F492696
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1296 | 422 | 2592 | 118 |
Family's Representative Sequence
| Representative Sequence | 3300046472|Ga0495580_0003907|Ga0495580_0003907_8655_9074 |
| Length | 139 |
| Sequence | MAVMDNRPRQLRPLTTSGVIMSDSSNQGIKTVLHPVSDLAAAKAVYTALLGIPPQADGPYYVGFDVAGQHIGLVPGGGPQAMTSPVAYWHVSDIEAKLAEVTAAGATLKEAARDVGGGRLVATVTDPDGNVLGLLQDPQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 74 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 75 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 77 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 107 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 128 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 129 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 130 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 131 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 133 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 134 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 191 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 195 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 196 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 197 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 198 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 199 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 200 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 201 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 202 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 203 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 204 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 205 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 206 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 207 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 208 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 209 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 210 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 211 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 212 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 213 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 214 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 215 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 216 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 217 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 218 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 219 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 220 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 221 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 222 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 223 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 224 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 225 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 226 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 227 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 228 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 229 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 230 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 231 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 232 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 233 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 234 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 235 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 236 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 237 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 238 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 239 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 240 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 241 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 242 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 243 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 244 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 245 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 246 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 247 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 249 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 250 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 251 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 252 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 253 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 254 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 255 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 256 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 257 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 258 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 259 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 260 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 261 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 262 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 263 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 264 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 265 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 266 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 267 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 268 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 269 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 270 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 271 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 272 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 273 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 274 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 275 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 276 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 277 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 278 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 279 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 280 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 281 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 282 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 283 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 284 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 285 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 286 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 350 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 351 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 352 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 353 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 354 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 355 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 356 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 357 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 358 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 359 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 360 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 361 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 362 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 363 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 364 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 365 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 366 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 367 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 368 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 399 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 413 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 414 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 415 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 416 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 417 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 419 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 420 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 421 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 422 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.23 |
| Metatranscriptomes | 1.47 |
| Isolates | 0.31 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.15 |
| Nodule | 0.08 |
| Rhizoplane | 6.87 |
| Rhizosphere | 90.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.32 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495580_0003907 | 3300046472 | Bacteria | 12592 |
| 2 | JGI24751J29686_10145405 | 3300002459 | Bacteria | 503 |
| 3 | JGI25406J46586_10025075 | 3300003203 | Bacteria | 2322 |
| 4 | JGI25406J46586_10029754 | 3300003203 | Bacteria | 2062 |
| 5 | JGI25406J46586_10065086 | 3300003203 | Bacteria | 1163 |
| 6 | JGI25406J46586_10179250 | 3300003203 | Bacteria | 618 |
| 7 | JGI25407J50210_10027103 | 3300003373 | Bacteria | 1486 |
| 8 | JGI25407J50210_10038167 | 3300003373 | Bacteria | 1233 |
| 9 | JGI25407J50210_10044410 | 3300003373 | Bacteria | 1135 |
| 10 | JGI25407J50210_10070060 | 3300003373 | Bacteria | 875 |
| 11 | JGI25404J52841_10019512 | 3300003659 | Bacteria | 1469 |
| 12 | Ga0058861_11156605 | 3300004800 | Unclassified | 632 |
| 13 | Ga0065712_10010065 | 3300005290 | Bacteria | 2434 |
| 14 | Ga0065715_10066109 | 3300005293 | Unclassified | 681 |
| 15 | Ga0070658_10546773 | 3300005327 | Bacteria | 1002 |
| 16 | Ga0070676_10216831 | 3300005328 | Bacteria | 1262 |
| 17 | Ga0070676_11312104 | 3300005328 | Bacteria | 553 |
| 18 | Ga0070676_11414474 | 3300005328 | Bacteria | 534 |
| 19 | Ga0070683_100029004 | 3300005329 | Bacteria | 5006 |
| 20 | Ga0070683_100245438 | 3300005329 | Bacteria | 1703 |
| 21 | Ga0070683_100571599 | 3300005329 | Bacteria | 1081 |
| 22 | Ga0070690_100194570 | 3300005330 | Bacteria | 1408 |
| 23 | Ga0070690_101027059 | 3300005330 | Unclassified | 651 |
| 24 | Ga0068869_101552718 | 3300005334 | Bacteria | 589 |
| 25 | Ga0070680_100215607 | 3300005336 | Bacteria | 1620 |
| 26 | Ga0070682_100039482 | 3300005337 | Bacteria | 2901 |
| 27 | Ga0070682_100283303 | 3300005337 | Bacteria | 1209 |
| 28 | Ga0070682_100392629 | 3300005337 | Bacteria | 1047 |
| 29 | Ga0068868_100028892 | 3300005338 | Bacteria | 4244 |
| 30 | Ga0068868_100847747 | 3300005338 | Bacteria | 827 |
| 31 | Ga0068868_101547610 | 3300005338 | Bacteria | 622 |
| 32 | Ga0070660_100005305 | 3300005339 | Bacteria | 8917 |
| 33 | Ga0070689_100261859 | 3300005340 | Bacteria | 1430 |
| 34 | Ga0070689_100301598 | 3300005340 | Bacteria | 1334 |
| 35 | Ga0070687_100196359 | 3300005343 | Bacteria | 1220 |
| 36 | Ga0070692_10250770 | 3300005345 | Bacteria | 1060 |
| 37 | Ga0070692_10256690 | 3300005345 | Bacteria | 1049 |
| 38 | Ga0070692_10734759 | 3300005345 | Bacteria | 668 |
| 39 | Ga0070669_100966091 | 3300005353 | Bacteria | 730 |
| 40 | Ga0070675_100380727 | 3300005354 | Bacteria | 1256 |
| 41 | Ga0070675_101275884 | 3300005354 | Bacteria | 677 |
| 42 | Ga0070671_102013932 | 3300005355 | Unclassified | 514 |
| 43 | Ga0070674_100309886 | 3300005356 | Bacteria | 1262 |
| 44 | Ga0070674_100632940 | 3300005356 | Bacteria | 907 |
| 45 | Ga0070674_102013386 | 3300005356 | Bacteria | 526 |
| 46 | Ga0070673_100428567 | 3300005364 | Bacteria | 1187 |
| 47 | Ga0070673_100874509 | 3300005364 | Bacteria | 832 |
| 48 | Ga0070673_101341627 | 3300005364 | Bacteria | 672 |
| 49 | Ga0070688_100283039 | 3300005365 | Bacteria | 1192 |
| 50 | Ga0070688_100334820 | 3300005365 | Bacteria | 1104 |
| 51 | Ga0070659_100068442 | 3300005366 | Bacteria | 2816 |
| 52 | Ga0070709_10001407 | 3300005434 | Bacteria | 13043 |
| 53 | Ga0070709_10002051 | 3300005434 | Bacteria | 10931 |
| 54 | Ga0070709_10002526 | 3300005434 | Bacteria | 9902 |
| 55 | Ga0070709_10829020 | 3300005434 | Bacteria | 727 |
| 56 | Ga0070709_11309209 | 3300005434 | Unclassified | 585 |
| 57 | Ga0070714_100001906 | 3300005435 | Bacteria | 15212 |
| 58 | Ga0070714_100003367 | 3300005435 | Bacteria | 11915 |
| 59 | Ga0070714_100074066 | 3300005435 | Bacteria | 2951 |
| 60 | Ga0070714_100118797 | 3300005435 | Bacteria | 2349 |
| 61 | Ga0070714_100120558 | 3300005435 | Bacteria | 2333 |
| 62 | Ga0070714_100219772 | 3300005435 | Bacteria | 1745 |
| 63 | Ga0070714_100620522 | 3300005435 | Bacteria | 1039 |
| 64 | Ga0070714_100630868 | 3300005435 | Bacteria | 1031 |
| 65 | Ga0070714_101487411 | 3300005435 | Bacteria | 661 |
| 66 | Ga0070714_102122241 | 3300005435 | Bacteria | 547 |
| 67 | Ga0070713_100008866 | 3300005436 | Bacteria | 7160 |
| 68 | Ga0070713_100031781 | 3300005436 | Bacteria | 4208 |
| 69 | Ga0070713_100082147 | 3300005436 | Bacteria | 2751 |
| 70 | Ga0070713_100203675 | 3300005436 | Bacteria | 1788 |
| 71 | Ga0070713_100326682 | 3300005436 | Bacteria | 1418 |
| 72 | Ga0070713_100350996 | 3300005436 | Bacteria | 1368 |
| 73 | Ga0070713_100374181 | 3300005436 | Bacteria | 1326 |
| 74 | Ga0070713_100517124 | 3300005436 | Bacteria | 1128 |
| 75 | Ga0070713_102045192 | 3300005436 | Bacteria | 555 |
| 76 | Ga0070710_10002135 | 3300005437 | Bacteria | 9375 |
| 77 | Ga0070710_10015270 | 3300005437 | Bacteria | 3884 |
| 78 | Ga0070710_10027285 | 3300005437 | Bacteria | 3043 |
| 79 | Ga0070710_10083743 | 3300005437 | Bacteria | 1867 |
| 80 | Ga0070710_10084363 | 3300005437 | Bacteria | 1861 |
| 81 | Ga0070710_10338637 | 3300005437 | Unclassified | 992 |
| 82 | Ga0070710_10378325 | 3300005437 | Bacteria | 944 |
| 83 | Ga0070710_10611765 | 3300005437 | Unclassified | 759 |
| 84 | Ga0070701_10387131 | 3300005438 | Bacteria | 883 |
| 85 | Ga0070701_11009715 | 3300005438 | Bacteria | 581 |
| 86 | Ga0070711_100001226 | 3300005439 | Bacteria | 13849 |
| 87 | Ga0070711_100045301 | 3300005439 | Bacteria | 2991 |
| 88 | Ga0070711_100083056 | 3300005439 | Bacteria | 2287 |
| 89 | Ga0070711_100187022 | 3300005439 | Bacteria | 1589 |
| 90 | Ga0070711_100313264 | 3300005439 | Bacteria | 1251 |
| 91 | Ga0070711_100458411 | 3300005439 | Unclassified | 1045 |
| 92 | Ga0070705_100241031 | 3300005440 | Unclassified | 1263 |
| 93 | Ga0070700_100299846 | 3300005441 | Bacteria | 1173 |
| 94 | Ga0070694_100157699 | 3300005444 | Bacteria | 1662 |
| 95 | Ga0070708_100014601 | 3300005445 | Bacteria | 6469 |
| 96 | Ga0070708_100017056 | 3300005445 | Bacteria | 6047 |
| 97 | Ga0070708_100073026 | 3300005445 | Bacteria | 3092 |
| 98 | Ga0070663_100005352 | 3300005455 | Bacteria | 7618 |
| 99 | Ga0070663_101591162 | 3300005455 | Bacteria | 582 |
| 100 | Ga0070678_101271624 | 3300005456 | Bacteria | 684 |
| 101 | Ga0070678_101582750 | 3300005456 | Bacteria | 615 |
| 102 | Ga0070662_100271606 | 3300005457 | Unclassified | 1369 |
| 103 | Ga0070662_100375049 | 3300005457 | Bacteria | 1170 |
| 104 | Ga0070681_10565069 | 3300005458 | Unclassified | 1051 |
| 105 | Ga0070681_10757346 | 3300005458 | Bacteria | 888 |
| 106 | Ga0068867_100278592 | 3300005459 | Bacteria | 1371 |
| 107 | Ga0070685_10360361 | 3300005466 | Bacteria | 997 |
| 108 | Ga0070685_10550088 | 3300005466 | Bacteria | 824 |
| 109 | Ga0070706_100022274 | 3300005467 | Bacteria | 5833 |
| 110 | Ga0070706_100456009 | 3300005467 | Bacteria | 1190 |
| 111 | Ga0070706_101271474 | 3300005467 | Bacteria | 675 |
| 112 | Ga0070707_100003908 | 3300005468 | Bacteria | 14029 |
| 113 | Ga0070707_100062063 | 3300005468 | Bacteria | 3585 |
| 114 | Ga0070707_100070994 | 3300005468 | Bacteria | 3354 |
| 115 | Ga0070707_100168655 | 3300005468 | Bacteria | 2133 |
| 116 | Ga0070707_100169938 | 3300005468 | Bacteria | 2125 |
| 117 | Ga0070707_100208378 | 3300005468 | Bacteria | 1906 |
| 118 | Ga0070707_100673076 | 3300005468 | Bacteria | 997 |
| 119 | Ga0070698_100001125 | 3300005471 | Bacteria | 29557 |
| 120 | Ga0070698_100010424 | 3300005471 | Bacteria | 9923 |
| 121 | Ga0070698_100066483 | 3300005471 | Bacteria | 3628 |
| 122 | Ga0070698_100068614 | 3300005471 | Bacteria | 3563 |
| 123 | Ga0070698_100071335 | 3300005471 | Bacteria | 3484 |
| 124 | Ga0070698_100147134 | 3300005471 | Bacteria | 2304 |
| 125 | Ga0070698_100186217 | 3300005471 | Bacteria | 2014 |
| 126 | Ga0070698_100479543 | 3300005471 | Bacteria | 1181 |
| 127 | Ga0070698_100855749 | 3300005471 | Bacteria | 854 |
| 128 | Ga0070698_100938474 | 3300005471 | Unclassified | 811 |
| 129 | Ga0070699_100372075 | 3300005518 | Unclassified | 1289 |
| 130 | Ga0070699_100485062 | 3300005518 | Bacteria | 1122 |
| 131 | Ga0070699_100497076 | 3300005518 | Bacteria | 1108 |
| 132 | Ga0070699_100522980 | 3300005518 | Bacteria | 1079 |
| 133 | Ga0070679_100476952 | 3300005530 | Bacteria | 1192 |
| 134 | Ga0070684_100083660 | 3300005535 | Bacteria | 2828 |
| 135 | Ga0070684_100112456 | 3300005535 | Bacteria | 2443 |
