F492665

General Info

Members Datasets Scaffolds Average Seq Length
1294 357 1294 308

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100045527|Ga0070707_1000455273
Length 325
Sequence MSARRAKVSATPESAHRHSRNTVLVMNGDWPDVSYQRWSATCDTLHAHTQVLGKLAATLAPPEPQLQHAALRLSARGWETAPLPTPDGLGSIVAVLDLHEHQTAVEHSGGQVRRIAHTPNRPVADVTRDVLAGQVEINMTPQEVHWKVPLDEDEEHATYDPEQVSDYFAAATQVALALAAFRAPYRGKSTPVNAWWGSFDLAVNLFSGRQANPPSDDFIMRNAMDSQEIAVGWWPGDPRHPEAAFYAYAHPAPDSYAAAKLSPAAAYWDAQIGEYLLRWADVRSAADPHAFALEFARSAFQHGCQVCAWDPGLAASANGTPPPIR

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
102 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
103 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
157 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
158 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
159 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
160 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
161 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
162 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
163 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
164 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
165 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
166 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
167 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
168 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
169 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
170 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
171 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
172 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
173 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
174 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
177 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
178 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
179 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
180 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
182 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
183 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
184 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
185 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
186 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
187 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
188 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
189 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
190 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
191 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
192 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
193 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
194 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
195 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
196 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
197 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
198 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
199 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
202 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
203 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
204 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
205 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
206 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
207 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
208 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
209 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
210 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
211 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
212 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
213 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
214 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
215 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
216 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
217 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
218 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
219 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
220 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
221 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
222 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
223 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
224 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
225 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
226 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
227 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
228 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
229 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
230 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
231 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
232 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
233 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
234 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
235 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
236 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
237 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
238 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
239 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
240 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
241 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
242 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
243 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
244 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
245 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
246 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
247 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
248 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
249 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
250 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
251 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
252 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
253 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
254 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
255 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
256 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
257 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
258 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
259 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
260 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
261 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
262 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
263 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
264 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
265 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
266 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
267 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
268 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
269 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
270 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
271 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
272 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
273 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
274 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
275 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
276 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
277 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
278 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
279 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
280 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
281 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
282 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
283 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
284 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
285 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
286 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
287 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
288 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
289 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
290 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
291 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
292 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
293 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
294 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
295 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
296 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
297 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
298 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
299 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
300 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
301 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
302 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
303 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
304 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
305 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
306 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
307 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
323 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
324 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
325 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
326 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
327 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
328 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
329 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
330 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
331 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
332 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
333 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
334 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
335 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
336 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
339 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
340 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
341 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
342 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
343 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
344 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
345 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
346 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
347 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
348 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
349 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
350 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
351 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
352 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
353 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
354 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
355 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
356 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
357 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0.54
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.39
Nodule 0
Rhizoplane 5.72
Rhizosphere 89.34
Stem 0
Stem Tuber 0
Unclassified 4.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10025727 3300003373 Bacteria 1526
2 Ga0070658_10080642 3300005327 Bacteria 2673
3 Ga0070658_10373830 3300005327 Bacteria 1222
4 Ga0070683_100009946 3300005329 Bacteria 8157
5 Ga0070683_100019594 3300005329 Bacteria 6011
6 Ga0070683_100170219 3300005329 Bacteria 2068
7 Ga0070683_100284168 3300005329 Bacteria 1574
8 Ga0070683_100323683 3300005329 Bacteria 1467
9 Ga0070690_100014049 3300005330 Bacteria 4746
10 Ga0070677_10000002 3300005333 Bacteria 87295
11 Ga0070680_100140757 3300005336 Unclassified 2023
12 Ga0070680_100159976 3300005336 Unclassified 1892
13 Ga0070682_100008022 3300005337 Bacteria 5945
14 Ga0070682_100127257 3300005337 Bacteria 1719
15 Ga0068868_100008367 3300005338 Bacteria 7404
16 Ga0070660_100019468 3300005339 Bacteria 4975
17 Ga0070660_100245268 3300005339 Bacteria 1460
18 Ga0070691_10015127 3300005341 Bacteria 3545
19 Ga0070691_10030432 3300005341 Bacteria 2529
20 Ga0070661_100273522 3300005344 Unclassified 1309
21 Ga0070668_100002605 3300005347 Bacteria 13258
22 Ga0070668_100005448 3300005347 Bacteria 9447
23 Ga0070688_100154568 3300005365 Bacteria 1571
24 Ga0070659_100062719 3300005366 Bacteria 2939
25 Ga0070659_100185818 3300005366 Unclassified 1707
26 Ga0070667_100008391 3300005367 Bacteria 8567
27 Ga0070703_10017905 3300005406 Bacteria 2044
28 Ga0070709_10000154 3300005434 Bacteria 45206
29 Ga0070709_10000593 3300005434 Bacteria 21181
30 Ga0070709_10012165 3300005434 Bacteria 4812
31 Ga0070709_10299269 3300005434 Unclassified 1175
32 Ga0070714_100000805 3300005435 Bacteria 22198
33 Ga0070714_100001506 3300005435 Bacteria 16958
34 Ga0070714_100001889 3300005435 Bacteria 15282
35 Ga0070714_100002037 3300005435 Bacteria 14804
36 Ga0070714_100011882 3300005435 Bacteria 6922
37 Ga0070714_100020983 3300005435 Bacteria 5341
38 Ga0070714_100035528 3300005435 Bacteria 4178
39 Ga0070714_100039533 3300005435 Bacteria 3972
40 Ga0070714_100079262 3300005435 Bacteria 2855
41 Ga0070714_100113296 3300005435 Bacteria 2405
42 Ga0070714_100128022 3300005435 Bacteria 2266
43 Ga0070714_100131479 3300005435 Bacteria 2237
44 Ga0070714_100148367 3300005435 Unclassified 2111
45 Ga0070714_100162162 3300005435 Bacteria 2023
46 Ga0070714_100233104 3300005435 Bacteria 1697
47 Ga0070713_100000392 3300005436 Bacteria 28109
48 Ga0070713_100000999 3300005436 Bacteria 18113
49 Ga0070713_100013259 3300005436 Bacteria 6077
50 Ga0070713_100016183 3300005436 Bacteria 5605
51 Ga0070713_100020277 3300005436 Bacteria 5093
52 Ga0070713_100044544 3300005436 Bacteria 3632
53 Ga0070713_100097384 3300005436 Bacteria 2542
54 Ga0070713_100153985 3300005436 Bacteria 2047
55 Ga0070713_100162128 3300005436 Bacteria 1997
56 Ga0070713_100247090 3300005436 Bacteria 1626
57 Ga0070713_100265511 3300005436 Bacteria 1570
58 Ga0070710_10000240 3300005437 Bacteria 25768
59 Ga0070710_10000321 3300005437 Bacteria 22977
60 Ga0070710_10013466 3300005437 Bacteria 4099
61 Ga0070710_10023790 3300005437 Bacteria 3224
62 Ga0070710_10025172 3300005437 Bacteria 3149
63 Ga0070711_100001255 3300005439 Bacteria 13751
64 Ga0070711_100001547 3300005439 Bacteria 12660
65 Ga0070711_100027302 3300005439 Bacteria 3747
66 Ga0070711_100044736 3300005439 Bacteria 3006
67 Ga0070711_100066246 3300005439 Unclassified 2529
68 Ga0070711_100114389 3300005439 Bacteria 1985
69 Ga0070711_100241494 3300005439 Bacteria 1412
70 Ga0070700_100114025 3300005441 Unclassified 1801
71 Ga0070708_100031333 3300005445 Bacteria 4602
72 Ga0070708_100052103 3300005445 Bacteria 3628
73 Ga0070708_100108488 3300005445 Bacteria 2550
74 Ga0070662_100001262 3300005457 Bacteria 15548
75 Ga0070662_100148488 3300005457 Bacteria 1823
76 Ga0070681_10020178 3300005458 Bacteria 6680
77 Ga0070681_10142135 3300005458 Unclassified 2329
78 Ga0070706_100007391 3300005467 Bacteria 10304
79 Ga0070706_100008272 3300005467 Bacteria 9697
80 Ga0070706_100016226 3300005467 Bacteria 6880
81 Ga0070706_100060280 3300005467 Bacteria 3503
82 Ga0070706_100088650 3300005467 Bacteria 2868
83 Ga0070706_100179073 3300005467 Bacteria 1979
84 Ga0070707_100001431 3300005468 Bacteria 23356
85 Ga0070707_100011200 3300005468 Bacteria 8358
86 Ga0070707_100015444 3300005468 Bacteria 7165
87 Ga0070707_100027375 3300005468 Bacteria 5424
88 Ga0070707_100045527 3300005468 Bacteria 4200
89 Ga0070707_100047975 3300005468 Bacteria 4090
90 Ga0070707_100064100 3300005468 Bacteria 3528
91 Ga0070707_100095333 3300005468 Bacteria 2881
92 Ga0070707_100213682 3300005468 Bacteria 1880
93 Ga0070698_100000006 3300005471 Bacteria 129236
94 Ga0070698_100002067 3300005471 Bacteria 22298
95 Ga0070698_100007492 3300005471 Bacteria 11808
96 Ga0070698_100009579 3300005471 Bacteria 10366
97 Ga0070698_100092561 3300005471 Bacteria 3004
98 Ga0070698_100187511 3300005471 Bacteria 2006
99 Ga0070698_100359051 3300005471 Bacteria 1388
100 Ga0070698_100478893 3300005471 Unclassified 1181
101 Ga0070699_100006926 3300005518 Bacteria 9854
102 Ga0070699_100157296 3300005518 Bacteria 2011
103 Ga0070699_100314617 3300005518 Bacteria 1406
104 Ga0070679_100009834 3300005530 Bacteria 9048
105 Ga0070679_100014593 3300005530 Bacteria 7548
106 Ga0070679_100020228 3300005530 Bacteria 6488
107 Ga0070679_100090331 3300005530 Unclassified 3051
108 Ga0070679_100455976 3300005530 Unclassified 1223
