0005234_5679_6317 | 212 |
| 1202 | 3300047470 | Ga0495681_0006018 | Ga0495681_0006018_1471_2109 | 212 |
| 1203 | 3300047470 | Ga0495681_0007812 | Ga0495681_0007812_2108_2746 | 212 |
| 1204 | 3300047470 | Ga0495681_0034316 | Ga0495681_0034316_743_1381 | 212 |
| 1205 | 3300047470 | Ga0495681_0041884 | Ga0495681_0041884_1367_2005 | 212 |
| 1206 | 3300047470 | Ga0495681_0050152 | Ga0495681_0050152_358_996 | 212 |
| 1207 | 3300047470 | Ga0495681_0066529 | Ga0495681_0066529_935_1573 | 212 |
| 1208 | 3300047471 | Ga0495684_0006237 | Ga0495684_0006237_8041_8679 | 212 |
| 1209 | 3300047472 | Ga0495686_0008952 | Ga0495686_0008952_4803_5441 | 212 |
| 1210 | 3300048091 | Ga0495626_0000678 | Ga0495626_0000678_25345_25983 | 212 |
| 1211 | 3300048091 | Ga0495626_0003052 | Ga0495626_0003052_3339_3977 | 212 |
| 1212 | 3300048091 | Ga0495626_0003444 | Ga0495626_0003444_1727_2365 | 212 |
| 1213 | 3300048091 | Ga0495626_0003637 | Ga0495626_0003637_1393_2031 | 212 |
| 1214 | 3300048091 | Ga0495626_0014645 | Ga0495626_0014645_2788_3426 | 212 |
| 1215 | 3300048091 | Ga0495626_0018953 | Ga0495626_0018953_944_1582 | 212 |
| 1216 | 3300048091 | Ga0495626_0036940 | Ga0495626_0036940_1043_1681 | 212 |
| 1217 | 3300048913 | Ga0496110_0049528 | Ga0496110_0049528_2094_2732 | 212 |
| 1218 | 3300048913 | Ga0496110_0309836 | Ga0496110_0309836_691_1329 | 212 |
| 1219 | 3300048913 | Ga0496110_0707054 | Ga0496110_0707054_40_678 | 212 |
| 1220 | 3300048914 | Ga0496111_0213673 | Ga0496111_0213673_468_1106 | 212 |
| 1221 | 3300048917 | Ga0496114_0007131 | Ga0496114_0007131_3767_4405 | 212 |
| 1222 | 3300048919 | Ga0496116_0000670 | Ga0496116_0000670_8064_8702 | 212 |
| 1223 | 3300048919 | Ga0496116_0029466 | Ga0496116_0029466_1685_2323 | 212 |
| 1224 | 3300048920 | Ga0496117_0002093 | Ga0496117_0002093_8065_8703 | 212 |
| 1225 | 3300048920 | Ga0496117_0002217 | Ga0496117_0002217_1980_2618 | 212 |
| 1226 | 3300048920 | Ga0496117_0003858 | Ga0496117_0003858_1063_1701 | 212 |
| 1227 | 3300048920 | Ga0496117_0006799 | Ga0496117_0006799_9783_10421 | 212 |
| 1228 | 3300048920 | Ga0496117_0013238 | Ga0496117_0013238_5106_5744 | 212 |
| 1229 | 3300048920 | Ga0496117_0043602 | Ga0496117_0043602_823_1464 | 212 |
| 1230 | 3300048920 | Ga0496117_0155598 | Ga0496117_0155598_306_944 | 212 |
| 1231 | 3300048921 | Ga0496118_0001842 | Ga0496118_0001842_3374_4012 | 212 |
| 1232 | 3300048921 | Ga0496118_0037855 | Ga0496118_0037855_1582_2220 | 212 |
| 1233 | 3300048921 | Ga0496118_0041256 | Ga0496118_0041256_1003_1641 | 212 |
| 1234 | 3300048921 | Ga0496118_0054999 | Ga0496118_0054999_1603_2241 | 212 |
| 1235 | 3300048921 | Ga0496118_0074123 | Ga0496118_0074123_1140_1781 | 212 |
| 1236 | 3300048921 | Ga0496118_0145066 | Ga0496118_0145066_642_1280 | 212 |
| 1237 | 3300048922 | Ga0496119_0000229 | Ga0496119_0000229_62193_62834 | 212 |
| 1238 | 3300048922 | Ga0496119_0059214 | Ga0496119_0059214_808_1446 | 212 |
| 1239 | 3300048922 | Ga0496119_0223052 | Ga0496119_0223052_67_705 | 212 |
| 1240 | 3300048923 | Ga0496120_0001476 | Ga0496120_0001476_11805_12446 | 212 |
| 1241 | 3300048924 | Ga0496121_0001246 | Ga0496121_0001246_36032_36670 | 212 |
| 1242 | 3300048924 | Ga0496121_0032444 | Ga0496121_0032444_198_839 | 212 |