| 136 | Ga0070684_100286159 | 3300005535 | Bacteria | 1511 |
| 137 | Ga0070697_100916145 | 3300005536 | Bacteria | 778 |
| 138 | Ga0068853_100836097 | 3300005539 | Bacteria | 883 |
| 139 | Ga0070686_100193084 | 3300005544 | Bacteria | 1454 |
| 140 | Ga0070686_100451519 | 3300005544 | Bacteria | 988 |
| 141 | Ga0070695_100169587 | 3300005545 | Unclassified | 1539 |
| 142 | Ga0070696_100580311 | 3300005546 | Unclassified | 902 |
| 143 | Ga0070693_100023516 | 3300005547 | Bacteria | 3294 |
| 144 | Ga0070693_100777502 | 3300005547 | Bacteria | 708 |
| 145 | Ga0070704_100648859 | 3300005549 | Unclassified | 932 |
| 146 | Ga0070704_100691672 | 3300005549 | Bacteria | 904 |
| 147 | Ga0070704_100933751 | 3300005549 | Bacteria | 782 |
| 148 | Ga0068855_100139901 | 3300005563 | Bacteria | 2760 |
| 149 | Ga0068855_100313587 | 3300005563 | Bacteria | 1735 |
| 150 | Ga0068855_101506066 | 3300005563 | Bacteria | 691 |
| 151 | Ga0068857_100283273 | 3300005577 | Bacteria | 1525 |
| 152 | Ga0068857_100291562 | 3300005577 | Bacteria | 1502 |
| 153 | Ga0068857_101069062 | 3300005577 | Unclassified | 778 |
| 154 | Ga0068857_101358156 | 3300005577 | Bacteria | 691 |
| 155 | Ga0068854_100337658 | 3300005578 | Bacteria | 1229 |
| 156 | Ga0068854_102116573 | 3300005578 | Bacteria | 520 |
| 157 | Ga0068856_100002969 | 3300005614 | Bacteria | 17381 |
| 158 | Ga0068856_100445329 | 3300005614 | Bacteria | 1316 |
| 159 | Ga0068856_100845331 | 3300005614 | Bacteria | 934 |
| 160 | Ga0068856_100905316 | 3300005614 | Unclassified | 901 |
| 161 | Ga0068856_101606867 | 3300005614 | Bacteria | 663 |
| 162 | Ga0068856_101635283 | 3300005614 | Bacteria | 657 |
| 163 | Ga0068856_101743786 | 3300005614 | Unclassified | 635 |
| 164 | Ga0068856_101751375 | 3300005614 | Unclassified | 633 |
| 165 | Ga0070702_100043474 | 3300005615 | Bacteria | 2532 |
| 166 | Ga0068852_100523008 | 3300005616 | Bacteria | 1184 |
| 167 | Ga0068859_100593646 | 3300005617 | Bacteria | 1201 |
| 168 | Ga0068864_100074576 | 3300005618 | Bacteria | 2960 |
| 169 | Ga0068866_10340539 | 3300005718 | Bacteria | 950 |
| 170 | Ga0068866_10524642 | 3300005718 | Bacteria | 788 |
| 171 | Ga0068861_100884697 | 3300005719 | Bacteria | 845 |
| 172 | Ga0068870_10137632 | 3300005840 | Bacteria | 1426 |
| 173 | Ga0068863_100002784 | 3300005841 | Bacteria | 17320 |
| 174 | Ga0068863_100360141 | 3300005841 | Bacteria | 1418 |
| 175 | Ga0068858_101100825 | 3300005842 | Bacteria | 780 |
| 176 | Ga0068862_100396279 | 3300005844 | Bacteria | 1290 |
| 177 | Ga0081455_10067149 | 3300005937 | Bacteria | 2990 |
| 178 | Ga0081538_10005724 | 3300005981 | Bacteria | 11105 |
| 179 | Ga0081538_10008886 | 3300005981 | Bacteria | 8453 |
| 180 | Ga0081538_10017624 | 3300005981 | Bacteria | 5411 |
| 181 | Ga0081538_10020118 | 3300005981 | Bacteria | 4930 |
| 182 | Ga0081538_10024172 | 3300005981 | Bacteria | 4336 |
| 183 | Ga0081538_10044149 | 3300005981 | Bacteria | 2784 |
| 184 | Ga0081538_10057052 | 3300005981 | Bacteria | 2281 |
| 185 | Ga0081540_1000355 | 3300005983 | Bacteria | 46352 |
| 186 | Ga0081540_1022528 | 3300005983 | Bacteria | 3719 |
| 187 | Ga0081540_1058377 | 3300005983 | Bacteria | 1859 |
| 188 | Ga0081539_10001638 | 3300005985 | Bacteria | 36478 |
| 189 | Ga0081539_10003001 | 3300005985 | Bacteria | 22027 |
| 190 | Ga0081539_10004760 | 3300005985 | Bacteria | 14654 |
| 191 | Ga0081539_10005846 | 3300005985 | Bacteria | 12207 |
| 192 | Ga0081539_10054047 | 3300005985 | Bacteria | 2245 |
| 193 | Ga0081539_10118586 | 3300005985 | Bacteria | 1318 |
| 194 | Ga0070717_10003806 | 3300006028 | Bacteria | 10853 |
| 195 | Ga0070717_10040948 | 3300006028 | Bacteria | 3776 |
| 196 | Ga0070717_10136693 | 3300006028 | Bacteria | 2111 |
| 197 | Ga0070717_10143522 | 3300006028 | Bacteria | 2061 |
| 198 | Ga0070717_10156816 | 3300006028 | Bacteria | 1973 |
| 199 | Ga0070717_10288110 | 3300006028 | Bacteria | 1458 |
| 200 | Ga0070717_10323260 | 3300006028 | Bacteria | 1375 |
| 201 | Ga0070717_10757790 | 3300006028 | Bacteria | 883 |
| 202 | Ga0070717_10908031 | 3300006028 | Bacteria | 802 |
| 203 | Ga0070717_10983230 | 3300006028 | Bacteria | 768 |
| 204 | Ga0070717_11027976 | 3300006028 | Bacteria | 750 |
| 205 | Ga0070717_11043789 | 3300006028 | Bacteria | 744 |
| 206 | Ga0070717_11049088 | 3300006028 | Bacteria | 742 |
| 207 | Ga0075432_10005911 | 3300006058 | Bacteria | 4163 |
| 208 | Ga0075432_10236129 | 3300006058 | Bacteria | 737 |
| 209 | Ga0070715_10000964 | 3300006163 | Bacteria | 8026 |
| 210 | Ga0070715_10380351 | 3300006163 | Bacteria | 779 |
| 211 | Ga0070715_11083792 | 3300006163 | Bacteria | 504 |
| 212 | Ga0070716_100000106 | 3300006173 | Bacteria | 33206 |
| 213 | Ga0070716_100002360 | 3300006173 | Bacteria | 8685 |
| 214 | Ga0070716_100021073 | 3300006173 | Bacteria | 3430 |
| 215 | Ga0070716_100338049 | 3300006173 | Bacteria | 1061 |
| 216 | Ga0070716_101051575 | 3300006173 | Bacteria | 646 |
| 217 | Ga0070712_100007581 | 3300006175 | Bacteria | 6782 |
| 218 | Ga0070712_100015848 | 3300006175 | Bacteria | 4859 |
| 219 | Ga0070712_100087218 | 3300006175 | Bacteria | 2276 |
| 220 | Ga0070712_100104354 | 3300006175 | Bacteria | 2103 |
| 221 | Ga0070712_100350872 | 3300006175 | Bacteria | 1207 |
| 222 | Ga0070712_101358713 | 3300006175 | Unclassified | 620 |
| 223 | Ga0097621_100462113 | 3300006237 | Bacteria | 1145 |
| 224 | Ga0097621_100532519 | 3300006237 | Bacteria | 1067 |
| 225 | Ga0097621_101098290 | 3300006237 | Bacteria | 747 |
| 226 | Ga0075428_100000700 | 3300006844 | Bacteria | 34626 |
| 227 | Ga0075428_100011941 | 3300006844 | Bacteria | 9662 |
| 228 | Ga0075428_100066766 | 3300006844 | Bacteria | 3938 |
| 229 | Ga0075428_100100491 | 3300006844 | Bacteria | 3154 |
| 230 | Ga0075428_100146196 | 3300006844 | Bacteria | 2569 |
| 231 | Ga0075428_100390904 | 3300006844 | Bacteria | 1491 |
| 232 | Ga0075428_100427148 | 3300006844 | Bacteria | 1420 |
| 233 | Ga0075428_100571815 | 3300006844 | Bacteria | 1208 |
| 234 | Ga0075428_101658769 | 3300006844 | Bacteria | 668 |
| 235 | Ga0075430_100006777 | 3300006846 | Bacteria | 9658 |
| 236 | Ga0075430_100056386 | 3300006846 | Bacteria | 3303 |
| 237 | Ga0075430_100097271 | 3300006846 | Bacteria | 2459 |
| 238 | Ga0075430_100377180 | 3300006846 | Bacteria | 1171 |
| 239 | Ga0075431_100002774 | 3300006847 | Bacteria | 16973 |
| 240 | Ga0075431_100013583 | 3300006847 | Bacteria | 8229 |
| 241 | Ga0075431_100089328 | 3300006847 | Bacteria | 3180 |
| 242 | Ga0075431_100284224 | 3300006847 | Bacteria | 1675 |
| 243 | Ga0075431_100500348 | 3300006847 | Bacteria | 1206 |
| 244 | Ga0075433_10102297 | 3300006852 | Bacteria | 2537 |
| 245 | Ga0075434_100001286 | 3300006871 | Bacteria | 20926 |
| 246 | Ga0075434_100043314 | 3300006871 | Bacteria | 4464 |
| 247 | Ga0075434_100184271 | 3300006871 | Bacteria | 2108 |
| 248 | Ga0075434_100265488 | 3300006871 | Bacteria | 1736 |
| 249 | Ga0075434_100805159 | 3300006871 | Bacteria | 956 |
| 250 | Ga0075429_100015603 | 3300006880 | Bacteria | 6583 |
| 251 | Ga0075429_100019984 | 3300006880 | Bacteria | 5807 |
| 252 | Ga0075429_100225452 | 3300006880 | Bacteria | 1641 |
| 253 | Ga0075429_100410564 | 3300006880 | Bacteria | 1186 |
| 254 | Ga0075429_101087116 | 3300006880 | Bacteria | 699 |
| 255 | Ga0068865_100252803 | 3300006881 | Bacteria | 1392 |
| 256 | Ga0068865_100534419 | 3300006881 | Bacteria | 982 |
| 257 | Ga0068865_100538303 | 3300006881 | Bacteria | 979 |
| 258 | Ga0068865_100564568 | 3300006881 | Bacteria | 957 |
| 259 | Ga0068865_100889829 | 3300006881 | Bacteria | 774 |
| 260 | Ga0075436_100025083 | 3300006914 | Bacteria | 4100 |
| 261 | Ga0075436_100039596 | 3300006914 | Bacteria | 3252 |
| 262 | Ga0075436_100621387 | 3300006914 | Bacteria | 797 |
| 263 | Ga0097620_100017973 | 3300006931 | Bacteria | 7106 |
| 264 | Ga0097620_100593696 | 3300006931 | Bacteria | 1201 |
| 265 | Ga0075435_100000284 | 3300007076 | Bacteria | 31543 |
| 266 | Ga0075435_100004226 | 3300007076 | Bacteria | 9863 |
| 267 | Ga0075435_101666842 | 3300007076 | Unclassified | 559 |
| 268 | Ga0099794_10003406 | 3300007265 | Bacteria | 6057 |
| 269 | Ga0099794_10337380 | 3300007265 | Bacteria | 783 |
| 270 | Ga0105240_10811602 | 3300009093 | Bacteria | 1013 |
| 271 | Ga0111539_10252876 | 3300009094 | Bacteria | 2052 |
| 272 | Ga0111539_11225601 | 3300009094 | Bacteria | 871 |
| 273 | Ga0105245_10007401 | 3300009098 | Bacteria | 9615 |
| 274 | Ga0105245_10082153 | 3300009098 | Bacteria | 2947 |
| 275 | Ga0105245_10170003 | 3300009098 | Bacteria | 2075 |
| 276 | Ga0105245_10178446 | 3300009098 | Bacteria | 2027 |
| 277 | Ga0105245_11209111 | 3300009098 | Bacteria | 804 |
| 278 | Ga0105247_10197025 | 3300009101 | Bacteria | 1351 |
| 279 | Ga0105247_11832278 | 3300009101 | Bacteria | 506 |
| 280 | Ga0114129_10000084 | 3300009147 | Bacteria | 87485 |
| 281 | Ga0114129_10005201 | 3300009147 | Bacteria | 18333 |
| 282 | Ga0114129_10039773 | 3300009147 | Bacteria | 6632 |
| 283 | Ga0114129_10118025 | 3300009147 | Bacteria | 3655 |
| 284 | Ga0114129_10343913 | 3300009147 | Bacteria | 1977 |
| 285 | Ga0114129_10430890 | 3300009147 | Bacteria | 1733 |
| 286 | Ga0114129_10644157 | 3300009147 | Bacteria | 1368 |
| 287 | Ga0114129_10981897 | 3300009147 | Bacteria | 1065 |
| 288 | Ga0105243_10022986 | 3300009148 | Bacteria | 4742 |
| 289 | Ga0105243_10062194 | 3300009148 | Unclassified | 2988 |
| 290 | Ga0105243_10091930 | 3300009148 | Bacteria | 2500 |
| 291 | Ga0105241_10067749 | 3300009174 | Bacteria | 2763 |
| 292 | Ga0105241_10646661 | 3300009174 | Bacteria | 960 |
| 293 | Ga0105241_12108421 | 3300009174 | Bacteria | 557 |
| 294 | Ga0105242_10643566 | 3300009176 | Bacteria | 1030 |
| 295 | Ga0105242_12303149 | 3300009176 | Unclassified | 585 |
| 296 | Ga0105248_10440439 | 3300009177 | Bacteria | 1468 |
| 297 | Ga0105248_12768394 | 3300009177 | Bacteria | 559 |
| 298 | Ga0105237_10114788 | 3300009545 | Bacteria | 2686 |
| 299 | Ga0105237_10853197 | 3300009545 | Bacteria | 917 |
| 300 | Ga0105237_11141161 | 3300009545 | Bacteria | 786 |
| 301 | Ga0105238_10015811 | 3300009551 | Bacteria | 7638 |
| 302 | Ga0105238_10856724 | 3300009551 | Bacteria | 926 |
| 303 | Ga0105238_11666325 | 3300009551 | Bacteria | 668 |
| 304 | Ga0105238_12210270 | 3300009551 | Bacteria | 585 |
| 305 | Ga0105238_12469399 | 3300009551 | Bacteria | 555 |
| 306 | Ga0105249_10107477 | 3300009553 | Bacteria | 2633 |
| 307 | Ga0105249_10408384 | 3300009553 | Bacteria | 1390 |
| 308 | Ga0105249_11022210 | 3300009553 | Bacteria | 896 |
| 309 | Ga0105239_10339162 | 3300010375 | Bacteria | 1696 |
| 310 | Ga0105239_10350750 | 3300010375 | Bacteria | 1666 |
| 311 | Ga0105239_10605685 | 3300010375 | Bacteria | 1250 |
| 312 | Ga0105239_10809935 | 3300010375 | Bacteria | 1073 |
| 313 | Ga0105239_11795125 | 3300010375 | Unclassified | 711 |
| 314 | Ga0105246_10001080 | 3300011119 | Bacteria | 15765 |
| 315 | Ga0105246_10349530 | 3300011119 | Bacteria | 1211 |
| 316 | Ga0105246_11061007 | 3300011119 | Bacteria | 737 |
| 317 | Ga0105246_11859222 | 3300011119 | Bacteria | 577 |
| 318 | Ga0157337_1000331 | 3300012483 | Bacteria | 2171 |
| 319 | Ga0157338_1039459 | 3300012515 | Bacteria | 637 |
| 320 | Ga0157370_10105930 | 3300013104 | Bacteria | 2631 |
| 321 | Ga0157370_10451557 | 3300013104 | Bacteria | 1182 |
| 322 | Ga0157370_11003482 | 3300013104 | Bacteria | 756 |
| 323 | Ga0157369_10075813 | 3300013105 | Bacteria | 3605 |
| 324 | Ga0157369_10432010 | 3300013105 | Bacteria | 1365 |
| 325 | Ga0157369_11035313 | 3300013105 | Bacteria | 840 |
| 326 | Ga0157374_10026919 | 3300013296 | Bacteria | 5179 |
| 327 | Ga0157374_10394561 | 3300013296 | Unclassified | 1380 |
| 328 | Ga0157374_11677537 | 3300013296 | Bacteria | 660 |
| 329 | Ga0157378_10245605 | 3300013297 | Bacteria | 1712 |
| 330 | Ga0157378_10436514 | 3300013297 | Bacteria | 1297 |
| 331 | Ga0157378_11423647 | 3300013297 | Bacteria | 736 |
| 332 | Ga0157378_12942436 | 3300013297 | Unclassified | 528 |
| 333 | Ga0163162_10296942 | 3300013306 | Bacteria | 1747 |
| 334 | Ga0163162_10516294 | 3300013306 | Bacteria | 1324 |
| 335 | Ga0163162_10545640 | 3300013306 | Bacteria | 1288 |
| 336 | Ga0163162_12687692 | 3300013306 | Bacteria | 573 |
| 337 | Ga0157372_10029700 | 3300013307 | Bacteria | 5972 |
| 338 | Ga0157372_10321413 | 3300013307 | Unclassified | 1802 |
| 339 | Ga0157372_10803627 | 3300013307 | Bacteria | 1093 |
| 340 | Ga0157372_11415182 | 3300013307 | Bacteria | 801 |
| 341 | Ga0157375_10584030 | 3300013308 | Bacteria | 1277 |
| 342 | Ga0157375_11019055 | 3300013308 | Bacteria | 967 |
| 343 | Ga0157375_11616241 | 3300013308 | Bacteria | 766 |
| 344 | Ga0163163_10013940 | 3300014325 | Bacteria | 7375 |
| 345 | Ga0163163_10105847 | 3300014325 | Bacteria | 2839 |
| 346 | Ga0163163_10559039 | 3300014325 | Bacteria | 1207 |
| 347 | Ga0163163_11474549 | 3300014325 | Bacteria | 742 |
| 348 | Ga0163163_11725308 | 3300014325 | Bacteria | 687 |
| 349 | Ga0163163_12345798 | 3300014325 | Bacteria | 592 |
| 350 | Ga0157380_10096821 | 3300014326 | Bacteria | 2447 |
| 351 | Ga0157380_10762285 | 3300014326 | Bacteria | 980 |
| 352 | Ga0157377_10206465 | 3300014745 | Bacteria | 1250 |
| 353 | Ga0157377_10704547 | 3300014745 | Bacteria | 733 |
| 354 | Ga0157377_11170958 | 3300014745 | Bacteria | 593 |
| 355 | Ga0157379_11137495 | 3300014968 | Bacteria | 749 |
| 356 | Ga0157376_10156538 | 3300014969 | Bacteria | 2061 |
| 357 | Ga0163161_10573595 | 3300017792 | Bacteria | 927 |
| 358 | Ga0197907_10015037 | 3300020069 | Bacteria | 824 |
| 359 | Ga0197907_10018504 | 3300020069 | Bacteria | 534 |
| 360 | Ga0197907_10302286 | 3300020069 | Bacteria | 530 |
| 361 | Ga0197907_11024113 | 3300020069 | Bacteria | 1643 |
| 362 | Ga0197907_11308136 | 3300020069 | Unclassified | 654 |
| 363 | Ga0206356_11502990 | 3300020070 | Bacteria | 500 |
| 364 | Ga0206352_10264080 | 3300020078 | Unclassified | 890 |
| 365 | Ga0206350_10220609 | 3300020080 | Bacteria | 959 |
| 366 | Ga0206354_10480729 | 3300020081 | Bacteria | 724 |
| 367 | Ga0206353_10290880 | 3300020082 | Bacteria | 1515 |
| 368 | Ga0206353_10610583 | 3300020082 | Bacteria | 938 |
| 369 | Ga0206353_10991793 | 3300020082 | Bacteria | 1049 |
| 370 | Ga0206353_12029006 | 3300020082 | Bacteria | 560 |
| 371 | Ga0213873_10037562 | 3300021358 | Bacteria | 1234 |
| 372 | Ga0213874_10201129 | 3300021377 | Bacteria | 717 |
| 373 | Ga0213876_10028639 | 3300021384 | Bacteria | 2936 |
| 374 | Ga0213876_10095731 | 3300021384 | Bacteria | 1573 |
| 375 | Ga0213876_10188717 | 3300021384 | Bacteria | 1096 |
| 376 | Ga0213875_10000986 | 3300021388 | Bacteria | 20337 |
| 377 | Ga0213875_10029170 | 3300021388 | Bacteria | 2616 |
| 378 | Ga0213875_10109653 | 3300021388 | Bacteria | 1289 |
| 379 | Ga0213875_10157987 | 3300021388 | Bacteria | 1063 |
| 380 | Ga0224712_10049903 | 3300022467 | Bacteria | 1623 |
| 381 | Ga0228598_1019200 | 3300024227 | Bacteria | 1348 |
| 382 | Ga0228598_1032450 | 3300024227 | Bacteria | 1029 |
| 383 | Ga0209759_1011348 | 3300025256 | Bacteria | 2539 |
| 384 | Ga0207653_10174970 | 3300025885 | Bacteria | 801 |
| 385 | Ga0207692_10042144 | 3300025898 | Bacteria | 2264 |
| 386 | Ga0207692_10122300 | 3300025898 | Bacteria | 1459 |
| 387 | Ga0207692_10196974 | 3300025898 | Bacteria | 1182 |
| 388 | Ga0207692_10419355 | 3300025898 | Bacteria | 838 |
| 389 | Ga0207692_10551981 | 3300025898 | Bacteria | 736 |
| 390 | Ga0207692_10678448 | 3300025898 | Bacteria | 667 |
| 391 | Ga0207642_10175664 | 3300025899 | Bacteria | 1162 |
| 392 | Ga0207642_10553109 | 3300025899 | Bacteria | 711 |
| 393 | Ga0207710_10120627 | 3300025900 | Bacteria | 1252 |
| 394 | Ga0207710_10515824 | 3300025900 | Bacteria | 621 |
| 395 | Ga0207710_10677394 | 3300025900 | Bacteria | 541 |
| 396 | Ga0207688_10213258 | 3300025901 | Bacteria | 1161 |
| 397 | Ga0207680_10856650 | 3300025903 | Unclassified | 651 |
| 398 | Ga0207685_10053552 | 3300025905 | Bacteria | 1568 |
| 399 | Ga0207685_10067525 | 3300025905 | Bacteria | 1438 |
| 400 | Ga0207699_10000040 | 3300025906 | Bacteria | 120655 |
| 401 | Ga0207699_10000228 | 3300025906 | Bacteria | 32185 |
| 402 | Ga0207699_10071634 | 3300025906 | Bacteria | 2120 |
| 403 | Ga0207699_10150565 | 3300025906 | Bacteria | 1539 |
| 404 | Ga0207699_10239242 | 3300025906 | Unclassified | 1246 |
| 405 | Ga0207699_10847410 | 3300025906 | Bacteria | 673 |
| 406 | Ga0207699_10883030 | 3300025906 | Bacteria | 659 |
| 407 | Ga0207699_11132609 | 3300025906 | Bacteria | 579 |
| 408 | Ga0207643_10017557 | 3300025908 | Bacteria | 3914 |