109 Ga0070684_100003262 3300005535 Bacteria 12148
110 Ga0070684_100006020 3300005535 Bacteria 9344
111 Ga0070684_100065746 3300005535 Bacteria 3183
112 Ga0070684_100076330 3300005535 Bacteria 2958
113 Ga0070684_100142820 3300005535 Bacteria 2165
114 Ga0070684_100300400 3300005535 Bacteria 1473
115 Ga0070684_100331365 3300005535 Bacteria 1399
116 Ga0070697_100021095 3300005536 Bacteria 5158
117 Ga0070697_100083476 3300005536 Bacteria 2635
118 Ga0070697_100316139 3300005536 Bacteria 1344
119 Ga0070697_100347969 3300005536 Unclassified 1280
120 Ga0068853_100000104 3300005539 Bacteria 56511
121 Ga0070693_100173708 3300005547 Bacteria 1382
122 Ga0070665_100004357 3300005548 Bacteria 14891
123 Ga0070665_100114629 3300005548 Bacteria 2698
124 Ga0070665_100340356 3300005548 Bacteria 1505
125 Ga0070665_100474255 3300005548 Bacteria 1262
126 Ga0070704_100057930 3300005549 Unclassified 2758
127 Ga0070704_100101414 3300005549 Bacteria 2170
128 Ga0068855_100151233 3300005563 Bacteria 2639
129 Ga0068855_100703468 3300005563 Bacteria 1081
130 Ga0068854_100291297 3300005578 Bacteria 1317
131 Ga0068856_100002922 3300005614 Bacteria 17503
132 Ga0068856_100005060 3300005614 Bacteria 13051
133 Ga0068856_100058409 3300005614 Bacteria 3809
134 Ga0068856_100162151 3300005614 Bacteria 2246
135 Ga0068856_100194169 3300005614 Unclassified 2044
136 Ga0070702_100136470 3300005615 Unclassified 1557
137 Ga0070702_100200495 3300005615 Bacteria 1321
138 Ga0068852_100011961 3300005616 Bacteria 6564
139 Ga0068859_100169217 3300005617 Bacteria 2266
140 Ga0068864_100000066 3300005618 Bacteria 116383
141 Ga0068866_10011303 3300005718 Unclassified 3858
142 Ga0068861_100007297 3300005719 Bacteria 7576
143 Ga0068861_100008118 3300005719 Bacteria 7222
144 Ga0068858_100000066 3300005842 Bacteria 108011
145 Ga0068858_100334562 3300005842 Bacteria 1448
146 Ga0068860_100044784 3300005843 Bacteria 4216
147 Ga0068860_100063123 3300005843 Unclassified 3519
148 Ga0068860_100145498 3300005843 Bacteria 2280
149 Ga0068862_100026493 3300005844 Unclassified 4873
150 Ga0081455_10003044 3300005937 Bacteria 19530
151 Ga0081455_10004209 3300005937 Bacteria 16215
152 Ga0081455_10020845 3300005937 Bacteria 6161
153 Ga0081455_10072665 3300005937 Bacteria 2847
154 Ga0081455_10265088 3300005937 Bacteria 1249
155 Ga0081538_10000099 3300005981 Bacteria 83947
156 Ga0081538_10000404 3300005981 Bacteria 48911
157 Ga0081538_10001126 3300005981 Bacteria 28304
158 Ga0081538_10003701 3300005981 Bacteria 14346
159 Ga0081538_10004796 3300005981 Bacteria 12344
160 Ga0081538_10007557 3300005981 Bacteria 9383
161 Ga0081538_10017444 3300005981 Bacteria 5447
162 Ga0081538_10020277 3300005981 Bacteria 4903
163 Ga0081538_10108040 3300005981 Bacteria 1376
164 Ga0081540_1000548 3300005983 Bacteria 36395
165 Ga0081540_1000993 3300005983 Bacteria 25522
166 Ga0081540_1002417 3300005983 Bacteria 15217
167 Ga0081539_10002438 3300005985 Bacteria 26262
168 Ga0081539_10039115 3300005985 Unclassified 2803
169 Ga0070717_10002723 3300006028 Bacteria 12479
170 Ga0070717_10004745 3300006028 Bacteria 9881
171 Ga0070717_10007556 3300006028 Bacteria 8077
172 Ga0070717_10013669 3300006028 Bacteria 6228
173 Ga0070717_10017901 3300006028 Bacteria 5525
174 Ga0070717_10020149 3300006028 Bacteria 5241
175 Ga0070717_10088586 3300006028 Bacteria 2609
176 Ga0070717_10103358 3300006028 Bacteria 2422
177 Ga0070717_10109893 3300006028 Bacteria 2350
178 Ga0070717_10122923 3300006028 Bacteria 2225
179 Ga0070717_10155064 3300006028 Bacteria 1983
180 Ga0070717_10176487 3300006028 Unclassified 1860
181 Ga0070717_10186288 3300006028 Bacteria 1812
182 Ga0070717_10187921 3300006028 Bacteria 1804
183 Ga0070717_10197580 3300006028 Bacteria 1760
184 Ga0075365_10020729 3300006038 Bacteria 4083
185 Ga0075365_10036705 3300006038 Bacteria 3177
186 Ga0075363_100073093 3300006048 Bacteria 1865
187 Ga0070715_10052173 3300006163 Bacteria 1763
188 Ga0070715_10057692 3300006163 Bacteria 1692
189 Ga0070716_100000575 3300006173 Bacteria 15389
190 Ga0070716_100004451 3300006173 Bacteria 6700
191 Ga0070716_100012464 3300006173 Unclassified 4310
192 Ga0070716_100022864 3300006173 Bacteria 3308
193 Ga0070716_100028401 3300006173 Bacteria 3014
194 Ga0070716_100030576 3300006173 Bacteria 2923
195 Ga0070712_100001283 3300006175 Bacteria 15184
196 Ga0070712_100014248 3300006175 Bacteria 5103
197 Ga0070712_100037727 3300006175 Unclassified 3296
198 Ga0070712_100048434 3300006175 Bacteria 2946
199 Ga0070712_100084128 3300006175 Unclassified 2312
200 Ga0070712_100121360 3300006175 Bacteria 1967
201 Ga0097621_100030329 3300006237 Bacteria 4279
202 Ga0068871_100035193 3300006358 Bacteria 3977
203 Ga0068871_100048325 3300006358 Bacteria 3435
204 Ga0075428_100338948 3300006844 Bacteria 1615
205 Ga0075430_100159583 3300006846 Bacteria 1877
206 Ga0075431_100008958 3300006847 Bacteria 10032
207 Ga0075431_100030042 3300006847 Bacteria 5596
208 Ga0075431_100148413 3300006847 Bacteria 2415
209 Ga0075431_100394912 3300006847 Bacteria 1385
210 Ga0075433_10012815 3300006852 Bacteria 6792
211 Ga0075433_10061311 3300006852 Bacteria 3294
212 Ga0075433_10064345 3300006852 Bacteria 3214
213 Ga0075433_10226024 3300006852 Bacteria 1662
214 Ga0075433_10303939 3300006852 Bacteria 1412
215 Ga0075433_10351470 3300006852 Bacteria 1303
216 Ga0075434_100020758 3300006871 Bacteria 6375
217 Ga0075434_100026235 3300006871 Bacteria 5706
218 Ga0075434_100030084 3300006871 Bacteria 5346
219 Ga0075434_100030378 3300006871 Bacteria 5319
220 Ga0075434_100042602 3300006871 Bacteria 4501
221 Ga0075434_100042829 3300006871 Unclassified 4489
222 Ga0075434_100077868 3300006871 Bacteria 3311
223 Ga0075434_100123537 3300006871 Bacteria 2605
224 Ga0075434_100255168 3300006871 Bacteria 1772
225 Ga0075434_100256619 3300006871 Bacteria 1767
226 Ga0075429_100001873 3300006880 Bacteria 17424
227 Ga0075436_100036061 3300006914 Unclassified 3412
228 Ga0075436_100037602 3300006914 Bacteria 3342
229 Ga0075436_100046379 3300006914 Bacteria 2996
230 Ga0075436_100126038 3300006914 Bacteria 1794
231 Ga0097620_100169218 3300006931 Bacteria 2266
232 Ga0075435_100046796 3300007076 Bacteria 3471
233 Ga0075435_100051545 3300007076 Unclassified 3315
234 Ga0075435_100063537 3300007076 Bacteria 2998
235 Ga0075435_100150167 3300007076 Bacteria 1958
236 Ga0075435_100184663 3300007076 Bacteria 1763
237 Ga0099794_10030871 3300007265 Bacteria 2505
238 Ga0105240_10035422 3300009093 Bacteria 6432
239 Ga0105240_10045752 3300009093 Bacteria 5550
240 Ga0111539_10023017 3300009094 Bacteria 7651
241 Ga0111539_10036014 3300009094 Bacteria 5987
242 Ga0111539_10421933 3300009094 Bacteria 1554
243 Ga0105245_10000040 3300009098 Bacteria 144005
244 Ga0105245_10000587 3300009098 Bacteria 32974
245 Ga0105245_10386937 3300009098 Unclassified 1394
246 Ga0105247_10001420 3300009101 Bacteria 17388
247 Ga0105247_10187099 3300009101 Bacteria 1384
248 Ga0114129_10001880 3300009147 Bacteria 28626
249 Ga0114129_10003282 3300009147 Bacteria 22706
250 Ga0114129_10004818 3300009147 Bacteria 19072
251 Ga0114129_10028976 3300009147 Bacteria 7843
252 Ga0114129_10049241 3300009147 Bacteria 5921
253 Ga0114129_10091153 3300009147 Bacteria 4224
254 Ga0114129_10141971 3300009147 Bacteria 3291
255 Ga0114129_10247933 3300009147 Bacteria 2392
256 Ga0105243_10289053 3300009148 Bacteria 1480
257 Ga0105243_10311747 3300009148 Bacteria 1430
258 Ga0105241_10013332 3300009174 Bacteria 6025
259 Ga0105241_10213003 3300009174 Bacteria 1620
260 Ga0105242_10002895 3300009176 Bacteria 13427
261 Ga0105242_10020599 3300009176 Bacteria 5172
262 Ga0105248_10206760 3300009177 Bacteria 2212
263 Ga0105248_10645625 3300009177 Unclassified 1194
264 Ga0105237_10063631 3300009545 Unclassified 3687
265 Ga0105238_10025337 3300009551 Bacteria 6046
266 Ga0105249_10000150 3300009553 Bacteria 88154
267 Ga0105249_10003847 3300009553 Bacteria 12957
268 Ga0105249_10007305 3300009553 Bacteria 9635
269 Ga0105249_10063664 3300009553 Bacteria 3389
270 Ga0105239_10032510 3300010375 Bacteria 5732
271 Ga0105239_10275388 3300010375 Unclassified 1893
272 Ga0105246_10025807 3300011119 Bacteria 3831
273 Ga0157370_10016303 3300013104 Bacteria 7528
274 Ga0157370_10017689 3300013104 Bacteria 7186
275 Ga0157370_10057944 3300013104 Bacteria 3682
276 Ga0157369_10020773 3300013105 Bacteria 7338
277 Ga0157369_10028131 3300013105 Bacteria 6223
278 Ga0157369_10047889 3300013105 Bacteria 4640
279 Ga0157369_10076080 3300013105 Bacteria 3598
280 Ga0157378_10030670 3300013297 Bacteria 4749
281 Ga0157378_10399980 3300013297 Bacteria 1353
282 Ga0157378_10594494 3300013297 Bacteria 1117
283 Ga0163162_10220245 3300013306 Unclassified 2028
284 Ga0163162_10774183 3300013306 Bacteria 1078
285 Ga0157372_10058760 3300013307 Bacteria 4300
286 Ga0157375_10180934 3300013308 Bacteria 2259
287 Ga0163163_10044741 3300014325 Bacteria 4344
288 Ga0163163_10096748 3300014325 Bacteria 2973
289 Ga0163163_10119141 3300014325 Unclassified 2673
290 Ga0163163_10355389 3300014325 Bacteria 1521
291 Ga0157380_10002140 3300014326 Bacteria 13254
292 Ga0157377_10079100 3300014745 Bacteria 1918
293 Ga0157379_10020093 3300014968 Bacteria 5902
294 Ga0157379_10022110 3300014968 Bacteria 5637
295 Ga0157379_10022130 3300014968 Bacteria 5635
296 Ga0157379_10044390 3300014968 Bacteria 3968
297 Ga0157379_10052776 3300014968 Bacteria 3631
298 Ga0157379_10331805 3300014968 Bacteria 1390
299 Ga0157376_10419948 3300014969 Bacteria 1298
300 Ga0163161_10000027 3300017792 Bacteria 197774
301 Ga0163161_10015637 3300017792 Bacteria 5294
302 Ga0206356_10946904 3300020070 Bacteria 1643
303 Ga0206349_1881519 3300020075 Bacteria 1306
304 Ga0206354_11671430 3300020081 Unclassified 1424
305 Ga0206353_10010222 3300020082 Unclassified 1271
306 Ga0206353_10459755 3300020082 Unclassified 2006
307 Ga0206353_10616013 3300020082 Bacteria 11959
308 Ga0206353_10980143 3300020082 Bacteria 1388
309 Ga0213874_10048410 3300021377 Bacteria 1296
310 Ga0213876_10003021 3300021384 Bacteria 9734
311 Ga0213876_10004167 3300021384 Bacteria 8111
312 Ga0213876_10035158 3300021384 Bacteria 2643
313 Ga0213876_10045418 3300021384 Bacteria 2323
314 Ga0213876_10219611 3300021384 Bacteria 1010
315 Ga0213875_10000303 3300021388 Bacteria 47142
316 Ga0213875_10001409 3300021388 Bacteria 15649
317 Ga0213875_10003306 3300021388 Bacteria 9219
318 Ga0213875_10012957 3300021388 Bacteria 4105
319 Ga0213875_10121861 3300021388 Bacteria 1219
320 Ga0207682_10000012 3300025893 Bacteria 84521
321 Ga0207692_10000889 3300025898 Bacteria 10801
322 Ga0207692_10001855 3300025898 Bacteria 8035
323 Ga0207692_10005663 3300025898 Bacteria 5015
324 Ga0207692_10015835 3300025898 Bacteria 3327
325 Ga0207692_10054161 3300025898 Bacteria 2047
326 Ga0207692_10059916 3300025898 Bacteria 1967
327 Ga0207692_10062729 3300025898 Bacteria 1930
328 Ga0207692_10161998 3300025898 Bacteria 1290
329 Ga0207642_10090020 3300025899 Bacteria 1513
330 Ga0207710_10000774 3300025900 Bacteria 17403
331 Ga0207688_10003585 3300025901 Bacteria 8475
332 Ga0207688_10225813 3300025901 Bacteria 1129
333 Ga0207647_10109471 3300025904 Bacteria 1634
334 Ga0207685_10044020 3300025905 Bacteria 1685
335 Ga0207685_10061337 3300025905 Bacteria 1491
336 Ga0207699_10000205 3300025906 Bacteria 35487
337 Ga0207699_10000387 3300025906 Bacteria 23083
338 Ga0207699_10018781 3300025906 Bacteria 3671
339 Ga0207699_10023351 3300025906 Bacteria 3365
340 Ga0207699_10055288 3300025906 Bacteria 2361
341 Ga0207699_10060730 3300025906 Bacteria 2271
342 Ga0207705_10066673 3300025909 Bacteria 2604
343 Ga0207705_10067680 3300025909 Bacteria 2585
344 Ga0207705_10304566 3300025909 Bacteria 1223
345 Ga0207684_10006796 3300025910 Bacteria 10371
346 Ga0207684_10018145 3300025910 Bacteria 6029
347 Ga0207684_10039399 3300025910 Bacteria 4008
348 Ga0207684_10198573 3300025910 Unclassified 1730
349 Ga0207684_10331309 3300025910 Bacteria 1311
350 Ga0207654_10094907 3300025911 Bacteria 1826
351 Ga0207671_10308266 3300025914 Bacteria 1251
352 Ga0207693_10000355 3300025915 Bacteria 42002
353 Ga0207693_10002883 3300025915 Bacteria 14878
354 Ga0207693_10003116 3300025915 Bacteria 14272
355 Ga0207693_10005416 3300025915 Bacteria 10657
356 Ga0207693_10012713 3300025915 Bacteria 6799
357 Ga0207693_10012719 3300025915 Bacteria 6797
358 Ga0207693_10013787 3300025915 Bacteria 6507
359 Ga0207693_10018936 3300025915 Bacteria 5480
360 Ga0207663_10002482 3300025916 Bacteria 8881
361 Ga0207663_10010862 3300025916 Bacteria 4864
362 Ga0207663_10011138 3300025916 Bacteria 4817
363 Ga0207663_10019008 3300025916 Bacteria 3862
364 Ga0207663_10020747 3300025916 Bacteria 3727
365 Ga0207663_10028222 3300025916 Bacteria 3282
366 Ga0207663_10035145 3300025916 Bacteria 3003
367 Ga0207663_10035744 3300025916 Bacteria 2983
368 Ga0207663_10072021 3300025916 Bacteria 2232
369 Ga0207663_10166059 3300025916 Bacteria 1563
370 Ga0207663_10193904 3300025916 Bacteria 1461
371 Ga0207660_10041529 3300025917 Bacteria 3223
372 Ga0207660_10423076 3300025917 Bacteria 1075
373 Ga0207662_10025515 3300025918 Unclassified 3404
374 Ga0207652_10007942 3300025921 Bacteria 8516
375 Ga0207652_10063069 3300025921 Bacteria 3204
376 Ga0207652_10378918 3300025921 Unclassified 1277
377 Ga0207646_10000049 3300025922 Bacteria 171680
378 Ga0207646_10001194 3300025922 Bacteria 32687
379 Ga0207646_10018441 3300025922 Bacteria 6509
380 Ga0207646_10021426 3300025922 Bacteria 5972
381 Ga0207646_10023460 3300025922 Bacteria 5667
382 Ga0207646_10172805 3300025922 Bacteria 1951
383 Ga0207646_10178091 3300025922 Bacteria 1920
384 Ga0207646_10230838 3300025922 Unclassified 1672
385 Ga0207646_10331994 3300025922 Bacteria 1374
386 Ga0207687_10000075 3300025927 Bacteria 71856
387 Ga0207687_10000142 3300025927 Bacteria 47994
388 Ga0207700_10000171 3300025928 Bacteria 38786
389 Ga0207700_10000420 3300025928 Bacteria 24955
390 Ga0207700_10002479 3300025928 Bacteria 10596
391 Ga0207700_10004060 3300025928 Bacteria 8578
392 Ga0207700_10015476 3300025928 Bacteria 5033
393 Ga0207700_10016530 3300025928 Bacteria 4905
394 Ga0207700_10027423 3300025928 Bacteria 3988
395 Ga0207700_10049847 3300025928 Bacteria 3117
396 Ga0207700_10209171 3300025928 Bacteria 1648
397 Ga0207700_10218064 3300025928 Bacteria 1616
398 Ga0207700_10251548 3300025928 Bacteria 1510
399 Ga0207700_10275358 3300025928 Bacteria 1446
400 Ga0207700_10295257 3300025928 Bacteria 1398
401 Ga0207664_10000190 3300025929 Bacteria 46168
402 Ga0207664_10000345 3300025929 Bacteria 34233
403 Ga0207664_10001768 3300025929 Bacteria 14241
404 Ga0207664_10005031 3300025929 Bacteria 8995
405 Ga0207664_10006681 3300025929 Bacteria 7957
406 Ga0207664_10033765 3300025929 Bacteria 3935
407 Ga0207664_10054100 3300025929 Bacteria 3180
408 Ga0207664_10055171 3300025929 Bacteria 3152
409 Ga0207664_10064330 3300025929 Bacteria 2933
410 Ga0207664_10073446 3300025929 Bacteria 2760
411 Ga0207664_10126525 3300025929 Bacteria 2146
412 Ga0207664_10171524 3300025929 Bacteria 1857
413 Ga0207664_10212255 3300025929 Bacteria 1675
414 Ga0207664_10251568 3300025929 Bacteria 1542
415 Ga0207690_10004837 3300025932 Bacteria 7949
416 Ga0207690_10072669 3300025932 Unclassified 2376
417 Ga0207706_10001340 3300025933 Bacteria 24589
418 Ga0207706_10084154 3300025933 Bacteria 2796
419 Ga0207686_10000544 3300025934 Bacteria 24398
420 Ga0207686_10007653 3300025934 Bacteria 5821
421 Ga0207709_10035348 3300025935 Bacteria 2953
422 Ga0207709_10145228 3300025935 Bacteria 1636
423 Ga0207665_10003456 3300025939 Bacteria 10554
424 Ga0207665_10004389 3300025939 Bacteria 9371
425 Ga0207665_10006851 3300025939 Bacteria 7543
426 Ga0207665_10007018 3300025939 Bacteria 7459
427 Ga0207665_10050407 3300025939 Bacteria 2799
428 Ga0207711_10195683 3300025941 Bacteria 1843
429 Ga0207711_10337835 3300025941 Bacteria 1394
430 Ga0207689_10004300 3300025942 Bacteria 12966
431 Ga0207661_10000883 3300025944 Bacteria 19704
432 Ga0207661_10035139 3300025944 Bacteria 3903
433 Ga0207661_10060133 3300025944 Bacteria 3064
434 Ga0207661_10063053 3300025944 Bacteria 3001
435 Ga0207661_10128530 3300025944 Bacteria 2167
436 Ga0207661_10196366 3300025944 Bacteria 1772
437 Ga0207679_10159659 3300025945 Bacteria 1844
438 Ga0207667_10131027 3300025949 Bacteria 2583
439 Ga0207667_10312608 3300025949 Bacteria 1605
440 Ga0207651_10007137 3300025960 Bacteria 5935
441 Ga0207712_10000027 3300025961 Bacteria 263739
442 Ga0207712_10095362 3300025961 Unclassified 2200
443 Ga0207668_10267826 3300025972 Bacteria 1395
444 Ga0207640_10007936 3300025981 Bacteria 5859
445 Ga0207658_10000985 3300025986 Bacteria 23486
446 Ga0207658_10048955 3300025986 Bacteria 3102