| 1243 | 3300048924 | Ga0496121_0180633 | Ga0496121_0180633_167_805 | 212 |
| 1244 | 3300048924 | Ga0496121_0214588 | Ga0496121_0214588_398_1036 | 212 |
| 1245 | 3300048925 | Ga0496122_0000590 | Ga0496122_0000590_59031_59669 | 212 |
| 1246 | 3300048925 | Ga0496122_0009159 | Ga0496122_0009159_2517_3155 | 212 |
| 1247 | 3300048925 | Ga0496122_0076098 | Ga0496122_0076098_1665_2303 | 212 |
| 1248 | 3300048926 | Ga0496123_0000088 | Ga0496123_0000088_90755_91393 | 212 |
| 1249 | 3300048926 | Ga0496123_0033910 | Ga0496123_0033910_215_853 | 212 |
| 1250 | 3300048926 | Ga0496123_0092130 | Ga0496123_0092130_1034_1672 | 212 |
| 1251 | 3300048927 | Ga0496124_0003431 | Ga0496124_0003431_1947_2585 | 212 |
| 1252 | 3300048927 | Ga0496124_0014858 | Ga0496124_0014858_1911_2549 | 212 |
| 1253 | 3300048927 | Ga0496124_0020430 | Ga0496124_0020430_4262_4900 | 212 |
| 1254 | 3300048927 | Ga0496124_0167101 | Ga0496124_0167101_349_987 | 212 |
| 1255 | 3300048927 | Ga0496124_0224873 | Ga0496124_0224873_684_1322 | 212 |
| 1256 | 3300048927 | Ga0496124_0440525 | Ga0496124_0440525_199_837 | 212 |
| 1257 | 3300048928 | Ga0496125_0001017 | Ga0496125_0001017_16776_17414 | 212 |
| 1258 | 3300048928 | Ga0496125_0012694 | Ga0496125_0012694_1115_1765 | 212 |
| 1259 | 3300048928 | Ga0496125_0014635 | Ga0496125_0014635_4978_5616 | 212 |
| 1260 | 3300048928 | Ga0496125_0029631 | Ga0496125_0029631_4083_4721 | 212 |
| 1261 | 3300048928 | Ga0496125_0041485 | Ga0496125_0041485_3229_3867 | 212 |
| 1262 | 3300048928 | Ga0496125_0074765 | Ga0496125_0074765_1667_2305 | 212 |
| 1263 | 3300048929 | Ga0496126_0167615 | Ga0496126_0167615_539_1177 | 212 |
| 1264 | 3300048929 | Ga0496126_0346797 | Ga0496126_0346797_498_1136 | 212 |
| 1265 | 3300049459 | Ga0495678_005047 | Ga0495678_005047_2144_2782 | 212 |
| 1266 | 3300049459 | Ga0495678_011637 | Ga0495678_011637_1200_1838 | 212 |
| 1267 | 3300049459 | Ga0495678_015508 | Ga0495678_015508_2180_2818 | 212 |
| 1268 | 3300049459 | Ga0495678_017639 | Ga0495678_017639_960_1598 | 212 |
| 1269 | 3300049459 | Ga0495678_018354 | Ga0495678_018354_93_731 | 212 |
| 1270 | 3300049459 | Ga0495678_028700 | Ga0495678_028700_1625_2263 | 212 |
| 1271 | 3300049459 | Ga0495678_114535 | Ga0495678_114535_103_741 | 212 |
| 1272 | 3300049460 | Ga0495682_0000124 | Ga0495682_0000124_22234_22872 | 212 |
| 1273 | 3300049460 | Ga0495682_0003137 | Ga0495682_0003137_1084_1722 | 212 |
| 1274 | 3300049571 | Ga0501034_0000101 | Ga0501034_0000101_78568_79206 | 212 |
| 1275 | 3300049656 | Ga0501209_000112 | Ga0501209_000112_2913_3551 | 212 |
| 1276 | 3300049662 | Ga0501222_004934 | Ga0501222_004934_605_1372 | 212 |
| 1277 | 3300049665 | Ga0501227_047146 | Ga0501227_047146_213_851 | 212 |
| 1278 | 3300049758 | Ga0501241_009560 | Ga0501241_009560_418_1056 | 212 |
| 1279 | 3300049822 | Ga0501035_0011403 | Ga0501035_0011403_7074_7715 | 212 |
| 1280 | 3300049823 | Ga0501044_0000396 | Ga0501044_0000396_24427_25068 | 212 |
| 1281 | 3300049853 | Ga0501226_002989 | Ga0501226_002989_705_1343 | 212 |
| 1282 | 3300050489 | nmdc:mga03683_69492_c1 | nmdc:mga03683_69492_c1_630_1268 | 212 |
| 1283 | 3300050489 | nmdc:mga03683_74871_c1 | nmdc:mga03683_74871_c1_805_1443 | 212 |