| 409 | Ga0207643_10170062 | 3300025908 | Bacteria | 1315 |
| 410 | Ga0207705_11403716 | 3300025909 | Bacteria | 531 |
| 411 | Ga0207684_10019316 | 3300025910 | Bacteria | 5829 |
| 412 | Ga0207684_10184809 | 3300025910 | Bacteria | 1797 |
| 413 | Ga0207654_10519668 | 3300025911 | Bacteria | 843 |
| 414 | Ga0207654_11258077 | 3300025911 | Bacteria | 539 |
| 415 | Ga0207671_10295783 | 3300025914 | Bacteria | 1279 |
| 416 | Ga0207693_10006194 | 3300025915 | Bacteria | 9927 |
| 417 | Ga0207693_10007328 | 3300025915 | Bacteria | 9073 |
| 418 | Ga0207693_10008319 | 3300025915 | Bacteria | 8489 |
| 419 | Ga0207693_10021044 | 3300025915 | Bacteria | 5184 |
| 420 | Ga0207693_10037509 | 3300025915 | Bacteria | 3820 |
| 421 | Ga0207693_10149351 | 3300025915 | Bacteria | 1838 |
| 422 | Ga0207693_10187567 | 3300025915 | Bacteria | 1627 |
| 423 | Ga0207693_10344219 | 3300025915 | Bacteria | 1167 |
| 424 | Ga0207693_10430465 | 3300025915 | Bacteria | 1031 |
| 425 | Ga0207693_10806512 | 3300025915 | Unclassified | 723 |
| 426 | Ga0207693_10867428 | 3300025915 | Unclassified | 694 |
| 427 | Ga0207663_10007204 | 3300025916 | Bacteria | 5756 |
| 428 | Ga0207663_10060136 | 3300025916 | Bacteria | 2406 |
| 429 | Ga0207663_10286780 | 3300025916 | Bacteria | 1225 |
| 430 | Ga0207663_10481630 | 3300025916 | Bacteria | 961 |
| 431 | Ga0207663_10554583 | 3300025916 | Bacteria | 899 |
| 432 | Ga0207663_10574583 | 3300025916 | Unclassified | 883 |
| 433 | Ga0207663_10750162 | 3300025916 | Bacteria | 775 |
| 434 | Ga0207663_11429567 | 3300025916 | Bacteria | 557 |
| 435 | Ga0207662_10209599 | 3300025918 | Bacteria | 1265 |
| 436 | Ga0207657_10006792 | 3300025919 | Bacteria | 11811 |
| 437 | Ga0207652_10430999 | 3300025921 | Bacteria | 1189 |
| 438 | Ga0207646_10001500 | 3300025922 | Bacteria | 28687 |
| 439 | Ga0207646_10013695 | 3300025922 | Bacteria | 7746 |
| 440 | Ga0207646_10017090 | 3300025922 | Bacteria | 6795 |
| 441 | Ga0207646_10052242 | 3300025922 | Bacteria | 3657 |
| 442 | Ga0207646_10130270 | 3300025922 | Bacteria | 2263 |
| 443 | Ga0207646_10183588 | 3300025922 | Bacteria | 1889 |
| 444 | Ga0207646_11436765 | 3300025922 | Bacteria | 599 |
| 445 | Ga0207681_10900981 | 3300025923 | Bacteria | 741 |
| 446 | Ga0207694_10068439 | 3300025924 | Bacteria | 2772 |
| 447 | Ga0207694_10555242 | 3300025924 | Bacteria | 964 |
| 448 | Ga0207694_11585574 | 3300025924 | Bacteria | 552 |
| 449 | Ga0207659_10341297 | 3300025926 | Bacteria | 1240 |
| 450 | Ga0207659_10440756 | 3300025926 | Bacteria | 1095 |
| 451 | Ga0207687_10033726 | 3300025927 | Bacteria | 3473 |
| 452 | Ga0207687_10169538 | 3300025927 | Bacteria | 1682 |
| 453 | Ga0207687_10469909 | 3300025927 | Bacteria | 1046 |
| 454 | Ga0207700_10000300 | 3300025928 | Bacteria | 29376 |
| 455 | Ga0207700_10000634 | 3300025928 | Bacteria | 20565 |
| 456 | Ga0207700_10005549 | 3300025928 | Bacteria | 7568 |
| 457 | Ga0207700_10019426 | 3300025928 | Bacteria | 4589 |
| 458 | Ga0207700_10383453 | 3300025928 | Bacteria | 1229 |
| 459 | Ga0207700_10385475 | 3300025928 | Bacteria | 1226 |
| 460 | Ga0207700_10794630 | 3300025928 | Bacteria | 846 |
| 461 | Ga0207700_11325054 | 3300025928 | Bacteria | 641 |
| 462 | Ga0207664_10000997 | 3300025929 | Bacteria | 19022 |
| 463 | Ga0207664_10051077 | 3300025929 | Bacteria | 3263 |
| 464 | Ga0207664_10063622 | 3300025929 | Bacteria | 2949 |
| 465 | Ga0207664_10142104 | 3300025929 | Bacteria | 2032 |
| 466 | Ga0207664_10166950 | 3300025929 | Bacteria | 1881 |
| 467 | Ga0207664_10173226 | 3300025929 | Bacteria | 1848 |
| 468 | Ga0207664_10648464 | 3300025929 | Bacteria | 949 |
| 469 | Ga0207664_10973898 | 3300025929 | Bacteria | 760 |
| 470 | Ga0207664_11103408 | 3300025929 | Bacteria | 709 |
| 471 | Ga0207664_11394151 | 3300025929 | Bacteria | 621 |
| 472 | Ga0207644_11228116 | 3300025931 | Unclassified | 630 |
| 473 | Ga0207644_11258701 | 3300025931 | Bacteria | 622 |
| 474 | Ga0207690_10144613 | 3300025932 | Bacteria | 1756 |
| 475 | Ga0207690_10848794 | 3300025932 | Bacteria | 756 |
| 476 | Ga0207690_11514358 | 3300025932 | Bacteria | 561 |
| 477 | Ga0207706_10373691 | 3300025933 | Bacteria | 1238 |
| 478 | Ga0207706_11375274 | 3300025933 | Bacteria | 580 |
| 479 | Ga0207706_11677686 | 3300025933 | Unclassified | 512 |
| 480 | Ga0207686_11432355 | 3300025934 | Bacteria | 569 |
| 481 | Ga0207709_10107501 | 3300025935 | Bacteria | 1858 |
| 482 | Ga0207709_10179475 | 3300025935 | Bacteria | 1494 |
| 483 | Ga0207709_10404967 | 3300025935 | Unclassified | 1044 |
| 484 | Ga0207709_10460587 | 3300025935 | Bacteria | 985 |
| 485 | Ga0207709_11231828 | 3300025935 | Bacteria | 617 |
| 486 | Ga0207670_10054343 | 3300025936 | Bacteria | 2702 |
| 487 | Ga0207670_10361817 | 3300025936 | Bacteria | 1151 |
| 488 | Ga0207670_10696610 | 3300025936 | Bacteria | 841 |
| 489 | Ga0207669_11104328 | 3300025937 | Bacteria | 670 |
| 490 | Ga0207704_10027498 | 3300025938 | Bacteria | 3140 |
| 491 | Ga0207704_10131784 | 3300025938 | Bacteria | 1733 |
| 492 | Ga0207704_10383130 | 3300025938 | Bacteria | 1104 |
| 493 | Ga0207704_10641735 | 3300025938 | Bacteria | 874 |
| 494 | Ga0207704_10693470 | 3300025938 | Bacteria | 842 |
| 495 | Ga0207665_10000170 | 3300025939 | Bacteria | 44106 |
| 496 | Ga0207665_10011924 | 3300025939 | Bacteria | 5708 |
| 497 | Ga0207665_10038888 | 3300025939 | Bacteria | 3170 |
| 498 | Ga0207665_10067733 | 3300025939 | Bacteria | 2432 |
| 499 | Ga0207665_10183425 | 3300025939 | Bacteria | 1517 |
| 500 | Ga0207665_10360189 | 3300025939 | Bacteria | 1100 |
| 501 | Ga0207711_12087160 | 3300025941 | Bacteria | 509 |
| 502 | Ga0207689_10071337 | 3300025942 | Bacteria | 2853 |
| 503 | Ga0207661_10129123 | 3300025944 | Bacteria | 2162 |
| 504 | Ga0207661_10291438 | 3300025944 | Bacteria | 1461 |
| 505 | Ga0207661_10307829 | 3300025944 | Bacteria | 1422 |
| 506 | Ga0207661_10416252 | 3300025944 | Bacteria | 1220 |
| 507 | Ga0207679_10138605 | 3300025945 | Bacteria | 1963 |
| 508 | Ga0207667_10111212 | 3300025949 | Bacteria | 2825 |
| 509 | Ga0207667_10781069 | 3300025949 | Bacteria | 953 |
| 510 | Ga0207667_10985095 | 3300025949 | Bacteria | 831 |
| 511 | Ga0207651_10090252 | 3300025960 | Bacteria | 2240 |
| 512 | Ga0207651_10949637 | 3300025960 | Bacteria | 767 |
| 513 | Ga0207712_10271312 | 3300025961 | Bacteria | 1380 |
| 514 | Ga0207712_11348297 | 3300025961 | Bacteria | 638 |
| 515 | Ga0207668_10059017 | 3300025972 | Bacteria | 2685 |
| 516 | Ga0207640_10347027 | 3300025981 | Bacteria | 1191 |
| 517 | Ga0207640_11286512 | 3300025981 | Bacteria | 652 |
| 518 | Ga0207677_10030436 | 3300026023 | Bacteria | 3445 |
| 519 | Ga0207677_10603985 | 3300026023 | Unclassified | 963 |
| 520 | Ga0207677_10744617 | 3300026023 | Bacteria | 873 |
| 521 | Ga0207677_12095836 | 3300026023 | Bacteria | 526 |
| 522 | Ga0207639_10142016 | 3300026041 | Bacteria | 2001 |
| 523 | Ga0207639_11080910 | 3300026041 | Bacteria | 752 |
| 524 | Ga0207678_10001185 | 3300026067 | Bacteria | 23892 |
| 525 | Ga0207708_10109732 | 3300026075 | Bacteria | 2141 |
| 526 | Ga0207708_10131498 | 3300026075 | Bacteria | 1957 |
| 527 | Ga0207702_10002526 | 3300026078 | Bacteria | 17233 |
| 528 | Ga0207702_10178421 | 3300026078 | Bacteria | 1954 |
| 529 | Ga0207702_10273606 | 3300026078 | Bacteria | 1594 |
| 530 | Ga0207702_10402456 | 3300026078 | Bacteria | 1320 |
| 531 | Ga0207702_10714774 | 3300026078 | Bacteria | 988 |
| 532 | Ga0207702_11084432 | 3300026078 | Unclassified | 795 |
| 533 | Ga0207702_11157050 | 3300026078 | Unclassified | 768 |
| 534 | Ga0207702_11759548 | 3300026078 | Bacteria | 612 |
| 535 | Ga0207641_10013086 | 3300026088 | Bacteria | 6804 |
| 536 | Ga0207641_10791386 | 3300026088 | Bacteria | 938 |
| 537 | Ga0207648_10355564 | 3300026089 | Bacteria | 1321 |
| 538 | Ga0207676_10566111 | 3300026095 | Bacteria | 1087 |
| 539 | Ga0207676_10591657 | 3300026095 | Bacteria | 1065 |
| 540 | Ga0207676_10670794 | 3300026095 | Bacteria | 1002 |
| 541 | Ga0207676_10921525 | 3300026095 | Bacteria | 858 |
| 542 | Ga0207676_11913254 | 3300026095 | Bacteria | 592 |
| 543 | Ga0207674_10185914 | 3300026116 | Bacteria | 2028 |
| 544 | Ga0207674_10283832 | 3300026116 | Bacteria | 1604 |
| 545 | Ga0207674_10403748 | 3300026116 | Bacteria | 1320 |
| 546 | Ga0207674_10491415 | 3300026116 | Bacteria | 1186 |
| 547 | Ga0207674_11062347 | 3300026116 | Unclassified | 779 |
| 548 | Ga0207675_100501137 | 3300026118 | Bacteria | 1209 |
| 549 | Ga0207683_10183435 | 3300026121 | Bacteria | 1898 |
| 550 | Ga0207683_10310032 | 3300026121 | Bacteria | 1445 |
| 551 | Ga0207683_10370351 | 3300026121 | Bacteria | 1316 |
| 552 | Ga0207683_10602453 | 3300026121 | Bacteria | 1017 |
| 553 | Ga0207683_11905949 | 3300026121 | Unclassified | 543 |
| 554 | Ga0207698_10665220 | 3300026142 | Bacteria | 1033 |
| 555 | Ga0209588_1004768 | 3300027671 | Bacteria | 3847 |
| 556 | Ga0207428_10075716 | 3300027907 | Bacteria | 2637 |
| 557 | Ga0207428_10187504 | 3300027907 | Bacteria | 1560 |
| 558 | Ga0207428_10933087 | 3300027907 | Bacteria | 612 |
| 559 | Ga0268266_10016586 | 3300028379 | Bacteria | 6295 |
| 560 | Ga0268265_10351206 | 3300028380 | Bacteria | 1347 |
| 561 | Ga0268264_10562835 | 3300028381 | Bacteria | 1119 |
| 562 | Ga0268264_10611397 | 3300028381 | Bacteria | 1075 |
| 563 | Ga0265318_10161101 | 3300028577 | Bacteria | 823 |
| 564 | Ga0265322_10011793 | 3300028654 | Bacteria | 2529 |
| 565 | Ga0307517_10319548 | 3300028786 | Bacteria | 860 |
| 566 | Ga0307515_10726119 | 3300028794 | Bacteria | 611 |
| 567 | Ga0265338_10027368 | 3300028800 | Bacteria | 5722 |
| 568 | Ga0265338_10049356 | 3300028800 | Bacteria | 3816 |
| 569 | Ga0265338_10259993 | 3300028800 | Bacteria | 1277 |
| 570 | Ga0265338_10291325 | 3300028800 | Bacteria | 1190 |
| 571 | Ga0265338_10876887 | 3300028800 | Bacteria | 612 |
| 572 | Ga0307512_10016919 | 3300030522 | Bacteria | 6715 |
| 573 | Ga0307512_10137804 | 3300030522 | Bacteria | 1504 |
| 574 | Ga0265763_1036988 | 3300030763 | Bacteria | 576 |
| 575 | Ga0265760_10212488 | 3300031090 | Unclassified | 657 |
| 576 | Ga0265328_10184377 | 3300031239 | Bacteria | 790 |
| 577 | Ga0265325_10167419 | 3300031241 | Bacteria | 1031 |
| 578 | Ga0265340_10122896 | 3300031247 | Bacteria | 1193 |
| 579 | Ga0265340_10293196 | 3300031247 | Bacteria | 722 |
| 580 | Ga0265327_10010227 | 3300031251 | Bacteria | 6627 |
| 581 | Ga0307513_10001290 | 3300031456 | Bacteria | 36243 |
| 582 | Ga0307513_10005029 | 3300031456 | Bacteria | 17511 |
| 583 | Ga0307408_100021353 | 3300031548 | Bacteria | 4381 |
| 584 | Ga0307408_100082037 | 3300031548 | Bacteria | 2412 |
| 585 | Ga0307408_100243227 | 3300031548 | Bacteria | 1480 |
| 586 | Ga0307408_100580800 | 3300031548 | Bacteria | 993 |
| 587 | Ga0307508_10031638 | 3300031616 | Bacteria | 4782 |
| 588 | Ga0307508_10117245 | 3300031616 | Bacteria | 2264 |
| 589 | Ga0265314_10394674 | 3300031711 | Bacteria | 750 |
| 590 | Ga0307516_10015657 | 3300031730 | Bacteria | 7972 |
| 591 | Ga0307516_10055221 | 3300031730 | Bacteria | 3878 |
| 592 | Ga0307405_10032315 | 3300031731 | Bacteria | 3092 |
| 593 | Ga0307405_10085312 | 3300031731 | Bacteria | 2075 |
| 594 | Ga0307405_10153763 | 3300031731 | Bacteria | 1621 |
| 595 | Ga0307405_10156627 | 3300031731 | Bacteria | 1608 |
| 596 | Ga0307413_10085560 | 3300031824 | Bacteria | 2036 |
| 597 | Ga0307413_10094553 | 3300031824 | Bacteria | 1957 |
| 598 | Ga0307413_10144163 | 3300031824 | Bacteria | 1650 |
| 599 | Ga0307413_10300182 | 3300031824 | Bacteria | 1217 |
| 600 | Ga0307413_10456782 | 3300031824 | Bacteria | 1015 |
| 601 | Ga0307410_10005052 | 3300031852 | Bacteria | 6932 |
| 602 | Ga0307410_10014926 | 3300031852 | Bacteria | 4591 |
| 603 | Ga0307410_10017496 | 3300031852 | Bacteria | 4307 |
| 604 | Ga0307410_10388827 | 3300031852 | Bacteria | 1124 |
| 605 | Ga0307406_10027205 | 3300031901 | Bacteria | 3443 |
| 606 | Ga0307406_10039026 | 3300031901 | Bacteria | 2943 |
| 607 | Ga0307406_10276543 | 3300031901 | Bacteria | 1278 |
| 608 | Ga0307406_10294314 | 3300031901 | Bacteria | 1244 |
| 609 | Ga0307406_10736295 | 3300031901 | Bacteria | 826 |
| 610 | Ga0307406_11185777 | 3300031901 | Bacteria | 662 |
| 611 | Ga0307407_10005105 | 3300031903 | Bacteria | 5659 |
| 612 | Ga0307407_10016190 | 3300031903 | Bacteria | 3707 |
| 613 | Ga0307407_10059281 | 3300031903 | Bacteria | 2229 |
| 614 | Ga0307407_10337192 | 3300031903 | Bacteria | 1063 |
| 615 | Ga0307407_10412690 | 3300031903 | Bacteria | 971 |
| 616 | Ga0307407_10451451 | 3300031903 | Bacteria | 933 |
| 617 | Ga0307407_11510713 | 3300031903 | Bacteria | 531 |
| 618 | Ga0307412_10024609 | 3300031911 | Bacteria | 3718 |
| 619 | Ga0307412_10121926 | 3300031911 | Bacteria | 1878 |
| 620 | Ga0307412_11541781 | 3300031911 | Bacteria | 605 |
| 621 | Ga0307412_12252250 | 3300031911 | Bacteria | 508 |
| 622 | Ga0307409_100002782 | 3300031995 | Bacteria | 9238 |
| 623 | Ga0307409_100006206 | 3300031995 | Bacteria | 6994 |
| 624 | Ga0307409_100014273 | 3300031995 | Bacteria | 5158 |
| 625 | Ga0307409_100064899 | 3300031995 | Bacteria | 2870 |
| 626 | Ga0307409_100133419 | 3300031995 | Bacteria | 2126 |
| 627 | Ga0307409_100189252 | 3300031995 | Bacteria | 1830 |
| 628 | Ga0307409_100225581 | 3300031995 | Bacteria | 1694 |
| 629 | Ga0307409_100230164 | 3300031995 | Bacteria | 1679 |
| 630 | Ga0307409_100499409 | 3300031995 | Bacteria | 1184 |
| 631 | Ga0307416_100000815 | 3300032002 | Bacteria | 16363 |
| 632 | Ga0307416_100002996 | 3300032002 | Bacteria | 9855 |
| 633 | Ga0307416_100006694 | 3300032002 | Bacteria | 7236 |
| 634 | Ga0307416_100009033 | 3300032002 | Bacteria | 6486 |
| 635 | Ga0307416_100078488 | 3300032002 | Bacteria | 2778 |
| 636 | Ga0307416_100108061 | 3300032002 | Bacteria | 2443 |
| 637 | Ga0307416_100135945 | 3300032002 | Bacteria | 2223 |
| 638 | Ga0307416_100163983 | 3300032002 | Bacteria | 2058 |
| 639 | Ga0307416_100300318 | 3300032002 | Bacteria | 1595 |
| 640 | Ga0307416_100660624 | 3300032002 | Bacteria | 1131 |
| 641 | Ga0307416_101208720 | 3300032002 | Bacteria | 861 |
| 642 | Ga0307416_101937952 | 3300032002 | Bacteria | 692 |
| 643 | Ga0307416_102887621 | 3300032002 | Bacteria | 575 |
| 644 | Ga0307414_10024335 | 3300032004 | Bacteria | 3860 |
| 645 | Ga0307414_10397176 | 3300032004 | Bacteria | 1196 |
| 646 | Ga0307414_10568982 | 3300032004 | Bacteria | 1012 |
| 647 | Ga0307414_10582566 | 3300032004 | Bacteria | 1001 |
| 648 | Ga0307414_10792368 | 3300032004 | Bacteria | 864 |
| 649 | Ga0307411_10052477 | 3300032005 | Bacteria | 2666 |
| 650 | Ga0307411_10082217 | 3300032005 | Bacteria | 2220 |
| 651 | Ga0307411_10422286 | 3300032005 | Bacteria | 1108 |
| 652 | Ga0307411_10752040 | 3300032005 | Bacteria | 854 |
| 653 | Ga0307411_11581657 | 3300032005 | Bacteria | 604 |
| 654 | Ga0307415_100000173 | 3300032126 | Bacteria | 28778 |
| 655 | Ga0307415_100000831 | 3300032126 | Bacteria | 14149 |
| 656 | Ga0307415_100026435 | 3300032126 | Bacteria | 3661 |
| 657 | Ga0307415_100059176 | 3300032126 | Bacteria | 2641 |
| 658 | Ga0307415_100076084 | 3300032126 | Bacteria | 2378 |
| 659 | Ga0307415_100086623 | 3300032126 | Bacteria | 2254 |
| 660 | Ga0307415_100327342 | 3300032126 | Bacteria | 1280 |
| 661 | Ga0307415_100343516 | 3300032126 | Bacteria | 1253 |
| 662 | Ga0307415_100427444 | 3300032126 | Bacteria | 1138 |
| 663 | Ga0307415_100460506 | 3300032126 | Bacteria | 1102 |
| 664 | Ga0307415_100552498 | 3300032126 | Bacteria | 1016 |
| 665 | Ga0307507_10000998 | 3300033179 | Bacteria | 62959 |
| 666 | Ga0307507_10321485 | 3300033179 | Bacteria | 931 |
| 667 | Ga0316214_1029760 | 3300033545 | Bacteria | 774 |
| 668 | Ga0373959_0062129 | 3300034820 | Bacteria | 829 |
| 669 | Ga0373926_0177974 | 3300035083 | Bacteria | 815 |
| 670 | Ga0373926_0322483 | 3300035083 | Bacteria | 604 |
| 671 | Ga0373934_0103272 | 3300035086 | Bacteria | 1153 |
| 672 | Ga0373944_0051522 | 3300035089 | Bacteria | 1298 |
| 673 | Ga0373923_0005472 | 3300035111 | Bacteria | 4313 |
| 674 | Ga0373923_0115953 | 3300035111 | Bacteria | 1193 |
| 675 | Ga0373923_0197289 | 3300035111 | Bacteria | 929 |
| 676 | Ga0373936_0010788 | 3300035113 | Bacteria | 3450 |
| 677 | Ga0373936_0017488 | 3300035113 | Bacteria | 2762 |
| 678 | Ga0373936_0170263 | 3300035113 | Bacteria | 952 |
| 679 | Ga0373941_0173011 | 3300035115 | Bacteria | 806 |
| 680 | Ga0373941_0214319 | 3300035115 | Bacteria | 738 |
| 681 | Ga0373945_0062387 | 3300035116 | Bacteria | 1393 |
| 682 | Ga0373945_0107411 | 3300035116 | Bacteria | 1098 |
| 683 | Ga0373953_0000637 | 3300035117 | Bacteria | 9734 |
| 684 | Ga0373953_0034129 | 3300035117 | Bacteria | 1993 |
| 685 | Ga0373953_0055976 | 3300035117 | Bacteria | 1603 |
| 686 | Ga0373953_0135264 | 3300035117 | Bacteria | 1053 |
| 687 | Ga0373954_0001768 | 3300035118 | Bacteria | 8880 |
| 688 | Ga0373954_0052000 | 3300035118 | Bacteria | 1925 |
| 689 | Ga0373956_0000852 | 3300035119 | Bacteria | 12692 |
| 690 | Ga0373956_0002082 | 3300035119 | Bacteria | 8293 |
| 691 | Ga0373956_0082714 | 3300035119 | Bacteria | 1475 |
| 692 | Ga0373956_0083324 | 3300035119 | Bacteria | 1469 |
| 693 | Ga0373957_0000515 | 3300035120 | Bacteria | 9741 |
| 694 | Ga0373957_0054773 | 3300035120 | Bacteria | 1532 |
| 695 | Ga0373960_0366820 | 3300035121 | Bacteria | 549 |
| 696 | Ga0373943_0001973 | 3300035170 | Bacteria | 9292 |
| 697 | Ga0373943_0060387 | 3300035170 | Bacteria | 1892 |
| 698 | Ga0373943_0143601 | 3300035170 | Unclassified | 1288 |
| 699 | Ga0373943_0283332 | 3300035170 | Bacteria | 937 |
| 700 | Ga0373946_0019995 | 3300035171 | Bacteria | 2584 |
| 701 | Ga0373946_0043157 | 3300035171 | Bacteria | 1857 |
| 702 | Ga0373946_0113432 | 3300035171 | Bacteria | 1229 |
| 703 | Ga0373946_0127642 | 3300035171 | Bacteria | 1167 |
| 704 | Ga0373946_0447834 | 3300035171 | Bacteria | 657 |
| 705 | Ga0373946_0646801 | 3300035171 | Bacteria | 550 |
| 706 | Ga0373955_0000006 | 3300035172 | Bacteria | 101050 |
| 707 | Ga0373955_0004296 | 3300035172 | Bacteria | 6293 |
| 708 | Ga0373955_0241804 | 3300035172 | Bacteria | 1081 |
| 709 | Ga0373955_0249775 | 3300035172 | Bacteria | 1063 |
| 710 | Ga0373955_0456095 | 3300035172 | Unclassified | 779 |
| 711 | Ga0373924_0024530 | 3300035410 | Bacteria | 2377 |
| 712 | Ga0373924_0040785 | 3300035410 | Bacteria | 1901 |
| 713 | Ga0373931_0995364 | 3300035691 | Bacteria | 567 |
| 714 | Ga0373935_0029852 | 3300035692 | Bacteria | 3375 |
| 715 | Ga0373935_0046344 | 3300035692 | Bacteria | 2746 |
| 716 | Ga0373935_0487944 | 3300035692 | Bacteria | 893 |
| 717 | Ga0373935_0532149 | 3300035692 | Bacteria | 855 |
| 718 | Ga0373935_0748917 | 3300035692 | Bacteria | 720 |
| 719 | Ga0373935_0939052 | 3300035692 | Bacteria | 641 |
| 720 | Ga0373935_1456537 | 3300035692 | Unclassified | 512 |
| 721 | Ga0373927_0064023 | 3300035695 | Bacteria | 2379 |
| 722 | Ga0373927_0138650 | 3300035695 | Bacteria | 1590 |
| 723 | Ga0373927_0432022 | 3300035695 | Bacteria | 869 |
| 724 | Ga0373927_0448129 | 3300035695 | Bacteria | 852 |
| 725 | Ga0373927_0629590 | 3300035695 | Bacteria | 709 |
| 726 | Ga0373927_0630095 | 3300035695 | Bacteria | 709 |
| 727 | Ga0373933_0000463 | 3300035724 | Bacteria | 25388 |
| 728 | Ga0373933_0002438 | 3300035724 | Bacteria | 10484 |
| 729 | Ga0373933_0033155 | 3300035724 | Bacteria | 3002 |
| 730 | Ga0373933_0202514 | 3300035724 | Bacteria | 1270 |
| 731 | Ga0373947_0066973 | 3300035725 | Bacteria | 2192 |
| 732 | Ga0373947_0075906 | 3300035725 | Bacteria | 2070 |
| 733 | Ga0373947_0233748 | 3300035725 | Bacteria | 1211 |
| 734 | Ga0373947_0276567 | 3300035725 | Bacteria | 1115 |
| 735 | Ga0373947_1083439 | 3300035725 | Unclassified | 546 |
| 736 | Ga0373937_0000731 | 3300036401 | Bacteria | 28392 |
| 737 | Ga0373937_0018299 | 3300036401 | Bacteria | 6254 |
| 738 | Ga0373937_0044125 | 3300036401 | Bacteria | 4071 |
| 739 | Ga0373937_0282201 | 3300036401 | Bacteria | 1568 |
| 740 | Ga0373937_0360656 | 3300036401 | Bacteria | 1377 |
| 741 | Ga0373937_1610237 | 3300036401 | Bacteria | 596 |
| 742 | Ga0373925_0118136 | 3300037068 | Bacteria | 2056 |
| 743 | Ga0373925_0479174 | 3300037068 | Bacteria | 1020 |
| 744 | Ga0373925_0684846 | 3300037068 | Bacteria | 845 |
| 745 | Ga0373925_0987084 | 3300037068 | Bacteria | 693 |
| 746 | Ga0395899_0134371 | 3300037312 | Bacteria | 1764 |
| 747 | Ga0395899_0236085 | 3300037312 | Bacteria | 1260 |
| 748 | Ga0395899_0886921 | 3300037312 | Bacteria | 545 |
| 749 | Ga0395900_0004358 | 3300037418 | Bacteria | 15013 |
| 750 | Ga0395900_0033379 | 3300037418 | Bacteria | 5297 |
| 751 | Ga0395900_0036126 | 3300037418 | Bacteria | 5092 |
| 752 | Ga0395898_0098251 | 3300037466 | Bacteria | 2811 |
| 753 | Ga0395898_0456591 | 3300037466 | Bacteria | 1216 |
| 754 | Ga0395905_0097366 | 3300037471 | Bacteria | 2762 |
| 755 | Ga0395905_0159780 | 3300037471 | Bacteria | 2118 |
| 756 | Ga0395905_0437386 | 3300037471 | Bacteria | 1205 |
| 757 | Ga0395905_0928799 | 3300037471 | Bacteria | 773 |
| 758 | Ga0436364_0190139 | 3300037853 | Bacteria | 4706 |
| 759 | Ga0436364_0461116 | 3300037853 | Bacteria | 28046 |
| 760 | Ga0436364_0840554 | 3300037853 | Bacteria | 2175 |
| 761 | Ga0436364_0892403 | 3300037853 | Bacteria | 41051 |
| 762 | Ga0436364_1011400 | 3300037853 | Bacteria | 1126 |
| 763 | Ga0395901_0012719 | 3300038443 | Bacteria | 8536 |
| 764 | Ga0395901_0015198 | 3300038443 | Bacteria | 7831 |
| 765 | Ga0395901_0018433 | 3300038443 | Bacteria | 7125 |
| 766 | Ga0395901_0091757 | 3300038443 | Bacteria | 3179 |
| 767 | Ga0395901_0873564 | 3300038443 | Bacteria | 883 |
| 768 | Ga0242420_149938 | 3300038996 | Bacteria | 523 |
| 769 | Ga0436365_0337423 | 3300039437 | Bacteria | 38026 |
| 770 | Ga0436365_0500092 | 3300039437 | Bacteria | 1498 |
| 771 | Ga0436365_0585665 | 3300039437 | Bacteria | 7174 |
| 772 | Ga0436360_1089305 | 3300039438 | Bacteria | 1246 |
| 773 | Ga0436361_0702798 | 3300039447 | Bacteria | 639 |
| 774 | Ga0436363_0424245 | 3300039450 | Bacteria | 671 |
| 775 | Ga0436363_0564765 | 3300039450 | Bacteria | 811 |
| 776 | Ga0436363_0695125 | 3300039450 | Bacteria | 4869 |
| 777 | Ga0436363_0955742 | 3300039450 | Bacteria | 6653 |
| 778 | Ga0436362_0337613 | 3300039453 | Bacteria | 1541 |
| 779 | Ga0436362_0894797 | 3300039453 | Bacteria | 1093 |
| 780 | Ga0439439_0058677 | 3300041406 | Bacteria | 1019 |
| 781 | Ga0439448_0017686 | 3300042005 | Bacteria | 2178 |
| 782 | Ga0439448_0060200 | 3300042005 | Bacteria | 1254 |
| 783 | Ga0439448_0162144 | 3300042005 | Bacteria | 778 |
| 784 | Ga0439449_0010289 | 3300042007 | Bacteria | 3532 |
| 785 | Ga0439449_0042843 | 3300042007 | Bacteria | 1681 |
| 786 | Ga0439450_007552 | 3300042008 | Bacteria | 1997 |
| 787 | Ga0439450_154227 | 3300042008 | Bacteria | 603 |
| 788 | Ga0439450_168951 | 3300042008 | Bacteria | 578 |
| 789 | Ga0439455_0057345 | 3300042012 | Bacteria | 1027 |
| 790 | Ga0439463_010240 | 3300042016 | Bacteria | 2304 |
| 791 | Ga0439463_048470 | 3300042016 | Bacteria | 1082 |
| 792 | Ga0450900_022822 | 3300042136 | Bacteria | 881 |
| 793 | Ga0439434_0248009 | 3300042435 | Bacteria | 608 |
| 794 | Ga0439464_0047134 | 3300042439 | Bacteria | 1240 |
| 795 | Ga0439460_0019044 | 3300042461 | Bacteria | 1855 |
| 796 | Ga0439460_0127456 | 3300042461 | Bacteria | 837 |
| 797 | Ga0451577_1708690 | 3300042876 | Bacteria | 554 |
| 798 | Ga0466969_0016351 | 3300044656 | Bacteria | 3884 |
| 799 | Ga0466969_0028254 | 3300044656 | Bacteria | 2867 |
| 800 | Ga0466969_0061275 | 3300044656 | Bacteria | 1828 |
| 801 | Ga0466972_0016692 | 3300044658 | Bacteria | 3670 |
| 802 | Ga0466972_0152997 | 3300044658 | Bacteria | 1084 |
| 803 | Ga0466966_0953578 | 3300044684 | Unclassified | 517 |
| 804 | Ga0466961_0005973 | 3300044693 | Bacteria | 7715 |
| 805 | Ga0466961_0132923 | 3300044693 | Bacteria | 1559 |
| 806 | Ga0466963_0030779 | 3300044694 | Bacteria | 3465 |
| 807 | Ga0466963_0113694 | 3300044694 | Bacteria | 1859 |
| 808 | Ga0466963_0615365 | 3300044694 | Bacteria | 767 |
| 809 | Ga0466963_0859663 | 3300044694 | Bacteria | 639 |
| 810 | Ga0453684_0283715 | 3300044712 | Bacteria | 1888 |
| 811 | Ga0466971_0077826 | 3300044719 | Bacteria | 1510 |
| 812 | Ga0466971_0187403 | 3300044719 | Bacteria | 974 |
| 813 | Ga0466971_0261083 | 3300044719 | Bacteria | 826 |
| 814 | Ga0466968_0019281 | 3300044735 | Bacteria | 2746 |
| 815 | Ga0466968_0032968 | 3300044735 | Bacteria | 2157 |
| 816 | Ga0466970_0007762 | 3300044765 | Bacteria | 5382 |
| 817 | Ga0466970_0387621 | 3300044765 | Bacteria | 796 |
| 818 | Ga0466957_0619798 | 3300044842 | Bacteria | 759 |
| 819 | Ga0466957_1300860 | 3300044842 | Bacteria | 528 |
| 820 | Ga0466957_1396218 | 3300044842 | Bacteria | 510 |
| 821 | Ga0466960_0045177 | 3300044901 | Bacteria | 2103 |
| 822 | Ga0466960_0129158 | 3300044901 | Bacteria | 1332 |
| 823 | Ga0466960_0438721 | 3300044901 | Bacteria | 757 |
| 824 | Ga0466959_0033975 | 3300045049 | Bacteria | 3773 |
| 825 | Ga0466959_0051498 | 3300045049 | Bacteria | 3019 |
| 826 | Ga0466959_0286234 | 3300045049 | Bacteria | 1130 |
| 827 | Ga0451576_0007007 | 3300045051 | Bacteria | 13637 |
| 828 | Ga0466958_0018706 | 3300045836 | Bacteria | 4025 |
| 829 | Ga0466958_0040497 | 3300045836 | Bacteria | 2800 |
| 830 | Ga0466958_0056459 | 3300045836 | Bacteria | 2385 |
| 831 | Ga0466958_0215048 | 3300045836 | Bacteria | 1225 |
| 832 | Ga0466967_0002037 | 3300045976 | Bacteria | 12332 |
| 833 | Ga0466967_0126127 | 3300045976 | Bacteria | 2371 |
| 834 | Ga0466967_0198979 | 3300045976 | Bacteria | 1897 |
| 835 | Ga0466967_0205870 | 3300045976 | Bacteria | 1865 |
| 836 | Ga0466967_0586034 | 3300045976 | Bacteria | 1100 |
| 837 | Ga0466967_0733059 | 3300045976 | Bacteria | 980 |
| 838 | Ga0466967_1233752 | 3300045976 | Bacteria | 745 |
| 839 | Ga0466967_1751471 | 3300045976 | Bacteria | 619 |
| 840 | Ga0466967_1848204 | 3300045976 | Bacteria | 601 |
| 841 | Ga0495592_0000567 | 3300046454 | Bacteria | 26216 |
| 842 | Ga0495592_0233148 | 3300046454 | Bacteria | 1224 |
| 843 | Ga0495592_0506585 | 3300046454 | Bacteria | 748 |
| 844 | Ga0495603_0011401 | 3300046455 | Bacteria | 5382 |
| 845 | Ga0495603_0080929 | 3300046455 | Bacteria | 1903 |
| 846 | Ga0495603_0173647 | 3300046455 | Bacteria | 1248 |
| 847 | Ga0495603_0215128 | 3300046455 | Bacteria | 1109 |
| 848 | Ga0495590_0072301 | 3300046457 | Bacteria | 1211 |
| 849 | Ga0495629_0010789 | 3300046459 | Bacteria | 6646 |
| 850 | Ga0495629_0016320 | 3300046459 | Bacteria | 5328 |
| 851 | Ga0495629_0064157 | 3300046459 | Bacteria | 2565 |
| 852 | Ga0495629_0137373 | 3300046459 | Bacteria | 1702 |
| 853 | Ga0495638_0137993 | 3300046460 | Bacteria | 1426 |
| 854 | Ga0495641_0003287 | 3300046461 | Bacteria | 12206 |
| 855 | Ga0495641_0020910 | 3300046461 | Bacteria | 3304 |
| 856 | Ga0495641_0200531 | 3300046461 | Bacteria | 894 |
| 857 | Ga0495641_0210135 | 3300046461 | Bacteria | 872 |
| 858 | Ga0495641_0484633 | 3300046461 | Bacteria | 563 |
| 859 | Ga0495651_0000013 | 3300046462 | Bacteria | 137933 |
| 860 | Ga0495651_0036765 | 3300046462 | Bacteria | 3812 |
| 861 | Ga0495651_0041286 | 3300046462 | Bacteria | 3584 |
| 862 | Ga0495651_0260439 | 3300046462 | Bacteria | 1180 |
| 863 | Ga0495651_0296132 | 3300046462 | Bacteria | 1087 |
| 864 | Ga0495651_0426963 | 3300046462 | Bacteria | 860 |
| 865 | Ga0495653_0006306 | 3300046463 | Bacteria | 9731 |
| 866 | Ga0495653_0025189 | 3300046463 | Bacteria | 4785 |
| 867 | Ga0495653_0027838 | 3300046463 | Bacteria | 4523 |
| 868 | Ga0495653_0120641 | 3300046463 | Bacteria | 1869 |
| 869 | Ga0495580_0089288 | 3300046472 | Bacteria | 2145 |
| 870 | Ga0495580_0266791 | 3300046472 | Bacteria | 1170 |
| 871 | Ga0495582_0038069 | 3300046473 | Bacteria | 2645 |
| 872 | Ga0495582_0089171 | 3300046473 | Bacteria | 1718 |
| 873 | Ga0495582_0104377 | 3300046473 | Bacteria | 1588 |
| 874 | Ga0495582_0611675 | 3300046473 | Bacteria | 630 |
| 875 | Ga0495605_0080547 | 3300046474 | Bacteria | 1524 |
| 876 | Ga0495639_0032392 | 3300046475 | Bacteria | 2331 |
| 877 | Ga0495639_0292934 | 3300046475 | Bacteria | 810 |
| 878 | Ga0495639_0391556 | 3300046475 | Bacteria | 701 |
| 879 | Ga0495662_0000412 | 3300046476 | Bacteria | 19214 |
| 880 | Ga0495662_0063213 | 3300046476 | Bacteria | 1788 |
| 881 | Ga0495662_0065199 | 3300046476 | Bacteria | 1760 |
| 882 | Ga0495662_0139416 | 3300046476 | Bacteria | 1193 |
| 883 | Ga0495662_0323296 | 3300046476 | Bacteria | 759 |
| 884 | Ga0495664_0000012 | 3300046477 | Bacteria | 226118 |
| 885 | Ga0495664_0029548 | 3300046477 | Bacteria | 3206 |
| 886 | Ga0495664_0131691 | 3300046477 | Bacteria | 1514 |
| 887 | Ga0495664_0304258 | 3300046477 | Bacteria | 962 |
| 888 | Ga0495664_0366303 | 3300046477 | Bacteria | 867 |
| 889 | Ga0495664_0441967 | 3300046477 | Bacteria | 779 |
| 890 | Ga0495664_0824580 | 3300046477 | Unclassified | 545 |
| 891 | Ga0495664_0859828 | 3300046477 | Bacteria | 531 |
| 892 | Ga0495585_0071222 | 3300046492 | Bacteria | 1895 |
| 893 | Ga0495594_0003603 | 3300046499 | Bacteria | 7963 |
| 894 | Ga0495594_0060769 | 3300046499 | Bacteria | 2090 |
| 895 | Ga0495594_0256809 | 3300046499 | Bacteria | 995 |
| 896 | Ga0495594_0260368 | 3300046499 | Bacteria | 988 |
| 897 | Ga0495594_0418812 | 3300046499 | Bacteria | 762 |
| 898 | Ga0495607_0153340 | 3300046501 | Bacteria | 1177 |
| 899 | Ga0495608_0000114 | 3300046511 | Bacteria | 57810 |
| 900 | Ga0495608_0003948 | 3300046511 | Bacteria | 10662 |
| 901 | Ga0495608_0021327 | 3300046511 | Bacteria | 4447 |
| 902 | Ga0495608_0216115 | 3300046511 | Bacteria | 1204 |
| 903 | Ga0495608_0317042 | 3300046511 | Bacteria | 964 |
| 904 | Ga0495608_0405622 | 3300046511 | Bacteria | 833 |
| 905 | Ga0495618_0017340 | 3300046514 | Bacteria | 4413 |
| 906 | Ga0495618_0025663 | 3300046514 | Bacteria | 3658 |
| 907 | Ga0495618_0053976 | 3300046514 | Bacteria | 2541 |
| 908 | Ga0495618_0404498 | 3300046514 | Bacteria | 834 |
| 909 | Ga0495620_0065446 | 3300046515 | Bacteria | 1500 |
| 910 | Ga0495628_0003223 | 3300046516 | Bacteria | 14633 |
| 911 | Ga0495628_0230816 | 3300046516 | Unclassified | 1387 |
| 912 | Ga0495628_0259772 | 3300046516 | Bacteria | 1294 |
| 913 | Ga0495628_0287232 | 3300046516 | Bacteria | 1220 |
| 914 | Ga0495628_0338446 | 3300046516 | Bacteria | 1108 |
| 915 | Ga0495630_0033212 | 3300046517 | Bacteria | 3847 |
| 916 | Ga0495630_0041315 | 3300046517 | Bacteria | 3443 |
| 917 | Ga0495630_0053897 | 3300046517 | Bacteria | 3012 |
| 918 | Ga0495630_0084396 | 3300046517 | Bacteria | 2398 |
| 919 | Ga0495630_0106339 | 3300046517 | Bacteria | 2125 |
| 920 | Ga0495630_0652742 | 3300046517 | Bacteria | 806 |
| 921 | Ga0495630_0722070 | 3300046517 | Bacteria | 762 |
| 922 | Ga0495630_0933474 | 3300046517 | Bacteria | 660 |
| 923 | Ga0495631_0308691 | 3300046518 | Bacteria | 673 |
| 924 | Ga0495666_0037259 | 3300046526 | Bacteria | 2366 |
| 925 | Ga0495666_0485332 | 3300046526 | Bacteria | 552 |
| 926 | Ga0495652_0000145 | 3300046529 | Bacteria | 80170 |
| 927 | Ga0495652_0021727 | 3300046529 | Bacteria | 5704 |
| 928 | Ga0495652_0071247 | 3300046529 | Bacteria | 2902 |
| 929 | Ga0495652_0116910 | 3300046529 | Bacteria | 2134 |
| 930 | Ga0495652_0197715 | 3300046529 | Bacteria | 1528 |
| 931 | Ga0495652_0303661 | 3300046529 | Bacteria | 1159 |
| 932 | Ga0495652_0305579 | 3300046529 | Bacteria | 1154 |
| 933 | Ga0495652_0343630 | 3300046529 | Bacteria | 1071 |
| 934 | Ga0495665_0004765 | 3300046531 | Bacteria | 7325 |
| 935 | Ga0495665_0015910 | 3300046531 | Bacteria | 4052 |
| 936 | Ga0495665_0020000 | 3300046531 | Bacteria | 3599 |
| 937 | Ga0495665_0455526 | 3300046531 | Bacteria | 646 |
| 938 | Ga0495640_0010023 | 3300046533 | Bacteria | 7346 |
| 939 | Ga0495640_0027736 | 3300046533 | Bacteria | 4082 |
| 940 | Ga0495640_0030122 | 3300046533 | Bacteria | 3888 |
| 941 | Ga0495640_0375407 | 3300046533 | Bacteria | 875 |
| 942 | Ga0495586_0154314 | 3300046535 | Bacteria | 1293 |
| 943 | Ga0495586_0168947 | 3300046535 | Bacteria | 1235 |
| 944 | Ga0495587_0000063 | 3300046536 | Bacteria | 91300 |
| 945 | Ga0495587_0060428 | 3300046536 | Bacteria | 2222 |
| 946 | Ga0495587_0096192 | 3300046536 | Bacteria | 1708 |
| 947 | Ga0495587_0499959 | 3300046536 | Bacteria | 672 |
| 948 | Ga0495645_0281977 | 3300046543 | Bacteria | 1092 |
| 949 | Ga0495645_0617483 | 3300046543 | Bacteria | 665 |
| 950 | Ga0495645_0777781 | 3300046543 | Bacteria | 576 |
| 951 | Ga0495667_0000049 | 3300046559 | Bacteria | 115812 |
| 952 | Ga0495667_0006707 | 3300046559 | Bacteria | 7812 |
| 953 | Ga0495667_0006724 | 3300046559 | Bacteria | 7804 |
| 954 | Ga0495667_0062597 | 3300046559 | Bacteria | 2438 |
| 955 | Ga0495667_0213648 | 3300046559 | Bacteria | 1232 |
| 956 | Ga0495667_0351270 | 3300046559 | Bacteria | 931 |
| 957 | Ga0495668_0598196 | 3300046616 | Bacteria | 609 |
| 958 | Ga0495634_0024247 | 3300046642 | Bacteria | 4259 |
| 959 | Ga0495634_0057146 | 3300046642 | Bacteria | 2605 |
| 960 | Ga0495634_0061114 | 3300046642 | Bacteria | 2505 |
| 961 | Ga0495634_0143830 | 3300046642 | Bacteria | 1512 |
| 962 | Ga0495634_0596739 | 3300046642 | Bacteria | 641 |
| 963 | Ga0495611_0044316 | 3300046648 | Bacteria | 1990 |
| 964 | Ga0495611_0127467 | 3300046648 | Bacteria | 1187 |
| 965 | Ga0495625_0068209 | 3300046660 | Bacteria | 2501 |
| 966 | Ga0495635_0075837 | 3300046663 | Bacteria | 2303 |
| 967 | Ga0495635_0462810 | 3300046663 | Bacteria | 837 |
| 968 | Ga0495635_0604887 | 3300046663 | Bacteria | 716 |
| 969 | Ga0495635_0717637 | 3300046663 | Bacteria | 647 |
| 970 | Ga0495661_0372355 | 3300046665 | Bacteria | 699 |
| 971 | Ga0495588_0004479 | 3300046674 | Bacteria | 6175 |
| 972 | Ga0495588_0070903 | 3300046674 | Bacteria | 1812 |
| 973 | Ga0495657_0000513 | 3300046675 | Bacteria | 36152 |
| 974 | Ga0495657_0046670 | 3300046675 | Bacteria | 2931 |
| 975 | Ga0495657_0202542 | 3300046675 | Bacteria | 1209 |
| 976 | Ga0495657_0645616 | 3300046675 | Bacteria | 610 |
| 977 | Ga0495599_0003180 | 3300046678 | Bacteria | 9567 |
| 978 | Ga0495599_0004667 | 3300046678 | Bacteria | 8126 |
| 979 | Ga0495599_0026783 | 3300046678 | Bacteria | 3613 |
| 980 | Ga0495599_0103917 | 3300046678 | Bacteria | 1770 |
| 981 | Ga0495599_0166537 | 3300046678 | Bacteria | 1361 |
| 982 | Ga0495599_0666333 | 3300046678 | Unclassified | 602 |
| 983 | Ga0495599_0742273 | 3300046678 | Bacteria | 564 |
| 984 | Ga0495623_0000822 | 3300046679 | Bacteria | 20935 |
| 985 | Ga0495623_0028757 | 3300046679 | Bacteria | 3576 |
| 986 | Ga0495623_0065537 | 3300046679 | Bacteria | 2271 |
| 987 | Ga0495646_0007651 | 3300046680 | Bacteria | 6866 |
| 988 | Ga0495646_0034331 | 3300046680 | Bacteria | 3150 |
| 989 | Ga0495646_0038976 | 3300046680 | Bacteria | 2931 |
| 990 | Ga0495646_0530638 | 3300046680 | Bacteria | 602 |
| 991 | Ga0495647_0025777 | 3300046681 | Bacteria | 2150 |
| 992 | Ga0495647_0093015 | 3300046681 | Bacteria | 1239 |
| 993 | Ga0495647_0196912 | 3300046681 | Bacteria | 882 |
| 994 | Ga0495658_0046314 | 3300046683 | Bacteria | 2444 |
| 995 | Ga0495658_1045959 | 3300046683 | Bacteria | 521 |
| 996 | Ga0495613_0014789 | 3300046689 | Bacteria | 5792 |
| 997 | Ga0495613_0029631 | 3300046689 | Bacteria | 4068 |
| 998 | Ga0495624_0007471 | 3300046690 | Bacteria | 7670 |
| 999 | Ga0495624_0023901 | 3300046690 | Bacteria | 4026 |
| 1000 | Ga0495624_0068148 | 3300046690 | Bacteria | 2218 |
| 1001 | Ga0495624_0104377 | 3300046690 | Bacteria | 1744 |
| 1002 | Ga0495670_0558114 | 3300046691 | Bacteria | 623 |
| 1003 | Ga0495671_0615750 | 3300046692 | Bacteria | 516 |
| 1004 | Ga0495589_0008884 | 3300046794 | Bacteria | 5227 |
| 1005 | Ga0495589_0056844 | 3300046794 | Bacteria | 1925 |
| 1006 | Ga0495600_0008537 | 3300046809 | Bacteria | 6299 |
| 1007 | Ga0495600_0011820 | 3300046809 | Bacteria | 5451 |
| 1008 | Ga0495600_0035139 | 3300046809 | Bacteria | 3254 |
| 1009 | Ga0495600_0112428 | 3300046809 | Bacteria | 1773 |
| 1010 | Ga0495660_0527292 | 3300046810 | Bacteria | 502 |
| 1011 | Ga0495581_0028253 | 3300047315 | Bacteria | 3252 |
| 1012 | Ga0495581_0029403 | 3300047315 | Bacteria | 3185 |
| 1013 | Ga0495581_0124434 | 3300047315 | Bacteria | 1501 |
| 1014 | Ga0495604_0000032 | 3300047317 | Bacteria | 137882 |
| 1015 | Ga0495604_0008119 | 3300047317 | Bacteria | 8312 |
| 1016 | Ga0495604_0074238 | 3300047317 | Bacteria | 2564 |
| 1017 | Ga0495636_0236755 | 3300047318 | Bacteria | 841 |
| 1018 | Ga0495674_0009608 | 3300047319 | Bacteria | 9187 |
| 1019 | Ga0495674_0023157 | 3300047319 | Bacteria | 5725 |
| 1020 | Ga0495674_0045391 | 3300047319 | Bacteria | 3901 |
| 1021 | Ga0495674_0083744 | 3300047319 | Bacteria | 2733 |
| 1022 | Ga0495674_0489655 | 3300047319 | Bacteria | 985 |
| 1023 | Ga0495674_0596301 | 3300047319 | Bacteria | 875 |
| 1024 | Ga0495674_0659531 | 3300047319 | Bacteria | 824 |
| 1025 | Ga0495674_0662846 | 3300047319 | Bacteria | 822 |
| 1026 | Ga0495674_0799033 | 3300047319 | Bacteria | 734 |
| 1027 | Ga0495674_0993350 | 3300047319 | Bacteria | 643 |
| 1028 | Ga0495676_0021059 | 3300047321 | Bacteria | 5706 |
| 1029 | Ga0495676_0055632 | 3300047321 | Bacteria | 3136 |
| 1030 | Ga0495676_0112797 | 3300047321 | Bacteria | 1991 |
| 1031 | Ga0495676_0120597 | 3300047321 | Bacteria | 1908 |
| 1032 | Ga0495676_0166640 | 3300047321 | Bacteria | 1553 |
| 1033 | Ga0495676_0243718 | 3300047321 | Bacteria | 1229 |
| 1034 | Ga0495676_0964740 | 3300047321 | Bacteria | 545 |
| 1035 | Ga0495680_0000058 | 3300047322 | Bacteria | 91920 |
| 1036 | Ga0495680_0010708 | 3300047322 | Bacteria | 8178 |
| 1037 | Ga0495680_0015525 | 3300047322 | Bacteria | 6569 |
| 1038 | Ga0495680_0086073 | 3300047322 | Bacteria | 2365 |
| 1039 | Ga0495683_0064032 | 3300047323 | Bacteria | 1816 |
| 1040 | Ga0495675_0022224 | 3300047444 | Bacteria | 4042 |
| 1041 | Ga0495675_0034916 | 3300047444 | Bacteria | 3211 |
| 1042 | Ga0495675_0655495 | 3300047444 | Unclassified | 591 |
| 1043 | Ga0495685_010867 | 3300047447 | Bacteria | 3059 |
| 1044 | Ga0495685_052778 | 3300047447 | Bacteria | 1376 |
| 1045 | Ga0495684_0009048 | 3300047471 | Bacteria | 7688 |
| 1046 | Ga0495684_0024672 | 3300047471 | Bacteria | 4627 |
| 1047 | Ga0495684_0038970 | 3300047471 | Bacteria | 3642 |
| 1048 | Ga0495684_0047940 | 3300047471 | Bacteria | 3266 |
| 1049 | Ga0495593_0010975 | 3300047673 | Bacteria | 5214 |
| 1050 | Ga0495593_0012660 | 3300047673 | Bacteria | 4818 |
| 1051 | Ga0495593_0160372 | 3300047673 | Bacteria | 1135 |
| 1052 | Ga0495593_0571225 | 3300047673 | Bacteria | 567 |
| 1053 | Ga0495602_0000092 | 3300048088 | Bacteria | 85286 |
| 1054 | Ga0495602_0019574 | 3300048088 | Bacteria | 6716 |
| 1055 | Ga0495602_0088660 | 3300048088 | Bacteria | 2575 |
| 1056 | Ga0495602_0142290 | 3300048088 | Bacteria | 1897 |
| 1057 | Ga0495602_0434456 | 3300048088 | Bacteria | 929 |
| 1058 | Ga0495614_0059543 | 3300048089 | Bacteria | 1640 |
| 1059 | Ga0496100_0007130 | 3300048903 | Bacteria | 6140 |
| 1060 | Ga0496100_0036548 | 3300048903 | Bacteria | 3099 |
| 1061 | Ga0496100_0291880 | 3300048903 | Bacteria | 1218 |
| 1062 | Ga0496100_0797205 | 3300048903 | Bacteria | 740 |
| 1063 | Ga0496101_0013730 | 3300048904 | Bacteria | 5433 |
| 1064 | Ga0496101_0050384 | 3300048904 | Bacteria | 2997 |
| 1065 | Ga0496101_0155481 | 3300048904 | Bacteria | 1751 |
| 1066 | Ga0496101_0499470 | 3300048904 | Bacteria | 961 |
| 1067 | Ga0496102_0054734 | 3300048905 | Bacteria | 3639 |
| 1068 | Ga0496102_0062391 | 3300048905 | Bacteria | 3413 |
| 1069 | Ga0496102_0330937 | 3300048905 | Bacteria | 1435 |
| 1070 | Ga0496102_0331173 | 3300048905 | Bacteria | 1434 |
| 1071 | Ga0496102_0384009 | 3300048905 | Bacteria | 1321 |
| 1072 | Ga0496102_0513601 | 3300048905 | Bacteria | 1120 |
| 1073 | Ga0496102_1002861 | 3300048905 | Bacteria | 755 |
| 1074 | Ga0496103_0045840 | 3300048906 | Bacteria | 2698 |
| 1075 | Ga0496103_0188137 | 3300048906 | Bacteria | 1327 |
| 1076 | Ga0496103_0420771 | 3300048906 | Bacteria | 858 |
| 1077 | Ga0496103_0752500 | 3300048906 | Bacteria | 616 |
| 1078 | Ga0496104_0002424 | 3300048907 | Bacteria | 16066 |
| 1079 | Ga0496104_0040078 | 3300048907 | Bacteria | 4389 |
| 1080 | Ga0496104_0249840 | 3300048907 | Bacteria | 1686 |
| 1081 | Ga0496104_0289301 | 3300048907 | Bacteria | 1551 |
| 1082 | Ga0496104_1029089 | 3300048907 | Bacteria | 727 |
| 1083 | Ga0496105_0001475 | 3300048908 | Bacteria | 16585 |
| 1084 | Ga0496105_0031981 | 3300048908 | Bacteria | 4315 |
| 1085 | Ga0496105_0091299 | 3300048908 | Bacteria | 2515 |
| 1086 | Ga0496105_0316601 | 3300048908 | Bacteria | 1251 |
| 1087 | Ga0496105_0724280 | 3300048908 | Bacteria | 762 |
| 1088 | Ga0496106_0017901 | 3300048909 | Bacteria | 5240 |
| 1089 | Ga0496106_0052086 | 3300048909 | Bacteria | 3087 |
| 1090 | Ga0496106_0131970 | 3300048909 | Bacteria | 1960 |
| 1091 | Ga0496106_0245738 | 3300048909 | Bacteria | 1430 |
| 1092 | Ga0496106_0418896 | 3300048909 | Bacteria | 1076 |
| 1093 | Ga0496106_0572776 | 3300048909 | Bacteria | 905 |
| 1094 | Ga0496106_0706945 | 3300048909 | Bacteria | 803 |
| 1095 | Ga0496107_0059505 | 3300048910 | Bacteria | 2764 |
| 1096 | Ga0496107_0100897 | 3300048910 | Bacteria | 2116 |
| 1097 | Ga0496107_0199728 | 3300048910 | Bacteria | 1486 |
| 1098 | Ga0496107_0494009 | 3300048910 | Bacteria | 908 |
| 1099 | Ga0496107_1001883 | 3300048910 | Unclassified | 606 |
| 1100 | Ga0496108_0001177 | 3300048911 | Bacteria | 20397 |
| 1101 | Ga0496108_0009511 | 3300048911 | Bacteria | 7873 |
| 1102 | Ga0496108_0037168 | 3300048911 | Bacteria | 4054 |
| 1103 | Ga0496108_0038498 | 3300048911 | Bacteria | 3984 |
| 1104 | Ga0496108_0793638 | 3300048911 | Bacteria | 817 |
| 1105 | Ga0496109_0004867 | 3300048912 | Bacteria | 11210 |
| 1106 | Ga0496109_0013250 | 3300048912 | Bacteria | 7140 |
| 1107 | Ga0496109_0072562 | 3300048912 | Bacteria | 3162 |
| 1108 | Ga0496109_0153232 | 3300048912 | Bacteria | 2158 |
| 1109 | Ga0496109_0409843 | 3300048912 | Bacteria | 1281 |
| 1110 | Ga0496109_1289653 | 3300048912 | Bacteria | 666 |
| 1111 | Ga0496110_0006115 | 3300048913 | Bacteria | 9488 |
| 1112 | Ga0496110_0009977 | 3300048913 | Bacteria | 7703 |
| 1113 | Ga0496110_0127924 | 3300048913 | Bacteria | 2292 |
| 1114 | Ga0496110_0317600 | 3300048913 | Bacteria | 1419 |
| 1115 | Ga0496110_0399606 | 3300048913 | Bacteria | 1253 |
| 1116 | Ga0496110_0627428 | 3300048913 | Bacteria | 974 |
| 1117 | Ga0496111_0000232 | 3300048914 | Bacteria | 26683 |
| 1118 | Ga0496111_0000822 | 3300048914 | Bacteria | 16685 |
| 1119 | Ga0496111_0058395 | 3300048914 | Bacteria | 2793 |
| 1120 | Ga0496111_0086795 | 3300048914 | Bacteria | 2290 |
| 1121 | Ga0496112_0004617 | 3300048915 | Bacteria | 11712 |
| 1122 | Ga0496112_0011653 | 3300048915 | Bacteria | 8042 |
| 1123 | Ga0496112_0013224 | 3300048915 | Bacteria | 7615 |
| 1124 | Ga0496112_0033687 | 3300048915 | Bacteria | 4980 |
| 1125 | Ga0496112_0187663 | 3300048915 | Bacteria | 2030 |
| 1126 | Ga0496112_0288838 | 3300048915 | Bacteria | 1586 |
| 1127 | Ga0496112_0591907 | 3300048915 | Bacteria | 1041 |
| 1128 | Ga0496112_0598641 | 3300048915 | Bacteria | 1034 |
| 1129 | Ga0496113_0201951 | 3300048916 | Unclassified | 1580 |
| 1130 | Ga0496113_0222436 | 3300048916 | Bacteria | 1504 |
| 1131 | Ga0496113_0227180 | 3300048916 | Bacteria | 1488 |
| 1132 | Ga0496113_0238563 | 3300048916 | Bacteria | 1450 |
| 1133 | Ga0496113_0258524 | 3300048916 | Bacteria | 1391 |
| 1134 | Ga0496113_0316341 | 3300048916 | Bacteria | 1251 |
| 1135 | Ga0496114_0082586 | 3300048917 | Bacteria | 2716 |
| 1136 | Ga0496114_0089943 | 3300048917 | Bacteria | 2606 |
| 1137 | Ga0496114_0091161 | 3300048917 | Bacteria | 2588 |
| 1138 | Ga0496114_0195116 | 3300048917 | Bacteria | 1772 |
| 1139 | Ga0496114_0457026 | 3300048917 | Bacteria | 1130 |
| 1140 | Ga0496114_0773283 | 3300048917 | Bacteria | 838 |
| 1141 | Ga0496115_0012774 | 3300048918 | Bacteria | 6330 |
| 1142 | Ga0496115_0028908 | 3300048918 | Bacteria | 4348 |
| 1143 | Ga0496115_0058479 | 3300048918 | Bacteria | 3102 |
| 1144 | Ga0496115_0096607 | 3300048918 | Bacteria | 2419 |
| 1145 | Ga0496115_0097488 | 3300048918 | Bacteria | 2408 |
| 1146 | Ga0496115_0184998 | 3300048918 | Bacteria | 1721 |
| 1147 | Ga0496115_0462021 | 3300048918 | Bacteria | 1024 |
| 1148 | Ga0496124_0532356 | 3300048927 | Bacteria | 780 |
| 1149 | Ga0501318_069323 | 3300049534 | Bacteria | 554 |
| 1150 | Ga0501325_001578 | 3300049541 | Bacteria | 1430 |
| 1151 | Ga0501031_0006057 | 3300049568 | Bacteria | 7897 |
| 1152 | Ga0501031_0081161 | 3300049568 | Bacteria | 2114 |
| 1153 | Ga0501031_0192541 | 3300049568 | Bacteria | 1331 |
| 1154 | Ga0501032_0100332 | 3300049569 | Bacteria | 1918 |
| 1155 | Ga0501032_0114195 | 3300049569 | Bacteria | 1786 |
| 1156 | Ga0501033_0073905 | 3300049570 | Bacteria | 2503 |
| 1157 | Ga0501033_0680412 | 3300049570 | Bacteria | 701 |
| 1158 | Ga0501034_0253266 | 3300049571 | Bacteria | 1705 |
| 1159 | Ga0501036_0006555 | 3300049572 | Bacteria | 9456 |
| 1160 | Ga0501036_0087545 | 3300049572 | Bacteria | 2632 |
| 1161 | Ga0501037_0063646 | 3300049573 | Bacteria | 2688 |
| 1162 | Ga0501037_0207334 | 3300049573 | Bacteria | 1383 |
| 1163 | Ga0501038_0007267 | 3300049574 | Bacteria | 10225 |
| 1164 | Ga0501038_0014230 | 3300049574 | Bacteria | 7249 |
| 1165 | Ga0501038_0045311 | 3300049574 | Bacteria | 3818 |
| 1166 | Ga0501039_0002266 | 3300049575 | Bacteria | 14277 |
| 1167 | Ga0501039_0004656 | 3300049575 | Bacteria | 10370 |
| 1168 | Ga0501039_0514390 | 3300049575 | Bacteria | 940 |
| 1169 | Ga0501040_0003042 | 3300049576 | Bacteria | 10876 |
| 1170 | Ga0501040_0032287 | 3300049576 | Bacteria | 3543 |
| 1171 | Ga0501040_0490511 | 3300049576 | Bacteria | 885 |
| 1172 | Ga0501041_0003506 | 3300049577 | Bacteria | 9030 |
| 1173 | Ga0501041_0032563 | 3300049577 | Bacteria | 3150 |
| 1174 | Ga0501041_0392584 | 3300049577 | Bacteria | 878 |
| 1175 | Ga0501042_0003569 | 3300049578 | Bacteria | 9800 |
| 1176 | Ga0501042_0045152 | 3300049578 | Bacteria | 3140 |
| 1177 | Ga0501042_0423655 | 3300049578 | Bacteria | 964 |
| 1178 | Ga0501042_0474088 | 3300049578 | Bacteria | 908 |
| 1179 | Ga0501043_0036451 | 3300049579 | Bacteria | 3869 |
| 1180 | Ga0501043_0051841 | 3300049579 | Bacteria | 3224 |
| 1181 | Ga0501046_0010059 | 3300049580 | Bacteria | 8146 |
| 1182 | Ga0501047_0056335 | 3300049581 | Bacteria | 3801 |
| 1183 | Ga0501047_0422722 | 3300049581 | Bacteria | 1164 |
| 1184 | Ga0501048_0028960 | 3300049582 | Bacteria | 4019 |
| 1185 | Ga0501067_0368080 | 3300049583 | Bacteria | 801 |
| 1186 | Ga0501068_0026818 | 3300049584 | Bacteria | 3398 |
| 1187 | Ga0501068_0041690 | 3300049584 | Bacteria | 2759 |
| 1188 | Ga0501068_1192936 | 3300049584 | Bacteria | 504 |
| 1189 | Ga0501070_0063350 | 3300049586 | Bacteria | 3063 |
| 1190 | Ga0501071_0017552 | 3300049587 | Bacteria | 4938 |
| 1191 | Ga0501071_0027990 | 3300049587 | Bacteria | 3968 |
| 1192 | Ga0501071_0040754 | 3300049587 | Bacteria | 3324 |
| 1193 | Ga0501072_0003521 | 3300049588 | Bacteria | 11798 |
| 1194 | Ga0501072_0014231 | 3300049588 | Bacteria | 6095 |
| 1195 | Ga0501072_1018477 | 3300049588 | Bacteria | 645 |
| 1196 | Ga0501074_0013682 | 3300049590 | Bacteria | 5898 |
| 1197 | Ga0501074_0056565 | 3300049590 | Bacteria | 2827 |
| 1198 | Ga0501074_0150904 | 3300049590 | Bacteria | 1661 |
| 1199 | Ga0501074_0912091 | 3300049590 | Bacteria | 618 |
| 1200 | Ga0501075_0012399 | 3300049591 | Bacteria | 6059 |
| 1201 | Ga0501075_0053711 | 3300049591 | Bacteria | 3030 |
| 1202 | Ga0501075_0055735 | 3300049591 | Bacteria | 2974 |
| 1203 | Ga0501075_0397659 | 3300049591 | Bacteria | 1050 |
| 1204 | Ga0501076_0027106 | 3300049592 | Bacteria | 4444 |
| 1205 | Ga0501076_1623392 | 3300049592 | Bacteria | 530 |
| 1206 | Ga0501077_0025271 | 3300049593 | Bacteria | 3772 |
| 1207 | Ga0501077_0028563 | 3300049593 | Bacteria | 3545 |
| 1208 | Ga0501079_0012788 | 3300049741 | Bacteria | 6410 |
| 1209 | Ga0501079_0015118 | 3300049741 | Bacteria | 5886 |
| 1210 | Ga0501079_0249812 | 3300049741 | Bacteria | 1386 |
| 1211 | Ga0501079_0888742 | 3300049741 | Unclassified | 702 |
| 1212 | Ga0501080_0060623 | 3300049742 | Bacteria | 3522 |
| 1213 | Ga0501081_0027986 | 3300049743 | Bacteria | 3801 |
| 1214 | Ga0501081_0919559 | 3300049743 | Bacteria | 660 |
| 1215 | Ga0501035_0107289 | 3300049822 | Bacteria | 2448 |
| 1216 | Ga0501035_0758699 | 3300049822 | Bacteria | 778 |
| 1217 | Ga0501035_1068057 | 3300049822 | Bacteria | 632 |
| 1218 | Ga0501044_0199299 | 3300049823 | Bacteria | 1961 |
| 1219 | Ga0501045_0020534 | 3300049824 | Bacteria | 4719 |
| 1220 | Ga0501045_0022552 | 3300049824 | Bacteria | 4509 |
| 1221 | Ga0501045_0043673 | 3300049824 | Bacteria | 3264 |
| 1222 | nmdc:mga0yw44_1224303_c1 | 3300050492 | Bacteria | 506 |
| 1223 | nmdc:mga05p37_1172238_c1 | 3300050507 | Bacteria | 797 |
| 1224 | nmdc:mga05p37_125784_c1 | 3300050507 | Bacteria | 3148 |
| 1225 | nmdc:mga05p37_126049_c1 | 3300050507 | Bacteria | 3145 |
| 1226 | nmdc:mga05p37_1594515_c1 | 3300050507 | Bacteria | 643 |
| 1227 | nmdc:mga05p37_225349_c1 | 3300050507 | Bacteria | 2261 |
| 1228 | nmdc:mga05p37_230025_c1 | 3300050507 | Bacteria | 2235 |
| 1229 | nmdc:mga05p37_338210_c1 | 3300050507 | Bacteria | 1776 |
| 1230 | nmdc:mga05p37_678_c1 | 3300050507 | Bacteria | 37695 |
| 1231 | nmdc:mga09592_189601_c1 | 3300050508 | Bacteria | 1780 |
| 1232 | nmdc:mga09592_3_c1 | 3300050508 | Bacteria | 144376 |
| 1233 | nmdc:mga09592_434464_c1 | 3300050508 | Bacteria | 1133 |
| 1234 | nmdc:mga09592_43972_c1 | 3300050508 | Bacteria | 3758 |
| 1235 | nmdc:mga09592_75154_c1 | 3300050508 | Bacteria | 2872 |
| 1236 | nmdc:mga0qj67_11728_c1 | 3300050509 | Bacteria | 6577 |
| 1237 | nmdc:mga0qj67_17_c1 | 3300050509 | Bacteria | 121673 |
| 1238 | nmdc:mga0qj67_18468_c1 | 3300050509 | Bacteria | 5314 |
| 1239 | nmdc:mga0qj67_345628_c1 | 3300050509 | Bacteria | 1203 |
| 1240 | nmdc:mga0qj67_349617_c1 | 3300050509 | Bacteria | 1195 |
| 1241 | nmdc:mga0qj67_382023_c1 | 3300050509 | Bacteria | 1137 |
| 1242 | nmdc:mga06r32_212314_c1 | 3300050510 | Bacteria | 1923 |
| 1243 | nmdc:mga06r32_292469_c1 | 3300050510 | Bacteria | 1616 |
| 1244 | nmdc:mga06r32_317073_c1 | 3300050510 | Bacteria | 1545 |
| 1245 | nmdc:mga06r32_327_c1 | 3300050510 | Bacteria | 39873 |
| 1246 | nmdc:mga06r32_9498_c1 | 3300050510 | Bacteria | 8781 |
| 1247 | nmdc:mga08y16_1097991_c1 | 3300050511 | Bacteria | 771 |
| 1248 | nmdc:mga08y16_1902230_c1 | 3300050511 | Bacteria | 546 |
| 1249 | nmdc:mga0n895_2041_c1 | 3300050512 | Bacteria | 15531 |
| 1250 | nmdc:mga0n895_208934_c1 | 3300050512 | Bacteria | 1983 |
| 1251 | nmdc:mga0n895_274305_c1 | 3300050512 | Bacteria | 1710 |
| 1252 | nmdc:mga0n895_54619_c1 | 3300050512 | Bacteria | 3930 |
| 1253 | nmdc:mga0rr50_12130_c1 | 3300050513 | Bacteria | 5555 |
| 1254 | nmdc:mga0rr50_5606_c1 | 3300050513 | Bacteria | 7513 |
| 1255 | nmdc:mga0rr50_575406_c1 | 3300050513 | Bacteria | 960 |
| 1256 | nmdc:mga08x19_107013_c1 | 3300050514 | Bacteria | 1861 |
| 1257 | nmdc:mga0a205_1212002_c1 | 3300050515 | Bacteria | 602 |
| 1258 | nmdc:mga0a205_322876_c1 | 3300050515 | Bacteria | 1415 |
| 1259 | nmdc:mga0a205_377605_c1 | 3300050515 | Bacteria | 1283 |
| 1260 | nmdc:mga0a205_540298_c1 | 3300050515 | Bacteria | 1021 |
| 1261 | Ga0495601_0001245 | 3300053077 | Bacteria | 13966 |
| 1262 | Ga0495601_0008069 | 3300053077 | Bacteria | 6207 |
| 1263 | Ga0495601_0094123 | 3300053077 | Bacteria | 1930 |
| 1264 | Ga0495601_0121250 | 3300053077 | Bacteria | 1698 |
| 1265 | Ga0495601_0282790 | 3300053077 | Bacteria | 1081 |
| 1266 | Ga0495601_0709772 | 3300053077 | Bacteria | 641 |
| 1267 | Ga0495612_0010754 | 3300053078 | Bacteria | 3695 |
| 1268 | Ga0495612_0050052 | 3300053078 | Bacteria | 1715 |
| 1269 | Ga0495612_0068728 | 3300053078 | Bacteria | 1474 |
| 1270 | Ga0495612_0084295 | 3300053078 | Bacteria | 1338 |
| 1271 | Ga0495612_0110022 | 3300053078 | Bacteria | 1178 |
| 1272 | Ga0495612_0159987 | 3300053078 | Bacteria | 983 |
| 1273 | Ga0495612_0283457 | 3300053078 | Bacteria | 741 |
| 1274 | Ga0495595_0016871 | 3300053084 | Bacteria | 3132 |
| 1275 | Ga0495595_0038238 | 3300053084 | Bacteria | 2185 |
| 1276 | Ga0495595_0103115 | 3300053084 | Bacteria | 1378 |
| 1277 | Ga0495595_0456617 | 3300053084 | Bacteria | 649 |
| 1278 | Ga0495619_0035119 | 3300053085 | Bacteria | 3260 |
| 1279 | Ga0495619_0103536 | 3300053085 | Bacteria | 1939 |
| 1280 | Ga0495619_0734944 | 3300053085 | Bacteria | 670 |
| 1281 | Ga0495619_0847800 | 3300053085 | Bacteria | 616 |
| 1282 | Ga0500600_0016171 | 3300053149 | Bacteria | 4517 |
| 1283 | Ga0501084_0005892 | 3300054114 | Bacteria | 10088 |
| 1284 | Ga0501084_0059137 | 3300054114 | Bacteria | 3207 |
| 1285 | Ga0590074_053387 | 3300059423 | Bacteria | 742 |
| 1286 | Ga0590075_108167 | 3300059424 | Bacteria | 725 |
| 1287 | Ga0590077_140621 | 3300059426 | Bacteria | 576 |
| 1288 | Ga0501082_0073951 | 3300060353 | Bacteria | 2934 |
| 1289 | Ga0501082_0188329 | 3300060353 | Bacteria | 1795 |
| 1290 | Ga0466962_0060293 | 3300061719 | Bacteria | 1811 |
| 1291 | Ga0530510_0004846 | 3300061734 | Bacteria | 9312 |
| 1292 | Ga0530510_0333761 | 3300061734 | Bacteria | 1137 |
| 1293 | 2816421313 | 2816332119 | Bacteria | 8120218 |
| 1294 | 2862580808 | 2862574272 | Bacteria | 10567477 |
| 1295 | 8001783783 | 8001781756 | Bacteria | 9586736 |
| 1296 | 8001784903 | 8001781756 | Bacteria | 9586736 |
| 1297 | Ga0495580_0003907 | |||
| 1298 | JGI24751J29686_10145405 | |||
| 1299 | JGI25406J46586_10025075 | |||
| 1300 | JGI25406J46586_10029754 | |||
| 1301 | JGI25406J46586_10065086 | |||
| 1302 | JGI25406J46586_10179250 | |||
| 1303 | JGI25407J50210_10027103 | |||
| 1304 | JGI25407J50210_10038167 | |||
| 1305 | JGI25407J50210_10044410 | |||
| 1306 | JGI25407J50210_10070060 | |||
| 1307 | JGI25404J52841_10019512 | |||
| 1308 | Ga0058861_11156605 | |||
| 1309 | Ga0065712_10010065 | |||
| 1310 | Ga0065715_10066109 | |||
| 1311 | Ga0070658_10546773 | |||
| 1312 | Ga0070676_10216831 | |||
| 1313 | Ga0070676_11312104 | |||
| 1314 | Ga0070676_11414474 | |||
| 1315 | Ga0070683_100029004 | |||
| 1316 | Ga0070683_100245438 | |||
| 1317 | Ga0070683_100571599 | |||
| 1318 | Ga0070690_100194570 | |||
| 1319 | Ga0070690_101027059 | |||
| 1320 | Ga0068869_101552718 | |||
| 1321 | Ga0070680_100215607 | |||
| 1322 | Ga0070682_100039482 | |||
| 1323 | Ga0070682_100283303 | |||
| 1324 | Ga0070682_100392629 | |||
| 1325 | Ga0068868_100028892 | |||
| 1326 | Ga0068868_100847747 | |||
| 1327 | Ga0068868_101547610 | |||
| 1328 | Ga0070660_100005305 | |||
| 1329 | Ga0070689_100261859 | |||
| 1330 | Ga0070689_100301598 | |||
| 1331 | Ga0070687_100196359 | |||
| 1332 | Ga0070692_10250770 | |||
| 1333 | Ga0070692_10256690 | |||
| 1334 | Ga0070692_10734759 | |||
| 1335 | Ga0070669_100966091 | |||
| 1336 | Ga0070675_100380727 | |||
| 1337 | Ga0070675_101275884 | |||
| 1338 | Ga0070671_102013932 | |||
| 1339 | Ga0070674_100309886 | |||
| 1340 | Ga0070674_100632940 | |||
| 1341 | Ga0070674_102013386 | |||
| 1342 | Ga0070673_100428567 | |||
| 1343 | Ga0070673_100874509 | |||
| 1344 | Ga0070673_101341627 | |||
| 1345 | Ga0070688_100283039 | |||
| 1346 | Ga0070688_100334820 | |||
| 1347 | Ga0070659_100068442 | |||
| 1348 | Ga0070709_10001407 | |||
| 1349 | Ga0070709_10002051 | |||
| 1350 | Ga0070709_10002526 | |||
| 1351 | Ga0070709_10829020 | |||
| 1352 | Ga0070709_11309209 | |||
| 1353 | Ga0070714_100001906 | |||
| 1354 | Ga0070714_100003367 | |||
| 1355 | Ga0070714_100074066 | |||
| 1356 | Ga0070714_100118797 | |||
| 1357 | Ga0070714_100120558 | |||
| 1358 | Ga0070714_100219772 | |||
| 1359 | Ga0070714_100620522 | |||
| 1360 | Ga0070714_100630868 | |||
| 1361 | Ga0070714_101487411 | |||
| 1362 | Ga0070714_102122241 | |||
| 1363 | Ga0070713_100008866 | |||
| 1364 | Ga0070713_100031781 | |||
| 1365 | Ga0070713_100082147 | |||
| 1366 | Ga0070713_100203675 | |||
| 1367 | Ga0070713_100326682 | |||
| 1368 | Ga0070713_100350996 | |||
| 1369 | Ga0070713_100374181 | |||
| 1370 | Ga0070713_100517124 | |||
| 1371 | Ga0070713_102045192 | |||
| 1372 | Ga0070710_10002135 | |||
| 1373 | Ga0070710_10015270 | |||
| 1374 | Ga0070710_10027285 | |||
| 1375 | Ga0070710_10083743 | |||
| 1376 | Ga0070710_10084363 | |||
| 1377 | Ga0070710_10338637 | |||
| 1378 | Ga0070710_10378325 | |||
| 1379 | Ga0070710_10611765 | |||
| 1380 | Ga0070701_10387131 | |||
| 1381 | Ga0070701_11009715 | |||
| 1382 | Ga0070711_100001226 | |||
| 1383 | Ga0070711_100045301 | |||
| 1384 | Ga0070711_100083056 | |||
| 1385 | Ga0070711_100187022 | |||
| 1386 | Ga0070711_100313264 | |||
| 1387 | Ga0070711_100458411 | |||
| 1388 | Ga0070705_100241031 | |||
| 1389 | Ga0070700_100299846 | |||
| 1390 | Ga0070694_100157699 | |||
| 1391 | Ga0070708_100014601 | |||
| 1392 | Ga0070708_100017056 | |||
| 1393 | Ga0070708_100073026 | |||
| 1394 | Ga0070663_100005352 | |||
| 1395 | Ga0070663_101591162 | |||
| 1396 | Ga0070678_101271624 | |||
| 1397 | Ga0070678_101582750 | |||
| 1398 | Ga0070662_100271606 | |||
| 1399 | Ga0070662_100375049 | |||
| 1400 | Ga0070681_10565069 | |||
| 1401 | Ga0070681_10757346 | |||
| 1402 | Ga0068867_100278592 | |||
| 1403 | Ga0070685_10360361 | |||
| 1404 | Ga0070685_10550088 | |||
| 1405 | Ga0070706_100022274 | |||
| 1406 | Ga0070706_100456009 | |||
| 1407 | Ga0070706_101271474 | |||
| 1408 | Ga0070707_100003908 | |||
| 1409 | Ga0070707_100062063 | |||
| 1410 | Ga0070707_100070994 | |||
| 1411 | Ga0070707_100168655 | |||
| 1412 | Ga0070707_100169938 | |||
| 1413 | Ga0070707_100208378 | |||
| 1414 | Ga0070707_100673076 | |||
| 1415 | Ga0070698_100001125 | |||
| 1416 | Ga0070698_100010424 | |||
| 1417 | Ga0070698_100066483 | |||
| 1418 | Ga0070698_100068614 | |||
| 1419 | Ga0070698_100071335 | |||
| 1420 | Ga0070698_100147134 | |||
| 1421 | Ga0070698_100186217 | |||
| 1422 | Ga0070698_100479543 | |||
| 1423 | Ga0070698_100855749 | |||
| 1424 | Ga0070698_100938474 | |||
| 1425 | Ga0070699_100372075 | |||
| 1426 | Ga0070699_100485062 | |||
| 1427 | Ga0070699_100497076 | |||
| 1428 | Ga0070699_100522980 | |||
| 1429 | Ga0070679_100476952 | |||
| 1430 | Ga0070684_100083660 | |||
| 1431 | Ga0070684_100112456 | |||
| 1432 | Ga0070684_100286159 | |||
| 1433 | Ga0070697_100916145 | |||
| 1434 | Ga0068853_100836097 | |||
| 1435 | Ga0070686_100193084 | |||
| 1436 | Ga0070686_100451519 | |||
| 1437 | Ga0070695_100169587 | |||
| 1438 | Ga0070696_100580311 | |||
| 1439 | Ga0070693_100023516 | |||
| 1440 | Ga0070693_100777502 | |||
| 1441 | Ga0070704_100648859 | |||
| 1442 | Ga0070704_100691672 | |||
| 1443 | Ga0070704_100933751 | |||
| 1444 | Ga0068855_100139901 | |||
| 1445 | Ga0068855_100313587 | |||
| 1446 | Ga0068855_101506066 | |||
| 1447 | Ga0068857_100283273 | |||
| 1448 | Ga0068857_100291562 | |||
| 1449 | Ga0068857_101069062 | |||
| 1450 | Ga0068857_101358156 | |||
| 1451 | Ga0068854_100337658 | |||
| 1452 | Ga0068854_102116573 | |||
| 1453 | Ga0068856_100002969 | |||
| 1454 | Ga0068856_100445329 | |||
| 1455 | Ga0068856_100845331 | |||
| 1456 | Ga0068856_100905316 | |||
| 1457 | Ga0068856_101606867 | |||
| 1458 | Ga0068856_101635283 | |||
| 1459 | Ga0068856_101743786 | |||
| 1460 | Ga0068856_101751375 | |||
| 1461 | Ga0070702_100043474 | |||
| 1462 | Ga0068852_100523008 | |||
| 1463 | Ga0068859_100593646 | |||
| 1464 | Ga0068864_100074576 | |||
| 1465 | Ga0068866_10340539 | |||
| 1466 | Ga0068866_10524642 | |||
| 1467 | Ga0068861_100884697 | |||
| 1468 | Ga0068870_10137632 | |||
| 1469 | Ga0068863_100002784 | |||
| 1470 | Ga0068863_100360141 | |||
| 1471 | Ga0068858_101100825 | |||
| 1472 | Ga0068862_100396279 | |||
| 1473 | Ga0081455_10067149 | |||
| 1474 | Ga0081538_10005724 | |||
| 1475 | Ga0081538_10008886 | |||
| 1476 | Ga0081538_10017624 | |||
| 1477 | Ga0081538_10020118 | |||
| 1478 | Ga0081538_10024172 | |||
| 1479 | Ga0081538_10044149 | |||
| 1480 | Ga0081538_10057052 | |||
| 1481 | Ga0081540_1000355 | |||
| 1482 | Ga0081540_1022528 | |||
| 1483 | Ga0081540_1058377 | |||
| 1484 | Ga0081539_10001638 | |||
| 1485 | Ga0081539_10003001 | |||
| 1486 | Ga0081539_10004760 | |||
| 1487 | Ga0081539_10005846 | |||
| 1488 | Ga0081539_10054047 | |||
| 1489 | Ga0081539_10118586 | |||
| 1490 | Ga0070717_10003806 | |||
| 1491 | Ga0070717_10040948 | |||
| 1492 | Ga0070717_10136693 | |||
| 1493 | Ga0070717_10143522 | |||
| 1494 | Ga0070717_10156816 | |||
| 1495 | Ga0070717_10288110 | |||
| 1496 | Ga0070717_10323260 | |||
| 1497 | Ga0070717_10757790 | |||
| 1498 | Ga0070717_10908031 | |||
| 1499 | Ga0070717_10983230 | |||
| 1500 | Ga0070717_11027976 | |||
| 1501 | Ga0070717_11043789 | |||
| 1502 | Ga0070717_11049088 | |||
| 1503 | Ga0075432_10005911 | |||
| 1504 | Ga0075432_10236129 | |||
| 1505 | Ga0070715_10000964 | |||
| 1506 | Ga0070715_10380351 | |||
| 1507 | Ga0070715_11083792 | |||
| 1508 | Ga0070716_100000106 | |||
| 1509 | Ga0070716_100002360 | |||
| 1510 | Ga0070716_100021073 | |||
| 1511 | Ga0070716_100338049 | |||
| 1512 | Ga0070716_101051575 | |||
| 1513 | Ga0070712_100007581 | |||
| 1514 | Ga0070712_100015848 | |||
| 1515 | Ga0070712_100087218 | |||
| 1516 | Ga0070712_100104354 | |||
| 1517 | Ga0070712_100350872 | |||
| 1518 | Ga0070712_101358713 | |||
| 1519 | Ga0097621_100462113 | |||
| 1520 | Ga0097621_100532519 | |||
| 1521 | Ga0097621_101098290 | |||
| 1522 | Ga0075428_100000700 | |||
| 1523 | Ga0075428_100011941 | |||
| 1524 | Ga0075428_100066766 | |||
| 1525 | Ga0075428_100100491 | |||
| 1526 | Ga0075428_100146196 | |||
| 1527 | Ga0075428_100390904 | |||
| 1528 | Ga0075428_100427148 | |||
| 1529 | Ga0075428_100571815 | |||
| 1530 | Ga0075428_101658769 | |||
| 1531 | Ga0075430_100006777 | |||
| 1532 | Ga0075430_100056386 | |||
| 1533 | Ga0075430_100097271 | |||
| 1534 | Ga0075430_100377180 | |||
| 1535 | Ga0075431_100002774 | |||
| 1536 | Ga0075431_100013583 | |||
| 1537 | Ga0075431_100089328 | |||
| 1538 | Ga0075431_100284224 | |||
| 1539 | Ga0075431_100500348 | |||
| 1540 | Ga0075433_10102297 | |||
| 1541 | Ga0075434_100001286 | |||
| 1542 | Ga0075434_100043314 | |||
| 1543 | Ga0075434_100184271 | |||
| 1544 | Ga0075434_100265488 | |||
| 1545 | Ga0075434_100805159 | |||
| 1546 | Ga0075429_100015603 | |||
| 1547 | Ga0075429_100019984 | |||
| 1548 | Ga0075429_100225452 | |||
| 1549 | Ga0075429_100410564 | |||
| 1550 | Ga0075429_101087116 | |||
| 1551 | Ga0068865_100252803 | |||
| 1552 | Ga0068865_100534419 | |||
| 1553 | Ga0068865_100538303 | |||
| 1554 | Ga0068865_100564568 | |||
| 1555 | Ga0068865_100889829 | |||
| 1556 | Ga0075436_100025083 | |||
| 1557 | Ga0075436_100039596 | |||
| 1558 | Ga0075436_100621387 | |||
| 1559 | Ga0097620_100017973 | |||
| 1560 | Ga0097620_100593696 | |||
| 1561 | Ga0075435_100000284 | |||
| 1562 | Ga0075435_100004226 | |||
| 1563 | Ga0075435_101666842 | |||
| 1564 | Ga0099794_10003406 | |||
| 1565 | Ga0099794_10337380 | |||
| 1566 | Ga0105240_10811602 | |||
| 1567 | Ga0111539_10252876 | |||
| 1568 | Ga0111539_11225601 | |||
| 1569 | Ga0105245_10007401 | |||
| 1570 | Ga0105245_10082153 | |||
| 1571 | Ga0105245_10170003 | |||
| 1572 | Ga0105245_10178446 | |||
| 1573 | Ga0105245_11209111 | |||
| 1574 | Ga0105247_10197025 | |||
| 1575 | Ga0105247_11832278 | |||
| 1576 | Ga0114129_10000084 | |||
| 1577 | Ga0114129_10005201 | |||
| 1578 | Ga0114129_10039773 | |||
| 1579 | Ga0114129_10118025 | |||
| 1580 | Ga0114129_10343913 | |||
| 1581 | Ga0114129_10430890 | |||
| 1582 | Ga0114129_10644157 | |||
| 1583 | Ga0114129_10981897 | |||
| 1584 | Ga0105243_10022986 | |||
| 1585 | Ga0105243_10062194 | |||
| 1586 | Ga0105243_10091930 | |||
| 1587 | Ga0105241_10067749 | |||
| 1588 | Ga0105241_10646661 | |||
| 1589 | Ga0105241_12108421 | |||
| 1590 | Ga0105242_10643566 | |||
| 1591 | Ga0105242_12303149 | |||
| 1592 | Ga0105248_10440439 | |||
| 1593 | Ga0105248_12768394 | |||
| 1594 | Ga0105237_10114788 | |||
| 1595 | Ga0105237_10853197 | |||
| 1596 | Ga0105237_11141161 | |||
| 1597 | Ga0105238_10015811 | |||
| 1598 | Ga0105238_10856724 | |||
| 1599 | Ga0105238_11666325 | |||
| 1600 | Ga0105238_12210270 | |||
| 1601 | Ga0105238_12469399 | |||
| 1602 | Ga0105249_10107477 | |||
| 1603 | Ga0105249_10408384 | |||
| 1604 | Ga0105249_11022210 | |||
| 1605 | Ga0105239_10339162 | |||
| 1606 | Ga0105239_10350750 | |||
| 1607 | Ga0105239_10605685 | |||
| 1608 | Ga0105239_10809935 | |||
| 1609 | Ga0105239_11795125 | |||
| 1610 | Ga0105246_10001080 | |||
| 1611 | Ga0105246_10349530 | |||
| 1612 | Ga0105246_11061007 | |||
| 1613 | Ga0105246_11859222 | |||
| 1614 | Ga0157337_1000331 | |||
| 1615 | Ga0157338_1039459 | |||
| 1616 | Ga0157370_10105930 | |||
| 1617 | Ga0157370_10451557 | |||
| 1618 | Ga0157370_11003482 | |||
| 1619 | Ga0157369_10075813 | |||
| 1620 | Ga0157369_10432010 | |||
| 1621 | Ga0157369_11035313 | |||
| 1622 | Ga0157374_10026919 | |||
| 1623 | Ga0157374_10394561 | |||
| 1624 | Ga0157374_11677537 | |||
| 1625 | Ga0157378_10245605 | |||
| 1626 | Ga0157378_10436514 | |||
| 1627 | Ga0157378_11423647 | |||
| 1628 | Ga0157378_12942436 | |||
| 1629 | Ga0163162_10296942 | |||
| 1630 | Ga0163162_10516294 | |||
| 1631 | Ga0163162_10545640 | |||
| 1632 | Ga0163162_12687692 | |||
| 1633 | Ga0157372_10029700 | |||
| 1634 | Ga0157372_10321413 | |||
| 1635 | Ga0157372_10803627 | |||
| 1636 | Ga0157372_11415182 | |||
| 1637 | Ga0157375_10584030 | |||
| 1638 | Ga0157375_11019055 | |||
| 1639 | Ga0157375_11616241 | |||
| 1640 | Ga0163163_10013940 | |||
| 1641 | Ga0163163_10105847 | |||
| 1642 | Ga0163163_10559039 | |||
| 1643 | Ga0163163_11474549 | |||
| 1644 | Ga0163163_11725308 | |||
| 1645 | Ga0163163_12345798 | |||
| 1646 | Ga0157380_10096821 | |||
| 1647 | Ga0157380_10762285 | |||
| 1648 | Ga0157377_10206465 | |||
| 1649 | Ga0157377_10704547 | |||
| 1650 | Ga0157377_11170958 | |||
| 1651 | Ga0157379_11137495 | |||
| 1652 | Ga0157376_10156538 | |||
| 1653 | Ga0163161_10573595 | |||
| 1654 | Ga0197907_10015037 | |||
| 1655 | Ga0197907_10018504 | |||
| 1656 | Ga0197907_10302286 | |||
| 1657 | Ga0197907_11024113 | |||
| 1658 | Ga0197907_11308136 | |||
| 1659 | Ga0206356_11502990 | |||
| 1660 | Ga0206352_10264080 | |||
| 1661 | Ga0206350_10220609 | |||
| 1662 | Ga0206354_10480729 | |||
| 1663 | Ga0206353_10290880 | |||
| 1664 | Ga0206353_10610583 | |||
| 1665 | Ga0206353_10991793 | |||
| 1666 | Ga0206353_12029006 | |||
| 1667 | Ga0213873_10037562 | |||
| 1668 | Ga0213874_10201129 | |||
| 1669 | Ga0213876_10028639 | |||
| 1670 | Ga0213876_10095731 | |||
| 1671 | Ga0213876_10188717 | |||
| 1672 | Ga0213875_10000986 | |||
| 1673 | Ga0213875_10029170 | |||
| 1674 | Ga0213875_10109653 | |||
| 1675 | Ga0213875_10157987 | |||
| 1676 | Ga0224712_10049903 | |||
| 1677 | Ga0228598_1019200 | |||
| 1678 | Ga0228598_1032450 | |||
| 1679 | Ga0209759_1011348 | |||
| 1680 | Ga0207653_10174970 | |||
| 1681 | Ga0207692_10042144 | |||
| 1682 | Ga0207692_10122300 | |||
| 1683 | Ga0207692_10196974 | |||
| 1684 | Ga0207692_10419355 | |||
| 1685 | Ga0207692_10551981 | |||
| 1686 | Ga0207692_10678448 | |||
| 1687 | Ga0207642_10175664 | |||
| 1688 | Ga0207642_10553109 | |||
| 1689 | Ga0207710_10120627 | |||
| 1690 | Ga0207710_10515824 | |||
| 1691 | Ga0207710_10677394 | |||
| 1692 | Ga0207688_10213258 | |||
| 1693 | Ga0207680_10856650 | |||
| 1694 | Ga0207685_10053552 | |||
| 1695 | Ga0207685_10067525 | |||
| 1696 | Ga0207699_10000040 | |||
| 1697 | Ga0207699_10000228 | |||
| 1698 | Ga0207699_10071634 | |||
| 1699 | Ga0207699_10150565 | |||
| 1700 | Ga0207699_10239242 | |||
| 1701 | Ga0207699_10847410 | |||
| 1702 | Ga0207699_10883030 | |||
| 1703 | Ga0207699_11132609 | |||
| 1704 | Ga0207643_10017557 | |||
| 1705 | Ga0207643_10170062 | |||
| 1706 | Ga0207705_11403716 | |||
| 1707 | Ga0207684_10019316 | |||
| 1708 | Ga0207684_10184809 | |||
| 1709 | Ga0207654_10519668 | |||
| 1710 | Ga0207654_11258077 | |||
| 1711 | Ga0207671_10295783 | |||
| 1712 | Ga0207693_10006194 | |||
| 1713 | Ga0207693_10007328 | |||
| 1714 | Ga0207693_10008319 | |||
| 1715 | Ga0207693_10021044 | |||
| 1716 | Ga0207693_10037509 | |||
| 1717 | Ga0207693_10149351 | |||
| 1718 | Ga0207693_10187567 | |||
| 1719 | Ga0207693_10344219 | |||
| 1720 | Ga0207693_10430465 | |||
| 1721 | Ga0207693_10806512 | |||
| 1722 | Ga0207693_10867428 | |||
| 1723 | Ga0207663_10007204 | |||
| 1724 | Ga0207663_10060136 | |||
| 1725 | Ga0207663_10286780 | |||
| 1726 | Ga0207663_10481630 | |||
| 1727 | Ga0207663_10554583 | |||
| 1728 | Ga0207663_10574583 | |||
| 1729 | Ga0207663_10750162 | |||
| 1730 | Ga0207663_11429567 | |||
| 1731 | Ga0207662_10209599 | |||
| 1732 | Ga0207657_10006792 | |||
| 1733 | Ga0207652_10430999 | |||
| 1734 | Ga0207646_10001500 | |||
| 1735 | Ga0207646_10013695 | |||
| 1736 | Ga0207646_10017090 | |||
| 1737 | Ga0207646_10052242 | |||
| 1738 | Ga0207646_10130270 | |||
| 1739 | Ga0207646_10183588 | |||
| 1740 | Ga0207646_11436765 | |||
| 1741 | Ga0207681_10900981 | |||
| 1742 | Ga0207694_10068439 | |||
| 1743 | Ga0207694_10555242 | |||
| 1744 | Ga0207694_11585574 | |||
| 1745 | Ga0207659_10341297 | |||
| 1746 | Ga0207659_10440756 | |||
| 1747 | Ga0207687_10033726 | |||
| 1748 | Ga0207687_10169538 | |||
| 1749 | Ga0207687_10469909 | |||
| 1750 | Ga0207700_10000300 | |||
| 1751 | Ga0207700_10000634 | |||
| 1752 | Ga0207700_10005549 | |||
| 1753 | Ga0207700_10019426 | |||
| 1754 | Ga0207700_10383453 | |||
| 1755 | Ga0207700_10385475 | |||
| 1756 | Ga0207700_10794630 | |||
| 1757 | Ga0207700_11325054 | |||
| 1758 | Ga0207664_10000997 | |||
| 1759 | Ga0207664_10051077 | |||
| 1760 | Ga0207664_10063622 | |||
| 1761 | Ga0207664_10142104 | |||
| 1762 | Ga0207664_10166950 | |||
| 1763 | Ga0207664_10173226 | |||
| 1764 | Ga0207664_10648464 | |||
| 1765 | Ga0207664_10973898 | |||
| 1766 | Ga0207664_11103408 | |||
| 1767 | Ga0207664_11394151 | |||
| 1768 | Ga0207644_11228116 | |||
| 1769 | Ga0207644_11258701 | |||
| 1770 | Ga0207690_10144613 | |||
| 1771 | Ga0207690_10848794 | |||
| 1772 | Ga0207690_11514358 | |||
| 1773 | Ga0207706_10373691 | |||
| 1774 | Ga0207706_11375274 | |||
| 1775 | Ga0207706_11677686 | |||
| 1776 | Ga0207686_11432355 | |||
| 1777 | Ga0207709_10107501 | |||
| 1778 | Ga0207709_10179475 | |||
| 1779 | Ga0207709_10404967 | |||
| 1780 | Ga0207709_10460587 | |||
| 1781 | Ga0207709_11231828 | |||
| 1782 | Ga0207670_10054343 | |||
| 1783 | Ga0207670_10361817 | |||
| 1784 | Ga0207670_10696610 | |||
| 1785 | Ga0207669_11104328 | |||
| 1786 | Ga0207704_10027498 | |||
| 1787 | Ga0207704_10131784 | |||
| 1788 | Ga0207704_10383130 | |||
| 1789 | Ga0207704_10641735 | |||
| 1790 | Ga0207704_10693470 | |||
| 1791 | Ga0207665_10000170 | |||
| 1792 | Ga0207665_10011924 | |||
| 1793 | Ga0207665_10038888 | |||
| 1794 | Ga0207665_10067733 | |||
| 1795 | Ga0207665_10183425 | |||
| 1796 | Ga0207665_10360189 | |||
| 1797 | Ga0207711_12087160 | |||
| 1798 | Ga0207689_10071337 | |||
| 1799 | Ga0207661_10129123 | |||
| 1800 | Ga0207661_10291438 | |||
| 1801 | Ga0207661_10307829 | |||
| 1802 | Ga0207661_10416252 | |||
| 1803 | Ga0207679_10138605 | |||
| 1804 | Ga0207667_10111212 | |||
| 1805 | Ga0207667_10781069 | |||
| 1806 | Ga0207667_10985095 | |||
| 1807 | Ga0207651_10090252 | |||
| 1808 | Ga0207651_10949637 | |||
| 1809 | Ga0207712_10271312 | |||
| 1810 | Ga0207712_11348297 | |||
| 1811 | Ga0207668_10059017 | |||
| 1812 | Ga0207640_10347027 | |||
| 1813 | Ga0207640_11286512 | |||
| 1814 | Ga0207677_10030436 | |||
| 1815 | Ga0207677_10603985 | |||
| 1816 | Ga0207677_10744617 | |||
| 1817 | Ga0207677_12095836 | |||
| 1818 | Ga0207639_10142016 | |||
| 1819 | Ga0207639_11080910 | |||
| 1820 | Ga0207678_10001185 | |||
| 1821 | Ga0207708_10109732 | |||
| 1822 | Ga0207708_10131498 | |||
| 1823 | Ga0207702_10002526 | |||
| 1824 | Ga0207702_10178421 | |||
| 1825 | Ga0207702_10273606 | |||
| 1826 | Ga0207702_10402456 | |||
| 1827 | Ga0207702_10714774 | |||
| 1828 | Ga0207702_11084432 | |||
| 1829 | Ga0207702_11157050 | |||
| 1830 | Ga0207702_11759548 | |||
| 1831 | Ga0207641_10013086 | |||
| 1832 | Ga0207641_10791386 | |||
| 1833 | Ga0207648_10355564 | |||
| 1834 | Ga0207676_10566111 | |||
| 1835 | Ga0207676_10591657 | |||
| 1836 | Ga0207676_10670794 | |||
| 1837 | Ga0207676_10921525 | |||
| 1838 | Ga0207676_11913254 | |||
| 1839 | Ga0207674_10185914 | |||
| 1840 | Ga0207674_10283832 | |||
| 1841 | Ga0207674_10403748 | |||
| 1842 | Ga0207674_10491415 | |||
| 1843 | Ga0207674_11062347 | |||
| 1844 | Ga0207675_100501137 | |||
| 1845 | Ga0207683_10183435 | |||
| 1846 | Ga0207683_10310032 | |||
| 1847 | Ga0207683_10370351 | |||
| 1848 | Ga0207683_10602453 | |||
| 1849 | Ga0207683_11905949 | |||
| 1850 | Ga0207698_10665220 | |||
| 1851 | Ga0209588_1004768 | |||
| 1852 | Ga0207428_10075716 | |||
| 1853 | Ga0207428_10187504 | |||
| 1854 | Ga0207428_10933087 | |||
| 1855 | Ga0268266_10016586 | |||
| 1856 | Ga0268265_10351206 | |||
| 1857 | Ga0268264_10562835 | |||
| 1858 | Ga0268264_10611397 | |||
| 1859 | Ga0265318_10161101 | |||
| 1860 | Ga0265322_10011793 | |||
| 1861 | Ga0307517_10319548 | |||
| 1862 | Ga0307515_10726119 | |||
| 1863 | Ga0265338_10027368 | |||
| 1864 | Ga0265338_10049356 | |||
| 1865 | Ga0265338_10259993 | |||
| 1866 | Ga0265338_10291325 | |||
| 1867 | Ga0265338_10876887 | |||
| 1868 | Ga0307512_10016919 | |||
| 1869 | Ga0307512_10137804 | |||
| 1870 | Ga0265763_1036988 | |||
| 1871 | Ga0265760_10212488 | |||
| 1872 | Ga0265328_10184377 | |||
| 1873 | Ga0265325_10167419 | |||
| 1874 | Ga0265340_10122896 | |||
| 1875 | Ga0265340_10293196 | |||
| 1876 | Ga0265327_10010227 | |||
| 1877 | Ga0307513_10001290 | |||
| 1878 | Ga0307513_10005029 | |||
| 1879 | Ga0307408_100021353 | |||
| 1880 | Ga0307408_100082037 | |||
| 1881 | Ga0307408_100243227 | |||
| 1882 | Ga0307408_100580800 | |||
| 1883 | Ga0307508_10031638 | |||
| 1884 | Ga0307508_10117245 | |||
| 1885 | Ga0265314_10394674 | |||
| 1886 | Ga0307516_10015657 | |||
| 1887 | Ga0307516_10055221 | |||
| 1888 | Ga0307405_10032315 | |||
| 1889 | Ga0307405_10085312 | |||
| 1890 | Ga0307405_10153763 | |||
| 1891 | Ga0307405_10156627 | |||
| 1892 | Ga0307413_10085560 | |||
| 1893 | Ga0307413_10094553 | |||
| 1894 | Ga0307413_10144163 | |||
| 1895 | Ga0307413_10300182 | |||
| 1896 | Ga0307413_10456782 | |||
| 1897 | Ga0307410_10005052 | |||
| 1898 | Ga0307410_10014926 | |||
| 1899 | Ga0307410_10017496 | |||
| 1900 | Ga0307410_10388827 | |||
| 1901 | Ga0307406_10027205 | |||
| 1902 | Ga0307406_10039026 | |||
| 1903 | Ga0307406_10276543 | |||
| 1904 | Ga0307406_10294314 | |||
| 1905 | Ga0307406_10736295 | |||
| 1906 | Ga0307406_11185777 | |||
| 1907 | Ga0307407_10005105 | |||
| 1908 | Ga0307407_10016190 | |||
| 1909 | Ga0307407_10059281 | |||
| 1910 | Ga0307407_10337192 | |||
| 1911 | Ga0307407_10412690 | |||
| 1912 | Ga0307407_10451451 | |||
| 1913 | Ga0307407_11510713 | |||
| 1914 | Ga0307412_10024609 | |||
| 1915 | Ga0307412_10121926 | |||
| 1916 | Ga0307412_11541781 | |||
| 1917 | Ga0307412_12252250 | |||
| 1918 | Ga0307409_100002782 | |||
| 1919 | Ga0307409_100006206 | |||
| 1920 | Ga0307409_100014273 | |||
| 1921 | Ga0307409_100064899 | |||
| 1922 | Ga0307409_100133419 | |||
| 1923 | Ga0307409_100189252 | |||
| 1924 | Ga0307409_100225581 | |||
| 1925 | Ga0307409_100230164 | |||
| 1926 | Ga0307409_100499409 | |||
| 1927 | Ga0307416_100000815 | |||
| 1928 | Ga0307416_100002996 | |||
| 1929 | Ga0307416_100006694 | |||
| 1930 | Ga0307416_100009033 | |||
| 1931 | Ga0307416_100078488 | |||
| 1932 | Ga0307416_100108061 | |||
| 1933 | Ga0307416_100135945 | |||
| 1934 | Ga0307416_100163983 | |||
| 1935 | Ga0307416_100300318 | |||
| 1936 | Ga0307416_100660624 | |||
| 1937 | Ga0307416_101208720 | |||
| 1938 | Ga0307416_101937952 | |||
| 1939 | Ga0307416_102887621 | |||
| 1940 | Ga0307414_10024335 | |||
| 1941 | Ga0307414_10397176 | |||
| 1942 | Ga0307414_10568982 | |||
| 1943 | Ga0307414_10582566 | |||
| 1944 | Ga0307414_10792368 | |||
| 1945 | Ga0307411_10052477 | |||
| 1946 | Ga0307411_10082217 | |||
| 1947 | Ga0307411_10422286 | |||
| 1948 | Ga0307411_10752040 | |||
| 1949 | Ga0307411_11581657 | |||
| 1950 | Ga0307415_100000173 | |||
| 1951 | Ga0307415_100000831 | |||
| 1952 | Ga0307415_100026435 | |||
| 1953 | Ga0307415_100059176 | |||
| 1954 | Ga0307415_100076084 | |||
| 1955 | Ga0307415_100086623 | |||
| 1956 | Ga0307415_100327342 | |||
| 1957 | Ga0307415_100343516 | |||
| 1958 | Ga0307415_100427444 | |||
| 1959 | Ga0307415_100460506 | |||
| 1960 | Ga0307415_100552498 | |||
| 1961 | Ga0307507_10000998 | |||
| 1962 | Ga0307507_10321485 | |||
| 1963 | Ga0316214_1029760 | |||
| 1964 | Ga0373959_0062129 | |||
| 1965 | Ga0373926_0177974 | |||
| 1966 | Ga0373926_0322483 | |||
| 1967 | Ga0373934_0103272 | |||
| 1968 | Ga0373944_0051522 | |||
| 1969 | Ga0373923_0005472 | |||
| 1970 | Ga0373923_0115953 | |||
| 1971 | Ga0373923_0197289 | |||
| 1972 | Ga0373936_0010788 | |||
| 1973 | Ga0373936_0017488 | |||
| 1974 | Ga0373936_0170263 | |||
| 1975 | Ga0373941_0173011 | |||
| 1976 | Ga0373941_0214319 | |||
| 1977 | Ga0373945_0062387 | |||
| 1978 | Ga0373945_0107411 | |||
| 1979 | Ga0373953_0000637 | |||
| 1980 | Ga0373953_0034129 | |||
| 1981 | Ga0373953_0055976 | |||
| 1982 | Ga0373953_0135264 | |||
| 1983 | Ga0373954_0001768 | |||
| 1984 | Ga0373954_0052000 | |||
| 1985 | Ga0373956_0000852 | |||
| 1986 | Ga0373956_0002082 | |||
| 1987 | Ga0373956_0082714 | |||
| 1988 | Ga0373956_0083324 | |||
| 1989 | Ga0373957_0000515 | |||
| 1990 | Ga0373957_0054773 | |||
| 1991 | Ga0373960_0366820 | |||
| 1992 | Ga0373943_0001973 | |||
| 1993 | Ga0373943_0060387 | |||
| 1994 | Ga0373943_0143601 | |||
| 1995 | Ga0373943_0283332 | |||
| 1996 | Ga0373946_0019995 | |||
| 1997 | Ga0373946_0043157 | |||
| 1998 | Ga0373946_0113432 | |||
| 1999 | Ga0373946_0127642 | |||
| 2000 | Ga0373946_0447834 | |||
| 2001 | Ga0373946_0646801 | |||
| 2002 | Ga0373955_0000006 | |||
| 2003 | Ga0373955_0004296 | |||
| 2004 | Ga0373955_0241804 | |||
| 2005 | Ga0373955_0249775 | |||
| 2006 | Ga0373955_0456095 | |||
| 2007 | Ga0373924_0024530 | |||
| 2008 | Ga0373924_0040785 | |||
| 2009 | Ga0373931_0995364 | |||
| 2010 | Ga0373935_0029852 | |||
| 2011 | Ga0373935_0046344 | |||
| 2012 | Ga0373935_0487944 | |||
| 2013 | Ga0373935_0532149 | |||
| 2014 | Ga0373935_0748917 | |||
| 2015 | Ga0373935_0939052 | |||
| 2016 | Ga0373935_1456537 | |||
| 2017 | Ga0373927_0064023 | |||
| 2018 | Ga0373927_0138650 | |||
| 2019 | Ga0373927_0432022 | |||
| 2020 | Ga0373927_0448129 | |||
| 2021 | Ga0373927_0629590 | |||
| 2022 | Ga0373927_0630095 | |||
| 2023 | Ga0373933_0000463 | |||
| 2024 | Ga0373933_0002438 | |||
| 2025 | Ga0373933_0033155 | |||
| 2026 | Ga0373933_0202514 | |||
| 2027 | Ga0373947_0066973 | |||
| 2028 | Ga0373947_0075906 | |||
| 2029 | Ga0373947_0233748 | |||
| 2030 | Ga0373947_0276567 | |||
| 2031 | Ga0373947_1083439 | |||
| 2032 | Ga0373937_0000731 | |||
| 2033 | Ga0373937_0018299 | |||
| 2034 | Ga0373937_0044125 | |||
| 2035 | Ga0373937_0282201 | |||
| 2036 | Ga0373937_0360656 | |||
| 2037 | Ga0373937_1610237 | |||
| 2038 | Ga0373925_0118136 | |||
| 2039 | Ga0373925_0479174 | |||
| 2040 | Ga0373925_0684846 | |||
| 2041 | Ga0373925_0987084 | |||
| 2042 | Ga0395899_0134371 | |||
| 2043 | Ga0395899_0236085 | |||
| 2044 | Ga0395899_0886921 | |||
| 2045 | Ga0395900_0004358 | |||
| 2046 | Ga0395900_0033379 | |||
| 2047 | Ga0395900_0036126 | |||
| 2048 | Ga0395898_0098251 | |||
| 2049 | Ga0395898_0456591 | |||
| 2050 | Ga0395905_0097366 | |||
| 2051 | Ga0395905_0159780 | |||
| 2052 | Ga0395905_0437386 | |||
| 2053 | Ga0395905_0928799 | |||
| 2054 | Ga0436364_0190139 | |||
| 2055 | Ga0436364_0461116 | |||
| 2056 | Ga0436364_0840554 | |||
| 2057 | Ga0436364_0892403 | |||
| 2058 | Ga0436364_1011400 | |||
| 2059 | Ga0395901_0012719 | |||
| 2060 | Ga0395901_0015198 | |||
| 2061 | Ga0395901_0018433 | |||
| 2062 | Ga0395901_0091757 | |||
| 2063 | Ga0395901_0873564 | |||
| 2064 | Ga0242420_149938 | |||
| 2065 | Ga0436365_0337423 | |||
| 2066 | Ga0436365_0500092 | |||
| 2067 | Ga0436365_0585665 | |||
| 2068 | Ga0436360_1089305 | |||
| 2069 | Ga0436361_0702798 | |||
| 2070 | Ga0436363_0424245 | |||
| 2071 | Ga0436363_0564765 | |||
| 2072 | Ga0436363_0695125 | |||
| 2073 | Ga0436363_0955742 | |||
| 2074 | Ga0436362_0337613 | |||
| 2075 | Ga0436362_0894797 | |||
| 2076 | Ga0439439_0058677 | |||
| 2077 | Ga0439448_0017686 | |||
| 2078 | Ga0439448_0060200 | |||
| 2079 | Ga0439448_0162144 | |||
| 2080 | Ga0439449_0010289 | |||
| 2081 | Ga0439449_0042843 | |||
| 2082 | Ga0439450_007552 | |||
| 2083 | Ga0439450_154227 | |||
| 2084 | Ga0439450_168951 | |||
| 2085 | Ga0439455_0057345 | |||
| 2086 | Ga0439463_010240 | |||
| 2087 | Ga0439463_048470 | |||
| 2088 | Ga0450900_022822 | |||
| 2089 | Ga0439434_0248009 | |||
| 2090 | Ga0439464_0047134 | |||
| 2091 | Ga0439460_0019044 | |||
| 2092 | Ga0439460_0127456 | |||
| 2093 | Ga0451577_1708690 | |||
| 2094 | Ga0466969_0016351 | |||
| 2095 | Ga0466969_0028254 | |||
| 2096 | Ga0466969_0061275 | |||
| 2097 | Ga0466972_0016692 | |||
| 2098 | Ga0466972_0152997 | |||
| 2099 | Ga0466966_0953578 | |||
| 2100 | Ga0466961_0005973 | |||
| 2101 | Ga0466961_0132923 | |||
| 2102 | Ga0466963_0030779 | |||
| 2103 | Ga0466963_0113694 | |||
| 2104 | Ga0466963_0615365 | |||
| 2105 | Ga0466963_0859663 | |||
| 2106 | Ga0453684_0283715 | |||
| 2107 | Ga0466971_0077826 | |||
| 2108 | Ga0466971_0187403 | |||
| 2109 | Ga0466971_0261083 | |||
| 2110 | Ga0466968_0019281 | |||
| 2111 | Ga0466968_0032968 | |||
| 2112 | Ga0466970_0007762 | |||
| 2113 | Ga0466970_0387621 | |||
| 2114 | Ga0466957_0619798 | |||
| 2115 | Ga0466957_1300860 | |||
| 2116 | Ga0466957_1396218 | |||
| 2117 | Ga0466960_0045177 | |||
| 2118 | Ga0466960_0129158 | |||
| 2119 | Ga0466960_0438721 | |||
| 2120 | Ga0466959_0033975 | |||
| 2121 | Ga0466959_0051498 | |||
| 2122 | Ga0466959_0286234 | |||
| 2123 | Ga0451576_0007007 | |||
| 2124 | Ga0466958_0018706 | |||
| 2125 | Ga0466958_0040497 | |||
| 2126 | Ga0466958_0056459 | |||
| 2127 | Ga0466958_0215048 | |||
| 2128 | Ga0466967_0002037 | |||
| 2129 | Ga0466967_0126127 | |||
| 2130 | Ga0466967_0198979 | |||
| 2131 | Ga0466967_0205870 | |||
| 2132 | Ga0466967_0586034 | |||
| 2133 | Ga0466967_0733059 | |||
| 2134 | Ga0466967_1233752 | |||
| 2135 | Ga0466967_1751471 | |||
| 2136 | Ga0466967_1848204 | |||
| 2137 | Ga0495592_0000567 | |||
| 2138 | Ga0495592_0233148 | |||
| 2139 | Ga0495592_0506585 | |||
| 2140 | Ga0495603_0011401 | |||
| 2141 | Ga0495603_0080929 | |||
| 2142 | Ga0495603_0173647 | |||
| 2143 | Ga0495603_0215128 | |||
| 2144 | Ga0495590_0072301 | |||
| 2145 | Ga0495629_0010789 | |||
| 2146 | Ga0495629_0016320 | |||
| 2147 | Ga0495629_0064157 | |||
| 2148 | Ga0495629_0137373 | |||
| 2149 | Ga0495638_0137993 | |||
| 2150 | Ga0495641_0003287 | |||
| 2151 | Ga0495641_0020910 | |||
| 2152 | Ga0495641_0200531 | |||
| 2153 | Ga0495641_0210135 | |||
| 2154 | Ga0495641_0484633 | |||
| 2155 | Ga0495651_0000013 | |||
| 2156 | Ga0495651_0036765 | |||
| 2157 | Ga0495651_0041286 | |||
| 2158 | Ga0495651_0260439 | |||
| 2159 | Ga0495651_0296132 | |||
| 2160 | Ga0495651_0426963 | |||
| 2161 | Ga0495653_0006306 | |||
| 2162 | Ga0495653_0025189 | |||
| 2163 | Ga0495653_0027838 | |||
| 2164 | Ga0495653_0120641 | |||
| 2165 | Ga0495580_0089288 | |||
| 2166 | Ga0495580_0266791 | |||
| 2167 | Ga0495582_0038069 | |||
| 2168 | Ga0495582_0089171 | |||
| 2169 | Ga0495582_0104377 | |||
| 2170 | Ga0495582_0611675 | |||
| 2171 | Ga0495605_0080547 | |||
| 2172 | Ga0495639_0032392 | |||
| 2173 | Ga0495639_0292934 | |||
| 2174 | Ga0495639_0391556 | |||
| 2175 | Ga0495662_0000412 | |||
| 2176 | Ga0495662_0063213 | |||
| 2177 | Ga0495662_0065199 | |||
| 2178 | Ga0495662_0139416 | |||
| 2179 | Ga0495662_0323296 | |||
| 2180 | Ga0495664_0000012 | |||
| 2181 | Ga0495664_0029548 | |||
| 2182 | Ga0495664_0131691 | |||
| 2183 | Ga0495664_0304258 | |||
| 2184 | Ga0495664_0366303 | |||
| 2185 | Ga0495664_0441967 | |||
| 2186 | Ga0495664_0824580 | |||
| 2187 | Ga0495664_0859828 | |||
| 2188 | Ga0495585_0071222 | |||
| 2189 | Ga0495594_0003603 | |||
| 2190 | Ga0495594_0060769 | |||
| 2191 | Ga0495594_0256809 | |||
| 2192 | Ga0495594_0260368 | |||
| 2193 | Ga0495594_0418812 | |||
| 2194 | Ga0495607_0153340 | |||
| 2195 | Ga0495608_0000114 | |||
| 2196 | Ga0495608_0003948 | |||
| 2197 | Ga0495608_0021327 | |||
| 2198 | Ga0495608_0216115 | |||
| 2199 | Ga0495608_0317042 | |||
| 2200 | Ga0495608_0405622 | |||
| 2201 | Ga0495618_0017340 | |||
| 2202 | Ga0495618_0025663 | |||
| 2203 | Ga0495618_0053976 | |||
| 2204 | Ga0495618_0404498 | |||
| 2205 | Ga0495620_0065446 | |||
| 2206 | Ga0495628_0003223 | |||
| 2207 | Ga0495628_0230816 | |||
| 2208 | Ga0495628_0259772 | |||
| 2209 | Ga0495628_0287232 | |||
| 2210 | Ga0495628_0338446 | |||
| 2211 | Ga0495630_0033212 | |||
| 2212 | Ga0495630_0041315 | |||
| 2213 | Ga0495630_0053897 | |||
| 2214 | Ga0495630_0084396 | |||
| 2215 | Ga0495630_0106339 | |||
| 2216 | Ga0495630_0652742 | |||
| 2217 | Ga0495630_0722070 | |||
| 2218 | Ga0495630_0933474 | |||
| 2219 | Ga0495631_0308691 | |||
| 2220 | Ga0495666_0037259 | |||
| 2221 | Ga0495666_0485332 | |||
| 2222 | Ga0495652_0000145 | |||
| 2223 | Ga0495652_0021727 | |||
| 2224 | Ga0495652_0071247 | |||
| 2225 | Ga0495652_0116910 | |||
| 2226 | Ga0495652_0197715 | |||
| 2227 | Ga0495652_0303661 | |||
| 2228 | Ga0495652_0305579 | |||
| 2229 | Ga0495652_0343630 | |||
| 2230 | Ga0495665_0004765 | |||
| 2231 | Ga0495665_0015910 | |||
| 2232 | Ga0495665_0020000 | |||
| 2233 | Ga0495665_0455526 | |||
| 2234 | Ga0495640_0010023 | |||
| 2235 | Ga0495640_0027736 | |||
| 2236 | Ga0495640_0030122 | |||
| 2237 | Ga0495640_0375407 | |||
| 2238 | Ga0495586_0154314 | |||
| 2239 | Ga0495586_0168947 | |||
| 2240 | Ga0495587_0000063 | |||
| 2241 | Ga0495587_0060428 | |||
| 2242 | Ga0495587_0096192 | |||
| 2243 | Ga0495587_0499959 | |||
| 2244 | Ga0495645_0281977 | |||
| 2245 | Ga0495645_0617483 | |||
| 2246 | Ga0495645_0777781 | |||
| 2247 | Ga0495667_0000049 | |||
| 2248 | Ga0495667_0006707 | |||
| 2249 | Ga0495667_0006724 | |||
| 2250 | Ga0495667_0062597 | |||
| 2251 | Ga0495667_0213648 | |||
| 2252 | Ga0495667_0351270 | |||
| 2253 | Ga0495668_0598196 | |||
| 2254 | Ga0495634_0024247 | |||
| 2255 | Ga0495634_0057146 | |||
| 2256 | Ga0495634_0061114 | |||
| 2257 | Ga0495634_0143830 | |||
| 2258 | Ga0495634_0596739 | |||
| 2259 | Ga0495611_0044316 | |||
| 2260 | Ga0495611_0127467 | |||
| 2261 | Ga0495625_0068209 | |||
| 2262 | Ga0495635_0075837 | |||
| 2263 | Ga0495635_0462810 | |||
| 2264 | Ga0495635_0604887 | |||
| 2265 | Ga0495635_0717637 | |||
| 2266 | Ga0495661_0372355 | |||
| 2267 | Ga0495588_0004479 | |||
| 2268 | Ga0495588_0070903 | |||
| 2269 | Ga0495657_0000513 | |||
| 2270 | Ga0495657_0046670 | |||
| 2271 | Ga0495657_0202542 | |||
| 2272 | Ga0495657_0645616 | |||
| 2273 | Ga0495599_0003180 | |||
| 2274 | Ga0495599_0004667 | |||
| 2275 | Ga0495599_0026783 | |||
| 2276 | Ga0495599_0103917 | |||
| 2277 | Ga0495599_0166537 | |||
| 2278 | Ga0495599_0666333 | |||
| 2279 | Ga0495599_0742273 | |||
| 2280 | Ga0495623_0000822 | |||
| 2281 | Ga0495623_0028757 | |||
| 2282 | Ga0495623_0065537 | |||
| 2283 | Ga0495646_0007651 | |||
| 2284 | Ga0495646_0034331 | |||
| 2285 | Ga0495646_0038976 | |||
| 2286 | Ga0495646_0530638 | |||
| 2287 | Ga0495647_0025777 | |||
| 2288 | Ga0495647_0093015 | |||
| 2289 | Ga0495647_0196912 | |||
| 2290 | Ga0495658_0046314 | |||
| 2291 | Ga0495658_1045959 | |||
| 2292 | Ga0495613_0014789 | |||
| 2293 | Ga0495613_0029631 | |||
| 2294 | Ga0495624_0007471 | |||
| 2295 | Ga0495624_0023901 | |||
| 2296 | Ga0495624_0068148 | |||
| 2297 | Ga0495624_0104377 | |||
| 2298 | Ga0495670_0558114 | |||
| 2299 | Ga0495671_0615750 | |||
| 2300 | Ga0495589_0008884 | |||
| 2301 | Ga0495589_0056844 | |||
| 2302 | Ga0495600_0008537 | |||
| 2303 | Ga0495600_0011820 | |||
| 2304 | Ga0495600_0035139 | |||
| 2305 | Ga0495600_0112428 | |||
| 2306 | Ga0495660_0527292 | |||
| 2307 | Ga0495581_0028253 | |||
| 2308 | Ga0495581_0029403 | |||
| 2309 | Ga0495581_0124434 | |||
| 2310 | Ga0495604_0000032 | |||
| 2311 | Ga0495604_0008119 | |||
| 2312 | Ga0495604_0074238 | |||
| 2313 | Ga0495636_0236755 | |||
| 2314 | Ga0495674_0009608 | |||
| 2315 | Ga0495674_0023157 | |||
| 2316 | Ga0495674_0045391 | |||
| 2317 | Ga0495674_0083744 | |||
| 2318 | Ga0495674_0489655 | |||
| 2319 | Ga0495674_0596301 | |||
| 2320 | Ga0495674_0659531 | |||
| 2321 | Ga0495674_0662846 | |||
| 2322 | Ga0495674_0799033 | |||
| 2323 | Ga0495674_0993350 | |||
| 2324 | Ga0495676_0021059 | |||
| 2325 | Ga0495676_0055632 | |||
| 2326 | Ga0495676_0112797 | |||
| 2327 | Ga0495676_0120597 | |||
| 2328 | Ga0495676_0166640 | |||
| 2329 | Ga0495676_0243718 | |||
| 2330 | Ga0495676_0964740 | |||
| 2331 | Ga0495680_0000058 | |||
| 2332 | Ga0495680_0010708 | |||
| 2333 | Ga0495680_0015525 | |||
| 2334 | Ga0495680_0086073 | |||
| 2335 | Ga0495683_0064032 | |||
| 2336 | Ga0495675_0022224 | |||
| 2337 | Ga0495675_0034916 | |||
| 2338 | Ga0495675_0655495 | |||
| 2339 | Ga0495685_010867 | |||
| 2340 | Ga0495685_052778 | |||
| 2341 | Ga0495684_0009048 | |||
| 2342 | Ga0495684_0024672 | |||
| 2343 | Ga0495684_0038970 | |||
| 2344 | Ga0495684_0047940 | |||
| 2345 | Ga0495593_0010975 | |||
| 2346 | Ga0495593_0012660 | |||
| 2347 | Ga0495593_0160372 | |||
| 2348 | Ga0495593_0571225 | |||
| 2349 | Ga0495602_0000092 | |||
| 2350 | Ga0495602_0019574 | |||
| 2351 | Ga0495602_0088660 | |||
| 2352 | Ga0495602_0142290 | |||
| 2353 | Ga0495602_0434456 | |||
| 2354 | Ga0495614_0059543 | |||
| 2355 | Ga0496100_0007130 | |||
| 2356 | Ga0496100_0036548 | |||
| 2357 | Ga0496100_0291880 | |||
| 2358 | Ga0496100_0797205 | |||
| 2359 | Ga0496101_0013730 | |||
| 2360 | Ga0496101_0050384 | |||
| 2361 | Ga0496101_0155481 | |||
| 2362 | Ga0496101_0499470 | |||
| 2363 | Ga0496102_0054734 | |||
| 2364 | Ga0496102_0062391 | |||
| 2365 | Ga0496102_0330937 | |||
| 2366 | Ga0496102_0331173 | |||
| 2367 | Ga0496102_0384009 | |||
| 2368 | Ga0496102_0513601 | |||
| 2369 | Ga0496102_1002861 | |||
| 2370 | Ga0496103_0045840 | |||
| 2371 | Ga0496103_0188137 | |||
| 2372 | Ga0496103_0420771 | |||
| 2373 | Ga0496103_0752500 | |||
| 2374 | Ga0496104_0002424 | |||
| 2375 | Ga0496104_0040078 | |||
| 2376 | Ga0496104_0249840 | |||
| 2377 | Ga0496104_0289301 | |||
| 2378 | Ga0496104_1029089 | |||
| 2379 | Ga0496105_0001475 | |||
| 2380 | Ga0496105_0031981 | |||
| 2381 | Ga0496105_0091299 | |||
| 2382 | Ga0496105_0316601 | |||
| 2383 | Ga0496105_0724280 | |||
| 2384 | Ga0496106_0017901 | |||
| 2385 | Ga0496106_0052086 | |||
| 2386 | Ga0496106_0131970 | |||
| 2387 | Ga0496106_0245738 | |||
| 2388 | Ga0496106_0418896 | |||
| 2389 | Ga0496106_0572776 | |||
| 2390 | Ga0496106_0706945 | |||
| 2391 | Ga0496107_0059505 | |||
| 2392 | Ga0496107_0100897 | |||
| 2393 | Ga0496107_0199728 | |||
| 2394 | Ga0496107_0494009 | |||
| 2395 | Ga0496107_1001883 | |||
| 2396 | Ga0496108_0001177 | |||
| 2397 | Ga0496108_0009511 | |||
| 2398 | Ga0496108_0037168 | |||
| 2399 | Ga0496108_0038498 | |||
| 2400 | Ga0496108_0793638 | |||
| 2401 | Ga0496109_0004867 | |||
| 2402 | Ga0496109_0013250 | |||
| 2403 | Ga0496109_0072562 | |||
| 2404 | Ga0496109_0153232 | |||
| 2405 | Ga0496109_0409843 | |||
| 2406 | Ga0496109_1289653 | |||
| 2407 | Ga0496110_0006115 | |||
| 2408 | Ga0496110_0009977 | |||
| 2409 | Ga0496110_0127924 | |||
| 2410 | Ga0496110_0317600 | |||
| 2411 | Ga0496110_0399606 | |||
| 2412 | Ga0496110_0627428 | |||
| 2413 | Ga0496111_0000232 | |||
| 2414 | Ga0496111_0000822 | |||
| 2415 | Ga0496111_0058395 | |||
| 2416 | Ga0496111_0086795 | |||
| 2417 | Ga0496112_0004617 | |||
| 2418 | Ga0496112_0011653 | |||
| 2419 | Ga0496112_0013224 | |||
| 2420 | Ga0496112_0033687 | |||
| 2421 | Ga0496112_0187663 | |||
| 2422 | Ga0496112_0288838 | |||
| 2423 | Ga0496112_0591907 | |||
| 2424 | Ga0496112_0598641 | |||
| 2425 | Ga0496113_0201951 | |||
| 2426 | Ga0496113_0222436 | |||
| 2427 | Ga0496113_0227180 | |||
| 2428 | Ga0496113_0238563 | |||
| 2429 | Ga0496113_0258524 | |||
| 2430 | Ga0496113_0316341 | |||
| 2431 | Ga0496114_0082586 | |||
| 2432 | Ga0496114_0089943 | |||
| 2433 | Ga0496114_0091161 | |||
| 2434 | Ga0496114_0195116 | |||
| 2435 | Ga0496114_0457026 | |||
| 2436 | Ga0496114_0773283 | |||
| 2437 | Ga0496115_0012774 | |||
| 2438 | Ga0496115_0028908 | |||
| 2439 | Ga0496115_0058479 | |||
| 2440 | Ga0496115_0096607 | |||
| 2441 | Ga0496115_0097488 | |||
| 2442 | Ga0496115_0184998 | |||
| 2443 | Ga0496115_0462021 | |||
| 2444 | Ga0496124_0532356 | |||
| 2445 | Ga0501318_069323 | |||
| 2446 | Ga0501325_001578 | |||
| 2447 | Ga0501031_0006057 | |||
| 2448 | Ga0501031_0081161 | |||
| 2449 | Ga0501031_0192541 | |||
| 2450 | Ga0501032_0100332 | |||
| 2451 | Ga0501032_0114195 | |||
| 2452 | Ga0501033_0073905 | |||
| 2453 | Ga0501033_0680412 | |||
| 2454 | Ga0501034_0253266 | |||
| 2455 | Ga0501036_0006555 | |||
| 2456 | Ga0501036_0087545 | |||
| 2457 | Ga0501037_0063646 | |||
| 2458 | Ga0501037_0207334 | |||
| 2459 | Ga0501038_0007267 | |||
| 2460 | Ga0501038_0014230 | |||
| 2461 | Ga0501038_0045311 | |||
| 2462 | Ga0501039_0002266 | |||
| 2463 | Ga0501039_0004656 | |||
| 2464 | Ga0501039_0514390 | |||
| 2465 | Ga0501040_0003042 | |||
| 2466 | Ga0501040_0032287 | |||
| 2467 | Ga0501040_0490511 | |||
| 2468 | Ga0501041_0003506 | |||
| 2469 | Ga0501041_0032563 | |||
| 2470 | Ga0501041_0392584 | |||
| 2471 | Ga0501042_0003569 | |||
| 2472 | Ga0501042_0045152 | |||
| 2473 | Ga0501042_0423655 | |||
| 2474 | Ga0501042_0474088 | |||
| 2475 | Ga0501043_0036451 | |||
| 2476 | Ga0501043_0051841 | |||
| 2477 | Ga0501046_0010059 | |||
| 2478 | Ga0501047_0056335 | |||
| 2479 | Ga0501047_0422722 | |||
| 2480 | Ga0501048_0028960 | |||
| 2481 | Ga0501067_0368080 | |||
| 2482 | Ga0501068_0026818 | |||
| 2483 | Ga0501068_0041690 | |||
| 2484 | Ga0501068_1192936 | |||
| 2485 | Ga0501070_0063350 | |||
| 2486 | Ga0501071_0017552 | |||
| 2487 | Ga0501071_0027990 | |||
| 2488 | Ga0501071_0040754 | |||
| 2489 | Ga0501072_0003521 | |||
| 2490 | Ga0501072_0014231 | |||
| 2491 | Ga0501072_1018477 | |||
| 2492 | Ga0501074_0013682 | |||
| 2493 | Ga0501074_0056565 | |||
| 2494 | Ga0501074_0150904 | |||
| 2495 | Ga0501074_0912091 | |||
| 2496 | Ga0501075_0012399 | |||
| 2497 | Ga0501075_0053711 | |||
| 2498 | Ga0501075_0055735 | |||
| 2499 | Ga0501075_0397659 | |||
| 2500 | Ga0501076_0027106 | |||
| 2501 | Ga0501076_1623392 | |||
| 2502 | Ga0501077_0025271 | |||
| 2503 | Ga0501077_0028563 | |||
| 2504 | Ga0501079_0012788 | |||
| 2505 | Ga0501079_0015118 | |||
| 2506 | Ga0501079_0249812 | |||
| 2507 | Ga0501079_0888742 | |||
| 2508 | Ga0501080_0060623 | |||
| 2509 | Ga0501081_0027986 | |||
| 2510 | Ga0501081_0919559 | |||
| 2511 | Ga0501035_0107289 | |||
| 2512 | Ga0501035_0758699 | |||
| 2513 | Ga0501035_1068057 | |||
| 2514 | Ga0501044_0199299 | |||
| 2515 | Ga0501045_0020534 | |||
| 2516 | Ga0501045_0022552 | |||
| 2517 | Ga0501045_0043673 | |||
| 2518 | nmdc:mga0yw44_1224303_c1 | |||
| 2519 | nmdc:mga05p37_1172238_c1 | |||
| 2520 | nmdc:mga05p37_125784_c1 | |||
| 2521 | nmdc:mga05p37_126049_c1 | |||
| 2522 | nmdc:mga05p37_1594515_c1 | |||
| 2523 | nmdc:mga05p37_225349_c1 | |||
| 2524 | nmdc:mga05p37_230025_c1 | |||
| 2525 | nmdc:mga05p37_338210_c1 | |||
| 2526 | nmdc:mga05p37_678_c1 | |||
| 2527 | nmdc:mga09592_189601_c1 | |||
| 2528 | nmdc:mga09592_3_c1 | |||
| 2529 | nmdc:mga09592_434464_c1 | |||
| 2530 | nmdc:mga09592_43972_c1 | |||
| 2531 | nmdc:mga09592_75154_c1 | |||
| 2532 | nmdc:mga0qj67_11728_c1 | |||
| 2533 | nmdc:mga0qj67_17_c1 | |||
| 2534 | nmdc:mga0qj67_18468_c1 | |||
| 2535 | nmdc:mga0qj67_345628_c1 | |||
| 2536 | nmdc:mga0qj67_349617_c1 | |||
| 2537 | nmdc:mga0qj67_382023_c1 | |||
| 2538 | nmdc:mga06r32_212314_c1 | |||
| 2539 | nmdc:mga06r32_292469_c1 | |||
| 2540 | nmdc:mga06r32_317073_c1 | |||
| 2541 | nmdc:mga06r32_327_c1 | |||
| 2542 | nmdc:mga06r32_9498_c1 | |||
| 2543 | nmdc:mga08y16_1097991_c1 | |||
| 2544 | nmdc:mga08y16_1902230_c1 | |||
| 2545 | nmdc:mga0n895_2041_c1 | |||
| 2546 | nmdc:mga0n895_208934_c1 | |||
| 2547 | nmdc:mga0n895_274305_c1 | |||
| 2548 | nmdc:mga0n895_54619_c1 | |||
| 2549 | nmdc:mga0rr50_12130_c1 | |||
| 2550 | nmdc:mga0rr50_5606_c1 | |||
| 2551 | nmdc:mga0rr50_575406_c1 | |||
| 2552 | nmdc:mga08x19_107013_c1 | |||
| 2553 | nmdc:mga0a205_1212002_c1 | |||
| 2554 | nmdc:mga0a205_322876_c1 | |||
| 2555 | nmdc:mga0a205_377605_c1 | |||
| 2556 | nmdc:mga0a205_540298_c1 | |||
| 2557 | Ga0495601_0001245 | |||
| 2558 | Ga0495601_0008069 | |||
| 2559 | Ga0495601_0094123 | |||
| 2560 | Ga0495601_0121250 | |||
| 2561 | Ga0495601_0282790 | |||
| 2562 | Ga0495601_0709772 | |||
| 2563 | Ga0495612_0010754 | |||
| 2564 | Ga0495612_0050052 | |||
| 2565 | Ga0495612_0068728 | |||
| 2566 | Ga0495612_0084295 | |||
| 2567 | Ga0495612_0110022 | |||
| 2568 | Ga0495612_0159987 | |||
| 2569 | Ga0495612_0283457 | |||
| 2570 | Ga0495595_0016871 | |||
| 2571 | Ga0495595_0038238 | |||
| 2572 | Ga0495595_0103115 | |||
| 2573 | Ga0495595_0456617 | |||
| 2574 | Ga0495619_0035119 | |||
| 2575 | Ga0495619_0103536 | |||
| 2576 | Ga0495619_0734944 | |||
| 2577 | Ga0495619_0847800 | |||
| 2578 | Ga0500600_0016171 | |||
| 2579 | Ga0501084_0005892 | |||
| 2580 | Ga0501084_0059137 | |||
| 2581 | Ga0590074_053387 | |||
| 2582 | Ga0590075_108167 | |||
| 2583 | Ga0590077_140621 | |||
| 2584 | Ga0501082_0073951 | |||
| 2585 | Ga0501082_0188329 | |||
| 2586 | Ga0466962_0060293 | |||
| 2587 | Ga0530510_0004846 | |||
| 2588 | Ga0530510_0333761 | |||
| 2589 | 2816421313 | |||
| 2590 | 2862580808 | |||
| 2591 | 8001783783 | |||
| 2592 | 8001784903 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6s8c-assembly1.cif.gz_B | post-fusion conformation of the envelope protein of tick-borne encephalitis virus with longer stem | 0.8327 | 85 | 107 |
| 6s8c-assembly1.cif.gz_C | post-fusion conformation of the envelope protein of tick-borne encephalitis virus with longer stem | 0.8238 | 85 | 107 |
| 3hdp-assembly1.cif.gz_A | crystal structure of the ni(ii)-bound glyoxalase-i from clostridium acetobutylicum | 0.821 | 9 | 117 |
| 1urz-assembly2.cif.gz_E | low ph induced, membrane fusion conformation of the envelope protein of tick-borne encephalitis virus | 0.8182 | 85 | 107 |
| 1urz-assembly2.cif.gz_D | low ph induced, membrane fusion conformation of the envelope protein of tick-borne encephalitis virus | 0.8145 | 85 | 107 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2kjzB01 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.9122 | 11 | 55 | 3.30.720.120 |
| af_P9WKQ3_98_165_3.30.720.110 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.9065 | 66 | 116 | 3.30.720.110 |
| af_I6XA34_8_128_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8352 | 8 | 117 | 3.10.180.10 |
| 3sk1C01 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8326 | 1 | 54 | 3.30.720.120 |
| af_P15179_25_134_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.821 | 86 | 115 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1C5IRP4-F1-model_v4 | VOC domain-containing protein | 0.9843 | 9 | 118 |
|
| AF-A0A7K2Y5X3-F1-model_v4 | VOC domain-containing protein | 0.9692 | 2 | 118 |
|
| AF-A0A1C5IRP4-F1-model_v4 | VOC domain-containing protein | 0.9668 | 9 | 118 |
|
| AF-A0A318K0Q1-F1-model_v4 | Putative enzyme related to lactoylglutathione lyase | 0.965 | 6 | 116 |
GO:0016829
|
| AF-A0A511N0I7-F1-model_v4 | Glyoxalase | 0.9599 | 7 | 97 |
|