447 Ga0207703_10000053 3300026035 Bacteria 143924
448 Ga0207703_10000054 3300026035 Bacteria 143734
449 Ga0207639_10000644 3300026041 Bacteria 24030
450 Ga0207639_10061912 3300026041 Bacteria 2892
451 Ga0207678_10015803 3300026067 Bacteria 6636
452 Ga0207708_10066034 3300026075 Bacteria 2766
453 Ga0207702_10004647 3300026078 Bacteria 12138
454 Ga0207702_10005043 3300026078 Bacteria 11600
455 Ga0207702_10008856 3300026078 Bacteria 8482
456 Ga0207702_10286944 3300026078 Unclassified 1558
457 Ga0207702_10380157 3300026078 Bacteria 1358
458 Ga0207648_10000872 3300026089 Bacteria 33984
459 Ga0207676_10000038 3300026095 Bacteria 171492
460 Ga0207676_10063085 3300026095 Bacteria 2942
461 Ga0207676_10248977 3300026095 Bacteria 1598
462 Ga0207674_10188255 3300026116 Bacteria 2014
463 Ga0207675_100001652 3300026118 Bacteria 22310
464 Ga0207675_100101425 3300026118 Unclassified 2712
465 Ga0207683_10004405 3300026121 Bacteria 12175
466 Ga0207683_10019744 3300026121 Bacteria 5757
467 Ga0207698_10092654 3300026142 Bacteria 2478
468 Ga0209588_1052850 3300027671 Bacteria 1314
469 Ga0207428_10057671 3300027907 Bacteria 3083
470 Ga0268266_10000099 3300028379 Bacteria 182294
471 Ga0268266_10000264 3300028379 Bacteria 88067
472 Ga0268266_10005669 3300028379 Bacteria 11581
473 Ga0268266_10045560 3300028379 Bacteria 3752
474 Ga0268266_10174315 3300028379 Bacteria 1954
475 Ga0268266_10281180 3300028379 Bacteria 1547
476 Ga0268265_10197906 3300028380 Bacteria 1740
477 Ga0268265_10292987 3300028380 Bacteria 1462
478 Ga0268264_10010773 3300028381 Bacteria 7553
479 Ga0265337_1007111 3300028556 Bacteria 4227
480 Ga0265326_10000554 3300028558 Bacteria 13960
481 Ga0265319_1000035 3300028563 Bacteria 117269
482 Ga0265319_1000191 3300028563 Bacteria 46600
483 Ga0265318_10003090 3300028577 Bacteria 8553
484 Ga0265318_10045898 3300028577 Bacteria 1651
485 Ga0265322_10004388 3300028654 Bacteria 4204
486 Ga0265336_10000005 3300028666 Bacteria 399349
487 Ga0265336_10020783 3300028666 Bacteria 2103
488 Ga0265338_10000001 3300028800 Bacteria 1177449
489 Ga0265338_10000171 3300028800 Bacteria 120054
490 Ga0265338_10208084 3300028800 Bacteria 1470
491 Ga0265324_10003754 3300029957 Bacteria 7099
492 Ga0265324_10025923 3300029957 Bacteria 2076
493 Ga0265325_10009289 3300031241 Bacteria 5748
494 Ga0265340_10000001 3300031247 Bacteria 1647668
495 Ga0265339_10009468 3300031249 Bacteria 6126
496 Ga0265327_10003224 3300031251 Bacteria 15871
497 Ga0265327_10003237 3300031251 Bacteria 15820
498 Ga0265327_10040769 3300031251 Bacteria 2508
499 Ga0265327_10053767 3300031251 Bacteria 2088
500 Ga0265316_10027474 3300031344 Bacteria 4711
501 Ga0265342_10089564 3300031712 Bacteria 1766
502 Ga0307413_10028983 3300031824 Bacteria 3091
503 Ga0307410_10283147 3300031852 Bacteria 1302
504 Ga0307406_10023547 3300031901 Bacteria 3665
505 Ga0307407_10102814 3300031903 Bacteria 1777
506 Ga0307409_100004099 3300031995 Bacteria 8111
507 Ga0307409_100524617 3300031995 Bacteria 1158
508 Ga0307416_100011231 3300032002 Bacteria 5956
509 Ga0307416_100028753 3300032002 Bacteria 4140
510 Ga0307414_10253168 3300032004 Bacteria 1465
511 Ga0307415_100278853 3300032126 Bacteria 1373
512 Ga0373934_0000367 3300035086 Bacteria 15754
513 Ga0373934_0005781 3300035086 Bacteria 4582
514 Ga0373934_0019439 3300035086 Bacteria 2607
515 Ga0373934_0058983 3300035086 Bacteria 1527
516 Ga0373934_0061345 3300035086 Unclassified 1498
517 Ga0373952_0011597 3300035092 Bacteria 1722
518 Ga0373923_0033764 3300035111 Bacteria 2073
519 Ga0373923_0085243 3300035111 Bacteria 1375
520 Ga0373932_0021183 3300035112 Bacteria 1714
521 Ga0373936_0014198 3300035113 Bacteria 3042
522 Ga0373936_0021873 3300035113 Unclassified 2489
523 Ga0373939_0008979 3300035114 Unclassified 2465
524 Ga0373945_0016069 3300035116 Bacteria 2521
525 Ga0373945_0055410 3300035116 Bacteria 1468
526 Ga0373953_0000284 3300035117 Bacteria 13935
527 Ga0373953_0002884 3300035117 Bacteria 5251
528 Ga0373953_0006023 3300035117 Bacteria 3972
529 Ga0373953_0038103 3300035117 Bacteria 1900
530 Ga0373953_0040961 3300035117 Unclassified 1842
531 Ga0373954_0002438 3300035118 Bacteria 7794
532 Ga0373954_0021640 3300035118 Bacteria 2912
533 Ga0373956_0000460 3300035119 Bacteria 16668
534 Ga0373956_0018799 3300035119 Bacteria 2928
535 Ga0373956_0045754 3300035119 Bacteria 1953
536 Ga0373956_0060502 3300035119 Bacteria 1715
537 Ga0373956_0071832 3300035119 Bacteria 1580
538 Ga0373956_0072460 3300035119 Bacteria 1573
539 Ga0373957_0000097 3300035120 Bacteria 20909
540 Ga0373957_0006738 3300035120 Bacteria 3636
541 Ga0373957_0054182 3300035120 Bacteria 1540
542 Ga0373957_0108744 3300035120 Bacteria 1115
543 Ga0373960_0010129 3300035121 Unclassified 2297
544 Ga0373943_0007393 3300035170 Bacteria 4933
545 Ga0373943_0081634 3300035170 Bacteria 1659
546 Ga0373943_0139223 3300035170 Bacteria 1306
547 Ga0373946_0018937 3300035171 Bacteria 2647
548 Ga0373946_0038353 3300035171 Bacteria 1951
549 Ga0373946_0066643 3300035171 Bacteria 1544
550 Ga0373955_0000658 3300035172 Bacteria 14679
551 Ga0373955_0028674 3300035172 Bacteria 2888
552 Ga0373955_0052535 3300035172 Bacteria 2223
553 Ga0373955_0060627 3300035172 Bacteria 2087
554 Ga0373955_0068305 3300035172 Bacteria 1980
555 Ga0373955_0069812 3300035172 Bacteria 1961
556 Ga0373955_0156566 3300035172 Bacteria 1342
557 Ga0373955_0219859 3300035172 Bacteria 1134
558 Ga0373924_0000206 3300035410 Bacteria 17894
559 Ga0373924_0058796 3300035410 Unclassified 1605
560 Ga0373931_0003652 3300035691 Bacteria 6954
561 Ga0373935_0001773 3300035692 Bacteria 12138
562 Ga0373935_0007414 3300035692 Bacteria 6565
563 Ga0373935_0022017 3300035692 Bacteria 3903
564 Ga0373935_0036195 3300035692 Bacteria 3085
565 Ga0373935_0077093 3300035692 Unclassified 2160
566 Ga0373935_0227704 3300035692 Bacteria 1297
567 Ga0373935_0288323 3300035692 Bacteria 1157
568 Ga0373927_0039584 3300035695 Bacteria 3060
569 Ga0373927_0055680 3300035695 Bacteria 2557
570 Ga0373933_0000050 3300035724 Bacteria 72501
571 Ga0373933_0001483 3300035724 Bacteria 13739
572 Ga0373933_0009346 3300035724 Bacteria 5355
573 Ga0373933_0010120 3300035724 Bacteria 5162
574 Ga0373933_0021920 3300035724 Unclassified 3633
575 Ga0373933_0025573 3300035724 Bacteria 3386
576 Ga0373933_0037081 3300035724 Unclassified 2858
577 Ga0373933_0082857 3300035724 Unclassified 1969
578 Ga0373933_0123519 3300035724 Bacteria 1623
579 Ga0373933_0187743 3300035724 Bacteria 1320
580 Ga0373947_0000780 3300035725 Bacteria 19144
581 Ga0373947_0020821 3300035725 Bacteria 3790
582 Ga0373947_0082956 3300035725 Bacteria 1987
583 Ga0373947_0113764 3300035725 Bacteria 1713
584 Ga0373937_0001377 3300036401 Bacteria 20333
585 Ga0373937_0002185 3300036401 Bacteria 16364
586 Ga0373937_0011544 3300036401 Bacteria 7754
587 Ga0373937_0011647 3300036401 Bacteria 7720
588 Ga0373937_0021560 3300036401 Bacteria 5781
589 Ga0373937_0021809 3300036401 Bacteria 5750
590 Ga0373937_0034372 3300036401 Unclassified 4611
591 Ga0373937_0134046 3300036401 Bacteria 2315
592 Ga0373937_0156865 3300036401 Bacteria 2133
593 Ga0373937_0179778 3300036401 Bacteria 1986
594 Ga0373925_0000070 3300037068 Bacteria 107528
595 Ga0373925_0000924 3300037068 Bacteria 26761
596 Ga0373925_0007357 3300037068 Bacteria 8033
597 Ga0373925_0028305 3300037068 Bacteria 4105
598 Ga0373925_0045468 3300037068 Bacteria 3262
599 Ga0373925_0196836 3300037068 Bacteria 1601
600 Ga0373925_0207590 3300037068 Bacteria 1560
601 Ga0373925_0345402 3300037068 Bacteria 1207
602 Ga0395899_0207919 3300037312 Bacteria 1361
603 Ga0395900_0015425 3300037418 Bacteria 7789
604 Ga0395900_0092034 3300037418 Bacteria 3115
605 Ga0395900_0116821 3300037418 Bacteria 2738
606 Ga0395900_0203658 3300037418 Bacteria 2001
607 Ga0395900_0253578 3300037418 Bacteria 1760
608 Ga0395898_0006087 3300037466 Bacteria 12945
609 Ga0395898_0018695 3300037466 Bacteria 7065
610 Ga0395898_0019149 3300037466 Bacteria 6969
611 Ga0395898_0142576 3300037466 Bacteria 2294
612 Ga0395898_0197363 3300037466 Bacteria 1922
613 Ga0395905_0026912 3300037471 Bacteria 5424
614 Ga0436364_0238171 3300037853 Bacteria 31452
615 Ga0436364_0267098 3300037853 Bacteria 21902
616 Ga0436364_0330965 3300037853 Bacteria 247749
617 Ga0436364_0352032 3300037853 Bacteria 14134
618 Ga0436364_0504315 3300037853 Bacteria 2804
619 Ga0436364_0524591 3300037853 Bacteria 3938
620 Ga0436364_0572747 3300037853 Bacteria 1212
621 Ga0436364_0634583 3300037853 Bacteria 1843
622 Ga0436364_0670286 3300037853 Bacteria 7454
623 Ga0436364_0722882 3300037853 Bacteria 28813
624 Ga0436364_0786424 3300037853 Bacteria 4509
625 Ga0436364_0999677 3300037853 Bacteria 8975
626 Ga0436364_1138532 3300037853 Bacteria 3231
627 Ga0436364_1143930 3300037853 Bacteria 1633
628 Ga0436364_1290118 3300037853 Bacteria 6797
629 Ga0436364_1297801 3300037853 Bacteria 1411
630 Ga0436364_1371035 3300037853 Bacteria 3677
631 Ga0395901_0002310 3300038443 Bacteria 19439
632 Ga0395901_0003924 3300038443 Bacteria 14959
633 Ga0395901_0014047 3300038443 Bacteria 8151
634 Ga0395901_0048772 3300038443 Bacteria 4398
635 Ga0395901_0064427 3300038443 Bacteria 3815
636 Ga0395901_0197366 3300038443 Bacteria 2110
637 Ga0395901_0208522 3300038443 Bacteria 2046
638 Ga0436365_0184504 3300039437 Bacteria 1281
639 Ga0436365_0284717 3300039437 Bacteria 5072
640 Ga0436365_0338012 3300039437 Bacteria 4133
641 Ga0436365_0404127 3300039437 Bacteria 2641
642 Ga0436365_0934209 3300039437 Bacteria 4326
643 Ga0436365_1023867 3300039437 Bacteria 6071
644 Ga0436365_1038045 3300039437 Bacteria 1859
645 Ga0436365_1683969 3300039437 Bacteria 16466
646 Ga0436365_1776465 3300039437 Bacteria 8527
647 Ga0436365_1866545 3300039437 Bacteria 18889
648 Ga0436365_1887834 3300039437 Bacteria 4633
649 Ga0436365_1925555 3300039437 Bacteria 5077
650 Ga0436360_0972853 3300039438 Bacteria 1780
651 Ga0436360_1033781 3300039438 Unclassified 1055
652 Ga0436361_0208010 3300039447 Unclassified 1559
653 Ga0436363_0169393 3300039450 Bacteria 44740
654 Ga0436363_0305819 3300039450 Bacteria 9755
655 Ga0436363_0717526 3300039450 Bacteria 8358
656 Ga0436363_1626173 3300039450 Bacteria 1591
657 Ga0436362_0068564 3300039453 Unclassified 2107
658 Ga0436362_0179366 3300039453 Bacteria 3461
659 Ga0436362_0943130 3300039453 Bacteria 5121
660 Ga0451853_1682050 3300041512 Bacteria 3226
661 Ga0439448_0065792 3300042005 Bacteria 1203
662 Ga0439455_0032242 3300042012 Bacteria 1309
663 Ga0466969_0142216 3300044656 Bacteria 1108
664 Ga0466965_0006363 3300044683 Bacteria 5355
665 Ga0466965_0048550 3300044683 Bacteria 2103
666 Ga0466965_0153670 3300044683 Bacteria 1204
667 Ga0466966_0071821 3300044684 Bacteria 2168
668 Ga0466966_0101952 3300044684 Bacteria 1775
669 Ga0466961_0030272 3300044693 Bacteria 3479
670 Ga0466961_0167162 3300044693 Bacteria 1369
671 Ga0466963_0000011 3300044694 Bacteria 65918
672 Ga0466963_0001291 3300044694 Bacteria 13294
673 Ga0466963_0001716 3300044694 Bacteria 11923
674 Ga0466963_0001804 3300044694 Bacteria 11656
675 Ga0466963_0032858 3300044694 Bacteria 3364
676 Ga0466964_0001347 3300044706 Bacteria 8385
677 Ga0466964_0015289 3300044706 Bacteria 2921
678 Ga0466971_0021326 3300044719 Bacteria 2884
679 Ga0466971_0070930 3300044719 Bacteria 1582
680 Ga0466968_0012178 3300044735 Bacteria 3360
681 Ga0466968_0033068 3300044735 Bacteria 2154
682 Ga0466968_0049837 3300044735 Bacteria 1785
683 Ga0466968_0127695 3300044735 Bacteria 1155
684 Ga0466970_0073719 3300044765 Bacteria 1837
685 Ga0466957_0003643 3300044842 Bacteria 8496
686 Ga0466960_0085110 3300044901 Bacteria 1601
687 Ga0466960_0108551 3300044901 Bacteria 1439
688 Ga0466959_0002338 3300045049 Bacteria 12107
689 Ga0466959_0014392 3300045049 Bacteria 5746
690 Ga0466959_0023232 3300045049 Bacteria 4588
691 Ga0466959_0048531 3300045049 Bacteria 3120
692 Ga0466959_0107211 3300045049 Bacteria 1997
693 Ga0466958_0007146 3300045836 Bacteria 6120
694 Ga0466958_0010554 3300045836 Bacteria 5178
695 Ga0466958_0037312 3300045836 Bacteria 2912
696 Ga0466958_0073161 3300045836 Bacteria 2099
697 Ga0466958_0102327 3300045836 Bacteria 1782
698 Ga0466958_0144582 3300045836 Bacteria 1498
699 Ga0466958_0149922 3300045836 Bacteria 1471
700 Ga0466967_0000130 3300045976 Bacteria 28758
701 Ga0466967_0006794 3300045976 Bacteria 8155
702 Ga0466967_0007002 3300045976 Bacteria 8071
703 Ga0466967_0020794 3300045976 Bacteria 5315
704 Ga0466967_0021730 3300045976 Bacteria 5220
705 Ga0466967_0062093 3300045976 Bacteria 3316
706 Ga0466967_0196345 3300045976 Bacteria 1909
707 Ga0466967_0212758 3300045976 Bacteria 1834
708 Ga0466967_0264878 3300045976 Bacteria 1645
709 Ga0466967_0287767 3300045976 Bacteria 1578
710 Ga0466967_0362967 3300045976 Bacteria 1404
711 Ga0466967_0444813 3300045976 Bacteria 1266
712 Ga0466967_0539664 3300045976 Bacteria 1147
713 Ga0495592_0001465 3300046454 Bacteria 16413
714 Ga0495592_0011582 3300046454 Bacteria 6678
715 Ga0495592_0045132 3300046454 Bacteria 3289
716 Ga0495592_0048084 3300046454 Bacteria 3174
717 Ga0495592_0095344 3300046454 Bacteria 2128
718 Ga0495592_0104076 3300046454 Bacteria 2018
719 Ga0495592_0136300 3300046454 Bacteria 1712
720 Ga0495592_0252511 3300046454 Bacteria 1165
721 Ga0495603_0000002 3300046455 Bacteria 86858
722 Ga0495603_0104688 3300046455 Bacteria 1651
723 Ga0495603_0145202 3300046455 Unclassified 1379
724 Ga0495629_0002899 3300046459 Bacteria 13092
725 Ga0495629_0019560 3300046459 Bacteria 4836
726 Ga0495629_0023063 3300046459 Bacteria 4435
727 Ga0495629_0030945 3300046459 Bacteria 3791
728 Ga0495629_0041848 3300046459 Bacteria 3221
729 Ga0495629_0052393 3300046459 Bacteria 2855
730 Ga0495641_0000988 3300046461 Bacteria 24404
731 Ga0495641_0010985 3300046461 Bacteria 5198
732 Ga0495641_0028608 3300046461 Bacteria 2696
733 Ga0495641_0101635 3300046461 Bacteria 1283
734 Ga0495641_0137723 3300046461 Bacteria 1090
735 Ga0495651_0000006 3300046462 Bacteria 171575
736 Ga0495651_0000690 3300046462 Bacteria 26292
737 Ga0495651_0002869 3300046462 Bacteria 13353
738 Ga0495651_0026197 3300046462 Bacteria 4541
739 Ga0495651_0031555 3300046462 Bacteria 4131
740 Ga0495651_0086925 3300046462 Bacteria 2351
741 Ga0495651_0089336 3300046462 Unclassified 2313
742 Ga0495651_0192384 3300046462 Bacteria 1434
743 Ga0495653_0000179 3300046463 Bacteria 52301
744 Ga0495653_0003668 3300046463 Bacteria 12404
745 Ga0495653_0009824 3300046463 Bacteria 7826
746 Ga0495653_0012749 3300046463 Bacteria 6864
747 Ga0495653_0025545 3300046463 Bacteria 4743
748 Ga0495653_0028629 3300046463 Bacteria 4453
749 Ga0495653_0033280 3300046463 Bacteria 4085
750 Ga0495653_0050261 3300046463 Bacteria 3207
751 Ga0495653_0077847 3300046463 Bacteria 2461
752 Ga0495653_0079750 3300046463 Bacteria 2423
753 Ga0495653_0081526 3300046463 Bacteria 2391
754 Ga0495653_0110289 3300046463 Unclassified 1978
755 Ga0495653_0213037 3300046463 Bacteria 1303
756 Ga0495650_0000035 3300046471 Bacteria 403799
757 Ga0495580_0005188 3300046472 Bacteria 10826
758 Ga0495580_0135512 3300046472 Bacteria 1707
759 Ga0495582_0000005 3300046473 Bacteria 156170
760 Ga0495582_0004052 3300046473 Bacteria 8228
761 Ga0495582_0012560 3300046473 Bacteria 4668
762 Ga0495582_0019785 3300046473 Bacteria 3680
763 Ga0495582_0053512 3300046473 Bacteria 2226
764 Ga0495639_0000185 3300046475 Bacteria 33068
765 Ga0495639_0181001 3300046475 Unclassified 1026
766 Ga0495662_0000010 3300046476 Bacteria 70156
767 Ga0495662_0000853 3300046476 Bacteria 14869
768 Ga0495662_0036605 3300046476 Unclassified 2368
769 Ga0495662_0045917 3300046476 Bacteria 2109
770 Ga0495662_0081225 3300046476 Bacteria 1576
771 Ga0495662_0125418 3300046476 Unclassified 1261
772 Ga0495664_0000036 3300046477 Bacteria 71543
773 Ga0495664_0011350 3300046477 Bacteria 5020
774 Ga0495664_0030999 3300046477 Bacteria 3133
775 Ga0495664_0038030 3300046477 Bacteria 2840
776 Ga0495664_0071503 3300046477 Unclassified 2072
777 Ga0495664_0072967 3300046477 Unclassified 2052
778 Ga0495584_0146190 3300046491 Unclassified 1201
779 Ga0495594_0181508 3300046499 Bacteria 1198
780 Ga0495608_0000115 3300046511 Bacteria 56782
781 Ga0495608_0000161 3300046511 Bacteria 47857
782 Ga0495608_0003722 3300046511 Bacteria 10957
783 Ga0495608_0006602 3300046511 Bacteria 8234
784 Ga0495608_0008262 3300046511 Bacteria 7308
785 Ga0495608_0019618 3300046511 Bacteria 4652
786 Ga0495608_0033678 3300046511 Unclassified 3460
787 Ga0495608_0119826 3300046511 Unclassified 1688
788 Ga0495618_0000076 3300046514 Bacteria 69851
789 Ga0495618_0027823 3300046514 Bacteria 3520
790 Ga0495618_0063215 3300046514 Bacteria 2349
791 Ga0495618_0128868 3300046514 Bacteria 1619