| 1284 | 3300050491 | nmdc:mga00v17_46197_c1 | nmdc:mga00v17_46197_c1_1019_1657 | 212 |
| 1285 | 3300050491 | nmdc:mga00v17_98480_c1 | nmdc:mga00v17_98480_c1_922_1560 | 212 |
| 1286 | 3300050493 | nmdc:mga0k408_134424_c1 | nmdc:mga0k408_134424_c1_502_1143 | 212 |
| 1287 | 3300050496 | nmdc:mga07m45_218950_c1 | nmdc:mga07m45_218950_c1_210_851 | 212 |
| 1288 | 3300050514 | nmdc:mga08x19_200157_c1 | nmdc:mga08x19_200157_c1_424_1062 | 212 |
| 1289 | 3300050514 | nmdc:mga08x19_48891_c1 | nmdc:mga08x19_48891_c1_587_1225 | 212 |
| 1290 | 3300053125 | Ga0500618_002135 | Ga0500618_002135_3677_4315 | 212 |
| 1291 | 3300053135 | Ga0500659_0002113 | Ga0500659_0002113_10549_11187 | 212 |
| 1292 | 3300059477 | Ga0587084_003707 | Ga0587084_003707_154_804 | 212 |
| 1293 | 3300059492 | Ga0587073_0005079 | Ga0587073_0005079_187_837 | 212 |
| 1294 | 3300059508 | Ga0587088_001545 | Ga0587088_001545_1711_2361 | 212 |
| 1295 | 3300059511 | Ga0587091_004577 | Ga0587091_004577_1135_1785 | 212 |
| 1296 | 3300059623 | Ga0587101_040959 | Ga0587101_040959_61_711 | 212 |
| 1297 | 3300059640 | Ga0587067_000901 | Ga0587067_000901_65_715 | 212 |
| 1298 | 3300059641 | Ga0587068_004107 | Ga0587068_004107_78_728 | 212 |
| 1299 | 3300059643 | Ga0587072_000193 | Ga0587072_000193_2194_2844 | 212 |
| 1300 | 3300059651 | Ga0587105_006430 | Ga0587105_006430_100_750 | 212 |
| 1301 | iso_pu_bacteria | 2511231156 | 2511827635 | 212 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7kuu-assembly1.cif.gz_B | lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form | 0.9613 | 3 | 207 |
| 7kuu-assembly1.cif.gz_B | lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form | 0.9566 | 3 | 207 |
| 6p0w-assembly1.cif.gz_A-2 | lsfa from p. aeruginosa, a 1-cys prx in reduced form | 0.9492 | 3 | 207 |
| 5b6n-assembly2.cif.gz_C | crystal structures of human peroxiredoxin 6 in sulfinic acid state | 0.9423 | 2 | 206 |
| 6p0w-assembly1.cif.gz_A-2 | lsfa from p. aeruginosa, a 1-cys prx in reduced form | 0.94 | 3 | 207 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54SE2_176_239_3.30.1020.10 | Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 | 0.9745 | 142 | 206 | 3.30.1020.10 |
| af_Q54SE2_176_239_3.30.1020.10 | Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 | 0.9598 | 142 | 206 | 3.30.1020.10 |
| af_A0A0R0K508_6_109_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9583 | 7 | 102 | 3.40.30.10 |
| af_I1KRJ7_151_218_3.30.1020.10 | Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 | 0.9507 | 142 | 204 | 3.30.1020.10 |
| 5b6mE01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9417 | 2 | 141 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3TGA5-F1-model_v4 | Peroxidase | 0.9892 | 130 | 208 |
GO:0051920
|
| AF-A1WG86-F1-model_v4 | 1-Cys peroxiredoxin (EC 1.11.1.15) | 0.989 | 1 | 208 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 |
| AF-A0A3D2SRI0-F1-model_v4 | Peroxiredoxin | 0.987 | 1 | 176 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 |
| AF-A0A516SDU3-F1-model_v4 | Peroxiredoxin (EC 1.11.1.24) | 0.9868 | 1 | 208 |
GO:0005829
GO:0045454 GO:0051920 |
| AF-A0A1H2PQ68-F1-model_v4 | Alkyl hydroperoxide reductase subunit AhpC (Peroxiredoxin) | 0.9868 | 1 | 208 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar