F492767

General Info

Members Datasets Scaffolds Average Seq Length
1301 700 969 211

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2511231156|2511827635
Length 251
Sequence ASEQFFIFTNDLNKWVFILFKAMKTGAQLVPQQPSRSRTMSLRLGDIAPDFEQDSSAGKIRFHEWLGDSWGVLFSHPADFTPVCTTELGLTAKLKDEFAQRGVKAIALSVDPVDSHHKWIEDINETQNAVVNFPILADADRKVSDLYDLIHPNASDTLTVRSLFVIDPNKKIRLTITYPASTGRNFNEILRVIDSLQLTDNYKVATPANWQDGDEVVIVPSLKDEEELKQRFPKGYRAVKPYLRLTPQPNR

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
4 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
5 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
6 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
7 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
8 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
9 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
10 2511231004 Pseudomonas sp. GM102 Isolate Nodule
11 2511231006 Pseudomonas sp. GM17 Isolate Nodule
12 2511231007 Pseudomonas sp. GM18 Isolate Nodule
13 2511231008 Pseudomonas sp. GM21 Isolate Nodule
14 2511231010 Pseudomonas sp. GM25 Isolate Nodule
15 2511231011 Pseudomonas sp. GM30 Isolate Nodule
16 2511231012 Pseudomonas sp. GM33 Isolate Nodule
17 2511231014 Pseudomonas sp. GM48 Isolate Nodule
18 2511231015 Pseudomonas sp. GM49 Isolate Nodule
19 2511231016 Pseudomonas sp. GM50 Isolate Nodule
20 2511231017 Pseudomonas sp. GM55 Isolate Nodule
21 2511231018 Pseudomonas sp. GM60 Isolate Nodule
22 2511231019 Pseudomonas sp. GM67 Isolate Nodule
23 2511231020 Pseudomonas sp. GM74 Isolate Nodule
24 2511231021 Pseudomonas sp. GM78 Isolate Nodule
25 2511231022 Pseudomonas sp. GM79 Isolate Nodule
26 2511231023 Pseudomonas sp. GM80 Isolate Nodule
27 2511231031 Pseudomonas sp. GM16 Isolate Nodule
28 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
29 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
30 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
31 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
32 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
33 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
34 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
35 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
36 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
37 2547132374 Acidovorax radicis N35 Isolate Unclassified
38 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
39 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
40 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
41 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
42 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
43 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
44 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
45 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
46 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
47 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
48 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
49 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
50 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
51 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
52 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
53 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
54 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
55 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
56 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
57 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
58 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
59 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
60 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
61 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
62 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
63 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
64 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
65 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
66 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
67 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
68 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
69 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
70 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
71 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
72 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
73 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
74 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
75 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
76 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
77 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
78 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
79 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
80 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
81 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
82 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
83 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
84 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
85 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
86 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
87 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
88 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
89 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
90 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
91 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
92 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
93 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
94 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
95 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
96 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
97 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
98 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
99 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
100 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
101 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
102 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
103 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
104 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
105 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
106 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
107 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
108 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
109 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
110 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
111 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
112 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
113 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
114 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
115 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
116 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
117 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
118 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
119 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
120 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
121 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
122 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
123 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
124 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
125 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
126 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
127 2643221609 Acidovorax sp. Root217 Isolate Unclassified
128 2643221611 Acidovorax sp. Root219 Isolate Unclassified
129 2643221621 Achromobacter sp. Root83 Isolate Unclassified
130 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
131 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
132 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
133 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
134 2643221683 Variovorax sp. Root473 Isolate Unclassified
135 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
136 2643221717 Acidovorax sp. Root267 Isolate Unclassified
137 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
138 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
139 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
140 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
141 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
142 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
143 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
144 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
145 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
146 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
147 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
148 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
149 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
150 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
151 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
152 2738541277 Variovorax sp. GV051 Isolate Unclassified
153 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
154 2738541283 Pedobacter sp. OK701 Isolate Unclassified
155 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
156 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
157 2738541307 Variovorax sp. GV008 Isolate Unclassified
158 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
159 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
160 2738543012 Acidovorax sp. CF301 Isolate Unclassified
161 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
162 2738543019 Variovorax sp. GV040 Isolate Unclassified
163 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
164 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
165 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
166 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
167 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
168 2773857670 Pseudomonas sp. 478 Isolate Unclassified
169 2773857673 Pseudomonas sp. 443 Isolate Unclassified
170 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
171 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
172 2784132063 Pseudomonas sp. 424 Isolate Unclassified
173 2784132072 Pseudomonas sp. 460 Isolate Unclassified
174 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
175 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
176 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
177 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
178 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
179 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
180 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
181 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
182 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
183 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
184 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
185 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
186 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
187 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
188 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
189 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
190 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
191 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
192 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
193 2816332133 Acidovorax radicis 2721A Isolate Unclassified
194 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
195 2818991436 Collimonas arenae 515 Isolate Unclassified
196 2818991450 Burkholderia sp. 604 Isolate Unclassified
197 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
198 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
199 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
200 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
201 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
202 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
203 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
204 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
205 2842733646 Variovorax sp. R-72446 Isolate Unclassified
206 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
207 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
208 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
209 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
210 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
211 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
212 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
213 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
214 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
215 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
216 2855730933 Achromobacter sp. HZ28 Isolate Nodule
217 2855767633 Achromobacter sp. HZ34 Isolate Nodule
218 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
219 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
220 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
221 2858950400 Achromobacter sp. K91 Isolate Unclassified
222 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
223 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
224 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
225 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
226 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
227 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
228 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
229 2885266251 Ralstonia sp. SET104 Isolate Nodule
230 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
231 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
232 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
233 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
234 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
235 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
236 2904456579 Variovorax sp. 2002 Isolate Unclassified
237 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
238 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
239 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
240 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
241 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
242 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
243 2916699645 Acinetobacter ursingii M3 Isolate Unclassified
244 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
245 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
246 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
247 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
248 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
249 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
250 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
251 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
252 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
253 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
254 2919506607 Acinetobacter sp. 3657 Isolate Unclassified
255 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
256 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
257 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
258 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
259 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
260 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
261 2928058823 Ralstonia sp. 1138 Isolate Unclassified
262 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
263 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
264 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
265 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
266 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
267 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
268 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
269 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
270 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
271 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
272 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
273 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
274 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
275 2941479691
276 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
277 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
278 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
279 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
280 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
281 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
282 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
283 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
284 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
285 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
286 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
287 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
288 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
289 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
290 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
291 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
292 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
293 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
294 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
295 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
296 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
297 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
298 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
299 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
300 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
301 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
302 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
303 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
304 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
305 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
306 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
307 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
308 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
309 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
310 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
311 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
312 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
313 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
314 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
315 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
316 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
317 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
318 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
319 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
320 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
321 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
322 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
323 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
324 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
325 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
326 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
327 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
329 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
330 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
331 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
332 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
333 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
334 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
335 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
336 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
337 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
338 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
339 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
340 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
341 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
342 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
343 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
344 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
345 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
346 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
347 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
348 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
349 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
350 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
351 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
352 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
353 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
354 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
355 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
356 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
357 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
358 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
359 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
360 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
361 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
362 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
363 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
364 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
365 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
366 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
367 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
368 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
369 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
370 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
371 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
372 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
373 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
374 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
375 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
376 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
377 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
378 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
379 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
380 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
381 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
382 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
383 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
384 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
385 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
386 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
387 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
388 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
389 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
390 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
391 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
392 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
393 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
394 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
395 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
396 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
397 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
398 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
399 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
400 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
401 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
402 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
403 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
404 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
405 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
406 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
408 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
409 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
410 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
411 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
412 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
413 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
414 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
415 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
416 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
417 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
418 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
419 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
420 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
421 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
422 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
423 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
424 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
425 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
426 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
427 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
428 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
429 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
430 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
431 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
432 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
433 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
434 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
435 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
436 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
437 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
438 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
439 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
440 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
441 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
442 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
443 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
444 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
445 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
446 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
447 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
448 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
449 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
450 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
451 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
452 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
453 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
454 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
455 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
456 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
457 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
458 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
459 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
460 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
461 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
462 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
463 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
464 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
465 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
466 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
467 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
468 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
469 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
470 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
471 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
472 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
473 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
474 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
475 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
476 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
477 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
478 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
479 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
480 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
481 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
482 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
483 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
484 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
485 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
486 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
487 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
488 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
489 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
490 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
491 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
492 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
493 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
494 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
495 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
496 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
497 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
498 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
499 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
500 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
501 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
502 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
503 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
504 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
505 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
506 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
507 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
508 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
509 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
510 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
511 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
512 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
513 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
514 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
515 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
516 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
517 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
518 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
519 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
520 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
521 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
522 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
523 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
524 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
525 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
526 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
527 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
528 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
529 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
530 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
531 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
532 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
533 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
534 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
535 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
536 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
537 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
538 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
539 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
540 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
541 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
542 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
543 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
544 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
545 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
546 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
547 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
548 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
549 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
550 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
551 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
552 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
553 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
554 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
555 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
556 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
557 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
558 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
559 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
560 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
561 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
562 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
563 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
564 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
565 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
566 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
567 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
568 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
569 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
570 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
571 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
572 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
573 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
574 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
575 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
576 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
577 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
578 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
579 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
580 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
581 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
582 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
583 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
584 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
585 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
586 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
587 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
588 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
589 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
590 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
591 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
592 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
593 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
594 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
595 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
596 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
597 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
598 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
599 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
600 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
601 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
602 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
603 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
604 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
605 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
606 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
607 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
608 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
609 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
610 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
611 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
612 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
613 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
614 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
615 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
616 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
617 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
618 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
619 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
620 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
621 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
622 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
623 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
624 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
625 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
626 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
627 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
628 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
629 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
630 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
631 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
632 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
633 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
634 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
635 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
636 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
637 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
638 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
639 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
640 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
641 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
642 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
643 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
644 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
645 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
646 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
647 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
648 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
649 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
650 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
651 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
652 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
653 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
654 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
655 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
656 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
657 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
658 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
659 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
660 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
661 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
662 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
663 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
664 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
665 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
666 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
667 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
668 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
669 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
670 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
671 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
672 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
673 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
674 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
675 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
676 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
677 8033232454 Acinetobacter radioresistens SA188 Isolate Unclassified
678 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
679 8052494512 Pseudomonas putida LD6 Isolate Unclassified
680 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
681 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
682 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
683 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
684 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
685 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
686 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
687 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
688 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
689 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
690 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
691 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
692 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
693 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
694 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
695 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
696 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
697 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
698 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
699 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
700 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 72.71
Metatranscriptomes 1.77
Isolates 25.52

Biome Distribution

Category Percentage (%)
Aerial Root 0.15
Bulb 0
Endosphere 9.84
Nodule 3.61
Rhizoplane 6.15
Rhizosphere 66.1
Stem 0
Stem Tuber 0
Unclassified 14.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_6468 2124908027 Bacteria 8027
2 SwRhRL2b_contig_137706 2162886007 Bacteria 6987
3 SwRhRL2b_contig_1872146 2162886007 Bacteria 1537
4 JGI24741J21665_1004476 3300001915 Bacteria 3087
5 JGI24741J21665_1008997 3300001915 Bacteria 1855
6 JGI24740J21852_10000054 3300001979 Bacteria 36657
7 JGI24737J22298_10117372 3300001990 Bacteria 786
8 JGI25156J39149_1012551 3300002705 Bacteria 1853
9 JGI25162J39368_1000154 3300002737 Bacteria 75240
10 JGI25162J39368_1000319 3300002737 Bacteria 42383
11 JGI25162J39368_1000474 3300002737 Bacteria 30875
12 JGI25154J39366_1012343 3300002738 Bacteria 946
13 JGI25163J39215_1000691 3300002771 Bacteria 8909
14 JGI25163J39215_1004782 3300002771 Bacteria 916
15 JGI25164J39214_1000236 3300002772 Bacteria 42383
16 JGI25164J39214_1000674 3300002772 Bacteria 13675
17 JGI25164J39214_1006548 3300002772 Bacteria 1218
18 JGI25165J46597_1000239 3300003214 Bacteria 75240
19 JGI25165J46597_1000434 3300003214 Bacteria 42383
20 JGI25165J46597_1000600 3300003214 Bacteria 30875
21 rootL2_10028101 3300003322 Bacteria 1039
22 Ga0055538_1000032 3300003751 Bacteria 199718
23 Ga0055538_1000094 3300003751 Bacteria 75240
24 Ga0055539_1000038 3300003752 Bacteria 205053
25 Ga0055539_1000043 3300003752 Bacteria 199718
26 Ga0055539_1000136 3300003752 Bacteria 76284
27 Ga0055533_1000052 3300003756 Bacteria 199718
28 Ga0055533_1000143 3300003756 Bacteria 75240
29 Ga0055532_1000002 3300003758 Bacteria 576000
30 Ga0055532_1000047 3300003758 Bacteria 179201
31 Ga0055525_1000062 3300003759 Bacteria 199718
32 Ga0055525_1000188 3300003759 Bacteria 75240
33 Ga0055525_1000304 3300003759 Bacteria 40731
34 Ga0055527_1001999 3300003760 Bacteria 3715
35 Ga0055535_1000096 3300003761 Bacteria 96196
36 Ga0055535_1004523 3300003761 Bacteria 3348
37 Ga0055529_1000091 3300003763 Bacteria 138369
38 Ga0055529_1000113 3300003763 Bacteria 118574
39 Ga0055524_1020020 3300003775 Bacteria 2268
40 Ga0055524_1034939 3300003775 Bacteria 1379
41 Ga0055536_1001726 3300003781 Bacteria 12927
42 Ga0055536_1049437 3300003781 Bacteria 934
43 Ga0055530_10000658 3300003791 Bacteria 29519
44 Ga0055530_10002203 3300003791 Bacteria 12895
45 Ga0055530_10002392 3300003791 Bacteria 12142
46 Ga0055530_10007867 3300003791 Bacteria 4389
47 Ga0055540_1000506 3300003792 Bacteria 29519
48 Ga0055540_1001654 3300003792 Bacteria 12927
49 Ga0055541_1000030 3300003841 Bacteria 199616
50 Ga0055541_1000092 3300003841 Bacteria 75240
51 Ga0055541_1003579 3300003841 Bacteria 2902
52 Ga0058692_1011559 3300003856 Bacteria 2128
53 Ga0058858_1283826 3300004785 Bacteria 747
54 Ga0058859_11577485 3300004798 Bacteria 689
55 Ga0058861_11914072 3300004800 Bacteria 688
56 Ga0065703_1000504 3300005272 Bacteria 27344
57 Ga0065714_10003312 3300005288 Bacteria 8289
58 Ga0065714_10004172 3300005288 Bacteria 9076
59 Ga0065714_10011359 3300005288 Bacteria 2582
60 Ga0065714_10066507 3300005288 Bacteria 6721
61 Ga0065714_10088098 3300005288 Bacteria 2032
62 Ga0065714_10098238 3300005288 Bacteria 1716
63 Ga0065714_10115878 3300005288 Bacteria 1408
64 Ga0065714_10177037 3300005288 Bacteria 960
65 Ga0065714_10264676 3300005288 Bacteria 750
66 Ga0065704_10071355 3300005289 Bacteria 11543
67 Ga0065704_10127589 3300005289 Bacteria 1670
68 Ga0065704_10348031 3300005289 Bacteria 814
69 Ga0065712_10016049 3300005290 Bacteria 2777
70 Ga0065712_10071153 3300005290 Bacteria 5449
71 Ga0065715_10061165 3300005293 Bacteria 959
72 Ga0065715_10223276 3300005293 Bacteria 1236
73 Ga0070658_10011063 3300005327 Bacteria 7232
74 Ga0070658_10068187 3300005327 Bacteria 2908
75 Ga0070670_100002144 3300005331 Bacteria 16199
76 Ga0070670_100096891 3300005331 Bacteria 2537
77 Ga0070680_100175563 3300005336 Bacteria 1804
78 Ga0070660_100388857 3300005339 Bacteria 1152
79 Ga0070661_100000126 3300005344 Bacteria 63357
80 Ga0070661_100001535 3300005344 Bacteria 16078
81 Ga0070668_100317372 3300005347 Bacteria 1311
82 Ga0070669_100000187 3300005353 Bacteria 53997
83 Ga0070669_100000481 3300005353 Bacteria 30338
84 Ga0070669_100312294 3300005353 Bacteria 1267
85 Ga0070675_100808153 3300005354 Bacteria 857
86 Ga0070674_100406308 3300005356 Bacteria 1114
87 Ga0070659_100001468 3300005366 Bacteria 16982
88 Ga0070659_100111253 3300005366 Bacteria 2211
89 Ga0070710_10468505 3300005437 Bacteria 857
90 Ga0070711_100003206 3300005439 Bacteria 9495
91 Ga0070663_100000012 3300005455 Bacteria 144773
92 Ga0070662_100000101 3300005457 Bacteria 47097
93 Ga0070707_100137876 3300005468 Bacteria 2373
94 Ga0070699_100101826 3300005518 Bacteria 2518
95 Ga0070679_100019496 3300005530 Bacteria 6596
96 Ga0070679_100031842 3300005530 Bacteria 5214
97 Ga0068853_100000187 3300005539 Bacteria 43749
98 Ga0068853_100155478 3300005539 Bacteria 2060
99 Ga0070665_100000991 3300005548 Bacteria 35979
100 Ga0070665_100905468 3300005548 Bacteria 895
101 Ga0070664_100000045 3300005564 Bacteria 74810
102 Ga0070664_100000491 3300005564 Bacteria 29927
103 Ga0070664_100036041 3300005564 Bacteria 4154
104 Ga0068857_100038455 3300005577 Bacteria 4237
105 Ga0068854_100000127 3300005578 Bacteria 52256
106 Ga0068854_100005297 3300005578 Bacteria 8140
107 Ga0068856_100000035 3300005614 Bacteria 124192
108 Ga0068851_10000007 3300005834 Bacteria 244101
109 Ga0068863_100079116 3300005841 Bacteria 3114
110 Ga0068863_100476334 3300005841 Bacteria 1227
111 Ga0068860_100029014 3300005843 Bacteria 5323
112 Ga0081538_10002039 3300005981 Bacteria 20160
113 Ga0075365_10207462 3300006038 Bacteria 1373
114 Ga0075365_10384063 3300006038 Bacteria 991
115 Ga0075365_10426461 3300006038 Bacteria 936
116 Ga0075368_10142611 3300006042 Bacteria 999
117 Ga0075368_10195228 3300006042 Bacteria 856
118 Ga0075363_100153465 3300006048 Bacteria 1301
119 Ga0075364_10021870 3300006051 Bacteria 4033
120 Ga0075364_10077774 3300006051 Bacteria 2190
121 Ga0075364_10118442 3300006051 Bacteria 1771
122 Ga0075364_10232689 3300006051 Bacteria 1251
123 Ga0075432_10008747 3300006058 Bacteria 3454
124 Ga0075432_10035996 3300006058 Bacteria 1720
125 Ga0075432_10090677 3300006058 Bacteria 1118
126 Ga0075432_10101492 3300006058 Bacteria 1063
127 Ga0075362_10017681 3300006177 Bacteria 2941
128 Ga0075362_10083436 3300006177 Bacteria 1475
129 Ga0075362_10204581 3300006177 Bacteria 962
130 Ga0075362_10215922 3300006177 Bacteria 936
131 Ga0075367_10034341 3300006178 Bacteria 2929
132 Ga0075367_10432556 3300006178 Bacteria 833
133 Ga0075366_10063498 3300006195 Bacteria 2195
134 Ga0075366_10214640 3300006195 Bacteria 1172
135 Ga0075436_100056271 3300006914 Bacteria 2717
136 Ga0075436_100212610 3300006914 Bacteria 1371
137 Ga0075436_100215555 3300006914 Bacteria 1361
138 Ga0075436_100279006 3300006914 Bacteria 1194
139 Ga0075436_100337469 3300006914 Bacteria 1084
140 Ga0099823_1000086 3300006944 Bacteria 44633
141 Ga0099823_1036036 3300006944 Bacteria 3825
142 Ga0079104_1000424 3300006946 Bacteria 48276
143 Ga0079104_1000718 3300006946 Bacteria 29917
144 Ga0079104_1009624 3300006946 Bacteria 3259
145 Ga0099826_10016562 3300006948 Bacteria 5567
146 Ga0075435_100174648 3300007076 Bacteria 1814
147 Ga0105251_10000274 3300009011 Bacteria 51694
148 Ga0105251_10000828 3300009011 Bacteria 27688
149 Ga0105251_10001027 3300009011 Bacteria 24511
150 Ga0105251_10003921 3300009011 Bacteria 10569
151 Ga0105251_10012768 3300009011 Bacteria 4734
152 Ga0105251_10030044 3300009011 Bacteria 2732
153 Ga0105251_10147962 3300009011 Bacteria 1061
154 Ga0105244_10002564 3300009036 Bacteria 13641
155 Ga0105244_10004785 3300009036 Bacteria 9202
156 Ga0105244_10006019 3300009036 Bacteria 7946
157 Ga0105244_10028370 3300009036 Bacteria 3003
158 Ga0105244_10068499 3300009036 Bacteria 1773
159 Ga0105244_10184439 3300009036 Bacteria 989
160 Ga0105250_10000191 3300009092 Bacteria 52429
161 Ga0105250_10013949 3300009092 Bacteria 3309
162 Ga0105250_10035745 3300009092 Bacteria 1994
163 Ga0105250_10201902 3300009092 Bacteria 839
164 Ga0105240_10252669 3300009093 Bacteria 2038
165 Ga0105240_10365136 3300009093 Bacteria 1634
166 Ga0111539_10695785 3300009094 Bacteria 1183
167 Ga0105247_10686781 3300009101 Bacteria 769
168 Ga0105243_10000418 3300009148 Bacteria 44790
169 Ga0105243_10002911 3300009148 Bacteria 14171
170 Ga0105243_10003724 3300009148 Bacteria 12232
171 Ga0105243_10005562 3300009148 Bacteria 9815
172 Ga0105243_10011149 3300009148 Bacteria 6799
173 Ga0105243_10030328 3300009148 Bacteria 4162
174 Ga0105242_10001499 3300009176 Bacteria 18352
175 Ga0105237_10001509 3300009545 Bacteria 30588
176 Ga0105237_10426342 3300009545 Bacteria 1332
177 Ga0105249_10006152 3300009553 Bacteria 10410
178 Ga0105249_10483838 3300009553 Bacteria 1281
179 Ga0105239_10422536 3300010375 Bacteria 1510
180 Ga0105246_10021610 3300011119 Bacteria 4143
181 Ga0157373_10004396 3300013100 Bacteria 10624
182 Ga0157373_10006454 3300013100 Bacteria 8758
183 Ga0157373_10042510 3300013100 Bacteria 3248
184 Ga0157373_10080342 3300013100 Bacteria 2299
185 Ga0157373_10126273 3300013100 Bacteria 1799
186 Ga0157371_10000609 3300013102 Bacteria 42602
187 Ga0157371_10003267 3300013102 Bacteria 14869
188 Ga0157371_10010705 3300013102 Bacteria 7121
189 Ga0157370_10000025 3300013104 Bacteria 158865
190 Ga0157370_10026152 3300013104 Bacteria 5765
191 Ga0157370_10068885 3300013104 Bacteria 3343
192 Ga0157370_10101418 3300013104 Bacteria 2696
193 Ga0157370_10134402 3300013104 Bacteria 2306
194 Ga0157370_10160617 3300013104 Bacteria 2091
195 Ga0157370_10225054 3300013104 Bacteria 1737
196 Ga0157370_10636936 3300013104 Bacteria 975
197 Ga0157369_10002004 3300013105 Bacteria 24531
198 Ga0157369_10020339 3300013105 Bacteria 7420
199 Ga0157369_10087691 3300013105 Bacteria 3323
200 Ga0157369_10506551 3300013105 Bacteria 1249
201 Ga0163162_10704382 3300013306 Bacteria 1131
202 Ga0157372_10000227 3300013307 Bacteria 62661
203 Ga0157372_10181212 3300013307 Bacteria 2438
204 Ga0157372_10321758 3300013307 Bacteria 1801
205 Ga0157375_10079061 3300013308 Bacteria 3323
206 Ga0157375_10080456 3300013308 Bacteria 3296
207 Ga0163163_10166706 3300014325 Bacteria 2249
208 Ga0157380_10035816 3300014326 Bacteria 3836
209 Ga0182008_10000293 3300014497 Bacteria 39393
210 Ga0182008_10032172 3300014497 Bacteria 2636
211 Ga0182008_10036046 3300014497 Bacteria 2476
212 Ga0182008_10051729 3300014497 Bacteria 2037
213 Ga0182008_10081816 3300014497 Bacteria 1589
214 Ga0157376_10194707 3300014969 Bacteria 1861
215 Ga0182006_1001907 3300015261 Bacteria 11876
216 Ga0182006_1002075 3300015261 Bacteria 11207
217 Ga0182006_1011903 3300015261 Bacteria 3810
218 Ga0182006_1017384 3300015261 Bacteria 3056
219 Ga0182006_1023480 3300015261 Bacteria 2554
220 Ga0182006_1036303 3300015261 Bacteria 1960
221 Ga0182006_1059376 3300015261 Bacteria 1448
222 Ga0182006_1097929 3300015261 Bacteria 1045
223 Ga0182007_10000284 3300015262 Bacteria 33721
224 Ga0182007_10012189 3300015262 Bacteria 3319
225 Ga0182007_10020719 3300015262 Bacteria 2345
226 Ga0182007_10029870 3300015262 Bacteria 1865
227 Ga0182005_1001150 3300015265 Bacteria 10975
228 Ga0163161_10004577 3300017792 Bacteria 9628
229 Ga0163161_10005887 3300017792 Bacteria 8506
230 Ga0163161_10022215 3300017792 Bacteria 4465
231 Ga0163161_10151888 3300017792 Bacteria 1760
232 Ga0197907_10062933 3300020069 Bacteria 670
233 Ga0197907_10109288 3300020069 Bacteria 1864
234 Ga0206356_10469082 3300020070 Bacteria 2760
235 Ga0206349_1210075 3300020075 Bacteria 2829
236 Ga0206355_1608568 3300020076 Bacteria 914
237 Ga0206351_10301792 3300020077 Bacteria 6724
238 Ga0206350_10572994 3300020080 Bacteria 817
239 Ga0206350_11061825 3300020080 Bacteria 817
240 Ga0154015_1353180 3300020610 Bacteria 9097
241 Ga0213872_10000305 3300021361 Bacteria 41889
242 Ga0213872_10010123 3300021361 Bacteria 4498
243 Ga0224712_10006729 3300022467 Bacteria 3301
244 Ga0224712_10128930 3300022467 Bacteria 1103
245 Ga0209435_100821 3300025206 Bacteria 4907
246 Ga0209760_100027 3300025207 Bacteria 153290
247 Ga0209760_100149 3300025207 Bacteria 43212
248 Ga0209760_100681 3300025207 Bacteria 5379
249 Ga0209784_100003 3300025224 Bacteria 1379451
250 Ga0209784_100007 3300025224 Bacteria 747715
251 Ga0209784_100010 3300025224 Bacteria 683664
252 Ga0209784_100441 3300025224 Bacteria 17844
253 Ga0209566_100002 3300025225 Bacteria 2614868
254 Ga0209566_100008 3300025225 Bacteria 683664
255 Ga0209566_100009 3300025225 Bacteria 554018
256 Ga0209674_100008 3300025226 Bacteria 1076909
257 Ga0209674_100019 3300025226 Bacteria 683664
258 Ga0209674_100021 3300025226 Bacteria 629811
259 Ga0209672_100235 3300025228 Bacteria 42143
260 Ga0209147_100002 3300025229 Bacteria 2158988
261 Ga0209147_100009 3300025229 Bacteria 747409
262 Ga0209563_100004 3300025230 Bacteria 1814108
263 Ga0209563_100018 3300025230 Bacteria 747850
264 Ga0209563_100021 3300025230 Bacteria 683764
265 Ga0209563_100026 3300025230 Bacteria 559453
266 Ga0207427_100005 3300025231 Bacteria 797999
267 Ga0207427_100006 3300025231 Bacteria 785415
268 Ga0207427_100342 3300025231 Bacteria 30270
269 Ga0209437_100013 3300025233 Bacteria 785457
270 Ga0209437_100018 3300025233 Bacteria 694400
271 Ga0209437_100019 3300025233 Bacteria 683764
272 Ga0209437_104041 3300025233 Bacteria 2603
273 Ga0209258_100002 3300025242 Bacteria 2158988
274 Ga0209258_100169 3300025242 Bacteria 145227
275 Ga0209258_100177 3300025242 Bacteria 140714
276 Ga0209646_1000184 3300025246 Bacteria 78423
277 Ga0209026_1012445 3300025250 Bacteria 1483
278 Ga0209677_100011 3300025253 Bacteria 683664
279 Ga0209677_100012 3300025253 Bacteria 554018
280 Ga0209677_100013 3300025253 Bacteria 548200
281 Ga0209148_1002932 3300025254 Bacteria 5175
282 Ga0209148_1003831 3300025254 Bacteria 3924
283 Ga0209759_1000399 3300025256 Bacteria 53437
284 Ga0209759_1004392 3300025256 Bacteria 5287
285 Ga0209759_1005052 3300025256 Bacteria 4733
286 Ga0209759_1005073 3300025256 Bacteria 4715
287 Ga0209759_1016653 3300025256 Bacteria 1845
288 Ga0209233_1000021 3300025261 Bacteria 798078
289 Ga0209233_1000022 3300025261 Bacteria 785415
290 Ga0209233_1000025 3300025261 Bacteria 683764
291 Ga0209565_1009039 3300025263 Bacteria 2563
292 Ga0209565_1025325 3300025263 Bacteria 1200
293 Ga0209455_1000021 3300025272 Bacteria 699993
294 Ga0209455_1000108 3300025272 Bacteria 193021
295 Ga0209675_1003233 3300025291 Bacteria 7869
296 Ga0209676_1000030 3300025292 Bacteria 506421
297 Ga0209676_1000041 3300025292 Bacteria 424583
298 Ga0209676_1000510 3300025292 Bacteria 61272
299 Ga0209676_1002546 3300025292 Bacteria 12662
300 Ga0209676_1003117 3300025292 Bacteria 10646
301 Ga0209025_1000040 3300025294 Bacteria 376228
302 Ga0209025_1000524 3300025294 Bacteria 73057
303 Ga0209050_1000024 3300025298 Bacteria 533389
304 Ga0209050_1000518 3300025298 Bacteria 64332
305 Ga0209050_1000647 3300025298 Bacteria 54000
306 Ga0209256_1000149 3300025299 Bacteria 146390
307 Ga0209051_1000023 3300025303 Bacteria 437371
308 Ga0209051_1000721 3300025303 Bacteria 36119
309 Ga0209051_1005515 3300025303 Bacteria 7377
310 Ga0209051_1009026 3300025303 Bacteria 5192
311 Ga0207656_10000006 3300025321 Bacteria 395044
312 Ga0207696_1000078 3300025711 Bacteria 207623
313 Ga0207696_1000145 3300025711 Bacteria 122321
314 Ga0207696_1008153 3300025711 Bacteria 4036
315 Ga0207696_1021631 3300025711 Bacteria 2057
316 Ga0207696_1046209 3300025711 Bacteria 1256
317 Ga0207696_1068504 3300025711 Bacteria 990
318 Ga0207655_1000014 3300025728 Bacteria 607124
319 Ga0207655_1000018 3300025728 Bacteria 537129
320 Ga0207655_1000202 3300025728 Bacteria 103907
321 Ga0207655_1000309 3300025728 Bacteria 72910
322 Ga0207655_1000388 3300025728 Bacteria 61513
323 Ga0207655_1001315 3300025728 Bacteria 23457
324 Ga0207655_1007901 3300025728 Bacteria 6830
325 Ga0207655_1015714 3300025728 Bacteria 4189
326 Ga0207655_1024451 3300025728 Bacteria 2960
327 Ga0207655_1028654 3300025728 Bacteria 2623
328 Ga0207655_1035454 3300025728 Bacteria 2227
329 Ga0207655_1054242 3300025728 Bacteria 1595
330 Ga0207713_1000010 3300025735 Bacteria 528374
331 Ga0207713_1000815 3300025735 Bacteria 28847
332 Ga0207713_1001109 3300025735 Bacteria 23001
333 Ga0207713_1001785 3300025735 Bacteria 16465
334 Ga0207713_1003196 3300025735 Bacteria 11322
335 Ga0207713_1003415 3300025735 Bacteria 10847
336 Ga0207713_1004607 3300025735 Bacteria 8904
337 Ga0207713_1006691 3300025735 Bacteria 6970
338 Ga0207713_1018033 3300025735 Bacteria 3509
339 Ga0207705_10301653 3300025909 Unclassified 1229
340 Ga0207654_10102260 3300025911 Bacteria 1767
341 Ga0207695_10001515 3300025913 Bacteria 38585
342 Ga0207695_10306689 3300025913 Bacteria 1478
343 Ga0207695_10524193 3300025913 Bacteria 1066
344 Ga0207671_10000131 3300025914 Bacteria 116866
345 Ga0207663_10057951 3300025916 Bacteria 2442
346 Ga0207660_10176502 3300025917 Bacteria 1657
347 Ga0207657_10350363 3300025919 Bacteria 1164
348 Ga0207649_10000012 3300025920 Bacteria 265674
349 Ga0207649_10000370 3300025920 Bacteria 33558
350 Ga0207652_10048901 3300025921 Bacteria 3617
351 Ga0207652_10174749 3300025921 Bacteria 1929
352 Ga0207681_10000099 3300025923 Bacteria 73220
353 Ga0207681_10000699 3300025923 Bacteria 22008
354 Ga0207681_10223433 3300025923 Bacteria 1458
355 Ga0207694_10182929 3300025924 Bacteria 1700
356 Ga0207650_10000518 3300025925 Bacteria 31804
357 Ga0207650_10000571 3300025925 Bacteria 29738
358 Ga0207644_10272424 3300025931 Bacteria 1357
359 Ga0207706_10000580 3300025933 Bacteria 38973
360 Ga0207686_10000319 3300025934 Bacteria 34615
361 Ga0207709_10000068 3300025935 Bacteria 188511
362 Ga0207709_10000071 3300025935 Bacteria 181156
363 Ga0207709_10000337 3300025935 Bacteria 49221
364 Ga0207709_10001011 3300025935 Bacteria 20847
365 Ga0207709_10003583 3300025935 Bacteria 9174
366 Ga0207709_10017354 3300025935 Bacteria 4017
367 Ga0207709_10021142 3300025935 Bacteria 3681
368 Ga0207709_10032812 3300025935 Bacteria 3044
369 Ga0207665_10131458 3300025939 Bacteria 1777
370 Ga0207711_10063414 3300025941 Bacteria 3190
371 Ga0207661_10001162 3300025944 Bacteria 17574
372 Ga0207679_10000001 3300025945 Bacteria 777444
373 Ga0207679_10000015 3300025945 Bacteria 265674
374 Ga0207712_10014475 3300025961 Bacteria 5076
375 Ga0207668_10161126 3300025972 Bacteria 1748
376 Ga0207668_10363741 3300025972 Bacteria 1213
377 Ga0207640_10000119 3300025981 Bacteria 59745
378 Ga0207640_10046142 3300025981 Bacteria 2802
379 Ga0207639_10000775 3300026041 Bacteria 21763
380 Ga0207678_10000004 3300026067 Bacteria 196743
381 Ga0207702_10000029 3300026078 Bacteria 181652
382 Ga0207641_10064155 3300026088 Bacteria 3139
383 Ga0207674_10012679 3300026116 Bacteria 9417
384 Ga0209281_1000016 3300027111 Bacteria 588107
385 Ga0209281_1000019 3300027111 Bacteria 576164
386 Ga0209281_1004114 3300027111 Bacteria 4465
387 Ga0209281_1005332 3300027111 Bacteria 3595
388 Ga0209389_1000049 3300027296 Bacteria 114702
389 Ga0209389_1064164 3300027296 Bacteria 2183
390 Ga0209371_1000106 3300027312 Bacteria 146212
391 Ga0207428_10066564 3300027907 Bacteria 2839
392 Ga0207428_10101827 3300027907 Bacteria 2219
393 Ga0207428_10157003 3300027907 Bacteria 1730
394 Ga0207428_10391467 3300027907 Bacteria 1018
395 Ga0207428_10582031 3300027907 Bacteria 808
396 Ga0207428_10589663 3300027907 Bacteria 802
397 Ga0207428_10670186 3300027907 Bacteria 743
398 Ga0268266_10002872 3300028379 Bacteria 17907
399 Ga0268264_10020980 3300028381 Bacteria 5337
400 Ga0268264_10043130 3300028381 Bacteria 3737
401 Ga0265319_1000174 3300028563 Bacteria 48778
402 Ga0265334_10033035 3300028573 Bacteria 2061
403 Ga0307517_10238794 3300028786 Bacteria 1081
404 Ga0307515_10000577 3300028794 Bacteria 86068
405 Ga0265338_10005327 3300028800 Bacteria 16841
406 Ga0268256_1000077 3300030500 Bacteria 177593
407 Ga0307511_10068564 3300030521 Bacteria 2618
408 Ga0316177_1038918 3300030731 Bacteria 3622
409 Ga0316177_1204046 3300030731 Bacteria 799
410 Ga0314311_1263845 3300030733 Bacteria 6278
411 Ga0316179_1012631 3300030734 Bacteria 5035
412 Ga0265330_10114871 3300031235 Bacteria 1148
413 Ga0265332_10064810 3300031238 Bacteria 1560
414 Ga0265325_10012992 3300031241 Bacteria 4749
415 Ga0265339_10001794 3300031249 Bacteria 15795
416 Ga0265327_10153912 3300031251 Bacteria 1066
417 Ga0265316_10005455 3300031344 Bacteria 12352
418 Ga0307513_10077668 3300031456 Bacteria 3437
419 Ga0307509_10116479 3300031507 Bacteria 2661
420 Ga0307408_100000019 3300031548 Bacteria 344502
421 Ga0307408_100001975 3300031548 Bacteria 14793
422 Ga0307408_100007309 3300031548 Bacteria 7307
423 Ga0307408_100007499 3300031548 Bacteria 7214
424 Ga0307408_100020706 3300031548 Bacteria 4443
425 Ga0307408_100030188 3300031548 Bacteria 3762
426 Ga0307408_100043515 3300031548 Bacteria 3195
427 Ga0307408_100162778 3300031548 Bacteria 1773
428 Ga0307514_10023189 3300031649 Bacteria 5038
429 Ga0265314_10000002 3300031711 Bacteria 2092193
430 Ga0307405_10002527 3300031731 Bacteria 8097
431 Ga0307405_10025146 3300031731 Bacteria 3413
432 Ga0307413_10136681 3300031824 Bacteria 1686
433 Ga0307406_10007961 3300031901 Bacteria 5902
434 Ga0307406_10052248 3300031901 Bacteria 2598
435 Ga0307407_10061619 3300031903 Bacteria 2193
436 Ga0307407_10135947 3300031903 Bacteria 1579
437 Ga0307412_10000155 3300031911 Bacteria 48968
438 Ga0307412_10001478 3300031911 Bacteria 13061
439 Ga0307412_10018416 3300031911 Bacteria 4201
440 Ga0307412_10020333 3300031911 Bacteria 4038
441 Ga0307412_10027487 3300031911 Bacteria 3547
442 Ga0307412_10098134 3300031911 Bacteria 2065
443 Ga0307412_10571708 3300031911 Bacteria 952
444 Ga0307412_10725525 3300031911 Bacteria 855
445 Ga0307409_100066516 3300031995 Bacteria 2842
446 Ga0307409_100080210 3300031995 Bacteria 2633
447 Ga0307416_100563229 3300032002 Bacteria 1214
448 Ga0307414_10000041 3300032004 Bacteria 144783
449 Ga0307414_10001579 3300032004 Bacteria 11830
450 Ga0307414_10003999 3300032004 Bacteria 7958
451 Ga0307414_10059474 3300032004 Bacteria 2698
452 Ga0307414_10067128 3300032004 Bacteria 2567
453 Ga0307414_10254278 3300032004 Bacteria 1462
454 Ga0307414_10843689 3300032004 Bacteria 837
455 Ga0307414_11077526 3300032004 Bacteria 741
456 Ga0307411_10007711 3300032005 Bacteria 5512
457 Ga0307411_10110186 3300032005 Bacteria 1968
458 Ga0307411_11119578 3300032005 Bacteria 710
459 Ga0307415_100117470 3300032126 Bacteria 1987
460 Ga0395900_0001438 3300037418 Bacteria 28413
461 Ga0395898_0326538 3300037466 Bacteria 1463
462 Ga0395905_0316328 3300037471 Bacteria 1450
463 Ga0395901_0522027 3300038443 Bacteria 1206
464 Ga0237819_01092 3300038705 Bacteria 7986
465 Ga0436365_1128753 3300039437 Bacteria 1310
466 Ga0436361_0662862 3300039447 Bacteria 13181
467 Ga0436361_1088302 3300039447 Bacteria 21721
468 Ga0439436_0001261 3300041404 Bacteria 7227
469 Ga0439438_000413 3300041405 Bacteria 19264
470 Ga0439438_002141 3300041405 Bacteria 8507
471 Ga0439438_003418 3300041405 Bacteria 6424
472 Ga0439438_006264 3300041405 Bacteria 4228
473 Ga0439438_006353 3300041405 Bacteria 4185
474 Ga0439438_010630 3300041405 Bacteria 2899
475 Ga0439438_011185 3300041405 Bacteria 2805
476 Ga0439438_011922 3300041405 Bacteria 2686
477 Ga0439438_016210 3300041405 Bacteria 2170
478 Ga0439438_044230 3300041405 Bacteria 1147
479 Ga0439438_044369 3300041405 Bacteria 1145
480 Ga0439447_000185 3300041407 Bacteria 22086
481 Ga0439447_001317 3300041407 Bacteria 9029
482 Ga0439447_004258 3300041407 Bacteria 4959
483 Ga0439447_004487 3300041407 Bacteria 4788
484 Ga0439447_005893 3300041407 Bacteria 4027
485 Ga0439447_006591 3300041407 Bacteria 3753
486 Ga0439447_010479 3300041407 Bacteria 2748
487 Ga0439466_0000460 3300041411 Bacteria 15548
488 Ga0439466_0002029 3300041411 Bacteria 7942
489 Ga0439466_0006648 3300041411 Bacteria 4390
490 Ga0439466_0007338 3300041411 Bacteria 4175
491 Ga0439466_0013865 3300041411 Bacteria 2945
492 Ga0439466_0015107 3300041411 Bacteria 2806
493 Ga0439466_0016538 3300041411 Bacteria 2664
494 Ga0439466_0018278 3300041411 Bacteria 2516
495 Ga0439466_0025288 3300041411 Bacteria 2073
496 Ga0439466_0028941 3300041411 Bacteria 1908
497 Ga0439466_0041300 3300041411 Bacteria 1539
498 Ga0439465_0000298 3300041413 Bacteria 13971
499 Ga0439431_0006104 3300041997 Bacteria 2660
500 Ga0439445_0000755 3300042004 Bacteria 6784
501 Ga0439445_0007805 3300042004 Bacteria 2492
502 Ga0439432_000797 3300042006 Bacteria 11779
503 Ga0439432_002776 3300042006 Bacteria 6527
504 Ga0439432_003848 3300042006 Bacteria 5533
505 Ga0439432_005322 3300042006 Bacteria 4645
506 Ga0439432_015589 3300042006 Bacteria 2564
507 Ga0439432_015972 3300042006 Bacteria 2529
508 Ga0439432_016716 3300042006 Bacteria 2467
509 Ga0439432_045898 3300042006 Bacteria 1373
510 Ga0439432_073626 3300042006 Bacteria 1039
511 Ga0439451_001405 3300042009 Bacteria 4759
512 Ga0439451_006121 3300042009 Bacteria 2459
513 Ga0439451_014709 3300042009 Bacteria 1578
514 Ga0439451_018243 3300042009 Bacteria 1415
515 Ga0439452_000354 3300042010 Bacteria 28113
516 Ga0439452_000769 3300042010 Bacteria 15322
517 Ga0439452_000864 3300042010 Bacteria 14004
518 Ga0439452_004376 3300042010 Bacteria 4748
519 Ga0439452_010875 3300042010 Bacteria 2632
520 Ga0439452_020001 3300042010 Bacteria 1761
521 Ga0439452_025050 3300042010 Bacteria 1517
522 Ga0439456_000043 3300042013 Bacteria 45603
523 Ga0439456_000444 3300042013 Bacteria 9140
524 Ga0439456_006434 3300042013 Bacteria 2399
525 Ga0439463_000618 3300042016 Bacteria 9853
526 Ga0439463_001239 3300042016 Bacteria 6828
527 Ga0439463_002794 3300042016 Bacteria 4429
528 Ga0439463_031436 3300042016 Bacteria 1339
529 Ga0450911_000118 3300042115 Bacteria 31744
530 Ga0450911_000515 3300042115 Bacteria 12209
531 Ga0450911_000943 3300042115 Bacteria 7611
532 Ga0450911_001271 3300042115 Bacteria 6029
533 Ga0450911_009389 3300042115 Bacteria 1371
534 Ga0450919_002285 3300042121 Bacteria 2483
535 Ga0450920_003501 3300042122 Bacteria 2723
536 Ga0450921_008231 3300042123 Bacteria 843
537 Ga0450922_000114 3300042124 Bacteria 7857
538 Ga0450922_000386 3300042124 Bacteria 4730
539 Ga0450923_003986 3300042125 Bacteria 2282
540 Ga0450923_050833 3300042125 Bacteria 890
541 Ga0450890_000259 3300042127 Bacteria 7780
542 Ga0450902_003798 3300042137 Bacteria 2227
543 Ga0450902_016646 3300042137 Bacteria 1199
544 Ga0450902_031180 3300042137 Bacteria 897
545 Ga0450903_001100 3300042138 Bacteria 5135
546 Ga0450903_002913 3300042138 Bacteria 2989
547 Ga0450904_001416 3300042139 Bacteria 3395
548 Ga0450906_000802 3300042145 Bacteria 6878
549 Ga0450906_006857 3300042145 Bacteria 2278
550 Ga0450907_000322 3300042146 Bacteria 15515
551 Ga0450907_001362 3300042146 Bacteria 5388
552 Ga0450907_001620 3300042146 Bacteria 4721
553 Ga0450910_000704 3300042147 Bacteria 4003
554 Ga0450910_013822 3300042147 Bacteria 1177
555 Ga0439446_0000162 3300042156 Bacteria 11674
556 Ga0439446_0002703 3300042156 Bacteria 4288
557 Ga0450908_000612 3300042184 Bacteria 6837
558 Ga0450908_001252 3300042184 Bacteria 4911
559 Ga0450909_004087 3300042185 Bacteria 2079
560 Ga0439434_0000151 3300042435 Bacteria 18441
561 Ga0439434_0001524 3300042435 Bacteria 6664
562 Ga0439434_0052588 3300042435 Bacteria 1265
563 Ga0439460_0000441 3300042461 Bacteria 8883
564 Ga0439460_0000521 3300042461 Bacteria 8350
565 Ga0439460_0004619 3300042461 Bacteria 3360
566 Ga0439460_0029891 3300042461 Bacteria 1545
567 Ga0439460_0155461 3300042461 Bacteria 765
568 Ga0450893_0004391 3300042532 Bacteria 2247
569 Ga0450901_002284 3300042533 Bacteria 2089
570 Ga0439440_0000802 3300042993 Bacteria 5441
571 Ga0495617_001375 3300046452 Bacteria 10746
572 Ga0495617_001612 3300046452 Bacteria 9739
573 Ga0495617_014525 3300046452 Bacteria 2676
574 Ga0495617_022087 3300046452 Bacteria 2150
575 Ga0495627_003332 3300046453 Bacteria 7141
576 Ga0495627_012631 3300046453 Bacteria 2991
577 Ga0495627_037720 3300046453 Bacteria 1498
578 Ga0495603_0017024 3300046455 Bacteria 4398
579 Ga0495590_0002290 3300046457 Bacteria 7982
580 Ga0495590_0002876 3300046457 Bacteria 7088
581 Ga0495590_0005412 3300046457 Bacteria 5069
582 Ga0495590_0084334 3300046457 Bacteria 1120
583 Ga0495591_000463 3300046458 Bacteria 32629
584 Ga0495591_004255 3300046458 Bacteria 7087
585 Ga0495591_004969 3300046458 Bacteria 6294
586 Ga0495591_009434 3300046458 Bacteria 3882
587 Ga0495591_026079 3300046458 Bacteria 1823
588 Ga0495591_031318 3300046458 Bacteria 1597
589 Ga0495591_034228 3300046458 Bacteria 1497
590 Ga0495591_037868 3300046458 Bacteria 1392
591 Ga0495591_059346 3300046458 Bacteria 1020
592 Ga0495638_0017183 3300046460 Bacteria 4830
593 Ga0495638_0020816 3300046460 Bacteria 4332
594 Ga0495638_0020892 3300046460 Bacteria 4322
595 Ga0495638_0052858 3300046460 Bacteria 2529
596 Ga0495638_0067462 3300046460 Bacteria 2196
597 Ga0495638_0093596 3300046460 Bacteria 1807
598 Ga0495638_0135217 3300046460 Bacteria 1444
599 Ga0495638_0136514 3300046460 Bacteria 1435
600 Ga0495653_0005988 3300046463 Bacteria 9953
601 Ga0495650_0004305 3300046471 Bacteria 9819
602 Ga0495650_0004442 3300046471 Bacteria 9600
603 Ga0495650_0006511 3300046471 Bacteria 7257
604 Ga0495650_0049781 3300046471 Bacteria 1737
605 Ga0495605_0002791 3300046474 Bacteria 10633
606 Ga0495605_0012263 3300046474 Bacteria 4758
607 Ga0495605_0016231 3300046474 Bacteria 4033
608 Ga0495605_0029228 3300046474 Bacteria 2839
609 Ga0495605_0035624 3300046474 Bacteria 2514
610 Ga0495605_0057448 3300046474 Bacteria 1872
611 Ga0495639_0000444 3300046475 Bacteria 19714
612 Ga0495664_0283043 3300046477 Bacteria 1002
613 Ga0495584_0001930 3300046491 Bacteria 11930
614 Ga0495584_0006526 3300046491 Bacteria 6097
615 Ga0495584_0009316 3300046491 Bacteria 5058
616 Ga0495584_0010251 3300046491 Bacteria 4814
617 Ga0495584_0010587 3300046491 Bacteria 4737
618 Ga0495584_0011913 3300046491 Bacteria 4445
619 Ga0495584_0011929 3300046491 Bacteria 4442
620 Ga0495585_0002921 3300046492 Bacteria 11833
621 Ga0495585_0004927 3300046492 Bacteria 8540
622 Ga0495585_0005380 3300046492 Bacteria 8077
623 Ga0495585_0016691 3300046492 Bacteria 4253
624 Ga0495585_0079802 3300046492 Bacteria 1774
625 Ga0495585_0083975 3300046492 Bacteria 1723
626 Ga0495585_0114606 3300046492 Bacteria 1430
627 Ga0495596_0002695 3300046500 Bacteria 9364
628 Ga0495607_0006796 3300046501 Bacteria 7990
629 Ga0495607_0006981 3300046501 Bacteria 7863
630 Ga0495607_0007583 3300046501 Bacteria 7488
631 Ga0495607_0014785 3300046501 Bacteria 5074
632 Ga0495607_0028506 3300046501 Bacteria 3445
633 Ga0495607_0055584 3300046501 Bacteria 2276
634 Ga0495607_0060380 3300046501 Bacteria 2158
635 Ga0495607_0065116 3300046501 Bacteria 2056
636 Ga0495607_0065776 3300046501 Bacteria 2042
637 Ga0495607_0222531 3300046501 Bacteria 922
638 Ga0495583_0002807 3300046506 Bacteria 14274
639 Ga0495583_0005217 3300046506 Bacteria 8922
640 Ga0495606_0000177 3300046507 Bacteria 112843
641 Ga0495606_0009768 3300046507 Bacteria 8067
642 Ga0495606_0021409 3300046507 Bacteria 4735
643 Ga0495606_0025720 3300046507 Bacteria 4208
644 Ga0495606_0026432 3300046507 Bacteria 4138
645 Ga0495606_0037403 3300046507 Bacteria 3297
646 Ga0495606_0038442 3300046507 Bacteria 3237
647 Ga0495606_0068766 3300046507 Bacteria 2239
648 Ga0495606_0111488 3300046507 Bacteria 1649
649 Ga0495610_0003101 3300046512 Bacteria 13241
650 Ga0495610_0007353 3300046512 Bacteria 7353
651 Ga0495610_0007859 3300046512 Bacteria 7014
652 Ga0495610_0015192 3300046512 Bacteria 4486
653 Ga0495610_0018566 3300046512 Bacteria 3922
654 Ga0495610_0047645 3300046512 Bacteria 2107
655 Ga0495610_0086259 3300046512 Bacteria 1430
656 Ga0495610_0188096 3300046512 Bacteria 854
657 Ga0495616_0005418 3300046513 Bacteria 7861
658 Ga0495616_0015338 3300046513 Bacteria 4260
659 Ga0495616_0018417 3300046513 Bacteria 3833
660 Ga0495616_0022030 3300046513 Bacteria 3444
661 Ga0495616_0035602 3300046513 Bacteria 2574
662 Ga0495616_0083868 3300046513 Bacteria 1519
663 Ga0495620_0000039 3300046515 Bacteria 112877
664 Ga0495620_0006831 3300046515 Bacteria 6235
665 Ga0495620_0047560 3300046515 Bacteria 1845
666 Ga0495630_0008413 3300046517 Bacteria 7398
667 Ga0495631_0002026 3300046518 Bacteria 11793
668 Ga0495631_0015598 3300046518 Bacteria 3636
669 Ga0495631_0030329 3300046518 Bacteria 2454
670 Ga0495632_0001966 3300046519 Bacteria 16344
671 Ga0495632_0003351 3300046519 Bacteria 11416
672 Ga0495632_0003817 3300046519 Bacteria 10487
673 Ga0495632_0008689 3300046519 Bacteria 6199
674 Ga0495632_0013762 3300046519 Bacteria 4603
675 Ga0495632_0026572 3300046519 Bacteria 3045
676 Ga0495632_0043247 3300046519 Bacteria 2252
677 Ga0495632_0049112 3300046519 Bacteria 2087
678 Ga0495632_0104722 3300046519 Bacteria 1331
679 Ga0495637_0000393 3300046520 Bacteria 32465
680 Ga0495637_0002680 3300046520 Bacteria 9721
681 Ga0495637_0003136 3300046520 Bacteria 8823
682 Ga0495637_0003862 3300046520 Bacteria 7862
683 Ga0495637_0028791 3300046520 Bacteria 2477
684 Ga0495637_0030539 3300046520 Bacteria 2390
685 Ga0495637_0038598 3300046520 Bacteria 2066
686 Ga0495637_0040801 3300046520 Bacteria 1995
687 Ga0495637_0051080 3300046520 Bacteria 1732
688 Ga0495637_0078430 3300046520 Bacteria 1320
689 Ga0495637_0078500 3300046520 Bacteria 1319
690 Ga0495637_0129801 3300046520 Bacteria 963
691 Ga0495643_0001673 3300046522 Bacteria 19405
692 Ga0495643_0009672 3300046522 Bacteria 5968
693 Ga0495643_0012882 3300046522 Bacteria 5030
694 Ga0495643_0171255 3300046522 Bacteria 1061
695 Ga0495643_0177923 3300046522 Bacteria 1035
696 Ga0495644_0000975 3300046523 Bacteria 11863
697 Ga0495644_0005130 3300046523 Bacteria 5127
698 Ga0495644_0049038 3300046523 Bacteria 1586
699 Ga0495648_0000960 3300046524 Bacteria 29754
700 Ga0495648_0011440 3300046524 Bacteria 6684
701 Ga0495648_0019242 3300046524 Bacteria 4809
702 Ga0495648_0044392 3300046524 Bacteria 2775
703 Ga0495648_0064927 3300046524 Bacteria 2148
704 Ga0495648_0065311 3300046524 Bacteria 2140
705 Ga0495648_0131296 3300046524 Bacteria 1331
706 Ga0495648_0146757 3300046524 Bacteria 1235
707 Ga0495648_0158352 3300046524 Bacteria 1173
708 Ga0495648_0208269 3300046524 Bacteria 973
709 Ga0495666_0004351 3300046526 Bacteria 7147
710 Ga0495642_0000237 3300046528 Bacteria 31221
711 Ga0495642_0000270 3300046528 Bacteria 29305
712 Ga0495642_0012208 3300046528 Bacteria 3310
713 Ga0495654_0003373 3300046530 Bacteria 9838
714 Ga0495654_0006226 3300046530 Bacteria 6800
715 Ga0495654_0013941 3300046530 Bacteria 4288
716 Ga0495654_0014836 3300046530 Bacteria 4141
717 Ga0495654_0016049 3300046530 Bacteria 3967
718 Ga0495654_0016726 3300046530 Bacteria 3867
719 Ga0495654_0019909 3300046530 Bacteria 3503
720 Ga0495654_0056165 3300046530 Bacteria 1904
721 Ga0495654_0093612 3300046530 Bacteria 1391
722 Ga0495654_0128740 3300046530 Bacteria 1138
723 Ga0495609_0006042 3300046538 Bacteria 6240
724 Ga0495609_0007083 3300046538 Bacteria 5643
725 Ga0495609_0008362 3300046538 Bacteria 5071
726 Ga0495609_0068506 3300046538 Bacteria 1561
727 Ga0495609_0095384 3300046538 Bacteria 1291
728 Ga0495597_0008969 3300046542 Bacteria 4983
729 Ga0495597_0029685 3300046542 Bacteria 2496
730 Ga0495597_0034222 3300046542 Bacteria 2296
731 Ga0495597_0039639 3300046542 Bacteria 2109
732 Ga0495597_0077882 3300046542 Bacteria 1420
733 Ga0495622_0005331 3300046557 Bacteria 5969
734 Ga0495622_0007157 3300046557 Bacteria 5184
735 Ga0495622_0037419 3300046557 Bacteria 2260
736 Ga0495633_0009466 3300046558 Bacteria 5376
737 Ga0495633_0018776 3300046558 Bacteria 3506
738 Ga0495633_0051670 3300046558 Bacteria 1936
739 Ga0495633_0060047 3300046558 Bacteria 1782
740 Ga0495668_0002528 3300046616 Bacteria 14911
741 Ga0495668_0055166 3300046616 Bacteria 2194
742 Ga0495611_0002529 3300046648 Bacteria 8315
743 Ga0495625_0000501 3300046660 Bacteria 58243
744 Ga0495625_0040982 3300046660 Bacteria 3372
745 Ga0495625_0053539 3300046660 Bacteria 2885
746 Ga0495625_0089581 3300046660 Bacteria 2129
747 Ga0495625_0144246 3300046660 Bacteria 1604
748 Ga0495625_0180050 3300046660 Bacteria 1406
749 Ga0495659_0001738 3300046664 Bacteria 7248
750 Ga0495661_0000061 3300046665 Bacteria 130811
751 Ga0495661_0007575 3300046665 Bacteria 7564
752 Ga0495661_0022508 3300046665 Bacteria 4100
753 Ga0495661_0032339 3300046665 Bacteria 3307
754 Ga0495661_0044113 3300046665 Bacteria 2736
755 Ga0495661_0050582 3300046665 Bacteria 2515
756 Ga0495661_0071447 3300046665 Bacteria 2028
757 Ga0495588_0037096 3300046674 Bacteria 2475
758 Ga0495588_0107113 3300046674 Bacteria 1471
759 Ga0495623_0009150 3300046679 Bacteria 6426
760 Ga0495669_0060742 3300046684 Bacteria 1709
761 Ga0495613_0028910 3300046689 Bacteria 4123
762 Ga0495670_0007368 3300046691 Bacteria 5407
763 Ga0495670_0032832 3300046691 Bacteria 2581
764 Ga0495670_0045971 3300046691 Bacteria 2180
765 Ga0495670_0079658 3300046691 Bacteria 1667
766 Ga0495671_0000805 3300046692 Bacteria 22397
767 Ga0495671_0002987 3300046692 Bacteria 10508
768 Ga0495671_0066941 3300046692 Bacteria 1767
769 Ga0495671_0264954 3300046692 Bacteria 828
770 Ga0495649_0000531 3300046694 Bacteria 32369
771 Ga0495649_0001245 3300046694 Bacteria 19590
772 Ga0495649_0003048 3300046694 Bacteria 11493
773 Ga0495649_0003710 3300046694 Bacteria 10160
774 Ga0495649_0012270 3300046694 Bacteria 4993
775 Ga0495649_0018586 3300046694 Bacteria 3908
776 Ga0495649_0051485 3300046694 Bacteria 2232
777 Ga0495649_0078880 3300046694 Bacteria 1761
778 Ga0495649_0088332 3300046694 Bacteria 1653
779 Ga0495589_0002695 3300046794 Bacteria 9817
780 Ga0495589_0012290 3300046794 Bacteria 4438
781 Ga0495589_0015306 3300046794 Bacteria 3948
782 Ga0495589_0037613 3300046794 Bacteria 2424
783 Ga0495589_0046040 3300046794 Bacteria 2165
784 Ga0495660_0029689 3300046810 Bacteria 3083
785 Ga0495660_0037406 3300046810 Bacteria 2702
786 Ga0495660_0070082 3300046810 Bacteria 1862
787 Ga0495660_0085758 3300046810 Bacteria 1645
788 Ga0495660_0113005 3300046810 Bacteria 1383
789 Ga0495660_0190575 3300046810 Bacteria 985
790 Ga0495581_0003592 3300047315 Bacteria 8918
791 Ga0495581_0236406 3300047315 Bacteria 1069
792 Ga0495636_0002667 3300047318 Bacteria 6887
793 Ga0495636_0014338 3300047318 Bacteria 3150
794 Ga0495636_0014946 3300047318 Bacteria 3090
795 Ga0495672_0004415 3300047320 Bacteria 11531
796 Ga0495672_0005033 3300047320 Bacteria 10571
797 Ga0495672_0012539 3300047320 Bacteria 5910
798 Ga0495672_0017611 3300047320 Bacteria 4775
799 Ga0495672_0025576 3300047320 Bacteria 3774
800 Ga0495672_0028180 3300047320 Bacteria 3557
801 Ga0495672_0028941 3300047320 Bacteria 3496
802 Ga0495672_0068702 3300047320 Bacteria 2013
803 Ga0495672_0098395 3300047320 Bacteria 1591
804 Ga0495672_0142219 3300047320 Bacteria 1252
805 Ga0495672_0282460 3300047320 Bacteria 793
806 Ga0495676_0008681 3300047321 Bacteria 9302
807 Ga0495680_0018582 3300047322 Bacteria 5893
808 Ga0495680_0075397 3300047322 Bacteria 2559
809 Ga0495683_0000207 3300047323 Bacteria 55998
810 Ga0495683_0002916 3300047323 Bacteria 10128
811 Ga0495683_0003871 3300047323 Bacteria 8617
812 Ga0495683_0038518 3300047323 Bacteria 2420
813 Ga0495683_0042127 3300047323 Bacteria 2302
814 Ga0495687_005908 3300047443 Bacteria 7654
815 Ga0495687_012488 3300047443 Bacteria 4486
816 Ga0495687_028666 3300047443 Bacteria 2586
817 Ga0495675_0018497 3300047444 Bacteria 4422
818 Ga0495677_0001738 3300047445 Bacteria 8726
819 Ga0495679_005828 3300047446 Bacteria 5416
820 Ga0495679_016669 3300047446 Bacteria 2652
821 Ga0495673_0002875 3300047469 Bacteria 11711
822 Ga0495673_0009659 3300047469 Bacteria 5318
823 Ga0495673_0013229 3300047469 Bacteria 4343
824 Ga0495673_0022816 3300047469 Bacteria 3059
825 Ga0495673_0029293 3300047469 Bacteria 2599
826 Ga0495673_0042856 3300047469 Bacteria 2028
827 Ga0495673_0234113 3300047469 Bacteria 675
828 Ga0495681_0001573 3300047470 Bacteria 16993
829 Ga0495681_0004171 3300047470 Bacteria 9931
830 Ga0495681_0005234 3300047470 Bacteria 8713
831 Ga0495681_0006018 3300047470 Bacteria 8031
832 Ga0495681_0007812 3300047470 Bacteria 6773
833 Ga0495681_0034316 3300047470 Bacteria 2529
834 Ga0495681_0041884 3300047470 Bacteria 2220
835 Ga0495681_0050152 3300047470 Bacteria 1968
836 Ga0495681_0066529 3300047470 Bacteria 1644
837 Ga0495684_0006237 3300047471 Bacteria 9265
838 Ga0495686_0000127 3300047472 Bacteria 156278
839 Ga0495686_0008952 3300047472 Bacteria 7270
840 Ga0495686_0022085 3300047472 Bacteria 4213
841 Ga0495626_0000678 3300048091 Bacteria 32578
842 Ga0495626_0003052 3300048091 Bacteria 10994
843 Ga0495626_0003444 3300048091 Bacteria 10139
844 Ga0495626_0003637 3300048091 Bacteria 9810
845 Ga0495626_0014645 3300048091 Bacteria 4036
846 Ga0495626_0018953 3300048091 Bacteria 3444
847 Ga0495626_0036940 3300048091 Bacteria 2324
848 Ga0496102_0168949 3300048905 Bacteria 2059
849 Ga0496102_0260550 3300048905 Bacteria 1635
850 Ga0496103_0044661 3300048906 Bacteria 2731
851 Ga0496108_0239453 3300048911 Bacteria 1578
852 Ga0496108_0639818 3300048911 Bacteria 925
853 Ga0496109_0179782 3300048912 Bacteria 1986
854 Ga0496110_0049069 3300048913 Bacteria 3702
855 Ga0496110_0049528 3300048913 Bacteria 3685
856 Ga0496110_0309836 3300048913 Bacteria 1438
857 Ga0496110_0707054 3300048913 Bacteria 909
858 Ga0496111_0032978 3300048914 Bacteria 3693
859 Ga0496111_0213673 3300048914 Bacteria 1433
860 Ga0496114_0007131 3300048917 Bacteria 8815
861 Ga0496114_0391165 3300048917 Bacteria 1231
862 Ga0496116_0000670 3300048919 Bacteria 44682
863 Ga0496116_0029466 3300048919 Bacteria 3956
864 Ga0496117_0002093 3300048920 Bacteria 26276
865 Ga0496117_0002217 3300048920 Bacteria 25149
866 Ga0496117_0003858 3300048920 Bacteria 17058
867 Ga0496117_0006799 3300048920 Bacteria 11402
868 Ga0496117_0013238 3300048920 Bacteria 7210
869 Ga0496117_0043602 3300048920 Bacteria 3260
870 Ga0496117_0155598 3300048920 Bacteria 1346
871 Ga0496118_0001842 3300048921 Bacteria 30363
872 Ga0496118_0037855 3300048921 Bacteria 3874
873 Ga0496118_0041256 3300048921 Bacteria 3657
874 Ga0496118_0054999 3300048921 Bacteria 3008
875 Ga0496118_0074123 3300048921 Bacteria 2434
876 Ga0496118_0145066 3300048921 Bacteria 1496
877 Ga0496119_0000229 3300048922 Bacteria 78634
878 Ga0496119_0059214 3300048922 Bacteria 2302
879 Ga0496119_0223052 3300048922 Bacteria 963
880 Ga0496120_0001476 3300048923 Bacteria 27987
881 Ga0496121_0001246 3300048924 Bacteria 44184
882 Ga0496121_0032444 3300048924 Bacteria 4746
883 Ga0496121_0180633 3300048924 Bacteria 1523
884 Ga0496121_0214588 3300048924 Bacteria 1360
885 Ga0496122_0000590 3300048925 Bacteria 74565
886 Ga0496122_0001846 3300048925 Bacteria 32295
887 Ga0496122_0002049 3300048925 Bacteria 29920
888 Ga0496122_0009159 3300048925 Bacteria 10484
889 Ga0496122_0021605 3300048925 Bacteria 5754
890 Ga0496122_0076098 3300048925 Bacteria 2363
891 Ga0496123_0000088 3300048926 Bacteria 180478
892 Ga0496123_0002062 3300048926 Bacteria 25924
893 Ga0496123_0033910 3300048926 Bacteria 3666
894 Ga0496123_0060313 3300048926 Bacteria 2447
895 Ga0496123_0092130 3300048926 Bacteria 1795
896 Ga0496124_0003431 3300048927 Bacteria 19406
897 Ga0496124_0014858 3300048927 Bacteria 7501
898 Ga0496124_0020430 3300048927 Bacteria 6118
899 Ga0496124_0117519 3300048927 Bacteria 2130
900 Ga0496124_0167101 3300048927 Bacteria 1708
901 Ga0496124_0224873 3300048927 Bacteria 1408
902 Ga0496124_0440525 3300048927 Bacteria 891
903 Ga0496125_0001017 3300048928 Bacteria 43607
904 Ga0496125_0006232 3300048928 Bacteria 12973
905 Ga0496125_0012694 3300048928 Bacteria 8338
906 Ga0496125_0014635 3300048928 Bacteria 7626
907 Ga0496125_0029631 3300048928 Bacteria 4914
908 Ga0496125_0041485 3300048928 Bacteria 3932
909 Ga0496125_0074765 3300048928 Bacteria 2626
910 Ga0496125_0264565 3300048928 Bacteria 1075
911 Ga0496126_0167615 3300048929 Bacteria 1873
912 Ga0496126_0346797 3300048929 Bacteria 1215
913 Ga0495678_005047 3300049459 Bacteria 7423
914 Ga0495678_011637 3300049459 Bacteria 4203
915 Ga0495678_015508 3300049459 Bacteria 3502
916 Ga0495678_017639 3300049459 Bacteria 3227
917 Ga0495678_018354 3300049459 Bacteria 3147
918 Ga0495678_028700 3300049459 Bacteria 2344
919 Ga0495678_114535 3300049459 Bacteria 914
920 Ga0495682_0000124 3300049460 Bacteria 67600
921 Ga0495682_0003137 3300049460 Bacteria 7471
922 Ga0501300_004266 3300049523 Bacteria 2121
923 Ga0501303_000992 3300049526 Bacteria 2127
924 Ga0501033_0091253 3300049570 Bacteria 2228
925 Ga0501034_0000101 3300049571 Bacteria 158656
926 Ga0501038_0466971 3300049574 Bacteria 969
927 Ga0501046_0215662 3300049580 Bacteria 1423
928 Ga0501070_0972403 3300049586 Bacteria 659
929 Ga0501209_000112 3300049656 Bacteria 8525
930 Ga0501222_004934 3300049662 Bacteria 1808
931 Ga0501227_047146 3300049665 Bacteria 1079
932 Ga0501251_000381 3300049681 Bacteria 3953
933 Ga0501083_0076214 3300049744 Bacteria 2226
934 Ga0501241_000003 3300049758 Bacteria 178857
935 Ga0501241_009560 3300049758 Bacteria 1765
936 Ga0501269_000126 3300049766 Bacteria 24145
937 Ga0501280_000401 3300049776 Bacteria 10423
938 Ga0501282_002303 3300049778 Bacteria 2095
939 Ga0501035_0011403 3300049822 Bacteria 8240
940 Ga0501044_0000396 3300049823 Bacteria 54058
941 Ga0501044_0025147 3300049823 Bacteria 6313
942 Ga0501044_0097323 3300049823 Bacteria 2964
943 Ga0501226_002989 3300049853 Bacteria 2029
944 nmdc:mga03683_69492_c1 3300050489 Bacteria 1503
945 nmdc:mga03683_74871_c1 3300050489 Bacteria 1453
946 nmdc:mga00v17_46197_c1 3300050491 Bacteria 2634
947 nmdc:mga00v17_98480_c1 3300050491 Bacteria 1844
948 nmdc:mga0k408_134424_c1 3300050493 Bacteria 1469
949 nmdc:mga0k408_76008_c1 3300050493 Bacteria 1963
950 nmdc:mga07m45_218950_c1 3300050496 Bacteria 1107
951 nmdc:mga09592_392247_c1 3300050508 Bacteria 1200
952 nmdc:mga0qj67_81770_c1 3300050509 Bacteria 2590
953 nmdc:mga0rr50_1060650_c1 3300050513 Bacteria 690
954 nmdc:mga08x19_200157_c1 3300050514 Bacteria 1369
955 nmdc:mga08x19_48891_c1 3300050514 Bacteria 2711
956 Ga0500618_002135 3300053125 Bacteria 7802
957 Ga0500659_0002113 3300053135 Bacteria 12131
958 Ga0500573_0133974 3300053140 Bacteria 1370
959 Ga0500636_0004580 3300053177 Bacteria 7841
960 Ga0590075_029884 3300059424 Bacteria 1379
961 Ga0587084_003707 3300059477 Bacteria 1698
962 Ga0587073_0005079 3300059492 Bacteria 1935
963 Ga0587088_001545 3300059508 Bacteria 2412
964 Ga0587091_004577 3300059511 Bacteria 1825
965 Ga0587101_040959 3300059623 Bacteria 764
966 Ga0587067_000901 3300059640 Bacteria 2962
967 Ga0587068_004107 3300059641 Bacteria 1907
968 Ga0587072_000193 3300059643 Bacteria 5362
969 Ga0587105_006430 3300059651 Bacteria 807

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049586 Ga0501070_0972403 Ga0501070_0972403_25_579 174
2 3300004785 Ga0058858_1283826 Ga0058858_12838261 200
3 3300004798 Ga0058859_11577485 Ga0058859_115774851 200
4 3300005354 Ga0070675_100808153 Ga0070675_1008081531 200
5 3300014326 Ga0157380_10035816 Ga0157380_100358162 200
6 3300046520 Ga0495637_0030539 Ga0495637_0030539_203_808 200
7 3300021361 Ga0213872_10010123 Ga0213872_100101234 202
8 3300039447 Ga0436361_0662862 Ga0436361_0662862_9032_9670 202
9 3300005339 Ga0070660_100388857 Ga0070660_1003888571 203
10 3300005366 Ga0070659_100001468 Ga0070659_10000146823 203
11 3300015261 Ga0182006_1059376 Ga0182006_10593761 203
12 3300015262 Ga0182007_10020719 Ga0182007_100207192 203
13 3300025919 Ga0207657_10350363 Ga0207657_103503631 203
14 3300048927 Ga0496124_0117519 Ga0496124_0117519_1396_2013 205
15 3300021361 Ga0213872_10000305 Ga0213872_1000030529 206
16 3300039447 Ga0436361_1088302 Ga0436361_1088302_8944_9588 206
17 3300005336 Ga0070680_100175563 Ga0070680_1001755633 207
18 3300005530 Ga0070679_100031842 Ga0070679_1000318425 207
19 3300022467 Ga0224712_10128930 Ga0224712_101289302 207
20 3300025917 Ga0207660_10176502 Ga0207660_101765023 207
21 3300025921 Ga0207652_10048901 Ga0207652_100489013 207
22 iso_pu_bacteria 2511231000 2511232913 207
23 iso_pu_bacteria 2582581281 2585157611 207
24 iso_pu_bacteria 2582581282 2585162009 207
25 iso_pu_bacteria 2585428045 2587679339 207
26 iso_pu_bacteria 2585428115 2587945138 207
27 iso_pu_bacteria 2585428187 2588232752 207
28 iso_pu_bacteria 2588254255 2590601741 207
29 iso_pu_bacteria 2738541283 2738757183 207
30 iso_pu_bacteria 2775506739 2775671778 207
31 iso_pu_bacteria 2889290771 2889295075 207
32 iso_pu_bacteria 2916699645 2916701249 207
33 iso_pu_bacteria 2919097161 2919098783 207
34 iso_pu_bacteria 2984572630 2984573315 207
35 iso_pu_bacteria 2984606641 2984606750 207
36 iso_pu_bacteria 2993372514 2993376204 207
37 iso_pu_bacteria 2993480792 2993483018 207
38 iso_pu_bacteria 8001845381 8001850399 207
39 3300004800 Ga0058861_11914072 Ga0058861_119140721 208
40 3300032004 Ga0307414_10003999 Ga0307414_100039992 208
41 3300042004 Ga0439445_0000755 Ga0439445_0000755_4410_5036 208
42 3300042115 Ga0450911_000118 Ga0450911_000118_20042_20668 208
43 3300049744 Ga0501083_0076214 Ga0501083_0076214_1562_2188 208
44 iso_pu_bacteria 2501025501 2501074536 208
45 iso_pu_bacteria 2501025502 2501081780 208
46 iso_pu_bacteria 2501025504 2501408103 208
47 iso_pu_bacteria 2510917013 2511085715 208
48 iso_pu_bacteria 2510917014 2511095842 208
49 iso_pu_bacteria 2510917015 2511103405 208
50 iso_pu_bacteria 2511231004 2511254853 208
51 iso_pu_bacteria 2511231006 2511266839 208
52 iso_pu_bacteria 2511231007 2511273379 208
53 iso_pu_bacteria 2511231008 2511275091 208
54 iso_pu_bacteria 2511231010 2511288463 208
55 iso_pu_bacteria 2511231011 2511297751 208
56 iso_pu_bacteria 2511231012 2511302815 208
57 iso_pu_bacteria 2511231014 2511314409 208
58 iso_pu_bacteria 2511231015 2511317233 208
59 iso_pu_bacteria 2511231016 2511328008 208
60 iso_pu_bacteria 2511231017 2511329671 208
61 iso_pu_bacteria 2511231018 2511336832 208
62 iso_pu_bacteria 2511231019 2511344794 208
63 iso_pu_bacteria 2511231020 2511349559 208
64 iso_pu_bacteria 2511231021 2511359286 208
65 iso_pu_bacteria 2511231022 2511360896 208
66 iso_pu_bacteria 2511231023 2511370997 208
67 iso_pu_bacteria 2511231031 2511413465 208
68 iso_pu_bacteria 2512047018 2512326675 208
69 iso_pu_bacteria 2512047030 2512347575 208
70 iso_pu_bacteria 2513237082 2513556244 208
71 iso_pu_bacteria 2513237083 2513561403 208
72 iso_pu_bacteria 2513237150 2513955815 208
73 iso_pu_bacteria 2513237165 2514041219 208
74 iso_pu_bacteria 2515154122 2515679381 208
75 iso_pu_bacteria 2515154189 2516020806 208
76 iso_pu_bacteria 2551306352 2552747170 208
77 iso_pu_bacteria 2554235132 2554813850 208
78 iso_pu_bacteria 2554235231 2555245584 208
79 iso_pu_bacteria 2554235341 2555672837 208
80 iso_pu_bacteria 2582580891 2583795723 208
81 iso_pu_bacteria 2585428057 2587729069 208
82 iso_pu_bacteria 2585428058 2587733638 208
83 iso_pu_bacteria 2588253510 2588294030 208
84 iso_pu_bacteria 2596583598 2597029136 208
85 iso_pu_bacteria 2597489887 2597860882 208
86 iso_pu_bacteria 2597489888 2597866631 208
87 iso_pu_bacteria 2597489889 2597872487 208
88 iso_pu_bacteria 2599185160 2599355958 208
89 iso_pu_bacteria 2599185161 2599362640 208
90 iso_pu_bacteria 2599185162 2599369054 208
91 iso_pu_bacteria 2599185163 2599375749 208
92 iso_pu_bacteria 2599185164 2599381064 208
93 iso_pu_bacteria 2599185165 2599387420 208
94 iso_pu_bacteria 2599185166 2599394607 208
95 iso_pu_bacteria 2599185167 2599400539 208
96 iso_pu_bacteria 2599185168 2599406372 208
97 iso_pu_bacteria 2599185178 2599445754 208
98 iso_pu_bacteria 2599185179 2599449863 208
99 iso_pu_bacteria 2599185181 2599462792 208
100 iso_pu_bacteria 2599185182 2599467785 208
101 iso_pu_bacteria 2599185185 2599485883 208
102 iso_pu_bacteria 2599185186 2599491809 208
103 iso_pu_bacteria 2599185188 2599500262 208
104 iso_pu_bacteria 2599185189 2599505752 208
105 iso_pu_bacteria 2599185190 2599511937 208
106 iso_pu_bacteria 2599185191 2599516921 208
107 iso_pu_bacteria 2599185212 2599614431 208
108 iso_pu_bacteria 2599185248 2599768146 208
109 iso_pu_bacteria 2599185257 2599804665 208
110 iso_pu_bacteria 2599185288 2599879037 208
111 iso_pu_bacteria 2599185289 2599885581 208
112 iso_pu_bacteria 2599185290 2599892701 208
113 iso_pu_bacteria 2599185291 2599897295 208
114 iso_pu_bacteria 2599185300 2599930714 208
115 iso_pu_bacteria 2599185302 2599942348 208
116 iso_pu_bacteria 2599185303 2599951451 208
117 iso_pu_bacteria 2599185304 2599954239 208
118 iso_pu_bacteria 2599185305 2599961917 208
119 iso_pu_bacteria 2599185306 2599965939 208
120 iso_pu_bacteria 2599185308 2599980902 208
121 iso_pu_bacteria 2599185309 2599982918 208
122 iso_pu_bacteria 2599185310 2599988332 208
123 iso_pu_bacteria 2599185311 2599993992 208
124 iso_pu_bacteria 2599185312 2599999127 208
125 iso_pu_bacteria 2599185313 2600004309 208
126 iso_pu_bacteria 2599185314 2600014778 208
127 iso_pu_bacteria 2599185315 2600020402 208
128 iso_pu_bacteria 2599185316 2600026338 208
129 iso_pu_bacteria 2599185317 2600032085 208
130 iso_pu_bacteria 2599185318 2600035975 208
131 iso_pu_bacteria 2599185319 2600042339 208
132 iso_pu_bacteria 2599185320 2600046657 208
133 iso_pu_bacteria 2599185321 2600054920 208
134 iso_pu_bacteria 2599185322 2600061049 208
135 iso_pu_bacteria 2599185323 2600066367 208
136 iso_pu_bacteria 2599185324 2600071868 208
137 iso_pu_bacteria 2599185325 2600076536 208
138 iso_pu_bacteria 2599185356 2600215418 208
139 iso_pu_bacteria 2600254930 2600358988 208
140 iso_pu_bacteria 2600254931 2600363547 208
141 iso_pu_bacteria 2600254954 2600442701 208
142 iso_pu_bacteria 2600255067 2600810596 208
143 iso_pu_bacteria 2600255296 2601693445 208
144 iso_pu_bacteria 2600255313 2601775584 208
145 iso_pu_bacteria 2600255318 2601798559 208
146 iso_pu_bacteria 2603880185 2606077453 208
147 iso_pu_bacteria 2603880199 2606129301 208
148 iso_pu_bacteria 2606217733 2608380998 208
149 iso_pu_bacteria 2619619299 2621296846 208
150 iso_pu_bacteria 2623620443 2624483412 208
151 iso_pu_bacteria 2623620446 2624494933 208
152 iso_pu_bacteria 2643221565 2643842964 208
153 iso_pu_bacteria 2643221571 2643872264 208
154 iso_pu_bacteria 2643221589 2643955634 208
155 iso_pu_bacteria 2643221592 2643967133 208
156 iso_pu_bacteria 2643221602 2644020428 208
157 iso_pu_bacteria 2643221625 2644139963 208
158 iso_pu_bacteria 2643221633 2644184478 208
159 iso_pu_bacteria 2643221648 2644271203 208
160 iso_pu_bacteria 2643221650 2644283227 208
161 iso_pu_bacteria 2643221713 2644620168 208
162 iso_pu_bacteria 2651869719 2652545895 208
163 iso_pu_bacteria 2667528170 2671089555 208
164 iso_pu_bacteria 2667528171 2671099280 208
165 iso_pu_bacteria 2667528176 2671128583 208
166 iso_pu_bacteria 2671180172 2671771672 208
167 iso_pu_bacteria 2675903420 2677897131 208
168 iso_pu_bacteria 2675903507 2678232431 208
169 iso_pu_bacteria 2675903515 2678266149 208
170 iso_pu_bacteria 2713897148 2715749831 208
171 iso_pu_bacteria 2713897149 2715754847 208
172 iso_pu_bacteria 2718217725 2718636613 208
173 iso_pu_bacteria 2721755607 2723251366 208
174 iso_pu_bacteria 2721755763 2723879185 208
175 iso_pu_bacteria 2728369097 2729145215 208
176 iso_pu_bacteria 2738541265 2738671666 208
177 iso_pu_bacteria 2738541282 2738750060 208
178 iso_pu_bacteria 2738541294 2738807253 208
179 iso_pu_bacteria 2738541303 2738859100 208
180 iso_pu_bacteria 2738541309 2738894613 208
181 iso_pu_bacteria 2738543004 2739199059 208
182 iso_pu_bacteria 2738543015 2739259000 208
183 iso_pu_bacteria 2738543025 2739312505 208
184 iso_pu_bacteria 2740892503 2743740423 208
185 iso_pu_bacteria 2744054620 2745007381 208
186 iso_pu_bacteria 2751185846 2753568868 208
187 iso_pu_bacteria 2773857670 2774118377 208
188 iso_pu_bacteria 2773857673 2774135568 208
189 iso_pu_bacteria 2773857770 2774438933 208
190 iso_pu_bacteria 2784132063 2784261818 208
191 iso_pu_bacteria 2784132072 2784313575 208
192 iso_pu_bacteria 2791355520 2794593838 208
193 iso_pu_bacteria 2806310737 2807410793 208
194 iso_pu_bacteria 2806310745 2807459134 208
195 iso_pu_bacteria 2808606361 2808855693 208
196 iso_pu_bacteria 2808606376 2808926512 208
197 iso_pu_bacteria 2808606377 2808928442 208
198 iso_pu_bacteria 2808606378 2808935470 208
199 iso_pu_bacteria 2808606380 2808948673 208
200 iso_pu_bacteria 2808606381 2808950375 208
201 iso_pu_bacteria 2808606382 2808959843 208
202 iso_pu_bacteria 2808606383 2808964078 208
203 iso_pu_bacteria 2808606384 2808972238 208
204 iso_pu_bacteria 2808606385 2808976149 208
205 iso_pu_bacteria 2808606388 2808993249 208
206 iso_pu_bacteria 2808606389 2808999086 208
207 iso_pu_bacteria 2808606390 2809006844 208
208 iso_pu_bacteria 2808606391 2809013982 208
209 iso_pu_bacteria 2808606445 2809217186 208
210 iso_pu_bacteria 2811994881 2812369980 208
211 iso_pu_bacteria 2816332298 2817494041 208
212 iso_pu_bacteria 2818991436 2819543874 208
213 iso_pu_bacteria 2818991450 2819620916 208
214 iso_pu_bacteria 2818991456 2819655131 208
215 iso_pu_bacteria 2818991464 2819704402 208
216 iso_pu_bacteria 2825651385 2825655094 208
217 iso_pu_bacteria 2834028612 2834030950 208
218 iso_pu_bacteria 2834641062 2834641405 208
219 iso_pu_bacteria 2842324504 2842331292 208
220 iso_pu_bacteria 2842348783 2842355631 208
221 iso_pu_bacteria 2842454564 2842462065 208
222 iso_pu_bacteria 2842805378 2842807760 208
223 iso_pu_bacteria 2842826826 2842831285 208
224 iso_pu_bacteria 2842832357 2842833460 208
225 iso_pu_bacteria 2842837860 2842837899 208
226 iso_pu_bacteria 2842843487 2842845690 208
227 iso_pu_bacteria 2842854478 2842855622 208
228 iso_pu_bacteria 2844665904 2844667089 208
229 iso_pu_bacteria 2852612431 2852616351 208
230 iso_pu_bacteria 2852657418 2852659677 208
231 iso_pu_bacteria 2852667396 2852671319 208
232 iso_pu_bacteria 2860339153 2860341714 208
233 iso_pu_bacteria 2860867994 2860873028 208
234 iso_pu_bacteria 2878029506 2878035354 208
235 iso_pu_bacteria 2880230671 2880235995 208
236 iso_pu_bacteria 2883087390 2883095167 208
237 iso_pu_bacteria 2885266251 2885268084 208
238 iso_pu_bacteria 2885270888 2885277258 208
239 iso_pu_bacteria 2900577576 2900582067 208
240 iso_pu_bacteria 2902682994 2902683399 208
241 iso_pu_bacteria 2904483920 2904484007 208
242 iso_pu_bacteria 2904518522 2904518957 208
243 iso_pu_bacteria 2904550169 2904551328 208
244 iso_pu_bacteria 2908446538 2908452581 208
245 iso_pu_bacteria 2912963787 2912968858 208
246 iso_pu_bacteria 2913036834 2913042530 208
247 iso_pu_bacteria 2917070673 2917076734 208
248 iso_pu_bacteria 2919063839 2919065516 208
249 iso_pu_bacteria 2919155634 2919159589 208
250 iso_pu_bacteria 2919182534 2919185659 208
251 iso_pu_bacteria 2919385768 2919389189 208
252 iso_pu_bacteria 2919456309 2919457548 208
253 iso_pu_bacteria 2919481497 2919485659 208
254 iso_pu_bacteria 2919487758 2919488166 208
255 iso_pu_bacteria 2919501602 2919505870 208
256 iso_pu_bacteria 2919506607 2919507348 208
257 iso_pu_bacteria 2919527303 2919529955 208
258 iso_pu_bacteria 2919697872 2919700575 208
259 iso_pu_bacteria 2923153595 2923159516 208
260 iso_pu_bacteria 2923519811 2923524066 208
261 iso_pu_bacteria 2923586266 2923589000 208
262 iso_pu_bacteria 2926063275 2926067853 208
263 iso_pu_bacteria 2928058823 2928063501 208
264 iso_pu_bacteria 2928108538 2928109718 208
265 iso_pu_bacteria 2928135762 2928136828 208
266 iso_pu_bacteria 2928503688 2928506356 208
267 iso_pu_bacteria 2929144301 2929149921 208
268 iso_pu_bacteria 2929189879 2929195151 208
269 iso_pu_bacteria 2931369376 2931372639 208
270 iso_pu_bacteria 2931390751 2931396410 208
271 iso_pu_bacteria 2931396565 2931398079 208
272 iso_pu_bacteria 2935353572 2935358299 208
273 iso_pu_bacteria 2939636861 2939640805 208
274 iso_pu_bacteria 2939651529 2939654198 208
275 iso_pu_bacteria 2945928738 2945930909 208
276 iso_pu_bacteria 2945961074 2945966856 208
277 iso_pu_bacteria 2946006987 2946013285 208
278 iso_pu_bacteria 2946027586 2946027903 208
279 iso_pu_bacteria 2947233263 2947234423 208
280 iso_pu_bacteria 2969304461 2969310174 208
281 iso_pu_bacteria 2974289157 2974294078 208
282 iso_pu_bacteria 2984286254 2984286600 208
283 iso_pu_bacteria 2988728565 2988731464 208
284 iso_pu_bacteria 2998139840 2998145398 208
285 iso_pu_bacteria 3007395558 3007399398 208
286 iso_pu_bacteria 3007419365 3007419817 208
287 iso_pu_bacteria 3007614139 3007618533 208
288 iso_pu_bacteria 3007718800 3007721756 208
289 iso_pu_bacteria 3007803356 3007806009 208
290 iso_pu_bacteria 3007855910 3007859193 208
291 iso_pu_bacteria 3007866637 3007866778 208
292 iso_pu_bacteria 3007872151 3007873996 208
293 iso_pu_bacteria 637000220 637323274 208
294 iso_pu_bacteria 642555113 642620339 208
295 iso_pu_bacteria 644736347 644748624 208
296 iso_pu_bacteria 8003400568 8003403686 208
297 iso_pu_bacteria 8003955200 8003957546 208
298 iso_pu_bacteria 8015687852 8015693615 208
299 iso_pu_bacteria 8019769354 8019769768 208
300 iso_pu_bacteria 8019775933 8019777682 208
301 iso_pu_bacteria 8029995093 8029995504 208
302 iso_pu_bacteria 8033232454 8033233534 208
303 iso_pu_bacteria 8039098773 8039099254 208
304 iso_pu_bacteria 8052494512 8052499746 208
305 iso_pu_bacteria 8054285046 8054285727 208
306 iso_pu_bacteria 8054347763 8054349582 208
307 iso_pu_bacteria 8054503363 8054508934 208
308 iso_pu_bacteria 8054929484 8054934078 208
309 iso_pu_bacteria 8055266321 8055266663 208
310 iso_pu_bacteria 8055301274 8055305205 208
311 iso_pu_bacteria 8055817908 8055823903 208
312 iso_pu_bacteria 8055878733 8055881244 208
313 iso_pu_bacteria 8056115690 8056116520 208
314 iso_pu_bacteria 8056120720 8056125704 208
315 iso_pu_bacteria 8056125926 8056131605 208
316 iso_pu_bacteria 8056131705 8056137309 208
317 iso_pu_bacteria 8056137416 8056142774 208
318 iso_pu_bacteria 8056143049 8056148771 208
319 iso_pu_bacteria 8056148874 8056151494 208
320 iso_pu_bacteria 8056155041 8056160851 208
321 iso_pu_bacteria 8056161164 8056163632 208
322 iso_pu_bacteria 8056166840 8056171307 208
323 iso_pu_bacteria 8056172158 8056177408 208
324 iso_pu_bacteria 8056177738 8056182000 208
325 iso_pu_bacteria 8056569372 8056570465 208
326 3300005548 Ga0070665_100000991 Ga0070665_10000099123 209
327 3300007076 Ga0075435_100174648 Ga0075435_1001746481 209
328 3300014969 Ga0157376_10194707 Ga0157376_101947072 209
329 3300028379 Ga0268266_10002872 Ga0268266_100028728 209
330 3300031235 Ga0265330_10114871 Ga0265330_101148712 209
331 3300031241 Ga0265325_10012992 Ga0265325_100129923 209
332 3300042461 Ga0439460_0155461 Ga0439460_0155461_10_669 209
333 3300046689 Ga0495613_0028910 Ga0495613_0028910_1323_1982 209
334 3300047315 Ga0495581_0236406 Ga0495581_0236406_53_712 209
335 3300048905 Ga0496102_0168949 Ga0496102_0168949_1265_1960 209
336 3300049570 Ga0501033_0091253 Ga0501033_0091253_767_1426 209
337 3300049823 Ga0501044_0025147 Ga0501044_0025147_560_1219 209
338 3300050509 nmdc:mga0qj67_81770_c1 nmdc:mga0qj67_81770_c1_1078_1737 209
339 3300050513 nmdc:mga0rr50_1060650_c1 nmdc:mga0rr50_1060650_c1_20_676 209
340 iso_pu_bacteria 2547132374 2548498785 209
341 iso_pu_bacteria 2585428062 2587759088 209
342 iso_pu_bacteria 2599185292 2599903396 209
343 iso_pu_bacteria 2643221609 2644061796 209
344 iso_pu_bacteria 2643221611 2644073616 209
345 iso_pu_bacteria 2643221621 2644122310 209
346 iso_pu_bacteria 2643221683 2644468160 209
347 iso_pu_bacteria 2643221717 2644647773 209
348 iso_pu_bacteria 2738541277 2738717724 209
349 iso_pu_bacteria 2738541307 2738879335 209
350 iso_pu_bacteria 2738543012 2739242940 209
351 iso_pu_bacteria 2738543019 2739278410 209
352 iso_pu_bacteria 2816332133 2816475903 209
353 iso_pu_bacteria 2842733646 2842735036 209
354 iso_pu_bacteria 2855730933 2855736493 209
355 iso_pu_bacteria 2855767633 2855773430 209
356 iso_pu_bacteria 2857537821 2857542613 209
357 iso_pu_bacteria 2857542790 2857546701 209
358 iso_pu_bacteria 2858950400 2858955539 209
359 iso_pu_bacteria 2881412998 2881418614 209
360 iso_pu_bacteria 2881927736 2881930836 209
361 iso_pu_bacteria 2895511927 2895514832 209
362 iso_pu_bacteria 2904449895 2904455769 209
363 iso_pu_bacteria 2904456579 2904457800 209
364 iso_pu_bacteria 2928084124 2928084328 209
365 iso_pu_bacteria 2928115317 2928119921 209
366 iso_pu_bacteria 2941479691 2941482161 209
367 iso_pu_bacteria 2945909444 2945911596 209
368 iso_pu_bacteria 2945972063 2945977440 209
369 iso_pu_bacteria 2945984333 2945986063 209
370 3300005439 Ga0070711_100003206 Ga0070711_1000032067 210
371 3300005518 Ga0070699_100101826 Ga0070699_1001018263 210
372 3300005530 Ga0070679_100019496 Ga0070679_1000194963 210
373 3300005981 Ga0081538_10002039 Ga0081538_1000203912 210
374 3300006038 Ga0075365_10207462 Ga0075365_102074621 210
375 3300006042 Ga0075368_10142611 Ga0075368_101426111 210
376 3300025916 Ga0207663_10057951 Ga0207663_100579512 210
377 3300032005 Ga0307411_10110186 Ga0307411_101101862 210
378 3300032126 Ga0307415_100117470 Ga0307415_1001174701 210
379 3300039437 Ga0436365_1128753 Ga0436365_1128753_668_1300 210
380 3300046477 Ga0495664_0283043 Ga0495664_0283043_22_657 210
381 3300049574 Ga0501038_0466971 Ga0501038_0466971_293_925 210
382 3300049580 Ga0501046_0215662 Ga0501046_0215662_537_1169 210
383 3300049823 Ga0501044_0097323 Ga0501044_0097323_1966_2598 210
384 3300053177 Ga0500636_0004580 Ga0500636_0004580_4649_5281 210
385 3300059424 Ga0590075_029884 Ga0590075_029884_496_1128 210
386 iso_pu_bacteria 2857576091 2857579944 210
387 2162886007 SwRhRL2b_contig_1872146 SwRhRL2b_0454.00000680 211
388 3300005437 Ga0070710_10468505 Ga0070710_104685051 211
389 3300005841 Ga0068863_100079116 Ga0068863_1000791161 211
390 3300005841 Ga0068863_100476334 Ga0068863_1004763342 211
391 3300005843 Ga0068860_100029014 Ga0068860_1000290146 211
392 3300009094 Ga0111539_10695785 Ga0111539_106957852 211
393 3300009101 Ga0105247_10686781 Ga0105247_106867811 211
394 3300009545 Ga0105237_10426342 Ga0105237_104263422 211
395 3300010375 Ga0105239_10422536 Ga0105239_104225362 211
396 3300013100 Ga0157373_10126273 Ga0157373_101262732 211
397 3300014325 Ga0163163_10166706 Ga0163163_101667063 211
398 3300017792 Ga0163161_10004577 Ga0163161_1000457710 211
399 3300020069 Ga0197907_10062933 Ga0197907_100629331 211
400 3300025728 Ga0207655_1000018 Ga0207655_1000018115 211
401 3300025921 Ga0207652_10174749 Ga0207652_101747492 211
402 3300025924 Ga0207694_10182929 Ga0207694_101829293 211
403 3300025935 Ga0207709_10001011 Ga0207709_1000101113 211
404 3300025939 Ga0207665_10131458 Ga0207665_101314583 211
405 3300025944 Ga0207661_10001162 Ga0207661_100011626 211
406 3300025972 Ga0207668_10161126 Ga0207668_101611262 211
407 3300026088 Ga0207641_10064155 Ga0207641_100641554 211
408 3300028381 Ga0268264_10020980 Ga0268264_100209806 211
409 3300028381 Ga0268264_10043130 Ga0268264_100431303 211
410 3300030731 Ga0316177_1204046 Ga0316177_12040461 211
411 3300031911 Ga0307412_10000155 Ga0307412_1000015511 211
412 3300031911 Ga0307412_10001478 Ga0307412_1000147812 211
413 3300032004 Ga0307414_10000041 Ga0307414_1000004199 211
414 3300041413 Ga0439465_0000298 Ga0439465_0000298_11557_12192 211
415 3300042006 Ga0439432_015972 Ga0439432_015972_28_663 211
416 3300046519 Ga0495632_0013762 Ga0495632_0013762_1161_1796 211
417 3300046530 Ga0495654_0006226 Ga0495654_0006226_4467_5102 211
418 3300046558 Ga0495633_0018776 Ga0495633_0018776_2754_3389 211
419 3300046660 Ga0495625_0000501 Ga0495625_0000501_5713_6348 211
420 3300047472 Ga0495686_0000127 Ga0495686_0000127_14625_15260 211
421 3300047472 Ga0495686_0022085 Ga0495686_0022085_84_719 211
422 3300048905 Ga0496102_0260550 Ga0496102_0260550_317_952 211
423 3300048906 Ga0496103_0044661 Ga0496103_0044661_329_964 211
424 3300048911 Ga0496108_0239453 Ga0496108_0239453_813_1448 211
425 3300048911 Ga0496108_0639818 Ga0496108_0639818_18_653 211
426 3300048912 Ga0496109_0179782 Ga0496109_0179782_1230_1865 211
427 3300048913 Ga0496110_0049069 Ga0496110_0049069_79_714 211
428 3300048914 Ga0496111_0032978 Ga0496111_0032978_1813_2448 211
429 3300048917 Ga0496114_0391165 Ga0496114_0391165_487_1122 211
430 3300048925 Ga0496122_0001846 Ga0496122_0001846_26351_26986 211
431 3300048925 Ga0496122_0002049 Ga0496122_0002049_27928_28563 211
432 3300048925 Ga0496122_0021605 Ga0496122_0021605_2504_3139 211
433 3300048926 Ga0496123_0002062 Ga0496123_0002062_1228_1863 211
434 3300048926 Ga0496123_0060313 Ga0496123_0060313_1298_1933 211
435 3300048928 Ga0496125_0006232 Ga0496125_0006232_1383_2018 211
436 3300048928 Ga0496125_0264565 Ga0496125_0264565_183_818 211
437 3300049523 Ga0501300_004266 Ga0501300_004266_1155_1790 211
438 3300049526 Ga0501303_000992 Ga0501303_000992_1182_1817 211
439 3300049681 Ga0501251_000381 Ga0501251_000381_2523_3158 211
440 3300049758 Ga0501241_000003 Ga0501241_000003_20735_21370 211
441 3300049766 Ga0501269_000126 Ga0501269_000126_16390_17025 211
442 3300049776 Ga0501280_000401 Ga0501280_000401_1323_1958 211
443 3300049778 Ga0501282_002303 Ga0501282_002303_898_1533 211
444 3300050493 nmdc:mga0k408_76008_c1 nmdc:mga0k408_76008_c1_994_1629 211
445 3300050508 nmdc:mga09592_392247_c1 nmdc:mga09592_392247_c1_168_803 211
446 3300053140 Ga0500573_0133974 Ga0500573_0133974_694_1329 211
447 iso_pu_bacteria 2751185877 2753673307 211
448 2124908027 MRS2a_Contig_6468 MRS2a_00353290 212
449 2162886007 SwRhRL2b_contig_137706 SwRhRL2b_0777.00000320 212
450 3300001915 JGI24741J21665_1004476 JGI24741J21665_10044762 212
451 3300001915 JGI24741J21665_1008997 JGI24741J21665_10089972 212
452 3300001979 JGI24740J21852_10000054 JGI24740J21852_1000005415 212
453 3300001990 JGI24737J22298_10117372 JGI24737J22298_101173721 212
454 3300002705 JGI25156J39149_1012551 JGI25156J39149_10125512 212
455 3300002737 JGI25162J39368_1000154 JGI25162J39368_100015456 212
456 3300002737 JGI25162J39368_1000319 JGI25162J39368_100031910 212
457 3300002737 JGI25162J39368_1000474 JGI25162J39368_10004749 212
458 3300002738 JGI25154J39366_1012343 JGI25154J39366_10123431 212
459 3300002771 JGI25163J39215_1000691 JGI25163J39215_100069110 212
460 3300002771 JGI25163J39215_1004782 JGI25163J39215_10047821 212
461 3300002772 JGI25164J39214_1000236 JGI25164J39214_100023610 212
462 3300002772 JGI25164J39214_1000674 JGI25164J39214_10006749 212
463 3300002772 JGI25164J39214_1006548 JGI25164J39214_10065481 212
464 3300003214 JGI25165J46597_1000239 JGI25165J46597_100023932 212
465 3300003214 JGI25165J46597_1000434 JGI25165J46597_100043410 212
466 3300003214 JGI25165J46597_1000600 JGI25165J46597_10006009 212
467 3300003322 rootL2_10028101 rootL2_100281011 212
468 3300003751 Ga0055538_1000032 Ga0055538_1000032136 212
469 3300003751 Ga0055538_1000094 Ga0055538_100009432 212
470 3300003752 Ga0055539_1000038 Ga0055539_100003867 212
471 3300003752 Ga0055539_1000043 Ga0055539_1000043136 212
472 3300003752 Ga0055539_1000136 Ga0055539_100013632 212
473 3300003756 Ga0055533_1000052 Ga0055533_1000052136 212
474 3300003756 Ga0055533_1000143 Ga0055533_100014356 212
475 3300003758 Ga0055532_1000002 Ga0055532_1000002487 212
476 3300003758 Ga0055532_1000047 Ga0055532_1000047116 212
477 3300003759 Ga0055525_1000062 Ga0055525_1000062136 212
478 3300003759 Ga0055525_1000188 Ga0055525_100018856 212
479 3300003759 Ga0055525_1000304 Ga0055525_100030441 212
480 3300003760 Ga0055527_1001999 Ga0055527_10019992 212
481 3300003761 Ga0055535_1000096 Ga0055535_100009645 212
482 3300003761 Ga0055535_1004523 Ga0055535_10045232 212
483 3300003763 Ga0055529_1000091 Ga0055529_100009145 212
484 3300003763 Ga0055529_1000113 Ga0055529_100011357 212
485 3300003775 Ga0055524_1020020 Ga0055524_10200201 212
486 3300003775 Ga0055524_1034939 Ga0055524_10349392 212
487 3300003781 Ga0055536_1001726 Ga0055536_10017269 212
488 3300003781 Ga0055536_1049437 Ga0055536_10494371 212
489 3300003791 Ga0055530_10000658 Ga0055530_1000065822 212
490 3300003791 Ga0055530_10002203 Ga0055530_100022036 212
491 3300003791 Ga0055530_10002392 Ga0055530_100023924 212
492 3300003791 Ga0055530_10007867 Ga0055530_100078674 212
493 3300003792 Ga0055540_1000506 Ga0055540_100050622 212
494 3300003792 Ga0055540_1001654 Ga0055540_10016544 212
495 3300003841 Ga0055541_1000030 Ga0055541_1000030136 212
496 3300003841 Ga0055541_1000092 Ga0055541_100009256 212
497 3300003841 Ga0055541_1003579 Ga0055541_10035792 212
498 3300003856 Ga0058692_1011559 Ga0058692_10115592 212
499 3300005272 Ga0065703_1000504 Ga0065703_10005042 212
500 3300005288 Ga0065714_10003312 Ga0065714_1000331210 212
501 3300005288 Ga0065714_10004172 Ga0065714_100041729 212
502 3300005288 Ga0065714_10011359 Ga0065714_100113591 212
503 3300005288 Ga0065714_10066507 Ga0065714_100665076 212
504 3300005288 Ga0065714_10088098 Ga0065714_100880981 212
505 3300005288 Ga0065714_10098238 Ga0065714_100982381 212
506 3300005288 Ga0065714_10115878 Ga0065714_101158781 212
507 3300005288 Ga0065714_10177037 Ga0065714_101770371 212
508 3300005288 Ga0065714_10264676 Ga0065714_102646761 212
509 3300005289 Ga0065704_10071355 Ga0065704_100713559 212
510 3300005289 Ga0065704_10127589 Ga0065704_101275892 212
511 3300005289 Ga0065704_10348031 Ga0065704_103480311 212
512 3300005290 Ga0065712_10016049 Ga0065712_100160491 212
513 3300005290 Ga0065712_10071153 Ga0065712_100711533 212
514 3300005293 Ga0065715_10061165 Ga0065715_100611651 212
515 3300005293 Ga0065715_10223276 Ga0065715_102232761 212
516 3300005327 Ga0070658_10011063 Ga0070658_100110637 212
517 3300005327 Ga0070658_10068187 Ga0070658_100681873 212
518 3300005331 Ga0070670_100002144 Ga0070670_10000214410 212
519 3300005331 Ga0070670_100096891 Ga0070670_1000968913 212
520 3300005344 Ga0070661_100000126 Ga0070661_1000001268 212
521 3300005344 Ga0070661_100001535 Ga0070661_1000015354 212
522 3300005347 Ga0070668_100317372 Ga0070668_1003173722 212
523 3300005353 Ga0070669_100000187 Ga0070669_10000018714 212
524 3300005353 Ga0070669_100000481 Ga0070669_1000004819 212
525 3300005353 Ga0070669_100312294 Ga0070669_1003122941 212
526 3300005356 Ga0070674_100406308 Ga0070674_1004063081 212
527 3300005366 Ga0070659_100111253 Ga0070659_1001112532 212
528 3300005455 Ga0070663_100000012 Ga0070663_10000001242 212
529 3300005457 Ga0070662_100000101 Ga0070662_10000010140 212
530 3300005468 Ga0070707_100137876 Ga0070707_1001378763 212
531 3300005539 Ga0068853_100000187 Ga0068853_10000018710 212
532 3300005539 Ga0068853_100155478 Ga0068853_1001554782 212
533 3300005548 Ga0070665_100905468 Ga0070665_1009054681 212
534 3300005564 Ga0070664_100000045 Ga0070664_10000004516 212
535 3300005564 Ga0070664_100000491 Ga0070664_10000049124 212
536 3300005564 Ga0070664_100036041 Ga0070664_1000360412 212
537 3300005577 Ga0068857_100038455 Ga0068857_1000384556 212
538 3300005578 Ga0068854_100000127 Ga0068854_10000012744 212
539 3300005578 Ga0068854_100005297 Ga0068854_1000052977 212
540 3300005614 Ga0068856_100000035 Ga0068856_10000003567 212
541 3300005834 Ga0068851_10000007 Ga0068851_1000000738 212
542 3300006038 Ga0075365_10384063 Ga0075365_103840632 212
543 3300006038 Ga0075365_10426461 Ga0075365_104264612 212
544 3300006042 Ga0075368_10195228 Ga0075368_101952281 212
545 3300006048 Ga0075363_100153465 Ga0075363_1001534652 212
546 3300006051 Ga0075364_10021870 Ga0075364_100218703 212
547 3300006051 Ga0075364_10077774 Ga0075364_100777741 212
548 3300006051 Ga0075364_10118442 Ga0075364_101184422 212
549 3300006051 Ga0075364_10232689 Ga0075364_102326892 212
550 3300006058 Ga0075432_10008747 Ga0075432_100087473 212
551 3300006058 Ga0075432_10035996 Ga0075432_100359961 212
552 3300006058 Ga0075432_10090677 Ga0075432_100906771 212
553 3300006058 Ga0075432_10101492 Ga0075432_101014921 212
554 3300006177 Ga0075362_10017681 Ga0075362_100176814 212
555 3300006177 Ga0075362_10083436 Ga0075362_100834362 212
556 3300006177 Ga0075362_10204581 Ga0075362_102045811 212
557 3300006177 Ga0075362_10215922 Ga0075362_102159222 212
558 3300006178 Ga0075367_10034341 Ga0075367_100343412 212
559 3300006178 Ga0075367_10432556 Ga0075367_104325561 212
560 3300006195 Ga0075366_10063498 Ga0075366_100634983 212
561 3300006195 Ga0075366_10214640 Ga0075366_102146401 212
562 3300006914 Ga0075436_100056271 Ga0075436_1000562711 212
563 3300006914 Ga0075436_100212610 Ga0075436_1002126101 212
564 3300006914 Ga0075436_100215555 Ga0075436_1002155551 212
565 3300006914 Ga0075436_100279006 Ga0075436_1002790062 212
566 3300006914 Ga0075436_100337469 Ga0075436_1003374692 212
567 3300006944 Ga0099823_1000086 Ga0099823_100008623 212
568 3300006944 Ga0099823_1036036 Ga0099823_10360362 212
569 3300006946 Ga0079104_1000424 Ga0079104_100042437 212
570 3300006946 Ga0079104_1000718 Ga0079104_100071820 212
571 3300006946 Ga0079104_1009624 Ga0079104_10096243 212
572 3300006948 Ga0099826_10016562 Ga0099826_100165624 212
573 3300009011 Ga0105251_10000274 Ga0105251_1000027416 212
574 3300009011 Ga0105251_10000828 Ga0105251_100008287 212
575 3300009011 Ga0105251_10001027 Ga0105251_1000102715 212
576 3300009011 Ga0105251_10003921 Ga0105251_100039213 212
577 3300009011 Ga0105251_10012768 Ga0105251_100127681 212
578 3300009011 Ga0105251_10030044 Ga0105251_100300442 212
579 3300009011 Ga0105251_10147962 Ga0105251_101479621 212
580 3300009036 Ga0105244_10002564 Ga0105244_1000256410 212
581 3300009036 Ga0105244_10004785 Ga0105244_100047852 212
582 3300009036 Ga0105244_10006019 Ga0105244_100060193 212
583 3300009036 Ga0105244_10028370 Ga0105244_100283702 212
584 3300009036 Ga0105244_10068499 Ga0105244_100684992 212
585 3300009036 Ga0105244_10184439 Ga0105244_101844391 212
586 3300009092 Ga0105250_10000191 Ga0105250_1000019118 212
587 3300009092 Ga0105250_10013949 Ga0105250_100139494 212
588 3300009092 Ga0105250_10035745 Ga0105250_100357451 212
589 3300009092 Ga0105250_10201902 Ga0105250_102019021 212
590 3300009093 Ga0105240_10252669 Ga0105240_102526692 212
591 3300009093 Ga0105240_10365136 Ga0105240_103651362 212
592 3300009148 Ga0105243_10000418 Ga0105243_1000041810 212
593 3300009148 Ga0105243_10002911 Ga0105243_1000291110 212
594 3300009148 Ga0105243_10003724 Ga0105243_100037248 212
595 3300009148 Ga0105243_10005562 Ga0105243_100055622 212
596 3300009148 Ga0105243_10011149 Ga0105243_100111492 212
597 3300009148 Ga0105243_10030328 Ga0105243_100303284 212
598 3300009176 Ga0105242_10001499 Ga0105242_1000149917 212
599 3300009545 Ga0105237_10001509 Ga0105237_1000150923 212
600 3300009553 Ga0105249_10006152 Ga0105249_100061523 212
601 3300009553 Ga0105249_10483838 Ga0105249_104838381 212
602 3300011119 Ga0105246_10021610 Ga0105246_100216101 212
603 3300013100 Ga0157373_10004396 Ga0157373_1000439612 212
604 3300013100 Ga0157373_10006454 Ga0157373_100064542 212
605 3300013100 Ga0157373_10042510 Ga0157373_100425102 212
606 3300013100 Ga0157373_10080342 Ga0157373_100803421 212
607 3300013102 Ga0157371_10000609 Ga0157371_1000060931 212
608 3300013102 Ga0157371_10003267 Ga0157371_100032679 212
609 3300013102 Ga0157371_10010705 Ga0157371_100107053 212
610 3300013104 Ga0157370_10000025 Ga0157370_10000025126 212
611 3300013104 Ga0157370_10026152 Ga0157370_100261523 212
612 3300013104 Ga0157370_10068885 Ga0157370_100688852 212
613 3300013104 Ga0157370_10101418 Ga0157370_101014182 212
614 3300013104 Ga0157370_10134402 Ga0157370_101344021 212
615 3300013104 Ga0157370_10160617 Ga0157370_101606172 212
616 3300013104 Ga0157370_10225054 Ga0157370_102250542 212
617 3300013104 Ga0157370_10636936 Ga0157370_106369361 212
618 3300013105 Ga0157369_10002004 Ga0157369_1000200415 212
619 3300013105 Ga0157369_10020339 Ga0157369_100203399 212
620 3300013105 Ga0157369_10087691 Ga0157369_100876913 212
621 3300013105 Ga0157369_10506551 Ga0157369_105065512 212
622 3300013306 Ga0163162_10704382 Ga0163162_107043821 212
623 3300013307 Ga0157372_10000227 Ga0157372_1000022738 212
624 3300013307 Ga0157372_10181212 Ga0157372_101812122 212
625 3300013307 Ga0157372_10321758 Ga0157372_103217581 212
626 3300013308 Ga0157375_10079061 Ga0157375_100790612 212
627 3300013308 Ga0157375_10080456 Ga0157375_100804562 212
628 3300014497 Ga0182008_10000293 Ga0182008_1000029333 212
629 3300014497 Ga0182008_10032172 Ga0182008_100321721 212
630 3300014497 Ga0182008_10036046 Ga0182008_100360462 212
631 3300014497 Ga0182008_10051729 Ga0182008_100517291 212
632 3300014497 Ga0182008_10081816 Ga0182008_100818162 212
633 3300015261 Ga0182006_1001907 Ga0182006_10019075 212
634 3300015261 Ga0182006_1002075 Ga0182006_10020755 212
635 3300015261 Ga0182006_1011903 Ga0182006_10119033 212
636 3300015261 Ga0182006_1017384 Ga0182006_10173843 212
637 3300015261 Ga0182006_1023480 Ga0182006_10234802 212
638 3300015261 Ga0182006_1036303 Ga0182006_10363031 212
639 3300015261 Ga0182006_1097929 Ga0182006_10979291 212
640 3300015262 Ga0182007_10000284 Ga0182007_100002849 212
641 3300015262 Ga0182007_10012189 Ga0182007_100121891 212
642 3300015262 Ga0182007_10029870 Ga0182007_100298701 212
643 3300015265 Ga0182005_1001150 Ga0182005_10011506 212
644 3300017792 Ga0163161_10005887 Ga0163161_100058875 212
645 3300017792 Ga0163161_10022215 Ga0163161_100222154 212
646 3300017792 Ga0163161_10151888 Ga0163161_101518881 212
647 3300020069 Ga0197907_10109288 Ga0197907_101092882 212
648 3300020070 Ga0206356_10469082 Ga0206356_104690825 212
649 3300020075 Ga0206349_1210075 Ga0206349_12100755 212
650 3300020076 Ga0206355_1608568 Ga0206355_16085681 212
651 3300020077 Ga0206351_10301792 Ga0206351_1030179210 212
652 3300020080 Ga0206350_10572994 Ga0206350_105729941 212
653 3300020080 Ga0206350_11061825 Ga0206350_110618251 212
654 3300020610 Ga0154015_1353180 Ga0154015_13531806 212
655 3300022467 Ga0224712_10006729 Ga0224712_100067293 212
656 3300025206 Ga0209435_100821 Ga0209435_1008213 212
657 3300025207 Ga0209760_100027 Ga0209760_100027108 212
658 3300025207 Ga0209760_100149 Ga0209760_10014932 212
659 3300025207 Ga0209760_100681 Ga0209760_1006812 212
660 3300025224 Ga0209784_100003 Ga0209784_100003227 212
661 3300025224 Ga0209784_100007 Ga0209784_100007380 212
662 3300025224 Ga0209784_100010 Ga0209784_100010327 212
663 3300025224 Ga0209784_100441 Ga0209784_10044116 212
664 3300025225 Ga0209566_100002 Ga0209566_1000021270 212
665 3300025225 Ga0209566_100008 Ga0209566_100008327 212
666 3300025225 Ga0209566_100009 Ga0209566_100009380 212
667 3300025226 Ga0209674_100008 Ga0209674_100008919 212
668 3300025226 Ga0209674_100019 Ga0209674_100019327 212
669 3300025226 Ga0209674_100021 Ga0209674_100021380 212
670 3300025228 Ga0209672_100235 Ga0209672_10023530 212
671 3300025229 Ga0209147_100002 Ga0209147_1000022016 212
672 3300025229 Ga0209147_100009 Ga0209147_100009380 212
673 3300025230 Ga0209563_100004 Ga0209563_100004683 212
674 3300025230 Ga0209563_100018 Ga0209563_100018380 212
675 3300025230 Ga0209563_100021 Ga0209563_100021327 212
676 3300025230 Ga0209563_100026 Ga0209563_10002666 212
677 3300025231 Ga0207427_100005 Ga0207427_100005332 212
678 3300025231 Ga0207427_100006 Ga0207427_100006440 212
679 3300025231 Ga0207427_100342 Ga0207427_10034222 212
680 3300025233 Ga0209437_100013 Ga0209437_100013440 212
681 3300025233 Ga0209437_100018 Ga0209437_100018242 212
682 3300025233 Ga0209437_100019 Ga0209437_100019327 212
683 3300025233 Ga0209437_104041 Ga0209437_1040412 212
684 3300025242 Ga0209258_100002 Ga0209258_1000022016 212
685 3300025242 Ga0209258_100169 Ga0209258_100169103 212
686 3300025242 Ga0209258_100177 Ga0209258_10017787 212
687 3300025246 Ga0209646_1000184 Ga0209646_100018419 212
688 3300025250 Ga0209026_1012445 Ga0209026_10124452 212
689 3300025253 Ga0209677_100011 Ga0209677_100011327 212
690 3300025253 Ga0209677_100012 Ga0209677_100012380 212
691 3300025253 Ga0209677_100013 Ga0209677_100013306 212
692 3300025254 Ga0209148_1002932 Ga0209148_10029325 212
693 3300025254 Ga0209148_1003831 Ga0209148_10038315 212
694 3300025256 Ga0209759_1000399 Ga0209759_100039945 212
695 3300025256 Ga0209759_1004392 Ga0209759_10043923 212
696 3300025256 Ga0209759_1005052 Ga0209759_10050524 212
697 3300025256 Ga0209759_1005073 Ga0209759_10050732 212
698 3300025256 Ga0209759_1016653 Ga0209759_10166532 212
699 3300025261 Ga0209233_1000021 Ga0209233_1000021332 212
700 3300025261 Ga0209233_1000022 Ga0209233_1000022440 212
701 3300025261 Ga0209233_1000025 Ga0209233_1000025327 212
702 3300025263 Ga0209565_1009039 Ga0209565_10090395 212
703 3300025263 Ga0209565_1025325 Ga0209565_10253251 212
704 3300025272 Ga0209455_1000021 Ga0209455_1000021603 212
705 3300025272 Ga0209455_1000108 Ga0209455_100010845 212
706 3300025291 Ga0209675_1003233 Ga0209675_10032331 212
707 3300025292 Ga0209676_1000030 Ga0209676_1000030269 212
708 3300025292 Ga0209676_1000041 Ga0209676_1000041172 212
709 3300025292 Ga0209676_1000510 Ga0209676_100051011 212
710 3300025292 Ga0209676_1002546 Ga0209676_10025465 212
711 3300025292 Ga0209676_1003117 Ga0209676_10031174 212
712 3300025294 Ga0209025_1000040 Ga0209025_1000040139 212
713 3300025294 Ga0209025_1000524 Ga0209025_100052415 212
714 3300025298 Ga0209050_1000024 Ga0209050_1000024171 212
715 3300025298 Ga0209050_1000518 Ga0209050_100051835 212
716 3300025298 Ga0209050_1000647 Ga0209050_100064726 212
717 3300025299 Ga0209256_1000149 Ga0209256_100014954 212
718 3300025303 Ga0209051_1000023 Ga0209051_100002387 212
719 3300025303 Ga0209051_1000721 Ga0209051_10007219 212
720 3300025303 Ga0209051_1005515 Ga0209051_10055154 212
721 3300025303 Ga0209051_1009026 Ga0209051_10090261 212
722 3300025321 Ga0207656_10000006 Ga0207656_1000000664 212
723 3300025711 Ga0207696_1000078 Ga0207696_1000078185 212
724 3300025711 Ga0207696_1000145 Ga0207696_100014573 212
725 3300025711 Ga0207696_1008153 Ga0207696_10081532 212
726 3300025711 Ga0207696_1021631 Ga0207696_10216312 212
727 3300025711 Ga0207696_1046209 Ga0207696_10462092 212
728 3300025711 Ga0207696_1068504 Ga0207696_10685041 212
729 3300025728 Ga0207655_1000014 Ga0207655_1000014433 212
730 3300025728 Ga0207655_1000202 Ga0207655_100020241 212
731 3300025728 Ga0207655_1000309 Ga0207655_100030968 212
732 3300025728 Ga0207655_1000388 Ga0207655_100038841 212
733 3300025728 Ga0207655_1001315 Ga0207655_10013157 212
734 3300025728 Ga0207655_1007901 Ga0207655_10079011 212
735 3300025728 Ga0207655_1015714 Ga0207655_10157142 212
736 3300025728 Ga0207655_1024451 Ga0207655_10244511 212
737 3300025728 Ga0207655_1028654 Ga0207655_10286542 212
738 3300025728 Ga0207655_1035454 Ga0207655_10354542 212
739 3300025728 Ga0207655_1054242 Ga0207655_10542422 212
740 3300025735 Ga0207713_1000010 Ga0207713_1000010319 212
741 3300025735 Ga0207713_1000815 Ga0207713_10008159 212
742 3300025735 Ga0207713_1001109 Ga0207713_10011098 212
743 3300025735 Ga0207713_1001785 Ga0207713_10017856 212
744 3300025735 Ga0207713_1003196 Ga0207713_100319610 212
745 3300025735 Ga0207713_1003415 Ga0207713_10034153 212
746 3300025735 Ga0207713_1004607 Ga0207713_10046077 212
747 3300025735 Ga0207713_1006691 Ga0207713_10066919 212
748 3300025735 Ga0207713_1018033 Ga0207713_10180332 212
749 3300025909 Ga0207705_10301653 Ga0207705_103016532 212
750 3300025911 Ga0207654_10102260 Ga0207654_101022602 212
751 3300025913 Ga0207695_10001515 Ga0207695_100015153 212
752 3300025913 Ga0207695_10306689 Ga0207695_103066892 212
753 3300025913 Ga0207695_10524193 Ga0207695_105241932 212
754 3300025914 Ga0207671_10000131 Ga0207671_1000013141 212
755 3300025920 Ga0207649_10000012 Ga0207649_10000012106 212
756 3300025920 Ga0207649_10000370 Ga0207649_1000037023 212
757 3300025923 Ga0207681_10000099 Ga0207681_1000009936 212
758 3300025923 Ga0207681_10000699 Ga0207681_1000069915 212
759 3300025923 Ga0207681_10223433 Ga0207681_102234332 212
760 3300025925 Ga0207650_10000518 Ga0207650_100005189 212
761 3300025925 Ga0207650_10000571 Ga0207650_1000057122 212
762 3300025931 Ga0207644_10272424 Ga0207644_102724242 212
763 3300025933 Ga0207706_10000580 Ga0207706_1000058033 212
764 3300025934 Ga0207686_10000319 Ga0207686_1000031929 212
765 3300025935 Ga0207709_10000068 Ga0207709_1000006876 212
766 3300025935 Ga0207709_10000071 Ga0207709_1000007122 212
767 3300025935 Ga0207709_10000337 Ga0207709_1000033730 212
768 3300025935 Ga0207709_10003583 Ga0207709_100035836 212
769 3300025935 Ga0207709_10017354 Ga0207709_100173545 212
770 3300025935 Ga0207709_10021142 Ga0207709_100211422 212
771 3300025935 Ga0207709_10032812 Ga0207709_100328122 212
772 3300025941 Ga0207711_10063414 Ga0207711_100634143 212
773 3300025945 Ga0207679_10000001 Ga0207679_10000001610 212
774 3300025945 Ga0207679_10000015 Ga0207679_10000015106 212
775 3300025961 Ga0207712_10014475 Ga0207712_100144754 212
776 3300025972 Ga0207668_10363741 Ga0207668_103637411 212
777 3300025981 Ga0207640_10000119 Ga0207640_1000011949 212
778 3300025981 Ga0207640_10046142 Ga0207640_100461422 212
779 3300026041 Ga0207639_10000775 Ga0207639_100007756 212
780 3300026067 Ga0207678_10000004 Ga0207678_1000000485 212
781 3300026078 Ga0207702_10000029 Ga0207702_10000029108 212
782 3300026116 Ga0207674_10012679 Ga0207674_100126793 212
783 3300027111 Ga0209281_1000016 Ga0209281_1000016313 212
784 3300027111 Ga0209281_1000019 Ga0209281_1000019220 212
785 3300027111 Ga0209281_1004114 Ga0209281_10041141 212
786 3300027111 Ga0209281_1005332 Ga0209281_10053322 212
787 3300027296 Ga0209389_1000049 Ga0209389_100004946 212
788 3300027296 Ga0209389_1064164 Ga0209389_10641643 212
789 3300027312 Ga0209371_1000106 Ga0209371_100010665 212
790 3300027907 Ga0207428_10066564 Ga0207428_100665641 212
791 3300027907 Ga0207428_10101827 Ga0207428_101018273 212
792 3300027907 Ga0207428_10157003 Ga0207428_101570031 212
793 3300027907 Ga0207428_10391467 Ga0207428_103914671 212
794 3300027907 Ga0207428_10582031 Ga0207428_105820311 212
795 3300027907 Ga0207428_10589663 Ga0207428_105896631 212
796 3300027907 Ga0207428_10670186 Ga0207428_106701861 212
797 3300028563 Ga0265319_1000174 Ga0265319_100017424 212
798 3300028573 Ga0265334_10033035 Ga0265334_100330353 212
799 3300028786 Ga0307517_10238794 Ga0307517_102387941 212
800 3300028794 Ga0307515_10000577 Ga0307515_100005773 212
801 3300028800 Ga0265338_10005327 Ga0265338_1000532717 212
802 3300030500 Ga0268256_1000077 Ga0268256_100007765 212
803 3300030521 Ga0307511_10068564 Ga0307511_100685643 212
804 3300030731 Ga0316177_1038918 Ga0316177_10389184 212
805 3300030733 Ga0314311_1263845 Ga0314311_12638454 212
806 3300030734 Ga0316179_1012631 Ga0316179_10126315 212
807 3300031238 Ga0265332_10064810 Ga0265332_100648102 212
808 3300031249 Ga0265339_10001794 Ga0265339_100017943 212
809 3300031251 Ga0265327_10153912 Ga0265327_101539121 212
810 3300031344 Ga0265316_10005455 Ga0265316_100054558 212
811 3300031456 Ga0307513_10077668 Ga0307513_100776682 212
812 3300031507 Ga0307509_10116479 Ga0307509_101164792 212
813 3300031548 Ga0307408_100000019 Ga0307408_100000019222 212
814 3300031548 Ga0307408_100001975 Ga0307408_1000019759 212
815 3300031548 Ga0307408_100007309 Ga0307408_1000073092 212
816 3300031548 Ga0307408_100007499 Ga0307408_1000074994 212
817 3300031548 Ga0307408_100020706 Ga0307408_1000207064 212
818 3300031548 Ga0307408_100030188 Ga0307408_1000301883 212
819 3300031548 Ga0307408_100043515 Ga0307408_1000435152 212
820 3300031548 Ga0307408_100162778 Ga0307408_1001627782 212
821 3300031649 Ga0307514_10023189 Ga0307514_100231892 212
822 3300031711 Ga0265314_10000002 Ga0265314_10000002709 212
823 3300031731 Ga0307405_10002527 Ga0307405_100025276 212
824 3300031731 Ga0307405_10025146 Ga0307405_100251463 212
825 3300031824 Ga0307413_10136681 Ga0307413_101366811 212
826 3300031901 Ga0307406_10007961 Ga0307406_100079615 212
827 3300031901 Ga0307406_10052248 Ga0307406_100522482 212
828 3300031903 Ga0307407_10061619 Ga0307407_100616192 212
829 3300031903 Ga0307407_10135947 Ga0307407_101359471 212
830 3300031911 Ga0307412_10018416 Ga0307412_100184162 212
831 3300031911 Ga0307412_10020333 Ga0307412_100203332 212
832 3300031911 Ga0307412_10027487 Ga0307412_100274873 212
833 3300031911 Ga0307412_10098134 Ga0307412_100981342 212
834 3300031911 Ga0307412_10571708 Ga0307412_105717081 212
835 3300031911 Ga0307412_10725525 Ga0307412_107255251 212
836 3300031995 Ga0307409_100066516 Ga0307409_1000665162 212
837 3300031995 Ga0307409_100080210 Ga0307409_1000802102 212
838 3300032002 Ga0307416_100563229 Ga0307416_1005632292 212
839 3300032004 Ga0307414_10001579 Ga0307414_100015791 212
840 3300032004 Ga0307414_10059474 Ga0307414_100594741 212
841 3300032004 Ga0307414_10067128 Ga0307414_100671281 212
842 3300032004 Ga0307414_10254278 Ga0307414_102542782 212
843 3300032004 Ga0307414_10843689 Ga0307414_108436891 212
844 3300032004 Ga0307414_11077526 Ga0307414_110775261 212
845 3300032005 Ga0307411_10007711 Ga0307411_100077112 212
846 3300032005 Ga0307411_11119578 Ga0307411_111195781 212
847 3300037418 Ga0395900_0001438 Ga0395900_0001438_24512_25162 212
848 3300037466 Ga0395898_0326538 Ga0395898_0326538_515_1156 212
849 3300037471 Ga0395905_0316328 Ga0395905_0316328_211_849 212
850 3300038443 Ga0395901_0522027 Ga0395901_0522027_247_888 212
851 3300038705 Ga0237819_01092 Ga0237819_01092_3735_4373 212
852 3300041404 Ga0439436_0001261 Ga0439436_0001261_4907_5545 212
853 3300041405 Ga0439438_000413 Ga0439438_000413_17985_18623 212
854 3300041405 Ga0439438_002141 Ga0439438_002141_6020_6658 212
855 3300041405 Ga0439438_003418 Ga0439438_003418_3612_4250 212
856 3300041405 Ga0439438_006264 Ga0439438_006264_1032_1670 212
857 3300041405 Ga0439438_006353 Ga0439438_006353_2642_3280 212
858 3300041405 Ga0439438_010630 Ga0439438_010630_1563_2270 212
859 3300041405 Ga0439438_011185 Ga0439438_011185_1952_2590 212
860 3300041405 Ga0439438_011922 Ga0439438_011922_1088_1726 212
861 3300041405 Ga0439438_016210 Ga0439438_016210_872_1510 212
862 3300041405 Ga0439438_044230 Ga0439438_044230_257_895 212
863 3300041405 Ga0439438_044369 Ga0439438_044369_251_889 212
864 3300041407 Ga0439447_000185 Ga0439447_000185_8549_9187 212
865 3300041407 Ga0439447_001317 Ga0439447_001317_5818_6456 212
866 3300041407 Ga0439447_004258 Ga0439447_004258_3217_3855 212
867 3300041407 Ga0439447_004487 Ga0439447_004487_965_1603 212
868 3300041407 Ga0439447_005893 Ga0439447_005893_967_1605 212
869 3300041407 Ga0439447_006591 Ga0439447_006591_1999_2637 212
870 3300041407 Ga0439447_010479 Ga0439447_010479_1477_2184 212
871 3300041411 Ga0439466_0000460 Ga0439466_0000460_6604_7242 212
872 3300041411 Ga0439466_0002029 Ga0439466_0002029_2528_3166 212
873 3300041411 Ga0439466_0006648 Ga0439466_0006648_3547_4185 212
874 3300041411 Ga0439466_0007338 Ga0439466_0007338_2187_2825 212
875 3300041411 Ga0439466_0013865 Ga0439466_0013865_1141_1779 212
876 3300041411 Ga0439466_0015107 Ga0439466_0015107_1741_2379 212
877 3300041411 Ga0439466_0016538 Ga0439466_0016538_1494_2201 212
878 3300041411 Ga0439466_0018278 Ga0439466_0018278_668_1306 212
879 3300041411 Ga0439466_0025288 Ga0439466_0025288_1146_1784 212
880 3300041411 Ga0439466_0028941 Ga0439466_0028941_884_1525 212
881 3300041411 Ga0439466_0041300 Ga0439466_0041300_369_1007 212
882 3300041997 Ga0439431_0006104 Ga0439431_0006104_1351_2058 212
883 3300042004 Ga0439445_0007805 Ga0439445_0007805_668_1306 212
884 3300042006 Ga0439432_000797 Ga0439432_000797_4955_5593 212
885 3300042006 Ga0439432_002776 Ga0439432_002776_4084_4722 212
886 3300042006 Ga0439432_003848 Ga0439432_003848_1151_1789 212
887 3300042006 Ga0439432_005322 Ga0439432_005322_1355_1993 212
888 3300042006 Ga0439432_015589 Ga0439432_015589_1220_1858 212
889 3300042006 Ga0439432_016716 Ga0439432_016716_1581_2288 212
890 3300042006 Ga0439432_045898 Ga0439432_045898_418_1056 212
891 3300042006 Ga0439432_073626 Ga0439432_073626_272_910 212
892 3300042009 Ga0439451_001405 Ga0439451_001405_3175_3813 212
893 3300042009 Ga0439451_006121 Ga0439451_006121_692_1330 212
894 3300042009 Ga0439451_014709 Ga0439451_014709_762_1400 212
895 3300042009 Ga0439451_018243 Ga0439451_018243_540_1178 212
896 3300042010 Ga0439452_000354 Ga0439452_000354_24146_24784 212
897 3300042010 Ga0439452_000769 Ga0439452_000769_7924_8562 212
898 3300042010 Ga0439452_000864 Ga0439452_000864_6795_7433 212
899 3300042010 Ga0439452_004376 Ga0439452_004376_940_1578 212
900 3300042010 Ga0439452_010875 Ga0439452_010875_634_1272 212
901 3300042010 Ga0439452_020001 Ga0439452_020001_617_1255 212
902 3300042010 Ga0439452_025050 Ga0439452_025050_272_910 212
903 3300042013 Ga0439456_000043 Ga0439456_000043_16961_17599 212
904 3300042013 Ga0439456_000444 Ga0439456_000444_5513_6151 212
905 3300042013 Ga0439456_006434 Ga0439456_006434_122_760 212
906 3300042016 Ga0439463_000618 Ga0439463_000618_6535_7173 212
907 3300042016 Ga0439463_001239 Ga0439463_001239_1799_2437 212
908 3300042016 Ga0439463_002794 Ga0439463_002794_2863_3501 212
909 3300042016 Ga0439463_031436 Ga0439463_031436_421_1059 212
910 3300042115 Ga0450911_000515 Ga0450911_000515_5116_5754 212
911 3300042115 Ga0450911_000943 Ga0450911_000943_1814_2452 212
912 3300042115 Ga0450911_001271 Ga0450911_001271_4946_5584 212
913 3300042115 Ga0450911_009389 Ga0450911_009389_28_666 212
914 3300042121 Ga0450919_002285 Ga0450919_002285_719_1357 212
915 3300042122 Ga0450920_003501 Ga0450920_003501_1714_2352 212
916 3300042123 Ga0450921_008231 Ga0450921_008231_146_784 212
917 3300042124 Ga0450922_000114 Ga0450922_000114_1494_2132 212
918 3300042124 Ga0450922_000386 Ga0450922_000386_1876_2514 212
919 3300042125 Ga0450923_003986 Ga0450923_003986_656_1294 212
920 3300042125 Ga0450923_050833 Ga0450923_050833_85_723 212
921 3300042127 Ga0450890_000259 Ga0450890_000259_1807_2445 212
922 3300042137 Ga0450902_003798 Ga0450902_003798_191_829 212
923 3300042137 Ga0450902_016646 Ga0450902_016646_32_670 212
924 3300042137 Ga0450902_031180 Ga0450902_031180_11_649 212
925 3300042138 Ga0450903_001100 Ga0450903_001100_3111_3749 212
926 3300042138 Ga0450903_002913 Ga0450903_002913_1985_2623 212
927 3300042139 Ga0450904_001416 Ga0450904_001416_2344_2982 212
928 3300042145 Ga0450906_000802 Ga0450906_000802_330_968 212
929 3300042145 Ga0450906_006857 Ga0450906_006857_1369_2007 212
930 3300042146 Ga0450907_000322 Ga0450907_000322_7214_7852 212
931 3300042146 Ga0450907_001362 Ga0450907_001362_2065_2703 212
932 3300042146 Ga0450907_001620 Ga0450907_001620_686_1324 212
933 3300042147 Ga0450910_000704 Ga0450910_000704_372_1010 212
934 3300042147 Ga0450910_013822 Ga0450910_013822_473_1111 212
935 3300042156 Ga0439446_0000162 Ga0439446_0000162_1324_1962 212
936 3300042156 Ga0439446_0002703 Ga0439446_0002703_1224_1862 212
937 3300042184 Ga0450908_000612 Ga0450908_000612_1514_2152 212
938 3300042184 Ga0450908_001252 Ga0450908_001252_3812_4450 212
939 3300042185 Ga0450909_004087 Ga0450909_004087_245_883 212
940 3300042435 Ga0439434_0000151 Ga0439434_0000151_7386_8024 212
941 3300042435 Ga0439434_0001524 Ga0439434_0001524_5351_5989 212
942 3300042435 Ga0439434_0052588 Ga0439434_0052588_103_741 212
943 3300042461 Ga0439460_0000441 Ga0439460_0000441_2363_3001 212
944 3300042461 Ga0439460_0000521 Ga0439460_0000521_5914_6552 212
945 3300042461 Ga0439460_0004619 Ga0439460_0004619_776_1414 212
946 3300042461 Ga0439460_0029891 Ga0439460_0029891_627_1265 212
947 3300042532 Ga0450893_0004391 Ga0450893_0004391_338_976 212
948 3300042533 Ga0450901_002284 Ga0450901_002284_1328_1966 212
949 3300042993 Ga0439440_0000802 Ga0439440_0000802_1869_2507 212
950 3300046452 Ga0495617_001375 Ga0495617_001375_7905_8543 212
951 3300046452 Ga0495617_001612 Ga0495617_001612_7672_8310 212
952 3300046452 Ga0495617_014525 Ga0495617_014525_1108_1746 212
953 3300046452 Ga0495617_022087 Ga0495617_022087_567_1205 212
954 3300046453 Ga0495627_003332 Ga0495627_003332_4835_5473 212
955 3300046453 Ga0495627_012631 Ga0495627_012631_1126_1764 212
956 3300046453 Ga0495627_037720 Ga0495627_037720_691_1329 212
957 3300046455 Ga0495603_0017024 Ga0495603_0017024_3503_4141 212
958 3300046457 Ga0495590_0002290 Ga0495590_0002290_6099_6737 212
959 3300046457 Ga0495590_0002876 Ga0495590_0002876_5238_5876 212
960 3300046457 Ga0495590_0005412 Ga0495590_0005412_1347_1985 212
961 3300046457 Ga0495590_0084334 Ga0495590_0084334_275_913 212
962 3300046458 Ga0495591_000463 Ga0495591_000463_25300_25938 212
963 3300046458 Ga0495591_004255 Ga0495591_004255_1500_2138 212
964 3300046458 Ga0495591_004969 Ga0495591_004969_4759_5397 212
965 3300046458 Ga0495591_009434 Ga0495591_009434_963_1601 212
966 3300046458 Ga0495591_026079 Ga0495591_026079_215_853 212
967 3300046458 Ga0495591_031318 Ga0495591_031318_142_780 212
968 3300046458 Ga0495591_034228 Ga0495591_034228_774_1412 212
969 3300046458 Ga0495591_037868 Ga0495591_037868_248_886 212
970 3300046458 Ga0495591_059346 Ga0495591_059346_313_951 212
971 3300046460 Ga0495638_0017183 Ga0495638_0017183_2100_2738 212
972 3300046460 Ga0495638_0020816 Ga0495638_0020816_325_963 212
973 3300046460 Ga0495638_0020892 Ga0495638_0020892_3508_4146 212
974 3300046460 Ga0495638_0052858 Ga0495638_0052858_759_1397 212
975 3300046460 Ga0495638_0067462 Ga0495638_0067462_312_950 212
976 3300046460 Ga0495638_0093596 Ga0495638_0093596_1063_1701 212
977 3300046460 Ga0495638_0135217 Ga0495638_0135217_260_898 212
978 3300046460 Ga0495638_0136514 Ga0495638_0136514_690_1328 212
979 3300046463 Ga0495653_0005988 Ga0495653_0005988_8085_8723 212
980 3300046471 Ga0495650_0004305 Ga0495650_0004305_8179_8817 212
981 3300046471 Ga0495650_0004442 Ga0495650_0004442_1139_1777 212
982 3300046471 Ga0495650_0006511 Ga0495650_0006511_5920_6558 212
983 3300046471 Ga0495650_0049781 Ga0495650_0049781_815_1453 212
984 3300046474 Ga0495605_0002791 Ga0495605_0002791_4169_4807 212
985 3300046474 Ga0495605_0012263 Ga0495605_0012263_1605_2243 212
986 3300046474 Ga0495605_0016231 Ga0495605_0016231_1550_2188 212
987 3300046474 Ga0495605_0029228 Ga0495605_0029228_982_1620 212
988 3300046474 Ga0495605_0035624 Ga0495605_0035624_945_1583 212
989 3300046474 Ga0495605_0057448 Ga0495605_0057448_338_976 212
990 3300046475 Ga0495639_0000444 Ga0495639_0000444_10197_10835 212
991 3300046491 Ga0495584_0001930 Ga0495584_0001930_3519_4157 212
992 3300046491 Ga0495584_0006526 Ga0495584_0006526_1875_2513 212
993 3300046491 Ga0495584_0009316 Ga0495584_0009316_3746_4384 212
994 3300046491 Ga0495584_0010251 Ga0495584_0010251_3527_4165 212
995 3300046491 Ga0495584_0010587 Ga0495584_0010587_650_1288 212
996 3300046491 Ga0495584_0011913 Ga0495584_0011913_3386_4024 212
997 3300046491 Ga0495584_0011929 Ga0495584_0011929_2841_3479 212
998 3300046492 Ga0495585_0002921 Ga0495585_0002921_3461_4099 212
999 3300046492 Ga0495585_0004927 Ga0495585_0004927_1950_2588 212
1000 3300046492 Ga0495585_0005380 Ga0495585_0005380_813_1451 212
1001 3300046492 Ga0495585_0016691 Ga0495585_0016691_3357_3995 212
1002 3300046492 Ga0495585_0079802 Ga0495585_0079802_875_1513 212
1003 3300046492 Ga0495585_0083975 Ga0495585_0083975_1069_1707 212
1004 3300046492 Ga0495585_0114606 Ga0495585_0114606_508_1146 212
1005 3300046500 Ga0495596_0002695 Ga0495596_0002695_7724_8362 212
1006 3300046501 Ga0495607_0006796 Ga0495607_0006796_5919_6557 212
1007 3300046501 Ga0495607_0006981 Ga0495607_0006981_7152_7790 212
1008 3300046501 Ga0495607_0007583 Ga0495607_0007583_4513_5151 212
1009 3300046501 Ga0495607_0014785 Ga0495607_0014785_1534_2172 212
1010 3300046501 Ga0495607_0028506 Ga0495607_0028506_2534_3172 212
1011 3300046501 Ga0495607_0055584 Ga0495607_0055584_1153_1791 212
1012 3300046501 Ga0495607_0060380 Ga0495607_0060380_1096_1734 212
1013 3300046501 Ga0495607_0065116 Ga0495607_0065116_202_840 212
1014 3300046501 Ga0495607_0065776 Ga0495607_0065776_778_1416 212
1015 3300046501 Ga0495607_0222531 Ga0495607_0222531_207_845 212
1016 3300046506 Ga0495583_0002807 Ga0495583_0002807_5863_6501 212
1017 3300046506 Ga0495583_0005217 Ga0495583_0005217_5886_6524 212
1018 3300046507 Ga0495606_0000177 Ga0495606_0000177_62335_62973 212
1019 3300046507 Ga0495606_0009768 Ga0495606_0009768_3693_4331 212
1020 3300046507 Ga0495606_0021409 Ga0495606_0021409_3181_3819 212
1021 3300046507 Ga0495606_0025720 Ga0495606_0025720_1984_2622 212
1022 3300046507 Ga0495606_0026432 Ga0495606_0026432_3427_4065 212
1023 3300046507 Ga0495606_0037403 Ga0495606_0037403_857_1495 212
1024 3300046507 Ga0495606_0038442 Ga0495606_0038442_1392_2030 212
1025 3300046507 Ga0495606_0068766 Ga0495606_0068766_1576_2214 212
1026 3300046507 Ga0495606_0111488 Ga0495606_0111488_48_686 212
1027 3300046512 Ga0495610_0003101 Ga0495610_0003101_7833_8471 212
1028 3300046512 Ga0495610_0007353 Ga0495610_0007353_5759_6397 212
1029 3300046512 Ga0495610_0007859 Ga0495610_0007859_64_702 212
1030 3300046512 Ga0495610_0015192 Ga0495610_0015192_2246_2884 212
1031 3300046512 Ga0495610_0018566 Ga0495610_0018566_1698_2336 212
1032 3300046512 Ga0495610_0047645 Ga0495610_0047645_1157_1795 212
1033 3300046512 Ga0495610_0086259 Ga0495610_0086259_720_1358 212
1034 3300046512 Ga0495610_0188096 Ga0495610_0188096_124_762 212
1035 3300046513 Ga0495616_0005418 Ga0495616_0005418_5785_6423 212
1036 3300046513 Ga0495616_0015338 Ga0495616_0015338_266_904 212
1037 3300046513 Ga0495616_0018417 Ga0495616_0018417_2257_2895 212
1038 3300046513 Ga0495616_0022030 Ga0495616_0022030_1470_2108 212
1039 3300046513 Ga0495616_0035602 Ga0495616_0035602_1646_2284 212
1040 3300046513 Ga0495616_0083868 Ga0495616_0083868_690_1328 212
1041 3300046515 Ga0495620_0000039 Ga0495620_0000039_22339_22977 212
1042 3300046515 Ga0495620_0006831 Ga0495620_0006831_4098_4736 212
1043 3300046515 Ga0495620_0047560 Ga0495620_0047560_1059_1697 212
1044 3300046517 Ga0495630_0008413 Ga0495630_0008413_5877_6515 212
1045 3300046518 Ga0495631_0002026 Ga0495631_0002026_3437_4075 212
1046 3300046518 Ga0495631_0015598 Ga0495631_0015598_2544_3182 212
1047 3300046518 Ga0495631_0030329 Ga0495631_0030329_623_1261 212
1048 3300046519 Ga0495632_0001966 Ga0495632_0001966_3508_4146 212
1049 3300046519 Ga0495632_0003351 Ga0495632_0003351_7325_7963 212
1050 3300046519 Ga0495632_0003817 Ga0495632_0003817_3519_4157 212
1051 3300046519 Ga0495632_0008689 Ga0495632_0008689_1584_2222 212
1052 3300046519 Ga0495632_0026572 Ga0495632_0026572_1187_1825 212
1053 3300046519 Ga0495632_0043247 Ga0495632_0043247_351_989 212
1054 3300046519 Ga0495632_0049112 Ga0495632_0049112_392_1030 212
1055 3300046519 Ga0495632_0104722 Ga0495632_0104722_93_731 212
1056 3300046520 Ga0495637_0000393 Ga0495637_0000393_6593_7231 212
1057 3300046520 Ga0495637_0002680 Ga0495637_0002680_8030_8668 212
1058 3300046520 Ga0495637_0003136 Ga0495637_0003136_2144_2782 212
1059 3300046520 Ga0495637_0003862 Ga0495637_0003862_172_810 212
1060 3300046520 Ga0495637_0028791 Ga0495637_0028791_1348_1986 212
1061 3300046520 Ga0495637_0038598 Ga0495637_0038598_1194_1832 212
1062 3300046520 Ga0495637_0040801 Ga0495637_0040801_1279_1917 212
1063 3300046520 Ga0495637_0051080 Ga0495637_0051080_537_1175 212
1064 3300046520 Ga0495637_0078430 Ga0495637_0078430_509_1147 212
1065 3300046520 Ga0495637_0078500 Ga0495637_0078500_560_1198 212
1066 3300046520 Ga0495637_0129801 Ga0495637_0129801_274_912 212
1067 3300046522 Ga0495643_0001673 Ga0495643_0001673_927_1565 212
1068 3300046522 Ga0495643_0009672 Ga0495643_0009672_3486_4124 212
1069 3300046522 Ga0495643_0012882 Ga0495643_0012882_887_1525 212
1070 3300046522 Ga0495643_0171255 Ga0495643_0171255_86_724 212
1071 3300046522 Ga0495643_0177923 Ga0495643_0177923_318_956 212
1072 3300046523 Ga0495644_0000975 Ga0495644_0000975_7713_8351 212
1073 3300046523 Ga0495644_0005130 Ga0495644_0005130_795_1433 212
1074 3300046523 Ga0495644_0049038 Ga0495644_0049038_216_854 212
1075 3300046524 Ga0495648_0000960 Ga0495648_0000960_6475_7113 212
1076 3300046524 Ga0495648_0011440 Ga0495648_0011440_4878_5516 212
1077 3300046524 Ga0495648_0019242 Ga0495648_0019242_1402_2040 212
1078 3300046524 Ga0495648_0044392 Ga0495648_0044392_1023_1661 212
1079 3300046524 Ga0495648_0064927 Ga0495648_0064927_213_851 212
1080 3300046524 Ga0495648_0065311 Ga0495648_0065311_511_1149 212
1081 3300046524 Ga0495648_0131296 Ga0495648_0131296_208_846 212
1082 3300046524 Ga0495648_0146757 Ga0495648_0146757_141_779 212
1083 3300046524 Ga0495648_0158352 Ga0495648_0158352_254_892 212
1084 3300046524 Ga0495648_0208269 Ga0495648_0208269_80_718 212
1085 3300046526 Ga0495666_0004351 Ga0495666_0004351_5980_6618 212
1086 3300046528 Ga0495642_0000237 Ga0495642_0000237_3498_4136 212
1087 3300046528 Ga0495642_0000270 Ga0495642_0000270_27711_28349 212
1088 3300046528 Ga0495642_0012208 Ga0495642_0012208_848_1486 212
1089 3300046530 Ga0495654_0003373 Ga0495654_0003373_6890_7528 212
1090 3300046530 Ga0495654_0013941 Ga0495654_0013941_2077_2715 212
1091 3300046530 Ga0495654_0014836 Ga0495654_0014836_711_1349 212
1092 3300046530 Ga0495654_0016049 Ga0495654_0016049_2093_2731 212
1093 3300046530 Ga0495654_0016726 Ga0495654_0016726_2925_3563 212
1094 3300046530 Ga0495654_0019909 Ga0495654_0019909_2773_3411 212
1095 3300046530 Ga0495654_0056165 Ga0495654_0056165_942_1580 212
1096 3300046530 Ga0495654_0093612 Ga0495654_0093612_363_1001 212
1097 3300046530 Ga0495654_0128740 Ga0495654_0128740_411_1049 212
1098 3300046538 Ga0495609_0006042 Ga0495609_0006042_2044_2682 212
1099 3300046538 Ga0495609_0007083 Ga0495609_0007083_1291_1929 212
1100 3300046538 Ga0495609_0008362 Ga0495609_0008362_408_1046 212
1101 3300046538 Ga0495609_0068506 Ga0495609_0068506_215_853 212
1102 3300046538 Ga0495609_0095384 Ga0495609_0095384_280_918 212
1103 3300046542 Ga0495597_0008969 Ga0495597_0008969_3410_4048 212
1104 3300046542 Ga0495597_0029685 Ga0495597_0029685_885_1523 212
1105 3300046542 Ga0495597_0034222 Ga0495597_0034222_547_1185 212
1106 3300046542 Ga0495597_0039639 Ga0495597_0039639_504_1142 212
1107 3300046542 Ga0495597_0077882 Ga0495597_0077882_323_961 212
1108 3300046557 Ga0495622_0005331 Ga0495622_0005331_506_1144 212
1109 3300046557 Ga0495622_0007157 Ga0495622_0007157_4026_4664 212
1110 3300046557 Ga0495622_0037419 Ga0495622_0037419_221_859 212
1111 3300046558 Ga0495633_0009466 Ga0495633_0009466_1252_1890 212
1112 3300046558 Ga0495633_0051670 Ga0495633_0051670_709_1347 212
1113 3300046558 Ga0495633_0060047 Ga0495633_0060047_484_1122 212
1114 3300046616 Ga0495668_0002528 Ga0495668_0002528_7665_8303 212
1115 3300046616 Ga0495668_0055166 Ga0495668_0055166_1476_2114 212
1116 3300046648 Ga0495611_0002529 Ga0495611_0002529_5307_5945 212
1117 3300046660 Ga0495625_0040982 Ga0495625_0040982_1962_2600 212
1118 3300046660 Ga0495625_0053539 Ga0495625_0053539_1300_1938 212
1119 3300046660 Ga0495625_0089581 Ga0495625_0089581_1207_1845 212
1120 3300046660 Ga0495625_0144246 Ga0495625_0144246_625_1263 212
1121 3300046660 Ga0495625_0180050 Ga0495625_0180050_695_1333 212
1122 3300046664 Ga0495659_0001738 Ga0495659_0001738_2100_2738 212
1123 3300046665 Ga0495661_0000061 Ga0495661_0000061_79792_80430 212
1124 3300046665 Ga0495661_0007575 Ga0495661_0007575_1906_2544 212
1125 3300046665 Ga0495661_0022508 Ga0495661_0022508_675_1313 212
1126 3300046665 Ga0495661_0032339 Ga0495661_0032339_1383_2021 212
1127 3300046665 Ga0495661_0044113 Ga0495661_0044113_998_1636 212
1128 3300046665 Ga0495661_0050582 Ga0495661_0050582_1140_1778 212
1129 3300046665 Ga0495661_0071447 Ga0495661_0071447_629_1267 212
1130 3300046674 Ga0495588_0037096 Ga0495588_0037096_1172_1810 212
1131 3300046674 Ga0495588_0107113 Ga0495588_0107113_230_868 212
1132 3300046679 Ga0495623_0009150 Ga0495623_0009150_4251_4889 212
1133 3300046684 Ga0495669_0060742 Ga0495669_0060742_160_798 212
1134 3300046691 Ga0495670_0007368 Ga0495670_0007368_2276_2914 212
1135 3300046691 Ga0495670_0032832 Ga0495670_0032832_1817_2455 212
1136 3300046691 Ga0495670_0045971 Ga0495670_0045971_521_1159 212
1137 3300046691 Ga0495670_0079658 Ga0495670_0079658_86_724 212
1138 3300046692 Ga0495671_0000805 Ga0495671_0000805_3481_4119 212
1139 3300046692 Ga0495671_0002987 Ga0495671_0002987_7726_8409 212
1140 3300046692 Ga0495671_0066941 Ga0495671_0066941_129_767 212
1141 3300046692 Ga0495671_0264954 Ga0495671_0264954_175_813 212
1142 3300046694 Ga0495649_0000531 Ga0495649_0000531_23912_24550 212
1143 3300046694 Ga0495649_0001245 Ga0495649_0001245_15311_15955 212
1144 3300046694 Ga0495649_0003048 Ga0495649_0003048_7760_8398 212
1145 3300046694 Ga0495649_0003710 Ga0495649_0003710_3521_4159 212
1146 3300046694 Ga0495649_0012270 Ga0495649_0012270_2775_3413 212
1147 3300046694 Ga0495649_0018586 Ga0495649_0018586_1578_2216 212
1148 3300046694 Ga0495649_0051485 Ga0495649_0051485_209_847 212
1149 3300046694 Ga0495649_0078880 Ga0495649_0078880_69_707 212
1150 3300046694 Ga0495649_0088332 Ga0495649_0088332_455_1093 212
1151 3300046794 Ga0495589_0002695 Ga0495589_0002695_5769_6407 212
1152 3300046794 Ga0495589_0012290 Ga0495589_0012290_86_724 212
1153 3300046794 Ga0495589_0015306 Ga0495589_0015306_86_724 212
1154 3300046794 Ga0495589_0037613 Ga0495589_0037613_274_912 212
1155 3300046794 Ga0495589_0046040 Ga0495589_0046040_789_1427 212
1156 3300046810 Ga0495660_0029689 Ga0495660_0029689_326_964 212
1157 3300046810 Ga0495660_0037406 Ga0495660_0037406_208_846 212
1158 3300046810 Ga0495660_0070082 Ga0495660_0070082_1150_1788 212
1159 3300046810 Ga0495660_0085758 Ga0495660_0085758_88_726 212
1160 3300046810 Ga0495660_0113005 Ga0495660_0113005_426_1064 212
1161 3300046810 Ga0495660_0190575 Ga0495660_0190575_259_897 212
1162 3300047315 Ga0495581_0003592 Ga0495581_0003592_906_1544 212
1163 3300047318 Ga0495636_0002667 Ga0495636_0002667_4124_4762 212
1164 3300047318 Ga0495636_0014338 Ga0495636_0014338_1943_2581 212
1165 3300047318 Ga0495636_0014946 Ga0495636_0014946_117_755 212
1166 3300047320 Ga0495672_0004415 Ga0495672_0004415_3715_4353 212
1167 3300047320 Ga0495672_0005033 Ga0495672_0005033_2136_2774 212
1168 3300047320 Ga0495672_0012539 Ga0495672_0012539_1171_1809 212
1169 3300047320 Ga0495672_0017611 Ga0495672_0017611_2613_3251 212
1170 3300047320 Ga0495672_0025576 Ga0495672_0025576_2392_3030 212
1171 3300047320 Ga0495672_0028180 Ga0495672_0028180_1231_1869 212
1172 3300047320 Ga0495672_0028941 Ga0495672_0028941_2044_2682 212
1173 3300047320 Ga0495672_0068702 Ga0495672_0068702_1057_1695 212
1174 3300047320 Ga0495672_0098395 Ga0495672_0098395_897_1535 212
1175 3300047320 Ga0495672_0142219 Ga0495672_0142219_519_1157 212
1176 3300047320 Ga0495672_0282460 Ga0495672_0282460_11_649 212
1177 3300047321 Ga0495676_0008681 Ga0495676_0008681_3236_3874 212
1178 3300047322 Ga0495680_0018582 Ga0495680_0018582_1024_1662 212
1179 3300047322 Ga0495680_0075397 Ga0495680_0075397_567_1205 212
1180 3300047323 Ga0495683_0000207 Ga0495683_0000207_52013_52651 212
1181 3300047323 Ga0495683_0002916 Ga0495683_0002916_3777_4415 212
1182 3300047323 Ga0495683_0003871 Ga0495683_0003871_285_923 212
1183 3300047323 Ga0495683_0038518 Ga0495683_0038518_1119_1757 212
1184 3300047323 Ga0495683_0042127 Ga0495683_0042127_309_947 212
1185 3300047443 Ga0495687_005908 Ga0495687_005908_4515_5153 212
1186 3300047443 Ga0495687_012488 Ga0495687_012488_3505_4143 212
1187 3300047443 Ga0495687_028666 Ga0495687_028666_1607_2245 212
1188 3300047444 Ga0495675_0018497 Ga0495675_0018497_3494_4132 212
1189 3300047445 Ga0495677_0001738 Ga0495677_0001738_64_702 212
1190 3300047446 Ga0495679_005828 Ga0495679_005828_1383_2021 212
1191 3300047446 Ga0495679_016669 Ga0495679_016669_353_991 212
1192 3300047469 Ga0495673_0002875 Ga0495673_0002875_3424_4062 212
1193 3300047469 Ga0495673_0009659 Ga0495673_0009659_966_1604 212
1194 3300047469 Ga0495673_0013229 Ga0495673_0013229_3356_3994 212
1195 3300047469 Ga0495673_0022816 Ga0495673_0022816_2091_2729 212
1196 3300047469 Ga0495673_0029293 Ga0495673_0029293_1035_1673 212
1197 3300047469 Ga0495673_0042856 Ga0495673_0042856_562_1200 212
1198 3300047469 Ga0495673_0234113 Ga0495673_0234113_22_660 212
1199 3300047470 Ga0495681_0001573 Ga0495681_0001573_16025_16663 212
1200 3300047470 Ga0495681_0004171 Ga0495681_0004171_7746_8384 212
1201 3300047470 Ga0495681_0005234 Ga0495681_0005234_5679_6317 212
1202 3300047470 Ga0495681_0006018 Ga0495681_0006018_1471_2109 212
1203 3300047470 Ga0495681_0007812 Ga0495681_0007812_2108_2746 212
1204 3300047470 Ga0495681_0034316 Ga0495681_0034316_743_1381 212
1205 3300047470 Ga0495681_0041884 Ga0495681_0041884_1367_2005 212
1206 3300047470 Ga0495681_0050152 Ga0495681_0050152_358_996 212
1207 3300047470 Ga0495681_0066529 Ga0495681_0066529_935_1573 212
1208 3300047471 Ga0495684_0006237 Ga0495684_0006237_8041_8679 212
1209 3300047472 Ga0495686_0008952 Ga0495686_0008952_4803_5441 212
1210 3300048091 Ga0495626_0000678 Ga0495626_0000678_25345_25983 212
1211 3300048091 Ga0495626_0003052 Ga0495626_0003052_3339_3977 212
1212 3300048091 Ga0495626_0003444 Ga0495626_0003444_1727_2365 212
1213 3300048091 Ga0495626_0003637 Ga0495626_0003637_1393_2031 212
1214 3300048091 Ga0495626_0014645 Ga0495626_0014645_2788_3426 212
1215 3300048091 Ga0495626_0018953 Ga0495626_0018953_944_1582 212
1216 3300048091 Ga0495626_0036940 Ga0495626_0036940_1043_1681 212
1217 3300048913 Ga0496110_0049528 Ga0496110_0049528_2094_2732 212
1218 3300048913 Ga0496110_0309836 Ga0496110_0309836_691_1329 212
1219 3300048913 Ga0496110_0707054 Ga0496110_0707054_40_678 212
1220 3300048914 Ga0496111_0213673 Ga0496111_0213673_468_1106 212
1221 3300048917 Ga0496114_0007131 Ga0496114_0007131_3767_4405 212
1222 3300048919 Ga0496116_0000670 Ga0496116_0000670_8064_8702 212
1223 3300048919 Ga0496116_0029466 Ga0496116_0029466_1685_2323 212
1224 3300048920 Ga0496117_0002093 Ga0496117_0002093_8065_8703 212
1225 3300048920 Ga0496117_0002217 Ga0496117_0002217_1980_2618 212
1226 3300048920 Ga0496117_0003858 Ga0496117_0003858_1063_1701 212
1227 3300048920 Ga0496117_0006799 Ga0496117_0006799_9783_10421 212
1228 3300048920 Ga0496117_0013238 Ga0496117_0013238_5106_5744 212
1229 3300048920 Ga0496117_0043602 Ga0496117_0043602_823_1464 212
1230 3300048920 Ga0496117_0155598 Ga0496117_0155598_306_944 212
1231 3300048921 Ga0496118_0001842 Ga0496118_0001842_3374_4012 212
1232 3300048921 Ga0496118_0037855 Ga0496118_0037855_1582_2220 212
1233 3300048921 Ga0496118_0041256 Ga0496118_0041256_1003_1641 212
1234 3300048921 Ga0496118_0054999 Ga0496118_0054999_1603_2241 212
1235 3300048921 Ga0496118_0074123 Ga0496118_0074123_1140_1781 212
1236 3300048921 Ga0496118_0145066 Ga0496118_0145066_642_1280 212
1237 3300048922 Ga0496119_0000229 Ga0496119_0000229_62193_62834 212
1238 3300048922 Ga0496119_0059214 Ga0496119_0059214_808_1446 212
1239 3300048922 Ga0496119_0223052 Ga0496119_0223052_67_705 212
1240 3300048923 Ga0496120_0001476 Ga0496120_0001476_11805_12446 212
1241 3300048924 Ga0496121_0001246 Ga0496121_0001246_36032_36670 212
1242 3300048924 Ga0496121_0032444 Ga0496121_0032444_198_839 212
1243 3300048924 Ga0496121_0180633 Ga0496121_0180633_167_805 212
1244 3300048924 Ga0496121_0214588 Ga0496121_0214588_398_1036 212
1245 3300048925 Ga0496122_0000590 Ga0496122_0000590_59031_59669 212
1246 3300048925 Ga0496122_0009159 Ga0496122_0009159_2517_3155 212
1247 3300048925 Ga0496122_0076098 Ga0496122_0076098_1665_2303 212
1248 3300048926 Ga0496123_0000088 Ga0496123_0000088_90755_91393 212
1249 3300048926 Ga0496123_0033910 Ga0496123_0033910_215_853 212
1250 3300048926 Ga0496123_0092130 Ga0496123_0092130_1034_1672 212
1251 3300048927 Ga0496124_0003431 Ga0496124_0003431_1947_2585 212
1252 3300048927 Ga0496124_0014858 Ga0496124_0014858_1911_2549 212
1253 3300048927 Ga0496124_0020430 Ga0496124_0020430_4262_4900 212
1254 3300048927 Ga0496124_0167101 Ga0496124_0167101_349_987 212
1255 3300048927 Ga0496124_0224873 Ga0496124_0224873_684_1322 212
1256 3300048927 Ga0496124_0440525 Ga0496124_0440525_199_837 212
1257 3300048928 Ga0496125_0001017 Ga0496125_0001017_16776_17414 212
1258 3300048928 Ga0496125_0012694 Ga0496125_0012694_1115_1765 212
1259 3300048928 Ga0496125_0014635 Ga0496125_0014635_4978_5616 212
1260 3300048928 Ga0496125_0029631 Ga0496125_0029631_4083_4721 212
1261 3300048928 Ga0496125_0041485 Ga0496125_0041485_3229_3867 212
1262 3300048928 Ga0496125_0074765 Ga0496125_0074765_1667_2305 212
1263 3300048929 Ga0496126_0167615 Ga0496126_0167615_539_1177 212
1264 3300048929 Ga0496126_0346797 Ga0496126_0346797_498_1136 212
1265 3300049459 Ga0495678_005047 Ga0495678_005047_2144_2782 212
1266 3300049459 Ga0495678_011637 Ga0495678_011637_1200_1838 212
1267 3300049459 Ga0495678_015508 Ga0495678_015508_2180_2818 212
1268 3300049459 Ga0495678_017639 Ga0495678_017639_960_1598 212
1269 3300049459 Ga0495678_018354 Ga0495678_018354_93_731 212
1270 3300049459 Ga0495678_028700 Ga0495678_028700_1625_2263 212
1271 3300049459 Ga0495678_114535 Ga0495678_114535_103_741 212
1272 3300049460 Ga0495682_0000124 Ga0495682_0000124_22234_22872 212
1273 3300049460 Ga0495682_0003137 Ga0495682_0003137_1084_1722 212
1274 3300049571 Ga0501034_0000101 Ga0501034_0000101_78568_79206 212
1275 3300049656 Ga0501209_000112 Ga0501209_000112_2913_3551 212
1276 3300049662 Ga0501222_004934 Ga0501222_004934_605_1372 212
1277 3300049665 Ga0501227_047146 Ga0501227_047146_213_851 212
1278 3300049758 Ga0501241_009560 Ga0501241_009560_418_1056 212
1279 3300049822 Ga0501035_0011403 Ga0501035_0011403_7074_7715 212
1280 3300049823 Ga0501044_0000396 Ga0501044_0000396_24427_25068 212
1281 3300049853 Ga0501226_002989 Ga0501226_002989_705_1343 212
1282 3300050489 nmdc:mga03683_69492_c1 nmdc:mga03683_69492_c1_630_1268 212
1283 3300050489 nmdc:mga03683_74871_c1 nmdc:mga03683_74871_c1_805_1443 212
1284 3300050491 nmdc:mga00v17_46197_c1 nmdc:mga00v17_46197_c1_1019_1657 212
1285 3300050491 nmdc:mga00v17_98480_c1 nmdc:mga00v17_98480_c1_922_1560 212
1286 3300050493 nmdc:mga0k408_134424_c1 nmdc:mga0k408_134424_c1_502_1143 212
1287 3300050496 nmdc:mga07m45_218950_c1 nmdc:mga07m45_218950_c1_210_851 212
1288 3300050514 nmdc:mga08x19_200157_c1 nmdc:mga08x19_200157_c1_424_1062 212
1289 3300050514 nmdc:mga08x19_48891_c1 nmdc:mga08x19_48891_c1_587_1225 212
1290 3300053125 Ga0500618_002135 Ga0500618_002135_3677_4315 212
1291 3300053135 Ga0500659_0002113 Ga0500659_0002113_10549_11187 212
1292 3300059477 Ga0587084_003707 Ga0587084_003707_154_804 212
1293 3300059492 Ga0587073_0005079 Ga0587073_0005079_187_837 212
1294 3300059508 Ga0587088_001545 Ga0587088_001545_1711_2361 212
1295 3300059511 Ga0587091_004577 Ga0587091_004577_1135_1785 212
1296 3300059623 Ga0587101_040959 Ga0587101_040959_61_711 212
1297 3300059640 Ga0587067_000901 Ga0587067_000901_65_715 212
1298 3300059641 Ga0587068_004107 Ga0587068_004107_78_728 212
1299 3300059643 Ga0587072_000193 Ga0587072_000193_2194_2844 212
1300 3300059651 Ga0587105_006430 Ga0587105_006430_100_750 212
1301 iso_pu_bacteria 2511231156 2511827635 212

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

44

175

0.96

PF08534

Redoxin

Redoxin

43

193

0.86

PF10417

1-cysPrx_C

C-terminal domain of 1-Cys peroxiredoxin

195

235

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kuu-assembly1.cif.gz_B lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form 0.9613 3 207
7kuu-assembly1.cif.gz_B lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form 0.9566 3 207
6p0w-assembly1.cif.gz_A-2 lsfa from p. aeruginosa, a 1-cys prx in reduced form 0.9492 3 207
5b6n-assembly2.cif.gz_C crystal structures of human peroxiredoxin 6 in sulfinic acid state 0.9423 2 206
6p0w-assembly1.cif.gz_A-2 lsfa from p. aeruginosa, a 1-cys prx in reduced form 0.94 3 207
ID Description Score Start End Superfamily
af_Q54SE2_176_239_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9745 142 206 3.30.1020.10
af_Q54SE2_176_239_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9598 142 206 3.30.1020.10
af_A0A0R0K508_6_109_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9583 7 102 3.40.30.10
af_I1KRJ7_151_218_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9507 142 204 3.30.1020.10
5b6mE01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9417 2 141 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A4Q3TGA5-F1-model_v4 Peroxidase 0.9892 130 208 GO:0051920
AF-A1WG86-F1-model_v4 1-Cys peroxiredoxin (EC 1.11.1.15) 0.989 1 208 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A3D2SRI0-F1-model_v4 Peroxiredoxin 0.987 1 176 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A516SDU3-F1-model_v4 Peroxiredoxin (EC 1.11.1.24) 0.9868 1 208 GO:0005829
GO:0045454
GO:0051920
AF-A0A1H2PQ68-F1-model_v4 Alkyl hydroperoxide reductase subunit AhpC (Peroxiredoxin) 0.9868 1 208 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454

Feature Viewer

pLDDT pTM Quality
94.01 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map