792 Ga0495618_0269468 3300046514 Unclassified 1064
793 Ga0495620_0000747 3300046515 Bacteria 19970
794 Ga0495628_0002978 3300046516 Bacteria 15185
795 Ga0495628_0017619 3300046516 Bacteria 5939
796 Ga0495628_0043289 3300046516 Bacteria 3587
797 Ga0495628_0048475 3300046516 Bacteria 3367
798 Ga0495628_0056079 3300046516 Bacteria 3102
799 Ga0495628_0062391 3300046516 Bacteria 2921
800 Ga0495628_0074604 3300046516 Bacteria 2642
801 Ga0495628_0102937 3300046516 Bacteria 2202
802 Ga0495628_0184089 3300046516 Bacteria 1579
803 Ga0495628_0233485 3300046516 Bacteria 1378
804 Ga0495628_0258204 3300046516 Bacteria 1299
805 Ga0495630_0000891 3300046517 Bacteria 20921
806 Ga0495630_0001166 3300046517 Bacteria 18157
807 Ga0495630_0001902 3300046517 Bacteria 14542
808 Ga0495630_0018213 3300046517 Bacteria 5157
809 Ga0495630_0022674 3300046517 Bacteria 4637
810 Ga0495630_0023448 3300046517 Bacteria 4563
811 Ga0495630_0050384 3300046517 Unclassified 3116
812 Ga0495630_0067956 3300046517 Bacteria 2679
813 Ga0495630_0076394 3300046517 Unclassified 2524
814 Ga0495630_0094389 3300046517 Bacteria 2261
815 Ga0495630_0120996 3300046517 Unclassified 1986
816 Ga0495630_0188396 3300046517 Bacteria 1574
817 Ga0495630_0259637 3300046517 Unclassified 1327
818 Ga0495630_0387122 3300046517 Bacteria 1071
819 Ga0495666_0004199 3300046526 Bacteria 7265
820 Ga0495652_0001682 3300046529 Bacteria 23966
821 Ga0495652_0004882 3300046529 Bacteria 12723
822 Ga0495652_0006005 3300046529 Bacteria 11359
823 Ga0495652_0013833 3300046529 Bacteria 7258
824 Ga0495652_0016179 3300046529 Bacteria 6670
825 Ga0495652_0024932 3300046529 Bacteria 5291
826 Ga0495652_0028877 3300046529 Bacteria 4876
827 Ga0495652_0030805 3300046529 Bacteria 4701
828 Ga0495652_0031329 3300046529 Bacteria 4657
829 Ga0495652_0096289 3300046529 Bacteria 2411
830 Ga0495652_0146511 3300046529 Unclassified 1850
831 Ga0495652_0189643 3300046529 Bacteria 1570
832 Ga0495652_0193700 3300046529 Bacteria 1549
833 Ga0495665_0000433 3300046531 Bacteria 21230
834 Ga0495665_0001501 3300046531 Bacteria 12513
835 Ga0495665_0002901 3300046531 Bacteria 9265
836 Ga0495665_0154648 3300046531 Bacteria 1196
837 Ga0495665_0168441 3300046531 Bacteria 1141
838 Ga0495640_0001987 3300046533 Bacteria 16309
839 Ga0495640_0008324 3300046533 Bacteria 8132
840 Ga0495640_0009843 3300046533 Bacteria 7419
841 Ga0495640_0011594 3300046533 Bacteria 6774
842 Ga0495640_0016985 3300046533 Bacteria 5432
843 Ga0495640_0036150 3300046533 Bacteria 3490
844 Ga0495640_0113909 3300046533 Bacteria 1764
845 Ga0495640_0151576 3300046533 Unclassified 1489
846 Ga0495586_0000294 3300046535 Bacteria 31690
847 Ga0495586_0004484 3300046535 Bacteria 7457
848 Ga0495586_0009231 3300046535 Bacteria 5245
849 Ga0495586_0078635 3300046535 Bacteria 1810
850 Ga0495586_0143376 3300046535 Unclassified 1341
851 Ga0495587_0001335 3300046536 Bacteria 16391
852 Ga0495587_0001931 3300046536 Bacteria 13803
853 Ga0495587_0004407 3300046536 Bacteria 9272
854 Ga0495587_0005639 3300046536 Bacteria 8164
855 Ga0495587_0011324 3300046536 Bacteria 5651
856 Ga0495587_0013715 3300046536 Bacteria 5091
857 Ga0495587_0029292 3300046536 Bacteria 3342
858 Ga0495587_0056239 3300046536 Bacteria 2315
859 Ga0495587_0060891 3300046536 Bacteria 2212
860 Ga0495587_0062245 3300046536 Bacteria 2185
861 Ga0495587_0089866 3300046536 Bacteria 1774
862 Ga0495587_0122154 3300046536 Bacteria 1491
863 Ga0495645_0000012 3300046543 Bacteria 209044
864 Ga0495645_0011860 3300046543 Bacteria 6141
865 Ga0495645_0024293 3300046543 Bacteria 4396
866 Ga0495645_0024897 3300046543 Bacteria 4343
867 Ga0495645_0050641 3300046543 Bacteria 3023
868 Ga0495645_0058731 3300046543 Bacteria 2790
869 Ga0495645_0083961 3300046543 Bacteria 2281
870 Ga0495645_0162586 3300046543 Bacteria 1542
871 Ga0495667_0000153 3300046559 Bacteria 46974
872 Ga0495667_0002773 3300046559 Bacteria 11694
873 Ga0495667_0012091 3300046559 Bacteria 5846
874 Ga0495667_0015633 3300046559 Bacteria 5131
875 Ga0495667_0068905 3300046559 Bacteria 2309
876 Ga0495667_0081674 3300046559 Unclassified 2100
877 Ga0495668_0050394 3300046616 Bacteria 2308
878 Ga0495634_0000024 3300046642 Bacteria 116230
879 Ga0495634_0006302 3300046642 Bacteria 9036
880 Ga0495634_0009617 3300046642 Bacteria 7122
881 Ga0495634_0011468 3300046642 Bacteria 6448
882 Ga0495634_0017269 3300046642 Bacteria 5152
883 Ga0495634_0023539 3300046642 Bacteria 4327
884 Ga0495634_0088085 3300046642 Bacteria 2019
885 Ga0495634_0112171 3300046642 Bacteria 1753
886 Ga0495634_0126580 3300046642 Bacteria 1632
887 Ga0495634_0131121 3300046642 Bacteria 1598
888 Ga0495634_0135769 3300046642 Bacteria 1565
889 Ga0495625_0000204 3300046660 Bacteria 94356
890 Ga0495635_0000005 3300046663 Bacteria 302178
891 Ga0495635_0011439 3300046663 Bacteria 6223
892 Ga0495635_0026312 3300046663 Bacteria 4049
893 Ga0495635_0062909 3300046663 Unclassified 2548
894 Ga0495635_0131842 3300046663 Unclassified 1704
895 Ga0495635_0132051 3300046663 Bacteria 1702
896 Ga0495635_0170394 3300046663 Bacteria 1480
897 Ga0495588_0031043 3300046674 Bacteria 2688
898 Ga0495657_0000007 3300046675 Bacteria 222471
899 Ga0495657_0000767 3300046675 Bacteria 28554
900 Ga0495657_0001164 3300046675 Bacteria 23026
901 Ga0495657_0001996 3300046675 Bacteria 17385
902 Ga0495657_0008028 3300046675 Bacteria 8093
903 Ga0495657_0010072 3300046675 Bacteria 7124
904 Ga0495657_0017995 3300046675 Bacteria 5121
905 Ga0495657_0028039 3300046675 Bacteria 3965
906 Ga0495657_0044122 3300046675 Bacteria 3035
907 Ga0495657_0044689 3300046675 Bacteria 3011
908 Ga0495599_0000028 3300046678 Bacteria 113952
909 Ga0495599_0003834 3300046678 Bacteria 8832
910 Ga0495599_0015436 3300046678 Bacteria 4740
911 Ga0495599_0023570 3300046678 Bacteria 3848
912 Ga0495599_0025063 3300046678 Bacteria 3733
913 Ga0495599_0174389 3300046678 Bacteria 1326
914 Ga0495623_0002366 3300046679 Bacteria 12541
915 Ga0495623_0004276 3300046679 Bacteria 9400
916 Ga0495623_0007286 3300046679 Bacteria 7178
917 Ga0495646_0006007 3300046680 Bacteria 7696
918 Ga0495646_0007679 3300046680 Bacteria 6855
919 Ga0495646_0014153 3300046680 Bacteria 5073
920 Ga0495646_0080540 3300046680 Bacteria 1899
921 Ga0495646_0181750 3300046680 Bacteria 1154
922 Ga0495647_0000020 3300046681 Bacteria 77355
923 Ga0495647_0006368 3300046681 Bacteria 3904
924 Ga0495647_0016087 3300046681 Bacteria 2630
925 Ga0495647_0025009 3300046681 Unclassified 2178
926 Ga0495647_0077565 3300046681 Unclassified 1341
927 Ga0495658_0000113 3300046683 Bacteria 42967
928 Ga0495658_0000972 3300046683 Bacteria 15217
929 Ga0495658_0226897 3300046683 Unclassified 1170
930 Ga0495613_0000021 3300046689 Bacteria 159188
931 Ga0495613_0000040 3300046689 Bacteria 131633
932 Ga0495613_0007255 3300046689 Bacteria 8250
933 Ga0495613_0008636 3300046689 Bacteria 7558
934 Ga0495613_0023643 3300046689 Bacteria 4580
935 Ga0495613_0031810 3300046689 Bacteria 3919
936 Ga0495613_0037512 3300046689 Bacteria 3593
937 Ga0495613_0231139 3300046689 Bacteria 1295
938 Ga0495624_0000030 3300046690 Bacteria 91755
939 Ga0495624_0001702 3300046690 Bacteria 16822
940 Ga0495624_0002255 3300046690 Bacteria 14708
941 Ga0495624_0022354 3300046690 Bacteria 4182
942 Ga0495624_0082464 3300046690 Bacteria 1990
943 Ga0495624_0117991 3300046690 Bacteria 1630
944 Ga0495600_0001627 3300046809 Bacteria 12526
945 Ga0495600_0004500 3300046809 Bacteria 8354
946 Ga0495600_0006499 3300046809 Bacteria 7114
947 Ga0495600_0006813 3300046809 Bacteria 6967
948 Ga0495600_0012726 3300046809 Bacteria 5268
949 Ga0495600_0023222 3300046809 Bacteria 3989
950 Ga0495600_0033443 3300046809 Bacteria 3338
951 Ga0495600_0044807 3300046809 Bacteria 2885
952 Ga0495600_0047683 3300046809 Bacteria 2795
953 Ga0495600_0075917 3300046809 Bacteria 2194
954 Ga0495600_0107268 3300046809 Bacteria 1819
955 Ga0495600_0138733 3300046809 Bacteria 1578
956 Ga0495581_0007179 3300047315 Bacteria 6450
957 Ga0495581_0046879 3300047315 Unclassified 2498
958 Ga0495581_0049010 3300047315 Unclassified 2438
959 Ga0495581_0055045 3300047315 Bacteria 2296
960 Ga0495581_0074013 3300047315 Bacteria 1971
961 Ga0495581_0113098 3300047315 Bacteria 1578
962 Ga0495581_0148132 3300047315 Bacteria 1370
963 Ga0495581_0179032 3300047315 Unclassified 1240
964 Ga0495604_0000497 3300047317 Bacteria 34551
965 Ga0495604_0000872 3300047317 Bacteria 25164
966 Ga0495604_0001134 3300047317 Bacteria 22105
967 Ga0495604_0004140 3300047317 Bacteria 11514
968 Ga0495604_0005531 3300047317 Bacteria 10017
969 Ga0495604_0009158 3300047317 Bacteria 7836
970 Ga0495604_0026341 3300047317 Bacteria 4629
971 Ga0495604_0032132 3300047317 Bacteria 4161
972 Ga0495604_0053975 3300047317 Bacteria 3103
973 Ga0495604_0093595 3300047317 Bacteria 2223
974 Ga0495604_0143286 3300047317 Unclassified 1705
975 Ga0495604_0149760 3300047317 Bacteria 1659
976 Ga0495604_0210439 3300047317 Bacteria 1344
977 Ga0495604_0217976 3300047317 Unclassified 1315
978 Ga0495604_0255642 3300047317 Bacteria 1192
979 Ga0495674_0000495 3300047319 Bacteria 35990
980 Ga0495674_0006162 3300047319 Bacteria 11515
981 Ga0495674_0008274 3300047319 Bacteria 9920
982 Ga0495674_0016663 3300047319 Bacteria 6856
983 Ga0495674_0021142 3300047319 Bacteria 6020
984 Ga0495674_0065334 3300047319 Bacteria 3160
985 Ga0495674_0086207 3300047319 Bacteria 2689
986 Ga0495674_0094576 3300047319 Bacteria 2549
987 Ga0495674_0109317 3300047319 Bacteria 2345
988 Ga0495672_0009199 3300047320 Bacteria 7192
989 Ga0495676_0003199 3300047321 Bacteria 14801
990 Ga0495676_0020303 3300047321 Bacteria 5832
991 Ga0495676_0022041 3300047321 Bacteria 5551
992 Ga0495676_0075380 3300047321 Unclassified 2580
993 Ga0495676_0116604 3300047321 Unclassified 1950
994 Ga0495676_0201821 3300047321 Bacteria 1381
995 Ga0495676_0215941 3300047321 Bacteria 1324
996 Ga0495680_0000007 3300047322 Bacteria 152053
997 Ga0495680_0000843 3300047322 Bacteria 33990
998 Ga0495680_0001076 3300047322 Bacteria 30260
999 Ga0495680_0007749 3300047322 Bacteria 9806
1000 Ga0495680_0017850 3300047322 Bacteria 6039
1001 Ga0495680_0024093 3300047322 Bacteria 5052
1002 Ga0495680_0030962 3300047322 Bacteria 4360
1003 Ga0495680_0083739 3300047322 Bacteria 2404
1004 Ga0495680_0110758 3300047322 Unclassified 2034
1005 Ga0495680_0117975 3300047322 Bacteria 1961
1006 Ga0495675_0001223 3300047444 Bacteria 15548
1007 Ga0495675_0004577 3300047444 Bacteria 8389
1008 Ga0495675_0042485 3300047444 Bacteria 2896
1009 Ga0495675_0060681 3300047444 Bacteria 2396
1010 Ga0495675_0079991 3300047444 Bacteria 2058
1011 Ga0495679_023732 3300047446 Bacteria 2076
1012 Ga0495685_063385 3300047447 Bacteria 1244
1013 Ga0495684_0005564 3300047471 Bacteria 9817
1014 Ga0495684_0015078 3300047471 Bacteria 5952
1015 Ga0495684_0018090 3300047471 Bacteria 5431
1016 Ga0495684_0023894 3300047471 Bacteria 4700
1017 Ga0495684_0027171 3300047471 Bacteria 4393
1018 Ga0495684_0037745 3300047471 Bacteria 3706
1019 Ga0495684_0080151 3300047471 Bacteria 2479
1020 Ga0495684_0100547 3300047471 Bacteria 2186
1021 Ga0495684_0111644 3300047471 Bacteria 2062
1022 Ga0495684_0235934 3300047471 Bacteria 1336
1023 Ga0495684_0388437 3300047471 Bacteria 983
1024 Ga0495593_0000503 3300047673 Bacteria 22089
1025 Ga0495593_0069903 3300047673 Unclassified 1825
1026 Ga0495593_0070053 3300047673 Bacteria 1823
1027 Ga0495593_0096245 3300047673 Bacteria 1521
1028 Ga0495602_0000113 3300048088 Bacteria 76660
1029 Ga0495602_0003428 3300048088 Bacteria 16391
1030 Ga0495602_0004519 3300048088 Bacteria 14517
1031 Ga0495602_0009419 3300048088 Bacteria 10159
1032 Ga0495602_0018767 3300048088 Bacteria 6893
1033 Ga0495602_0050996 3300048088 Bacteria 3691
1034 Ga0495602_0076593 3300048088 Bacteria 2833
1035 Ga0495602_0100478 3300048088 Bacteria 2375
1036 Ga0495602_0105164 3300048088 Unclassified 2307
1037 Ga0495602_0114042 3300048088 Bacteria 2189
1038 Ga0495602_0168339 3300048088 Bacteria 1703
1039 Ga0495614_0000171 3300048089 Bacteria 24006
1040 Ga0495614_0031429 3300048089 Bacteria 2285
1041 Ga0496100_0000024 3300048903 Bacteria 116138
1042 Ga0496100_0000046 3300048903 Bacteria 77660
1043 Ga0496100_0085257 3300048903 Unclassified 2143
1044 Ga0496100_0345450 3300048903 Unclassified 1123
1045 Ga0496101_0000072 3300048904 Bacteria 116138
1046 Ga0496101_0000124 3300048904 Bacteria 75495
1047 Ga0496101_0011878 3300048904 Bacteria 5798
1048 Ga0496101_0219389 3300048904 Unclassified 1475
1049 Ga0496102_0000019 3300048905 Bacteria 264583
1050 Ga0496102_0033747 3300048905 Bacteria 4602
1051 Ga0496102_0038814 3300048905 Bacteria 4301
1052 Ga0496102_0208631 3300048905 Bacteria 1842
1053 Ga0496103_0000104 3300048906 Bacteria 93132
1054 Ga0496103_0079780 3300048906 Bacteria 2057
1055 Ga0496103_0157995 3300048906 Bacteria 1454
1056 Ga0496104_0000008 3300048907 Bacteria 516976
1057 Ga0496104_0000063 3300048907 Bacteria 116618
1058 Ga0496104_0002266 3300048907 Bacteria 16586
1059 Ga0496104_0040748 3300048907 Bacteria 4354
1060 Ga0496104_0043187 3300048907 Bacteria 4234
1061 Ga0496104_0130889 3300048907 Bacteria 2410
1062 Ga0496105_0000003 3300048908 Bacteria 713251
1063 Ga0496105_0000041 3300048908 Bacteria 116618
1064 Ga0496105_0001527 3300048908 Bacteria 16364
1065 Ga0496105_0024910 3300048908 Bacteria 4864
1066 Ga0496105_0026943 3300048908 Bacteria 4691
1067 Ga0496105_0037423 3300048908 Bacteria 3995
1068 Ga0496105_0215983 3300048908 Bacteria 1562
1069 Ga0496106_0000040 3300048909 Bacteria 108754
1070 Ga0496106_0000059 3300048909 Bacteria 87781
1071 Ga0496106_0060484 3300048909 Unclassified 2872
1072 Ga0496106_0080390 3300048909 Bacteria 2503
1073 Ga0496106_0114566 3300048909 Bacteria 2102
1074 Ga0496107_0000018 3300048910 Bacteria 158433
1075 Ga0496107_0000025 3300048910 Bacteria 116138
1076 Ga0496107_0025902 3300048910 Bacteria 4156
1077 Ga0496107_0052849 3300048910 Bacteria 2930
1078 Ga0496108_0000039 3300048911 Bacteria 149440
1079 Ga0496108_0000631 3300048911 Bacteria 27478
1080 Ga0496108_0011681 3300048911 Bacteria 7144
1081 Ga0496108_0049132 3300048911 Bacteria 3528
1082 Ga0496109_0000038 3300048912 Bacteria 150745
1083 Ga0496109_0000085 3300048912 Bacteria 95437
1084 Ga0496109_0003056 3300048912 Bacteria 13946
1085 Ga0496109_0009210 3300048912 Bacteria 8410
1086 Ga0496109_0010556 3300048912 Bacteria 7897
1087 Ga0496109_0019326 3300048912 Bacteria 6004
1088 Ga0496109_0249419 3300048912 Bacteria 1672
1089 Ga0496110_0013768 3300048913 Bacteria 6701
1090 Ga0496110_0022340 3300048913 Bacteria 5370
1091 Ga0496110_0055192 3300048913 Bacteria 3495
1092 Ga0496110_0062552 3300048913 Bacteria 3287
1093 Ga0496110_0334548 3300048913 Bacteria 1379
1094 Ga0496110_0489610 3300048913 Bacteria 1120
1095 Ga0496111_0000758 3300048914 Bacteria 17233
1096 Ga0496111_0006525 3300048914 Bacteria 7585
1097 Ga0496111_0103361 3300048914 Bacteria 2095
1098 Ga0496112_0000002 3300048915 Bacteria 782039
1099 Ga0496112_0001367 3300048915 Bacteria 18584
1100 Ga0496112_0019624 3300048915 Bacteria 6384
1101 Ga0496112_0061758 3300048915 Bacteria 3695
1102 Ga0496112_0092579 3300048915 Bacteria 2992
1103 Ga0496113_0073460 3300048916 Bacteria 2606
1104 Ga0496113_0122432 3300048916 Bacteria 2035
1105 Ga0496113_0241126 3300048916 Bacteria 1442
1106 Ga0496114_0000043 3300048917 Bacteria 131720
1107 Ga0496114_0140470 3300048917 Bacteria 2091
1108 Ga0496115_0000209 3300048918 Bacteria 54079
1109 Ga0496115_0000211 3300048918 Bacteria 54033
1110 Ga0496115_0000259 3300048918 Bacteria 47012
1111 Ga0496115_0041224 3300048918 Bacteria 3673
1112 Ga0496115_0073372 3300048918 Bacteria 2778
1113 Ga0496115_0196061 3300048918 Bacteria 1669
1114 Ga0496115_0214472 3300048918 Unclassified 1590
1115 Ga0496116_0000176 3300048919 Bacteria 128426
1116 Ga0496117_0190247 3300048920 Bacteria 1170
1117 Ga0496118_0005822 3300048921 Bacteria 13815
1118 Ga0496118_0082354 3300048921 Bacteria 2255
1119 Ga0496119_0001444 3300048922 Bacteria 28583
1120 Ga0496119_0042180 3300048922 Bacteria 2897
1121 Ga0496120_0006050 3300048923 Bacteria 9402
1122 Ga0496121_0026281 3300048924 Bacteria 5491
1123 Ga0496121_0112668 3300048924 Bacteria 2072
1124 Ga0496124_0060933 3300048927 Bacteria 3164
1125 Ga0496124_0076805 3300048927 Bacteria 2756
1126 Ga0496126_0035003 3300048929 Bacteria 4710
1127 Ga0496126_0040619 3300048929 Bacteria 4312
1128 Ga0496126_0081080 3300048929 Bacteria 2869
1129 Ga0501031_0004602 3300049568 Bacteria 8945
1130 Ga0501032_0002323 3300049569 Bacteria 14908
1131 Ga0501033_0001255 3300049570 Bacteria 22735
1132 Ga0501034_0014402 3300049571 Bacteria 8145
1133 Ga0501034_0026202 3300049571 Bacteria 5937
1134 Ga0501034_0056567 3300049571 Bacteria 3946
1135 Ga0501034_0111844 3300049571 Bacteria 2722
1136 Ga0501034_0249208 3300049571 Bacteria 1721
1137 Ga0501036_0004619 3300049572 Bacteria 11128
1138 Ga0501037_0002105 3300049573 Bacteria 14423
1139 Ga0501038_0003549 3300049574 Bacteria 14517
1140 Ga0501038_0306511 3300049574 Bacteria 1245
1141 Ga0501039_0017629 3300049575 Bacteria 5477
1142 Ga0501040_0034211 3300049576 Bacteria 3444
1143 Ga0501040_0084985 3300049576 Bacteria 2196
1144 Ga0501040_0140129 3300049576 Bacteria 1703
1145 Ga0501041_0013603 3300049577 Bacteria 4826
1146 Ga0501042_0013794 3300049578 Bacteria 5504
1147 Ga0501042_0028550 3300049578 Bacteria 3932
1148 Ga0501042_0065656 3300049578 Bacteria 2593
1149 Ga0501042_0347128 3300049578 Bacteria 1073
1150 Ga0501043_0002925 3300049579 Bacteria 14258
1151 Ga0501043_0247705 3300049579 Bacteria 1373
1152 Ga0501046_0003552 3300049580 Bacteria 14279
1153 Ga0501046_0038058 3300049580 Bacteria 3863
1154 Ga0501047_0002361 3300049581 Bacteria 18047
1155 Ga0501047_0009486 3300049581 Bacteria 9197
1156 Ga0501047_0011271 3300049581 Bacteria 8463
1157 Ga0501047_0048106 3300049581 Bacteria 4119
1158 Ga0501047_0258594 3300049581 Bacteria 1589
1159 Ga0501047_0478983 3300049581 Bacteria 1072
1160 Ga0501048_0002577 3300049582 Bacteria 13867
1161 Ga0501048_0116465 3300049582 Bacteria 1888
1162 Ga0501067_0211871 3300049583 Bacteria 1079
1163 Ga0501068_0242415 3300049584 Bacteria 1147
1164 Ga0501069_0004102 3300049585 Bacteria 7517
1165 Ga0501070_0000425 3300049586 Bacteria 38423
1166 Ga0501070_0000832 3300049586 Bacteria 28030
1167 Ga0501070_0002854 3300049586 Bacteria 15068
1168 Ga0501070_0092619 3300049586 Bacteria 2501
1169 Ga0501070_0251937 3300049586 Bacteria 1444
1170 Ga0501070_0254391 3300049586 Bacteria 1436
1171 Ga0501070_0306027 3300049586 Bacteria 1294
1172 Ga0501071_0017467 3300049587 Bacteria 4948
1173 Ga0501071_0029402 3300049587 Bacteria 3878
1174 Ga0501071_0111901 3300049587 Bacteria 2018
1175 Ga0501071_0155681 3300049587 Bacteria 1706
1176 Ga0501071_0170259 3300049587 Bacteria 1630
1177 Ga0501071_0194595 3300049587 Bacteria 1522
1178 Ga0501072_0076481 3300049588 Bacteria 2649
1179 Ga0501072_0133313 3300049588 Bacteria 1981
1180 Ga0501072_0339474 3300049588 Bacteria 1193
1181 Ga0501073_0011740 3300049589 Bacteria 6397
1182 Ga0501074_0010539 3300049590 Bacteria 6707
1183 Ga0501074_0018420 3300049590 Bacteria 5072
1184 Ga0501074_0021590 3300049590 Bacteria 4674
1185 Ga0501074_0155716 3300049590 Bacteria 1632
1186 Ga0501076_0042370 3300049592 Bacteria 3583
1187 Ga0501076_0091145 3300049592 Bacteria 2452
1188 Ga0501077_0153400 3300049593 Bacteria 1462
1189 Ga0501079_0119347 3300049741 Bacteria 2050
1190 Ga0501079_0300324 3300049741 Bacteria 1256
1191 Ga0501080_0000203 3300049742 Bacteria 43867
1192 Ga0501080_0007024 3300049742 Bacteria 10165
1193 Ga0501080_0117774 3300049742 Bacteria 2462
1194 Ga0501081_0040683 3300049743 Bacteria 3182
1195 Ga0501083_0020412 3300049744 Bacteria 4609
1196 Ga0501035_0004128 3300049822 Bacteria 13802
1197 Ga0501044_0000684 3300049823 Bacteria 40967
1198 Ga0501044_0066157 3300049823 Bacteria 3686
1199 Ga0501044_0098401 3300049823 Bacteria 2945
1200 Ga0501044_0263966 3300049823 Bacteria 1659
1201 Ga0501045_0139507 3300049824 Bacteria 1803
1202 Ga0501045_0147890 3300049824 Bacteria 1748
1203 nmdc:mga0yw44_41935_c2 3300050492 Bacteria 1947
1204 nmdc:mga05p37_139307_c1 3300050507 Bacteria 2973
1205 nmdc:mga05p37_1476_c1 3300050507 Bacteria 27323
1206 nmdc:mga05p37_180735_c2 3300050507 Bacteria 1938
1207 nmdc:mga05p37_234881_c1 3300050507 Bacteria 2207
1208 nmdc:mga05p37_26277_c1 3300050507 Bacteria 7080
1209 nmdc:mga05p37_60865_c1 3300050507 Bacteria 4648
1210 nmdc:mga09592_416752_c1 3300050508 Unclassified 1160
1211 nmdc:mga06r32_176246_c1 3300050510 Bacteria 2123
1212 nmdc:mga06r32_24750_c1 3300050510 Bacteria 5578
1213 nmdc:mga06r32_55703_c1 3300050510 Bacteria 3794
1214 nmdc:mga08y16_114032_c1 3300050511 Bacteria 2813
1215 nmdc:mga08y16_18718_c1 3300050511 Bacteria 7294
1216 nmdc:mga08y16_234657_c1 3300050511 Bacteria 1897
1217 nmdc:mga08y16_381365_c1 3300050511 Bacteria 1445
1218 nmdc:mga0n895_117238_c1 3300050512 Bacteria 2682
1219 nmdc:mga0n895_203828_c1 3300050512 Bacteria 2008
1220 nmdc:mga0n895_243157_c1 3300050512 Bacteria 1827
1221 nmdc:mga0n895_251756_c1 3300050512 Bacteria 1793
1222 nmdc:mga0n895_283510_c1 3300050512 Bacteria 1680
1223 nmdc:mga0n895_336200_c1 3300050512 Unclassified 1530
1224 nmdc:mga0n895_618613_c1 3300050512 Bacteria 1084
1225 nmdc:mga0n895_63088_c1 3300050512 Bacteria 3664
1226 nmdc:mga0n895_83833_c1 3300050512 Bacteria 3180
1227 nmdc:mga0rr50_24688_c1 3300050513 Bacteria 4169
1228 nmdc:mga0rr50_424421_c1 3300050513 Unclassified 1125
1229 nmdc:mga0rr50_50198_c1 3300050513 Bacteria 3091
1230 nmdc:mga0rr50_63607_c1 3300050513 Unclassified 2787
1231 nmdc:mga08x19_26371_c1 3300050514 Bacteria 3625
1232 nmdc:mga08x19_297218_c1 3300050514 Unclassified 1121
1233 nmdc:mga08x19_7286_c2 3300050514 Bacteria 6267
1234 nmdc:mga08x19_89829_c1 3300050514 Bacteria 2027
1235 nmdc:mga08x19_97275_c1 3300050514 Unclassified 1949
1236 nmdc:mga08x19_99277_c1 3300050514 Bacteria 1930
1237 nmdc:mga0a205_11001_c1 3300050515 Bacteria 8328
1238 nmdc:mga0a205_110029_c1 3300050515 Unclassified 2653
1239 nmdc:mga0a205_12859_c1 3300050515 Bacteria 7764
1240 nmdc:mga0a205_13616_c1 3300050515 Bacteria 7578
1241 nmdc:mga0a205_14047_c1 3300050515 Bacteria 7469
1242 nmdc:mga0a205_165481_c1 3300050515 Bacteria 2107
1243 nmdc:mga0a205_1_c2 3300050515 Bacteria 266330
1244 Ga0495601_0000022 3300053077 Bacteria 148418
1245 Ga0495601_0000028 3300053077 Bacteria 112630
1246 Ga0495601_0000240 3300053077 Bacteria 29205
1247 Ga0495601_0001051 3300053077 Bacteria 15116
1248 Ga0495601_0018202 3300053077 Bacteria 4273
1249 Ga0495601_0020574 3300053077 Bacteria 4031
1250 Ga0495601_0027036 3300053077 Bacteria 3545
1251 Ga0495601_0027960 3300053077 Bacteria 3490
1252 Ga0495601_0050002 3300053077 Bacteria 2636
1253 Ga0495601_0050942 3300053077 Bacteria 2613
1254 Ga0495601_0055209 3300053077 Unclassified 2514
1255 Ga0495601_0089612 3300053077 Bacteria 1978
1256 Ga0495601_0100137 3300053077 Bacteria 1871
1257 Ga0495601_0189334 3300053077 Bacteria 1345
1258 Ga0495612_0000023 3300053078 Bacteria 118413
1259 Ga0495612_0005461 3300053078 Bacteria 5255
1260 Ga0495612_0005726 3300053078 Bacteria 5132
1261 Ga0495612_0017611 3300053078 Bacteria 2859
1262 Ga0495612_0019760 3300053078 Bacteria 2699
1263 Ga0495612_0030967 3300053078 Unclassified 2156
1264 Ga0495612_0098385 3300053078 Unclassified 1244
1265 Ga0495655_0000375 3300053083 Bacteria 7733
1266 Ga0495595_0000072 3300053084 Bacteria 49973
1267 Ga0495595_0000403 3300053084 Bacteria 16426
1268 Ga0495595_0001370 3300053084 Bacteria 9461
1269 Ga0495595_0002090 3300053084 Bacteria 7761
1270 Ga0495595_0002354 3300053084 Bacteria 7368
1271 Ga0495595_0002872 3300053084 Bacteria 6794
1272 Ga0495595_0009334 3300053084 Bacteria 4054
1273 Ga0495595_0024120 3300053084 Unclassified 2684
1274 Ga0495619_0000024 3300053085 Bacteria 180821
1275 Ga0495619_0000127 3300053085 Bacteria 55995
1276 Ga0495619_0006055 3300053085 Bacteria 7663
1277 Ga0495619_0016649 3300053085 Bacteria 4653
1278 Ga0495619_0062319 3300053085 Bacteria 2482
1279 Ga0495619_0066284 3300053085 Unclassified 2409
1280 Ga0495619_0116933 3300053085 Bacteria 1826
1281 Ga0495619_0208426 3300053085 Bacteria 1353
1282 Ga0495619_0224756 3300053085 Bacteria 1300
1283 Ga0500566_0003277 3300053094 Bacteria 9670
1284 Ga0501084_0105644 3300054114 Bacteria 2365
1285 Ga0501084_0231906 3300054114 Bacteria 1558
1286 Ga0501084_0387216 3300054114 Bacteria 1181
1287 Ga0501082_0076582 3300060353 Bacteria 2883
1288 Ga0501082_0122007 3300060353 Bacteria 2259
1289 Ga0466962_0043422 3300061719 Bacteria 2151
1290 Ga0530510_0042099 3300061734 Bacteria 3299
1291 Ga0530510_0058963 3300061734 Bacteria 2776
1292 Ga0530510_0152533 3300061734 Bacteria 1707
1293 Ga0530510_0166465 3300061734 Bacteria 1632
1294 Ga0530510_0206497 3300061734 Bacteria 1460

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300010375 Ga0105239_10275388 Ga0105239_102753883 274
2 3300035410 Ga0373924_0000206 Ga0373924_0000206_3463_4314 281
3 3300005339 Ga0070660_100019468 Ga0070660_1000194685 298
4 3300005458 Ga0070681_10020178 Ga0070681_100201782 298
5 3300005468 Ga0070707_100045527 Ga0070707_1000455273 298
6 3300005530 Ga0070679_100009834 Ga0070679_1000098346 298
7 3300005616 Ga0068852_100011961 Ga0068852_1000119614 298
8 3300009093 Ga0105240_10035422 Ga0105240_100354224 298
9 3300009551 Ga0105238_10025337 Ga0105238_100253374 298
10 3300013104 Ga0157370_10016303 Ga0157370_100163034 298
11 3300013105 Ga0157369_10020773 Ga0157369_100207731 298
12 3300044693 Ga0466961_0167162 Ga0466961_0167162_417_1331 299
13 3300045836 Ga0466958_0144582 Ga0466958_0144582_405_1319 299
14 3300046536 Ga0495587_0056239 Ga0495587_0056239_50_976 299
15 3300025929 Ga0207664_10073446 Ga0207664_100734464 300
16 3300045976 Ga0466967_0287767 Ga0466967_0287767_422_1333 300
17 3300049576 Ga0501040_0140129 Ga0501040_0140129_328_1239 300
18 3300049577 Ga0501041_0013603 Ga0501041_0013603_1629_2540 300
19 3300049578 Ga0501042_0013794 Ga0501042_0013794_3093_4004 300
20 3300049582 Ga0501048_0116465 Ga0501048_0116465_947_1858 300
21 3300049586 Ga0501070_0306027 Ga0501070_0306027_274_1185 300
22 3300049587 Ga0501071_0017467 Ga0501071_0017467_3967_4878 300
23 3300049588 Ga0501072_0339474 Ga0501072_0339474_117_1028 300
24 3300061734 Ga0530510_0166465 Ga0530510_0166465_77_988 300
25 3300005435 Ga0070714_100131479 Ga0070714_1001314792 301
26 3300005435 Ga0070714_100162162 Ga0070714_1001621622 301
27 3300005436 Ga0070713_100162128 Ga0070713_1001621282 301
28 3300005439 Ga0070711_100114389 Ga0070711_1001143892 301
29 3300006028 Ga0070717_10109893 Ga0070717_101098932 301
30 3300025915 Ga0207693_10003116 Ga0207693_100031166 301
31 3300025916 Ga0207663_10011138 Ga0207663_100111382 301
32 3300025929 Ga0207664_10006681 Ga0207664_100066814 301
33 3300025949 Ga0207667_10312608 Ga0207667_103126081 301
34 3300045049 Ga0466959_0107211 Ga0466959_0107211_443_1357 301
35 3300048906 Ga0496103_0157995 Ga0496103_0157995_415_1326 301
36 3300048917 Ga0496114_0140470 Ga0496114_0140470_287_1198 301
37 3300005327 Ga0070658_10373830 Ga0070658_103738301 302
38 3300005435 Ga0070714_100079262 Ga0070714_1000792622 302
39 3300005435 Ga0070714_100148367 Ga0070714_1001483672 302
40 3300005437 Ga0070710_10023790 Ga0070710_100237902 302
41 3300005439 Ga0070711_100241494 Ga0070711_1002414942 302
42 3300005536 Ga0070697_100316139 Ga0070697_1003161392 302
43 3300006028 Ga0070717_10176487 Ga0070717_101764872 302
44 3300006028 Ga0070717_10187921 Ga0070717_101879212 302
45 3300006048 Ga0075363_100073093 Ga0075363_1000730932 302
46 3300006847 Ga0075431_100148413 Ga0075431_1001484132 302
47 3300006852 Ga0075433_10061311 Ga0075433_100613112 302
48 3300006871 Ga0075434_100042602 Ga0075434_1000426024 302
49 3300006871 Ga0075434_100256619 Ga0075434_1002566192 302
50 3300006914 Ga0075436_100046379 Ga0075436_1000463792 302
51 3300007076 Ga0075435_100046796 Ga0075435_1000467962 302
52 3300009094 Ga0111539_10023017 Ga0111539_100230173 302
53 3300021377 Ga0213874_10048410 Ga0213874_100484102 302
54 3300021384 Ga0213876_10003021 Ga0213876_100030218 302
55 3300021384 Ga0213876_10004167 Ga0213876_100041675 302
56 3300021384 Ga0213876_10219611 Ga0213876_102196111 302
57 3300021388 Ga0213875_10001409 Ga0213875_100014099 302
58 3300025909 Ga0207705_10304566 Ga0207705_103045662 302
59 3300025916 Ga0207663_10193904 Ga0207663_101939041 302
60 3300025986 Ga0207658_10000985 Ga0207658_1000098516 302
61 3300027907 Ga0207428_10057671 Ga0207428_100576712 302
62 3300028577 Ga0265318_10045898 Ga0265318_100458982 302
63 3300031251 Ga0265327_10040769 Ga0265327_100407692 302
64 3300035113 Ga0373936_0021873 Ga0373936_0021873_459_1373 302
65 3300035170 Ga0373943_0007393 Ga0373943_0007393_778_1692 302
66 3300035171 Ga0373946_0018937 Ga0373946_0018937_1697_2611 302
67 3300035695 Ga0373927_0039584 Ga0373927_0039584_1373_2287 302
68 3300035725 Ga0373947_0000780 Ga0373947_0000780_11445_12359 302
69 3300037068 Ga0373925_0000924 Ga0373925_0000924_8513_9427 302
70 3300037853 Ga0436364_0267098 Ga0436364_0267098_12543_13457 302
71 3300037853 Ga0436364_0352032 Ga0436364_0352032_3417_4337 302
72 3300037853 Ga0436364_0504315 Ga0436364_0504315_1250_2164 302
73 3300037853 Ga0436364_0670286 Ga0436364_0670286_3894_4808 302
74 3300037853 Ga0436364_1138532 Ga0436364_1138532_1370_2293 302
75 3300037853 Ga0436364_1290118 Ga0436364_1290118_3538_4452 302
76 3300039437 Ga0436365_0184504 Ga0436365_0184504_300_1223 302
77 3300039437 Ga0436365_0284717 Ga0436365_0284717_1106_2020 302
78 3300039437 Ga0436365_0338012 Ga0436365_0338012_194_1108 302
79 3300039437 Ga0436365_0934209 Ga0436365_0934209_176_1090 302
80 3300039437 Ga0436365_1683969 Ga0436365_1683969_6038_6952 302
81 3300039437 Ga0436365_1866545 Ga0436365_1866545_6000_6914 302
82 3300039437 Ga0436365_1887834 Ga0436365_1887834_2394_3308 302
83 3300039438 Ga0436360_0972853 Ga0436360_0972853_496_1410 302
84 3300039450 Ga0436363_0305819 Ga0436363_0305819_6225_7139 302
85 3300039450 Ga0436363_0717526 Ga0436363_0717526_4389_5303 302
86 3300039453 Ga0436362_0068564 Ga0436362_0068564_659_1573 302
87 3300039453 Ga0436362_0943130 Ga0436362_0943130_746_1660 302
88 3300044683 Ga0466965_0048550 Ga0466965_0048550_805_1716 302
89 3300044684 Ga0466966_0101952 Ga0466966_0101952_387_1301 302
90 3300044694 Ga0466963_0001291 Ga0466963_0001291_9914_10828 302
91 3300044706 Ga0466964_0015289 Ga0466964_0015289_302_1216 302
92 3300044719 Ga0466971_0070930 Ga0466971_0070930_413_1327 302
93 3300044735 Ga0466968_0012178 Ga0466968_0012178_1125_2036 302
94 3300045836 Ga0466958_0102327 Ga0466958_0102327_584_1495 302
95 3300045976 Ga0466967_0006794 Ga0466967_0006794_3908_4822 302
96 3300045976 Ga0466967_0539664 Ga0466967_0539664_112_1029 302
97 3300046454 Ga0495592_0104076 Ga0495592_0104076_272_1186 302
98 3300046454 Ga0495592_0252511 Ga0495592_0252511_25_939 302
99 3300046459 Ga0495629_0002899 Ga0495629_0002899_4567_5481 302
100 3300046459 Ga0495629_0030945 Ga0495629_0030945_731_1645 302
101 3300046461 Ga0495641_0000988 Ga0495641_0000988_7127_8041 302
102 3300046463 Ga0495653_0012749 Ga0495653_0012749_5789_6703 302
103 3300046463 Ga0495653_0028629 Ga0495653_0028629_1844_2758 302
104 3300046472 Ga0495580_0005188 Ga0495580_0005188_404_1318 302
105 3300046473 Ga0495582_0012560 Ga0495582_0012560_3717_4631 302
106 3300046473 Ga0495582_0019785 Ga0495582_0019785_488_1402 302
107 3300046475 Ga0495639_0000185 Ga0495639_0000185_24412_25326 302
108 3300046476 Ga0495662_0000853 Ga0495662_0000853_13353_14267 302
109 3300046477 Ga0495664_0030999 Ga0495664_0030999_1380_2294 302
110 3300046477 Ga0495664_0038030 Ga0495664_0038030_69_983 302
111 3300046511 Ga0495608_0019618 Ga0495608_0019618_823_1737 302
112 3300046514 Ga0495618_0063215 Ga0495618_0063215_1076_1990 302
113 3300046516 Ga0495628_0102937 Ga0495628_0102937_315_1229 302
114 3300046517 Ga0495630_0001166 Ga0495630_0001166_10458_11372 302
115 3300046517 Ga0495630_0050384 Ga0495630_0050384_220_1134 302
116 3300046517 Ga0495630_0188396 Ga0495630_0188396_508_1422 302
117 3300046526 Ga0495666_0004199 Ga0495666_0004199_1095_2009 302
118 3300046529 Ga0495652_0006005 Ga0495652_0006005_10226_11140 302
119 3300046529 Ga0495652_0146511 Ga0495652_0146511_592_1506 302
120 3300046531 Ga0495665_0000433 Ga0495665_0000433_15060_15974 302
121 3300046533 Ga0495640_0001987 Ga0495640_0001987_5955_6869 302
122 3300046533 Ga0495640_0151576 Ga0495640_0151576_150_1064 302
123 3300046535 Ga0495586_0004484 Ga0495586_0004484_700_1614 302
124 3300046536 Ga0495587_0122154 Ga0495587_0122154_458_1372 302
125 3300046642 Ga0495634_0006302 Ga0495634_0006302_6792_7706 302
126 3300046642 Ga0495634_0023539 Ga0495634_0023539_2467_3381 302
127 3300046663 Ga0495635_0062909 Ga0495635_0062909_1041_1955 302
128 3300046663 Ga0495635_0170394 Ga0495635_0170394_207_1121 302
129 3300046681 Ga0495647_0006368 Ga0495647_0006368_731_1645 302
130 3300046683 Ga0495658_0000972 Ga0495658_0000972_6690_7604 302
131 3300046689 Ga0495613_0007255 Ga0495613_0007255_4551_5465 302
132 3300046689 Ga0495613_0008636 Ga0495613_0008636_603_1517 302
133 3300046689 Ga0495613_0031810 Ga0495613_0031810_1211_2125 302
134 3300046690 Ga0495624_0001702 Ga0495624_0001702_15306_16220 302
135 3300046809 Ga0495600_0006813 Ga0495600_0006813_2991_3905 302
136 3300046809 Ga0495600_0138733 Ga0495600_0138733_620_1534 302
137 3300047315 Ga0495581_0049010 Ga0495581_0049010_794_1708 302
138 3300047319 Ga0495674_0065334 Ga0495674_0065334_360_1274 302
139 3300047321 Ga0495676_0022041 Ga0495676_0022041_3370_4284 302
140 3300047321 Ga0495676_0116604 Ga0495676_0116604_986_1900 302
141 3300047322 Ga0495680_0117975 Ga0495680_0117975_739_1653 302
142 3300047471 Ga0495684_0005564 Ga0495684_0005564_1672_2586 302
143 3300047471 Ga0495684_0388437 Ga0495684_0388437_24_938 302
144 3300047673 Ga0495593_0000503 Ga0495593_0000503_11684_12598 302
145 3300048089 Ga0495614_0000171 Ga0495614_0000171_7281_8195 302
146 3300048912 Ga0496109_0003056 Ga0496109_0003056_2099_3019 302
147 3300048913 Ga0496110_0062552 Ga0496110_0062552_2118_3038 302
148 3300048914 Ga0496111_0000758 Ga0496111_0000758_8921_9838 302
149 3300048916 Ga0496113_0073460 Ga0496113_0073460_1052_1972 302
150 3300049586 Ga0501070_0002854 Ga0501070_0002854_2890_3807 302
151 3300049590 Ga0501074_0018420 Ga0501074_0018420_1259_2176 302
152 3300050507 nmdc:mga05p37_234881_c1 nmdc:mga05p37_234881_c1_544_1461 302
153 3300050510 nmdc:mga06r32_55703_c1 nmdc:mga06r32_55703_c1_2142_3059 302
154 3300050512 nmdc:mga0n895_618613_c1 nmdc:mga0n895_618613_c1_100_1017 302
155 3300053077 Ga0495601_0018202 Ga0495601_0018202_2128_3042 302
156 3300053077 Ga0495601_0027036 Ga0495601_0027036_2276_3190 302
157 3300053078 Ga0495612_0017611 Ga0495612_0017611_1866_2780 302
158 3300053084 Ga0495595_0009334 Ga0495595_0009334_1222_2136 302
159 3300053085 Ga0495619_0116933 Ga0495619_0116933_227_1141 302
160 3300053094 Ga0500566_0003277 Ga0500566_0003277_1379_2293 302
161 3300005333 Ga0070677_10000002 Ga0070677_1000000251 303
162 3300005344 Ga0070661_100273522 Ga0070661_1002735222 303
163 3300005435 Ga0070714_100113296 Ga0070714_1001132962 303
164 3300005530 Ga0070679_100455976 Ga0070679_1004559761 303
165 3300005535 Ga0070684_100065746 Ga0070684_1000657463 303
166 3300005548 Ga0070665_100114629 Ga0070665_1001146293 303
167 3300005563 Ga0068855_100703468 Ga0068855_1007034681 303
168 3300005578 Ga0068854_100291297 Ga0068854_1002912972 303
169 3300005937 Ga0081455_10020845 Ga0081455_100208452 303
170 3300005981 Ga0081538_10000099 Ga0081538_1000009914 303
171 3300005981 Ga0081538_10001126 Ga0081538_1000112627 303
172 3300005981 Ga0081538_10017444 Ga0081538_100174446 303
173 3300005981 Ga0081538_10020277 Ga0081538_100202777 303
174 3300005985 Ga0081539_10002438 Ga0081539_1000243825 303
175 3300005985 Ga0081539_10039115 Ga0081539_100391154 303
176 3300006175 Ga0070712_100048434 Ga0070712_1000484342 303
177 3300006175 Ga0070712_100084128 Ga0070712_1000841282 303
178 3300006852 Ga0075433_10351470 Ga0075433_103514702 303
179 3300009094 Ga0111539_10421933 Ga0111539_104219331 303
180 3300009098 Ga0105245_10000040 Ga0105245_10000040136 303
181 3300009098 Ga0105245_10386937 Ga0105245_103869372 303
182 3300009148 Ga0105243_10311747 Ga0105243_103117472 303
183 3300009553 Ga0105249_10000150 Ga0105249_1000015045 303
184 3300025893 Ga0207682_10000012 Ga0207682_1000001217 303
185 3300025915 Ga0207693_10012719 Ga0207693_100127193 303
186 3300025916 Ga0207663_10028222 Ga0207663_100282224 303
187 3300025916 Ga0207663_10072021 Ga0207663_100720212 303
188 3300025921 Ga0207652_10378918 Ga0207652_103789182 303
189 3300025927 Ga0207687_10000142 Ga0207687_100001425 303
190 3300025935 Ga0207709_10145228 Ga0207709_101452282 303
191 3300025961 Ga0207712_10000027 Ga0207712_1000002748 303
192 3300025972 Ga0207668_10267826 Ga0207668_102678262 303
193 3300025981 Ga0207640_10007936 Ga0207640_100079363 303
194 3300028379 Ga0268266_10045560 Ga0268266_100455603 303
195 3300035410 Ga0373924_0058796 Ga0373924_0058796_619_1536 303
196 3300035724 Ga0373933_0037081 Ga0373933_0037081_1857_2774 303
197 3300036401 Ga0373937_0034372 Ga0373937_0034372_1609_2526 303
198 3300037418 Ga0395900_0253578 Ga0395900_0253578_682_1626 303
199 3300037466 Ga0395898_0019149 Ga0395898_0019149_782_1726 303
200 3300038443 Ga0395901_0048772 Ga0395901_0048772_2939_3883 303
201 3300039437 Ga0436365_1023867 Ga0436365_1023867_1139_2056 303
202 3300039437 Ga0436365_1038045 Ga0436365_1038045_749_1666 303
203 3300039447 Ga0436361_0208010 Ga0436361_0208010_476_1393 303
204 3300042012 Ga0439455_0032242 Ga0439455_0032242_260_1183 303
205 3300044683 Ga0466965_0006363 Ga0466965_0006363_2334_3251 303
206 3300044694 Ga0466963_0001716 Ga0466963_0001716_4239_5156 303
207 3300044719 Ga0466971_0021326 Ga0466971_0021326_326_1387 303
208 3300044735 Ga0466968_0049837 Ga0466968_0049837_311_1228 303
209 3300044842 Ga0466957_0003643 Ga0466957_0003643_2451_3368 303
210 3300044901 Ga0466960_0108551 Ga0466960_0108551_389_1309 303
211 3300045049 Ga0466959_0002338 Ga0466959_0002338_8969_9886 303
212 3300045836 Ga0466958_0010554 Ga0466958_0010554_1300_2217 303
213 3300045976 Ga0466967_0020794 Ga0466967_0020794_2056_3000 303
214 3300046462 Ga0495651_0089336 Ga0495651_0089336_556_1473 303
215 3300046463 Ga0495653_0110289 Ga0495653_0110289_597_1514 303
216 3300046477 Ga0495664_0072967 Ga0495664_0072967_423_1340 303
217 3300046511 Ga0495608_0033678 Ga0495608_0033678_1039_1956 303
218 3300046517 Ga0495630_0076394 Ga0495630_0076394_144_1061 303
219 3300046529 Ga0495652_0031329 Ga0495652_0031329_3564_4481 303
220 3300046535 Ga0495586_0000294 Ga0495586_0000294_11100_12023 303
221 3300046536 Ga0495587_0011324 Ga0495587_0011324_2228_3145 303
222 3300046559 Ga0495667_0081674 Ga0495667_0081674_324_1241 303
223 3300046663 Ga0495635_0131842 Ga0495635_0131842_159_1076 303
224 3300046679 Ga0495623_0007286 Ga0495623_0007286_2524_3441 303
225 3300046690 Ga0495624_0000030 Ga0495624_0000030_6850_7773 303
226 3300047317 Ga0495604_0143286 Ga0495604_0143286_597_1514 303
227 3300047322 Ga0495680_0030962 Ga0495680_0030962_740_1657 303
228 3300048088 Ga0495602_0105164 Ga0495602_0105164_727_1644 303
229 3300048903 Ga0496100_0000024 Ga0496100_0000024_11720_12637 303
230 3300048904 Ga0496101_0000072 Ga0496101_0000072_103502_104419 303
231 3300048909 Ga0496106_0000040 Ga0496106_0000040_4336_5253 303
232 3300048910 Ga0496107_0000025 Ga0496107_0000025_11720_12637 303
233 3300048911 Ga0496108_0000039 Ga0496108_0000039_41614_42531 303
234 3300048912 Ga0496109_0000038 Ga0496109_0000038_107139_108056 303
235 3300048918 Ga0496115_0073372 Ga0496115_0073372_44_961 303
236 3300048919 Ga0496116_0000176 Ga0496116_0000176_77889_78806 303
237 3300048921 Ga0496118_0082354 Ga0496118_0082354_1230_2147 303
238 3300048922 Ga0496119_0001444 Ga0496119_0001444_23431_24348 303
239 3300049576 Ga0501040_0084985 Ga0501040_0084985_1138_2055 303
240 3300049581 Ga0501047_0258594 Ga0501047_0258594_85_1005 303
241 3300049587 Ga0501071_0170259 Ga0501071_0170259_495_1412 303
242 3300049588 Ga0501072_0133313 Ga0501072_0133313_159_1076 303
243 3300049592 Ga0501076_0042370 Ga0501076_0042370_1323_2240 303
244 3300049741 Ga0501079_0300324 Ga0501079_0300324_59_976 303
245 3300050507 nmdc:mga05p37_60865_c1 nmdc:mga05p37_60865_c1_3667_4581 303
246 3300050515 nmdc:mga0a205_110029_c1 nmdc:mga0a205_110029_c1_108_1022 303
247 3300053084 Ga0495595_0024120 Ga0495595_0024120_398_1315 303
248 3300053085 Ga0495619_0066284 Ga0495619_0066284_632_1549 303
249 3300054114 Ga0501084_0105644 Ga0501084_0105644_1381_2298 303
250 3300060353 Ga0501082_0122007 Ga0501082_0122007_309_1226 303
251 3300061734 Ga0530510_0058963 Ga0530510_0058963_1343_2260 303
252 3300003373 JGI25407J50210_10025727 JGI25407J50210_100257271 304
253 3300005327 Ga0070658_10080642 Ga0070658_100806422 304
254 3300005329 Ga0070683_100009946 Ga0070683_1000099469 304
255 3300005329 Ga0070683_100019594 Ga0070683_1000195947 304
256 3300005329 Ga0070683_100170219 Ga0070683_1001702192 304
257 3300005329 Ga0070683_100284168 Ga0070683_1002841682 304
258 3300005329 Ga0070683_100323683 Ga0070683_1003236832 304
259 3300005330 Ga0070690_100014049 Ga0070690_1000140493 304
260 3300005336 Ga0070680_100140757 Ga0070680_1001407573 304
261 3300005336 Ga0070680_100159976 Ga0070680_1001599762 304
262 3300005337 Ga0070682_100008022 Ga0070682_1000080227 304
263 3300005337 Ga0070682_100127257 Ga0070682_1001272571 304
264 3300005338 Ga0068868_100008367 Ga0068868_1000083672 304
265 3300005339 Ga0070660_100245268 Ga0070660_1002452681 304
266 3300005341 Ga0070691_10015127 Ga0070691_100151274 304
267 3300005341 Ga0070691_10030432 Ga0070691_100304322 304
268 3300005347 Ga0070668_100002605 Ga0070668_1000026058 304
269 3300005347 Ga0070668_100005448 Ga0070668_1000054486 304
270 3300005365 Ga0070688_100154568 Ga0070688_1001545681 304
271 3300005366 Ga0070659_100062719 Ga0070659_1000627194 304
272 3300005366 Ga0070659_100185818 Ga0070659_1001858182 304
273 3300005367 Ga0070667_100008391 Ga0070667_1000083912 304
274 3300005406 Ga0070703_10017905 Ga0070703_100179052 304
275 3300005434 Ga0070709_10000154 Ga0070709_1000015435 304
276 3300005434 Ga0070709_10000593 Ga0070709_100005936 304
277 3300005434 Ga0070709_10012165 Ga0070709_100121652 304
278 3300005434 Ga0070709_10299269 Ga0070709_102992691 304
279 3300005435 Ga0070714_100000805 Ga0070714_10000080523 304
280 3300005435 Ga0070714_100001506 Ga0070714_1000015062 304
281 3300005435 Ga0070714_100001889 Ga0070714_1000018895 304
282 3300005435 Ga0070714_100002037 Ga0070714_1000020376 304
283 3300005435 Ga0070714_100011882 Ga0070714_1000118822 304
284 3300005435 Ga0070714_100020983 Ga0070714_1000209835 304
285 3300005435 Ga0070714_100035528 Ga0070714_1000355283 304
286 3300005435 Ga0070714_100039533 Ga0070714_1000395336 304
287 3300005435 Ga0070714_100128022 Ga0070714_1001280222 304
288 3300005435 Ga0070714_100233104 Ga0070714_1002331042 304
289 3300005436 Ga0070713_100000392 Ga0070713_10000039221 304
290 3300005436 Ga0070713_100000999 Ga0070713_1000009998 304
291 3300005436 Ga0070713_100013259 Ga0070713_1000132594 304
292 3300005436 Ga0070713_100016183 Ga0070713_1000161834 304
293 3300005436 Ga0070713_100020277 Ga0070713_1000202772 304
294 3300005436 Ga0070713_100044544 Ga0070713_1000445444 304
295 3300005436 Ga0070713_100097384 Ga0070713_1000973842 304
296 3300005436 Ga0070713_100153985 Ga0070713_1001539852 304
297 3300005436 Ga0070713_100247090 Ga0070713_1002470902 304
298 3300005436 Ga0070713_100265511 Ga0070713_1002655112 304
299 3300005437 Ga0070710_10000240 Ga0070710_1000024011 304
300 3300005437 Ga0070710_10000321 Ga0070710_1000032118 304
301 3300005437 Ga0070710_10013466 Ga0070710_100134662 304
302 3300005437 Ga0070710_10025172 Ga0070710_100251722 304
303 3300005439 Ga0070711_100001255 Ga0070711_1000012553 304
304 3300005439 Ga0070711_100001547 Ga0070711_1000015473 304
305 3300005439 Ga0070711_100027302 Ga0070711_1000273023 304
306 3300005439 Ga0070711_100044736 Ga0070711_1000447363 304
307 3300005439 Ga0070711_100066246 Ga0070711_1000662461 304
308 3300005441 Ga0070700_100114025 Ga0070700_1001140252 304
309 3300005445 Ga0070708_100031333 Ga0070708_1000313333 304
310 3300005445 Ga0070708_100052103 Ga0070708_1000521033 304
311 3300005445 Ga0070708_100108488 Ga0070708_1001084882 304
312 3300005457 Ga0070662_100001262 Ga0070662_1000012627 304
313 3300005457 Ga0070662_100148488 Ga0070662_1001484882 304
314 3300005458 Ga0070681_10142135 Ga0070681_101421352 304
315 3300005467 Ga0070706_100007391 Ga0070706_1000073918 304
316 3300005467 Ga0070706_100008272 Ga0070706_1000082724 304
317 3300005467 Ga0070706_100016226 Ga0070706_1000162265 304
318 3300005467 Ga0070706_100060280 Ga0070706_1000602803 304
319 3300005467 Ga0070706_100088650 Ga0070706_1000886503 304
320 3300005467 Ga0070706_100179073 Ga0070706_1001790732 304
321 3300005468 Ga0070707_100001431 Ga0070707_10000143114 304
322 3300005468 Ga0070707_100011200 Ga0070707_1000112009 304
323 3300005468 Ga0070707_100015444 Ga0070707_1000154449 304
324 3300005468 Ga0070707_100027375 Ga0070707_1000273754 304
325 3300005468 Ga0070707_100047975 Ga0070707_1000479757 304
326 3300005468 Ga0070707_100064100 Ga0070707_1000641002 304
327 3300005468 Ga0070707_100095333 Ga0070707_1000953332 304
328 3300005468 Ga0070707_100213682 Ga0070707_1002136822 304
329 3300005471 Ga0070698_100000006 Ga0070698_100000006120 304
330 3300005471 Ga0070698_100002067 Ga0070698_1000020672 304
331 3300005471 Ga0070698_100007492 Ga0070698_1000074927 304
332 3300005471 Ga0070698_100009579 Ga0070698_1000095798 304
333 3300005471 Ga0070698_100092561 Ga0070698_1000925612 304
334 3300005471 Ga0070698_100187511 Ga0070698_1001875112 304
335 3300005471 Ga0070698_100359051 Ga0070698_1003590511 304
336 3300005471 Ga0070698_100478893 Ga0070698_1004788931 304
337 3300005518 Ga0070699_100006926 Ga0070699_1000069267 304
338 3300005518 Ga0070699_100157296 Ga0070699_1001572963 304
339 3300005518 Ga0070699_100314617 Ga0070699_1003146172 304
340 3300005530 Ga0070679_100014593 Ga0070679_1000145935 304
341 3300005530 Ga0070679_100020228 Ga0070679_1000202282 304
342 3300005530 Ga0070679_100090331 Ga0070679_1000903312 304
343 3300005535 Ga0070684_100003262 Ga0070684_1000032626 304
344 3300005535 Ga0070684_100006020 Ga0070684_1000060207 304
345 3300005535 Ga0070684_100076330 Ga0070684_1000763303 304
346 3300005535 Ga0070684_100142820 Ga0070684_1001428203 304
347 3300005535 Ga0070684_100300400 Ga0070684_1003004002 304
348 3300005535 Ga0070684_100331365 Ga0070684_1003313652 304
349 3300005536 Ga0070697_100021095 Ga0070697_1000210952 304
350 3300005536 Ga0070697_100083476 Ga0070697_1000834763 304
351 3300005536 Ga0070697_100347969 Ga0070697_1003479692 304
352 3300005539 Ga0068853_100000104 Ga0068853_10000010425 304
353 3300005547 Ga0070693_100173708 Ga0070693_1001737081 304
354 3300005548 Ga0070665_100004357 Ga0070665_1000043571 304
355 3300005548 Ga0070665_100340356 Ga0070665_1003403562 304
356 3300005548 Ga0070665_100474255 Ga0070665_1004742552 304
357 3300005549 Ga0070704_100057930 Ga0070704_1000579303 304
358 3300005549 Ga0070704_100101414 Ga0070704_1001014142 304
359 3300005563 Ga0068855_100151233 Ga0068855_1001512332 304
360 3300005614 Ga0068856_100002922 Ga0068856_10000292213 304
361 3300005614 Ga0068856_100005060 Ga0068856_1000050604 304
362 3300005614 Ga0068856_100058409 Ga0068856_1000584093 304
363 3300005614 Ga0068856_100162151 Ga0068856_1001621512 304
364 3300005614 Ga0068856_100194169 Ga0068856_1001941692 304
365 3300005615 Ga0070702_100136470 Ga0070702_1001364701 304
366 3300005615 Ga0070702_100200495 Ga0070702_1002004951 304
367 3300005617 Ga0068859_100169217 Ga0068859_1001692172 304
368 3300005618 Ga0068864_100000066 Ga0068864_10000006625 304
369 3300005718 Ga0068866_10011303 Ga0068866_100113035 304
370 3300005719 Ga0068861_100007297 Ga0068861_1000072975 304
371 3300005719 Ga0068861_100008118 Ga0068861_1000081182 304
372 3300005842 Ga0068858_100000066 Ga0068858_10000006655 304
373 3300005842 Ga0068858_100334562 Ga0068858_1003345622 304
374 3300005843 Ga0068860_100044784 Ga0068860_1000447844 304
375 3300005843 Ga0068860_100063123 Ga0068860_1000631232 304
376 3300005843 Ga0068860_100145498 Ga0068860_1001454982 304
377 3300005844 Ga0068862_100026493 Ga0068862_1000264934 304
378 3300005937 Ga0081455_10003044 Ga0081455_100030445 304
379 3300005937 Ga0081455_10004209 Ga0081455_1000420915 304
380 3300005937 Ga0081455_10072665 Ga0081455_100726651 304
381 3300005937 Ga0081455_10265088 Ga0081455_102650882 304
382 3300005981 Ga0081538_10000404 Ga0081538_1000040421 304
383 3300005981 Ga0081538_10003701 Ga0081538_100037017 304
384 3300005981 Ga0081538_10004796 Ga0081538_100047963 304
385 3300005981 Ga0081538_10007557 Ga0081538_100075573 304
386 3300005981 Ga0081538_10108040 Ga0081538_101080402 304
387 3300005983 Ga0081540_1000548 Ga0081540_100054831 304
388 3300005983 Ga0081540_1000993 Ga0081540_10009932 304
389 3300005983 Ga0081540_1002417 Ga0081540_10024172 304
390 3300006028 Ga0070717_10002723 Ga0070717_1000272311 304
391 3300006028 Ga0070717_10004745 Ga0070717_100047453 304
392 3300006028 Ga0070717_10007556 Ga0070717_100075569 304
393 3300006028 Ga0070717_10013669 Ga0070717_100136696 304
394 3300006028 Ga0070717_10017901 Ga0070717_100179017 304
395 3300006028 Ga0070717_10020149 Ga0070717_100201496 304
396 3300006028 Ga0070717_10088586 Ga0070717_100885862 304
397 3300006028 Ga0070717_10103358 Ga0070717_101033583 304
398 3300006028 Ga0070717_10122923 Ga0070717_101229233 304
399 3300006028 Ga0070717_10155064 Ga0070717_101550642 304
400 3300006028 Ga0070717_10186288 Ga0070717_101862882 304
401 3300006028 Ga0070717_10197580 Ga0070717_101975802 304
402 3300006038 Ga0075365_10020729 Ga0075365_100207292 304
403 3300006038 Ga0075365_10036705 Ga0075365_100367053 304
404 3300006163 Ga0070715_10052173 Ga0070715_100521731 304
405 3300006163 Ga0070715_10057692 Ga0070715_100576922 304
406 3300006173 Ga0070716_100000575 Ga0070716_1000005754 304
407 3300006173 Ga0070716_100004451 Ga0070716_1000044514 304
408 3300006173 Ga0070716_100012464 Ga0070716_1000124642 304
409 3300006173 Ga0070716_100022864 Ga0070716_1000228646 304
410 3300006173 Ga0070716_100028401 Ga0070716_1000284012 304
411 3300006173 Ga0070716_100030576 Ga0070716_1000305762 304
412 3300006175 Ga0070712_100001283 Ga0070712_10000128313 304
413 3300006175 Ga0070712_100014248 Ga0070712_1000142483 304
414 3300006175 Ga0070712_100037727 Ga0070712_1000377273 304
415 3300006175 Ga0070712_100121360 Ga0070712_1001213602 304
416 3300006237 Ga0097621_100030329 Ga0097621_1000303294 304
417 3300006358 Ga0068871_100035193 Ga0068871_1000351934 304
418 3300006358 Ga0068871_100048325 Ga0068871_1000483252 304
419 3300006844 Ga0075428_100338948 Ga0075428_1003389482 304
420 3300006846 Ga0075430_100159583 Ga0075430_1001595832 304
421 3300006847 Ga0075431_100008958 Ga0075431_1000089581 304
422 3300006847 Ga0075431_100030042 Ga0075431_1000300422 304
423 3300006847 Ga0075431_100394912 Ga0075431_1003949122 304
424 3300006852 Ga0075433_10012815 Ga0075433_100128154 304
425 3300006852 Ga0075433_10064345 Ga0075433_100643452 304
426 3300006852 Ga0075433_10226024 Ga0075433_102260242 304
427 3300006852 Ga0075433_10303939 Ga0075433_103039392 304
428 3300006871 Ga0075434_100020758 Ga0075434_1000207583 304
429 3300006871 Ga0075434_100026235 Ga0075434_1000262351 304
430 3300006871 Ga0075434_100030084 Ga0075434_1000300845 304
431 3300006871 Ga0075434_100030378 Ga0075434_1000303783 304
432 3300006871 Ga0075434_100042829 Ga0075434_1000428295 304
433 3300006871 Ga0075434_100077868 Ga0075434_1000778685 304
434 3300006871 Ga0075434_100123537 Ga0075434_1001235373 304
435 3300006871 Ga0075434_100255168 Ga0075434_1002551682 304
436 3300006880 Ga0075429_100001873 Ga0075429_10000187317 304
437 3300006914 Ga0075436_100036061 Ga0075436_1000360614 304
438 3300006914 Ga0075436_100037602 Ga0075436_1000376023 304
439 3300006914 Ga0075436_100126038 Ga0075436_1001260381 304
440 3300006931 Ga0097620_100169218 Ga0097620_1001692182 304
441 3300007076 Ga0075435_100051545 Ga0075435_1000515454 304
442 3300007076 Ga0075435_100063537 Ga0075435_1000635373 304
443 3300007076 Ga0075435_100150167 Ga0075435_1001501672 304
444 3300007076 Ga0075435_100184663 Ga0075435_1001846632 304
445 3300007265 Ga0099794_10030871 Ga0099794_100308712 304
446 3300009093 Ga0105240_10045752 Ga0105240_100457524 304
447 3300009094 Ga0111539_10036014 Ga0111539_100360142 304
448 3300009098 Ga0105245_10000587 Ga0105245_100005873 304
449 3300009101 Ga0105247_10001420 Ga0105247_100014205 304
450 3300009101 Ga0105247_10187099 Ga0105247_101870992 304
451 3300009147 Ga0114129_10001880 Ga0114129_1000188020 304
452 3300009147 Ga0114129_10003282 Ga0114129_1000328213 304
453 3300009147 Ga0114129_10004818 Ga0114129_100048186 304
454 3300009147 Ga0114129_10028976 Ga0114129_100289764 304
455 3300009147 Ga0114129_10049241 Ga0114129_100492418 304
456 3300009147 Ga0114129_10091153 Ga0114129_100911533 304
457 3300009147 Ga0114129_10141971 Ga0114129_101419713 304
458 3300009147 Ga0114129_10247933 Ga0114129_102479334 304
459 3300009148 Ga0105243_10289053 Ga0105243_102890532 304
460 3300009174 Ga0105241_10013332 Ga0105241_100133322 304
461 3300009174 Ga0105241_10213003 Ga0105241_102130032 304
462 3300009176 Ga0105242_10002895 Ga0105242_100028956 304
463 3300009176 Ga0105242_10020599 Ga0105242_100205992 304
464 3300009177 Ga0105248_10206760 Ga0105248_102067603 304
465 3300009177 Ga0105248_10645625 Ga0105248_106456251 304
466 3300009545 Ga0105237_10063631 Ga0105237_100636312 304
467 3300009553 Ga0105249_10003847 Ga0105249_1000384711 304
468 3300009553 Ga0105249_10007305 Ga0105249_100073054 304
469 3300009553 Ga0105249_10063664 Ga0105249_100636644 304
470 3300010375 Ga0105239_10032510 Ga0105239_100325106 304
471 3300011119 Ga0105246_10025807 Ga0105246_100258072 304
472 3300013104 Ga0157370_10017689 Ga0157370_100176893 304
473 3300013104 Ga0157370_10057944 Ga0157370_100579443 304
474 3300013105 Ga0157369_10028131 Ga0157369_100281315 304
475 3300013105 Ga0157369_10047889 Ga0157369_100478893 304
476 3300013105 Ga0157369_10076080 Ga0157369_100760803 304
477 3300013297 Ga0157378_10030670 Ga0157378_100306704 304
478 3300013297 Ga0157378_10399980 Ga0157378_103999802 304
479 3300013297 Ga0157378_10594494 Ga0157378_105944941 304
480 3300013306 Ga0163162_10220245 Ga0163162_102202453 304
481 3300013306 Ga0163162_10774183 Ga0163162_107741831 304
482 3300013307 Ga0157372_10058760 Ga0157372_100587602 304
483 3300013308 Ga0157375_10180934 Ga0157375_101809342 304
484 3300014325 Ga0163163_10044741 Ga0163163_100447414 304
485 3300014325 Ga0163163_10096748 Ga0163163_100967483 304
486 3300014325 Ga0163163_10119141 Ga0163163_101191412 304
487 3300014325 Ga0163163_10355389 Ga0163163_103553892 304
488 3300014326 Ga0157380_10002140 Ga0157380_100021407 304
489 3300014745 Ga0157377_10079100 Ga0157377_100791002 304
490 3300014968 Ga0157379_10020093 Ga0157379_100200935 304
491 3300014968 Ga0157379_10022110 Ga0157379_100221101 304
492 3300014968 Ga0157379_10022130 Ga0157379_100221302 304
493 3300014968 Ga0157379_10044390 Ga0157379_100443901 304
494 3300014968 Ga0157379_10052776 Ga0157379_100527764 304
495 3300014968 Ga0157379_10331805 Ga0157379_103318052 304
496 3300014969 Ga0157376_10419948 Ga0157376_104199482 304
497 3300017792 Ga0163161_10000027 Ga0163161_1000002797 304
498 3300017792 Ga0163161_10015637 Ga0163161_100156373 304
499 3300020070 Ga0206356_10946904 Ga0206356_109469042 304
500 3300020075 Ga0206349_1881519 Ga0206349_18815192 304
501 3300020081 Ga0206354_11671430 Ga0206354_116714301 304
502 3300020082 Ga0206353_10010222 Ga0206353_100102221 304
503 3300020082 Ga0206353_10459755 Ga0206353_104597552 304
504 3300020082 Ga0206353_10616013 Ga0206353_106160137 304
505 3300020082 Ga0206353_10980143 Ga0206353_109801432 304
506 3300021384 Ga0213876_10035158 Ga0213876_100351582 304
507 3300021384 Ga0213876_10045418 Ga0213876_100454182 304
508 3300021388 Ga0213875_10000303 Ga0213875_100003035 304
509 3300021388 Ga0213875_10003306 Ga0213875_100033063 304
510 3300021388 Ga0213875_10012957 Ga0213875_100129573 304
511 3300021388 Ga0213875_10121861 Ga0213875_101218611 304
512 3300025898 Ga0207692_10000889 Ga0207692_100008893 304
513 3300025898 Ga0207692_10001855 Ga0207692_100018554 304
514 3300025898 Ga0207692_10005663 Ga0207692_100056635 304
515 3300025898 Ga0207692_10015835 Ga0207692_100158352 304
516 3300025898 Ga0207692_10054161 Ga0207692_100541612 304
517 3300025898 Ga0207692_10059916 Ga0207692_100599162 304
518 3300025898 Ga0207692_10062729 Ga0207692_100627292 304
519 3300025898 Ga0207692_10161998 Ga0207692_101619982 304
520 3300025899 Ga0207642_10090020 Ga0207642_100900202 304
521 3300025900 Ga0207710_10000774 Ga0207710_100007745 304
522 3300025901 Ga0207688_10003585 Ga0207688_100035852 304
523 3300025901 Ga0207688_10225813 Ga0207688_102258131 304
524 3300025904 Ga0207647_10109471 Ga0207647_101094711 304
525 3300025905 Ga0207685_10044020 Ga0207685_100440201 304
526 3300025905 Ga0207685_10061337 Ga0207685_100613372 304
527 3300025906 Ga0207699_10000205 Ga0207699_1000020514 304
528 3300025906 Ga0207699_10000387 Ga0207699_1000038718 304
529 3300025906 Ga0207699_10018781 Ga0207699_100187814 304
530 3300025906 Ga0207699_10023351 Ga0207699_100233516 304
531 3300025906 Ga0207699_10055288 Ga0207699_100552882 304
532 3300025906 Ga0207699_10060730 Ga0207699_100607302 304
533 3300025909 Ga0207705_10066673 Ga0207705_100666732 304
534 3300025909 Ga0207705_10067680 Ga0207705_100676802 304
535 3300025910 Ga0207684_10006796 Ga0207684_100067968 304
536 3300025910 Ga0207684_10018145 Ga0207684_100181454 304
537 3300025910 Ga0207684_10039399 Ga0207684_100393992 304
538 3300025910 Ga0207684_10198573 Ga0207684_101985731 304
539 3300025910 Ga0207684_10331309 Ga0207684_103313092 304
540 3300025911 Ga0207654_10094907 Ga0207654_100949071 304
541 3300025914 Ga0207671_10308266 Ga0207671_103082662 304
542 3300025915 Ga0207693_10000355 Ga0207693_1000035533 304
543 3300025915 Ga0207693_10002883 Ga0207693_1000288312 304
544 3300025915 Ga0207693_10005416 Ga0207693_100054167 304
545 3300025915 Ga0207693_10012713 Ga0207693_100127139 304
546 3300025915 Ga0207693_10013787 Ga0207693_100137878 304
547 3300025915 Ga0207693_10018936 Ga0207693_100189363 304
548 3300025916 Ga0207663_10002482 Ga0207663_100024822 304
549 3300025916 Ga0207663_10010862 Ga0207663_100108625 304
550 3300025916 Ga0207663_10019008 Ga0207663_100190085 304
551 3300025916 Ga0207663_10020747 Ga0207663_100207472 304
552 3300025916 Ga0207663_10035145 Ga0207663_100351454 304
553 3300025916 Ga0207663_10035744 Ga0207663_100357442 304
554 3300025916 Ga0207663_10166059 Ga0207663_101660592 304
555 3300025917 Ga0207660_10041529 Ga0207660_100415294 304
556 3300025917 Ga0207660_10423076 Ga0207660_104230762 304
557 3300025918 Ga0207662_10025515 Ga0207662_100255154 304
558 3300025921 Ga0207652_10007942 Ga0207652_100079426 304
559 3300025921 Ga0207652_10063069 Ga0207652_100630694 304
560 3300025922 Ga0207646_10000049 Ga0207646_1000004945 304
561 3300025922 Ga0207646_10001194 Ga0207646_1000119424 304
562 3300025922 Ga0207646_10018441 Ga0207646_100184416 304
563 3300025922 Ga0207646_10021426 Ga0207646_100214266 304
564 3300025922 Ga0207646_10023460 Ga0207646_100234606 304
565 3300025922 Ga0207646_10172805 Ga0207646_101728052 304
566 3300025922 Ga0207646_10178091 Ga0207646_101780912 304
567 3300025922 Ga0207646_10230838 Ga0207646_102308382 304
568 3300025922 Ga0207646_10331994 Ga0207646_103319942 304
569 3300025927 Ga0207687_10000075 Ga0207687_1000007544 304
570 3300025928 Ga0207700_10000171 Ga0207700_1000017119 304
571 3300025928 Ga0207700_10000420 Ga0207700_100004201 304
572 3300025928 Ga0207700_10002479 Ga0207700_100024795 304
573 3300025928 Ga0207700_10004060 Ga0207700_100040603 304
574 3300025928 Ga0207700_10015476 Ga0207700_100154764 304
575 3300025928 Ga0207700_10016530 Ga0207700_100165302 304
576 3300025928 Ga0207700_10027423 Ga0207700_100274234 304
577 3300025928 Ga0207700_10049847 Ga0207700_100498473 304
578 3300025928 Ga0207700_10209171 Ga0207700_102091712 304
579 3300025928 Ga0207700_10218064 Ga0207700_102180641 304
580 3300025928 Ga0207700_10251548 Ga0207700_102515482 304
581 3300025928 Ga0207700_10275358 Ga0207700_102753582 304
582 3300025928 Ga0207700_10295257 Ga0207700_102952572 304
583 3300025929 Ga0207664_10000190 Ga0207664_1000019020 304
584 3300025929 Ga0207664_10000345 Ga0207664_1000034533 304
585 3300025929 Ga0207664_10001768 Ga0207664_100017683 304
586 3300025929 Ga0207664_10005031 Ga0207664_100050315 304
587 3300025929 Ga0207664_10033765 Ga0207664_100337653 304
588 3300025929 Ga0207664_10054100 Ga0207664_100541003 304
589 3300025929 Ga0207664_10055171 Ga0207664_100551712 304
590 3300025929 Ga0207664_10064330 Ga0207664_100643303 304
591 3300025929 Ga0207664_10126525 Ga0207664_101265251 304
592 3300025929 Ga0207664_10171524 Ga0207664_101715243 304
593 3300025929 Ga0207664_10212255 Ga0207664_102122552 304
594 3300025929 Ga0207664_10251568 Ga0207664_102515682 304
595 3300025932 Ga0207690_10004837 Ga0207690_100048372 304
596 3300025932 Ga0207690_10072669 Ga0207690_100726691 304
597 3300025933 Ga0207706_10001340 Ga0207706_1000134012 304
598 3300025933 Ga0207706_10084154 Ga0207706_100841543 304
599 3300025934 Ga0207686_10000544 Ga0207686_1000054411 304
600 3300025934 Ga0207686_10007653 Ga0207686_100076533 304
601 3300025935 Ga0207709_10035348 Ga0207709_100353481 304
602 3300025939 Ga0207665_10003456 Ga0207665_100034567 304
603 3300025939 Ga0207665_10004389 Ga0207665_100043895 304
604 3300025939 Ga0207665_10006851 Ga0207665_100068513 304
605 3300025939 Ga0207665_10007018 Ga0207665_100070185 304
606 3300025939 Ga0207665_10050407 Ga0207665_100504073 304
607 3300025941 Ga0207711_10195683 Ga0207711_101956832 304
608 3300025941 Ga0207711_10337835 Ga0207711_103378352 304
609 3300025942 Ga0207689_10004300 Ga0207689_1000430010 304
610 3300025944 Ga0207661_10000883 Ga0207661_100008836 304
611 3300025944 Ga0207661_10035139 Ga0207661_100351392 304
612 3300025944 Ga0207661_10060133 Ga0207661_100601332 304
613 3300025944 Ga0207661_10063053 Ga0207661_100630531 304
614 3300025944 Ga0207661_10128530 Ga0207661_101285302 304
615 3300025944 Ga0207661_10196366 Ga0207661_101963662 304
616 3300025945 Ga0207679_10159659 Ga0207679_101596592 304
617 3300025949 Ga0207667_10131027 Ga0207667_101310274 304
618 3300025960 Ga0207651_10007137 Ga0207651_100071375 304
619 3300025961 Ga0207712_10095362 Ga0207712_100953623 304
620 3300025986 Ga0207658_10048955 Ga0207658_100489553 304
621 3300026035 Ga0207703_10000053 Ga0207703_1000005325 304
622 3300026035 Ga0207703_10000054 Ga0207703_1000005454 304
623 3300026041 Ga0207639_10000644 Ga0207639_1000064420 304
624 3300026041 Ga0207639_10061912 Ga0207639_100619122 304
625 3300026067 Ga0207678_10015803 Ga0207678_100158033 304
626 3300026075 Ga0207708_10066034 Ga0207708_100660342 304
627 3300026078 Ga0207702_10004647 Ga0207702_100046478 304
628 3300026078 Ga0207702_10005043 Ga0207702_1000504312 304
629 3300026078 Ga0207702_10008856 Ga0207702_100088564 304
630 3300026078 Ga0207702_10286944 Ga0207702_102869442 304
631 3300026078 Ga0207702_10380157 Ga0207702_103801572 304
632 3300026089 Ga0207648_10000872 Ga0207648_1000087221 304
633 3300026095 Ga0207676_10000038 Ga0207676_1000003875 304
634 3300026095 Ga0207676_10063085 Ga0207676_100630852 304
635 3300026095 Ga0207676_10248977 Ga0207676_102489772 304
636 3300026116 Ga0207674_10188255 Ga0207674_101882552 304
637 3300026118 Ga0207675_100001652 Ga0207675_1000016529 304
638 3300026118 Ga0207675_100101425 Ga0207675_1001014254 304
639 3300026121 Ga0207683_10004405 Ga0207683_100044056 304
640 3300026121 Ga0207683_10019744 Ga0207683_100197442 304
641 3300026142 Ga0207698_10092654 Ga0207698_100926542 304
642 3300027671 Ga0209588_1052850 Ga0209588_10528502 304
643 3300028379 Ga0268266_10000099 Ga0268266_1000009955 304
644 3300028379 Ga0268266_10000264 Ga0268266_100002645 304
645 3300028379 Ga0268266_10005669 Ga0268266_100056696 304
646 3300028379 Ga0268266_10174315 Ga0268266_101743152 304
647 3300028379 Ga0268266_10281180 Ga0268266_102811802 304
648 3300028380 Ga0268265_10197906 Ga0268265_101979062 304
649 3300028380 Ga0268265_10292987 Ga0268265_102929872 304
650 3300028381 Ga0268264_10010773 Ga0268264_100107734 304
651 3300028556 Ga0265337_1007111 Ga0265337_10071113 304
652 3300028558 Ga0265326_10000554 Ga0265326_1000055414 304
653 3300028563 Ga0265319_1000035 Ga0265319_100003587 304
654 3300028563 Ga0265319_1000191 Ga0265319_100019114 304
655 3300028577 Ga0265318_10003090 Ga0265318_100030906 304
656 3300028654 Ga0265322_10004388 Ga0265322_100043882 304
657 3300028666 Ga0265336_10000005 Ga0265336_10000005199 304
658 3300028666 Ga0265336_10020783 Ga0265336_100207832 304
659 3300028800 Ga0265338_10000001 Ga0265338_100000011015 304
660 3300028800 Ga0265338_10000171 Ga0265338_1000017190 304
661 3300028800 Ga0265338_10208084 Ga0265338_102080842 304
662 3300029957 Ga0265324_10003754 Ga0265324_100037546 304
663 3300029957 Ga0265324_10025923 Ga0265324_100259232 304
664 3300031241 Ga0265325_10009289 Ga0265325_100092897 304
665 3300031247 Ga0265340_10000001 Ga0265340_100000011013 304
666 3300031249 Ga0265339_10009468 Ga0265339_100094682 304
667 3300031251 Ga0265327_10003224 Ga0265327_1000322416 304
668 3300031251 Ga0265327_10003237 Ga0265327_100032372 304
669 3300031251 Ga0265327_10053767 Ga0265327_100537672 304
670 3300031344 Ga0265316_10027474 Ga0265316_100274743 304
671 3300031712 Ga0265342_10089564 Ga0265342_100895642 304
672 3300031824 Ga0307413_10028983 Ga0307413_100289831 304
673 3300031852 Ga0307410_10283147 Ga0307410_102831472 304
674 3300031901 Ga0307406_10023547 Ga0307406_100235472 304
675 3300031903 Ga0307407_10102814 Ga0307407_101028142 304
676 3300031995 Ga0307409_100004099 Ga0307409_1000040991 304
677 3300031995 Ga0307409_100524617 Ga0307409_1005246171 304
678 3300032002 Ga0307416_100011231 Ga0307416_1000112316 304
679 3300032002 Ga0307416_100028753 Ga0307416_1000287533 304
680 3300032004 Ga0307414_10253168 Ga0307414_102531682 304
681 3300032126 Ga0307415_100278853 Ga0307415_1002788531 304
682 3300035086 Ga0373934_0000367 Ga0373934_0000367_9403_10323 304
683 3300035086 Ga0373934_0005781 Ga0373934_0005781_574_1494 304
684 3300035086 Ga0373934_0019439 Ga0373934_0019439_975_1895 304
685 3300035086 Ga0373934_0058983 Ga0373934_0058983_431_1351 304
686 3300035086 Ga0373934_0061345 Ga0373934_0061345_163_1083 304
687 3300035092 Ga0373952_0011597 Ga0373952_0011597_606_1682 304
688 3300035111 Ga0373923_0033764 Ga0373923_0033764_59_979 304
689 3300035111 Ga0373923_0085243 Ga0373923_0085243_279_1199 304
690 3300035112 Ga0373932_0021183 Ga0373932_0021183_294_1214 304
691 3300035113 Ga0373936_0014198 Ga0373936_0014198_957_1904 304
692 3300035114 Ga0373939_0008979 Ga0373939_0008979_97_1173 304
693 3300035116 Ga0373945_0016069 Ga0373945_0016069_667_1587 304
694 3300035116 Ga0373945_0055410 Ga0373945_0055410_397_1344 304
695 3300035117 Ga0373953_0000284 Ga0373953_0000284_5444_6364 304
696 3300035117 Ga0373953_0002884 Ga0373953_0002884_80_1000 304
697 3300035117 Ga0373953_0006023 Ga0373953_0006023_3039_3959 304
698 3300035117 Ga0373953_0038103 Ga0373953_0038103_611_1531 304
699 3300035117 Ga0373953_0040961 Ga0373953_0040961_366_1286 304
700 3300035118 Ga0373954_0002438 Ga0373954_0002438_4866_5786 304
701 3300035118 Ga0373954_0021640 Ga0373954_0021640_1563_2483 304
702 3300035119 Ga0373956_0000460 Ga0373956_0000460_5414_6334 304
703 3300035119 Ga0373956_0018799 Ga0373956_0018799_1876_2796 304
704 3300035119 Ga0373956_0045754 Ga0373956_0045754_1002_1922 304
705 3300035119 Ga0373956_0060502 Ga0373956_0060502_151_1071 304
706 3300035119 Ga0373956_0071832 Ga0373956_0071832_645_1568 304
707 3300035119 Ga0373956_0072460 Ga0373956_0072460_272_1192 304
708 3300035120 Ga0373957_0000097 Ga0373957_0000097_10487_11407 304
709 3300035120 Ga0373957_0006738 Ga0373957_0006738_1959_2879 304
710 3300035120 Ga0373957_0054182 Ga0373957_0054182_63_983 304
711 3300035120 Ga0373957_0108744 Ga0373957_0108744_68_988 304
712 3300035121 Ga0373960_0010129 Ga0373960_0010129_91_1167 304
713 3300035170 Ga0373943_0081634 Ga0373943_0081634_188_1108 304
714 3300035170 Ga0373943_0139223 Ga0373943_0139223_218_1138 304
715 3300035171 Ga0373946_0038353 Ga0373946_0038353_301_1224 304
716 3300035171 Ga0373946_0066643 Ga0373946_0066643_595_1515 304
717 3300035172 Ga0373955_0000658 Ga0373955_0000658_5407_6327 304
718 3300035172 Ga0373955_0028674 Ga0373955_0028674_877_1824 304
719 3300035172 Ga0373955_0052535 Ga0373955_0052535_739_1662 304
720 3300035172 Ga0373955_0060627 Ga0373955_0060627_49_969 304
721 3300035172 Ga0373955_0068305 Ga0373955_0068305_232_1152 304
722 3300035172 Ga0373955_0069812 Ga0373955_0069812_771_1691 304
723 3300035172 Ga0373955_0156566 Ga0373955_0156566_199_1119 304
724 3300035172 Ga0373955_0219859 Ga0373955_0219859_44_964 304
725 3300035691 Ga0373931_0003652 Ga0373931_0003652_5078_6088 304
726 3300035692 Ga0373935_0001773 Ga0373935_0001773_6611_7531 304
727 3300035692 Ga0373935_0007414 Ga0373935_0007414_2472_3419 304
728 3300035692 Ga0373935_0022017 Ga0373935_0022017_1865_2785 304
729 3300035692 Ga0373935_0036195 Ga0373935_0036195_574_1497 304
730 3300035692 Ga0373935_0077093 Ga0373935_0077093_219_1139 304
731 3300035692 Ga0373935_0227704 Ga0373935_0227704_291_1211 304
732 3300035692 Ga0373935_0288323 Ga0373935_0288323_176_1096 304
733 3300035695 Ga0373927_0055680 Ga0373927_0055680_296_1216 304
734 3300035724 Ga0373933_0000050 Ga0373933_0000050_46389_47309 304
735 3300035724 Ga0373933_0001483 Ga0373933_0001483_984_1904 304
736 3300035724 Ga0373933_0009346 Ga0373933_0009346_2028_2951 304
737 3300035724 Ga0373933_0010120 Ga0373933_0010120_1776_2696 304
738 3300035724 Ga0373933_0021920 Ga0373933_0021920_2199_3119 304
739 3300035724 Ga0373933_0025573 Ga0373933_0025573_244_1164 304
740 3300035724 Ga0373933_0082857 Ga0373933_0082857_612_1532 304
741 3300035724 Ga0373933_0123519 Ga0373933_0123519_507_1427 304
742 3300035724 Ga0373933_0187743 Ga0373933_0187743_347_1267 304
743 3300035725 Ga0373947_0020821 Ga0373947_0020821_232_1152 304
744 3300035725 Ga0373947_0082956 Ga0373947_0082956_960_1880 304
745 3300035725 Ga0373947_0113764 Ga0373947_0113764_13_960 304
746 3300036401 Ga0373937_0001377 Ga0373937_0001377_7249_8169 304
747 3300036401 Ga0373937_0002185 Ga0373937_0002185_10018_10938 304
748 3300036401 Ga0373937_0011544 Ga0373937_0011544_6434_7354 304
749 3300036401 Ga0373937_0011647 Ga0373937_0011647_2568_3488 304
750 3300036401 Ga0373937_0021560 Ga0373937_0021560_2704_3624 304
751 3300036401 Ga0373937_0021809 Ga0373937_0021809_2102_3025 304
752 3300036401 Ga0373937_0134046 Ga0373937_0134046_1001_1921 304
753 3300036401 Ga0373937_0156865 Ga0373937_0156865_374_1294 304
754 3300036401 Ga0373937_0179778 Ga0373937_0179778_253_1173 304
755 3300037068 Ga0373925_0000070 Ga0373925_0000070_7898_8818 304
756 3300037068 Ga0373925_0007357 Ga0373925_0007357_5801_6721 304
757 3300037068 Ga0373925_0028305 Ga0373925_0028305_2079_3059 304
758 3300037068 Ga0373925_0045468 Ga0373925_0045468_577_1500 304
759 3300037068 Ga0373925_0196836 Ga0373925_0196836_200_1120 304
760 3300037068 Ga0373925_0207590 Ga0373925_0207590_252_1172 304
761 3300037068 Ga0373925_0345402 Ga0373925_0345402_264_1184 304
762 3300037312 Ga0395899_0207919 Ga0395899_0207919_208_1128 304
763 3300037418 Ga0395900_0015425 Ga0395900_0015425_195_1115 304
764 3300037418 Ga0395900_0092034 Ga0395900_0092034_1805_2725 304
765 3300037418 Ga0395900_0116821 Ga0395900_0116821_1255_2181 304
766 3300037418 Ga0395900_0203658 Ga0395900_0203658_947_1867 304
767 3300037466 Ga0395898_0006087 Ga0395898_0006087_3035_3955 304
768 3300037466 Ga0395898_0018695 Ga0395898_0018695_5642_6562 304
769 3300037466 Ga0395898_0142576 Ga0395898_0142576_492_1424 304
770 3300037466 Ga0395898_0197363 Ga0395898_0197363_818_1738 304
771 3300037471 Ga0395905_0026912 Ga0395905_0026912_1184_2104 304
772 3300037853 Ga0436364_0238171 Ga0436364_0238171_25795_26715 304
773 3300037853 Ga0436364_0330965 Ga0436364_0330965_197036_197986 304
774 3300037853 Ga0436364_0524591 Ga0436364_0524591_1839_2759 304
775 3300037853 Ga0436364_0572747 Ga0436364_0572747_193_1128 304
776 3300037853 Ga0436364_0634583 Ga0436364_0634583_56_976 304
777 3300037853 Ga0436364_0722882 Ga0436364_0722882_8318_9238 304
778 3300037853 Ga0436364_0786424 Ga0436364_0786424_1787_2707 304
779 3300037853 Ga0436364_0999677 Ga0436364_0999677_746_1666 304
780 3300037853 Ga0436364_1143930 Ga0436364_1143930_471_1391 304
781 3300037853 Ga0436364_1297801 Ga0436364_1297801_328_1248 304
782 3300037853 Ga0436364_1371035 Ga0436364_1371035_1420_2343 304
783 3300038443 Ga0395901_0002310 Ga0395901_0002310_7107_8027 304
784 3300038443 Ga0395901_0003924 Ga0395901_0003924_4119_5039 304
785 3300038443 Ga0395901_0014047 Ga0395901_0014047_5731_6651 304
786 3300038443 Ga0395901_0064427 Ga0395901_0064427_1246_2166 304
787 3300038443 Ga0395901_0197366 Ga0395901_0197366_195_1115 304
788 3300038443 Ga0395901_0208522 Ga0395901_0208522_408_1328 304
789 3300039437 Ga0436365_0404127 Ga0436365_0404127_1309_2229 304
790 3300039437 Ga0436365_1776465 Ga0436365_1776465_811_1731 304
791 3300039437 Ga0436365_1925555 Ga0436365_1925555_2649_3569 304
792 3300039438 Ga0436360_1033781 Ga0436360_1033781_80_1000 304
793 3300039450 Ga0436363_0169393 Ga0436363_0169393_10800_11720 304
794 3300039450 Ga0436363_1626173 Ga0436363_1626173_159_1079 304
795 3300039453 Ga0436362_0179366 Ga0436362_0179366_1980_2900 304
796 3300041512 Ga0451853_1682050 Ga0451853_1682050_1686_2606 304
797 3300042005 Ga0439448_0065792 Ga0439448_0065792_231_1190 304
798 3300044656 Ga0466969_0142216 Ga0466969_0142216_43_963 304
799 3300044683 Ga0466965_0153670 Ga0466965_0153670_74_1081 304
800 3300044684 Ga0466966_0071821 Ga0466966_0071821_906_1826 304
801 3300044693 Ga0466961_0030272 Ga0466961_0030272_903_1823 304
802 3300044694 Ga0466963_0000011 Ga0466963_0000011_17773_18693 304
803 3300044694 Ga0466963_0001804 Ga0466963_0001804_1009_1929 304
804 3300044694 Ga0466963_0032858 Ga0466963_0032858_458_1378 304
805 3300044706 Ga0466964_0001347 Ga0466964_0001347_1634_2554 304
806 3300044735 Ga0466968_0033068 Ga0466968_0033068_899_1819 304
807 3300044735 Ga0466968_0127695 Ga0466968_0127695_131_1054 304
808 3300044765 Ga0466970_0073719 Ga0466970_0073719_819_1739 304
809 3300044901 Ga0466960_0085110 Ga0466960_0085110_163_1086 304
810 3300045049 Ga0466959_0014392 Ga0466959_0014392_2654_3574 304
811 3300045049 Ga0466959_0023232 Ga0466959_0023232_2002_2922 304
812 3300045049 Ga0466959_0048531 Ga0466959_0048531_772_1695 304
813 3300045836 Ga0466958_0007146 Ga0466958_0007146_809_1729 304
814 3300045836 Ga0466958_0037312 Ga0466958_0037312_1302_2222 304
815 3300045836 Ga0466958_0073161 Ga0466958_0073161_1137_2057 304
816 3300045836 Ga0466958_0149922 Ga0466958_0149922_523_1446 304
817 3300045976 Ga0466967_0000130 Ga0466967_0000130_11741_12661 304
818 3300045976 Ga0466967_0007002 Ga0466967_0007002_5729_6649 304
819 3300045976 Ga0466967_0021730 Ga0466967_0021730_3141_4067 304
820 3300045976 Ga0466967_0062093 Ga0466967_0062093_290_1210 304
821 3300045976 Ga0466967_0196345 Ga0466967_0196345_874_1794 304
822 3300045976 Ga0466967_0212758 Ga0466967_0212758_545_1468 304
823 3300045976 Ga0466967_0264878 Ga0466967_0264878_525_1445 304
824 3300045976 Ga0466967_0362967 Ga0466967_0362967_98_1018 304
825 3300045976 Ga0466967_0444813 Ga0466967_0444813_56_976 304
826 3300046454 Ga0495592_0001465 Ga0495592_0001465_5454_6374 304
827 3300046454 Ga0495592_0011582 Ga0495592_0011582_773_1693 304
828 3300046454 Ga0495592_0045132 Ga0495592_0045132_676_1596 304
829 3300046454 Ga0495592_0048084 Ga0495592_0048084_1981_2901 304
830 3300046454 Ga0495592_0095344 Ga0495592_0095344_477_1400 304
831 3300046454 Ga0495592_0136300 Ga0495592_0136300_344_1264 304
832 3300046455 Ga0495603_0000002 Ga0495603_0000002_24437_25363 304
833 3300046455 Ga0495603_0104688 Ga0495603_0104688_625_1545 304
834 3300046455 Ga0495603_0145202 Ga0495603_0145202_216_1136 304
835 3300046459 Ga0495629_0019560 Ga0495629_0019560_392_1312 304
836 3300046459 Ga0495629_0023063 Ga0495629_0023063_195_1115 304
837 3300046459 Ga0495629_0041848 Ga0495629_0041848_604_1530 304
838 3300046459 Ga0495629_0052393 Ga0495629_0052393_1320_2267 304
839 3300046461 Ga0495641_0010985 Ga0495641_0010985_354_1274 304
840 3300046461 Ga0495641_0028608 Ga0495641_0028608_847_1773 304
841 3300046461 Ga0495641_0101635 Ga0495641_0101635_214_1134 304
842 3300046461 Ga0495641_0137723 Ga0495641_0137723_68_988 304
843 3300046462 Ga0495651_0000006 Ga0495651_0000006_165204_166124 304
844 3300046462 Ga0495651_0000690 Ga0495651_0000690_16294_17214 304
845 3300046462 Ga0495651_0002869 Ga0495651_0002869_4973_5893 304
846 3300046462 Ga0495651_0026197 Ga0495651_0026197_3107_4027 304
847 3300046462 Ga0495651_0031555 Ga0495651_0031555_750_1670 304
848 3300046462 Ga0495651_0086925 Ga0495651_0086925_1365_2285 304
849 3300046462 Ga0495651_0192384 Ga0495651_0192384_454_1374 304
850 3300046463 Ga0495653_0000179 Ga0495653_0000179_9091_10011 304
851 3300046463 Ga0495653_0003668 Ga0495653_0003668_5447_6367 304
852 3300046463 Ga0495653_0009824 Ga0495653_0009824_6370_7293 304
853 3300046463 Ga0495653_0025545 Ga0495653_0025545_2386_3306 304
854 3300046463 Ga0495653_0033280 Ga0495653_0033280_2869_3789 304
855 3300046463 Ga0495653_0050261 Ga0495653_0050261_2243_3163 304
856 3300046463 Ga0495653_0077847 Ga0495653_0077847_657_1577 304
857 3300046463 Ga0495653_0079750 Ga0495653_0079750_1320_2267 304
858 3300046463 Ga0495653_0081526 Ga0495653_0081526_1068_1994 304
859 3300046463 Ga0495653_0213037 Ga0495653_0213037_344_1264 304
860 3300046471 Ga0495650_0000035 Ga0495650_0000035_308919_309839 304
861 3300046472 Ga0495580_0135512 Ga0495580_0135512_219_1139 304
862 3300046473 Ga0495582_0000005 Ga0495582_0000005_13668_14594 304
863 3300046473 Ga0495582_0004052 Ga0495582_0004052_3024_3971 304
864 3300046473 Ga0495582_0053512 Ga0495582_0053512_237_1157 304
865 3300046475 Ga0495639_0181001 Ga0495639_0181001_74_994 304
866 3300046476 Ga0495662_0000010 Ga0495662_0000010_16707_17633 304
867 3300046476 Ga0495662_0036605 Ga0495662_0036605_936_1856 304
868 3300046476 Ga0495662_0045917 Ga0495662_0045917_31_951 304
869 3300046476 Ga0495662_0081225 Ga0495662_0081225_182_1102 304
870 3300046476 Ga0495662_0125418 Ga0495662_0125418_273_1193 304
871 3300046477 Ga0495664_0000036 Ga0495664_0000036_30412_31332 304
872 3300046477 Ga0495664_0011350 Ga0495664_0011350_2896_3843 304
873 3300046477 Ga0495664_0071503 Ga0495664_0071503_281_1201 304
874 3300046491 Ga0495584_0146190 Ga0495584_0146190_242_1168 304
875 3300046499 Ga0495594_0181508 Ga0495594_0181508_225_1145 304
876 3300046511 Ga0495608_0000115 Ga0495608_0000115_54629_55555 304
877 3300046511 Ga0495608_0000161 Ga0495608_0000161_41512_42432 304
878 3300046511 Ga0495608_0003722 Ga0495608_0003722_8494_9417 304
879 3300046511 Ga0495608_0006602 Ga0495608_0006602_200_1120 304
880 3300046511 Ga0495608_0008262 Ga0495608_0008262_3019_3939 304
881 3300046511 Ga0495608_0119826 Ga0495608_0119826_210_1130 304
882 3300046514 Ga0495618_0000076 Ga0495618_0000076_42315_43235 304
883 3300046514 Ga0495618_0027823 Ga0495618_0027823_2400_3320 304
884 3300046514 Ga0495618_0128868 Ga0495618_0128868_616_1539 304
885 3300046514 Ga0495618_0269468 Ga0495618_0269468_100_1020 304
886 3300046515 Ga0495620_0000747 Ga0495620_0000747_10606_11532 304
887 3300046516 Ga0495628_0002978 Ga0495628_0002978_8812_9732 304
888 3300046516 Ga0495628_0017619 Ga0495628_0017619_1403_2323 304
889 3300046516 Ga0495628_0043289 Ga0495628_0043289_1413_2333 304
890 3300046516 Ga0495628_0048475 Ga0495628_0048475_1818_2741 304
891 3300046516 Ga0495628_0056079 Ga0495628_0056079_227_1174 304
892 3300046516 Ga0495628_0062391 Ga0495628_0062391_1918_2844 304
893 3300046516 Ga0495628_0074604 Ga0495628_0074604_1300_2220 304
894 3300046516 Ga0495628_0184089 Ga0495628_0184089_112_1032 304
895 3300046516 Ga0495628_0233485 Ga0495628_0233485_216_1136 304
896 3300046516 Ga0495628_0258204 Ga0495628_0258204_233_1153 304
897 3300046517 Ga0495630_0000891 Ga0495630_0000891_7185_8105 304
898 3300046517 Ga0495630_0001902 Ga0495630_0001902_6082_7002 304
899 3300046517 Ga0495630_0018213 Ga0495630_0018213_802_1728 304
900 3300046517 Ga0495630_0022674 Ga0495630_0022674_1036_1956 304
901 3300046517 Ga0495630_0023448 Ga0495630_0023448_1214_2134 304
902 3300046517 Ga0495630_0067956 Ga0495630_0067956_169_1089 304
903 3300046517 Ga0495630_0094389 Ga0495630_0094389_944_1864 304
904 3300046517 Ga0495630_0120996 Ga0495630_0120996_907_1827 304
905 3300046517 Ga0495630_0259637 Ga0495630_0259637_207_1127 304
906 3300046517 Ga0495630_0387122 Ga0495630_0387122_64_984 304
907 3300046529 Ga0495652_0001682 Ga0495652_0001682_17593_18513 304
908 3300046529 Ga0495652_0004882 Ga0495652_0004882_2844_3764 304
909 3300046529 Ga0495652_0013833 Ga0495652_0013833_6236_7183 304
910 3300046529 Ga0495652_0016179 Ga0495652_0016179_3793_4719 304
911 3300046529 Ga0495652_0024932 Ga0495652_0024932_780_1703 304
912 3300046529 Ga0495652_0028877 Ga0495652_0028877_3388_4308 304
913 3300046529 Ga0495652_0030805 Ga0495652_0030805_2478_3398 304
914 3300046529 Ga0495652_0096289 Ga0495652_0096289_1318_2238 304
915 3300046529 Ga0495652_0189643 Ga0495652_0189643_325_1245 304
916 3300046529 Ga0495652_0193700 Ga0495652_0193700_543_1463 304
917 3300046531 Ga0495665_0001501 Ga0495665_0001501_5038_5985 304
918 3300046531 Ga0495665_0002901 Ga0495665_0002901_3424_4344 304
919 3300046531 Ga0495665_0154648 Ga0495665_0154648_264_1184 304
920 3300046531 Ga0495665_0168441 Ga0495665_0168441_151_1074 304
921 3300046533 Ga0495640_0008324 Ga0495640_0008324_3897_4817 304
922 3300046533 Ga0495640_0009843 Ga0495640_0009843_1048_1968 304
923 3300046533 Ga0495640_0011594 Ga0495640_0011594_3482_4405 304
924 3300046533 Ga0495640_0016985 Ga0495640_0016985_2967_3887 304
925 3300046533 Ga0495640_0036150 Ga0495640_0036150_562_1482 304
926 3300046533 Ga0495640_0113909 Ga0495640_0113909_361_1284 304
927 3300046535 Ga0495586_0009231 Ga0495586_0009231_240_1160 304
928 3300046535 Ga0495586_0078635 Ga0495586_0078635_551_1471 304
929 3300046535 Ga0495586_0143376 Ga0495586_0143376_265_1185 304
930 3300046536 Ga0495587_0001335 Ga0495587_0001335_5454_6374 304
931 3300046536 Ga0495587_0001931 Ga0495587_0001931_1215_2135 304
932 3300046536 Ga0495587_0004407 Ga0495587_0004407_4018_4938 304
933 3300046536 Ga0495587_0005639 Ga0495587_0005639_5483_6430 304
934 3300046536 Ga0495587_0013715 Ga0495587_0013715_2212_3138 304
935 3300046536 Ga0495587_0029292 Ga0495587_0029292_1834_2754 304
936 3300046536 Ga0495587_0060891 Ga0495587_0060891_801_1721 304
937 3300046536 Ga0495587_0062245 Ga0495587_0062245_1123_2043 304
938 3300046536 Ga0495587_0089866 Ga0495587_0089866_734_1657 304
939 3300046543 Ga0495645_0000012 Ga0495645_0000012_48608_49534 304
940 3300046543 Ga0495645_0011860 Ga0495645_0011860_5174_6094 304
941 3300046543 Ga0495645_0024293 Ga0495645_0024293_483_1403 304
942 3300046543 Ga0495645_0024897 Ga0495645_0024897_1331_2254 304
943 3300046543 Ga0495645_0050641 Ga0495645_0050641_23_943 304
944 3300046543 Ga0495645_0058731 Ga0495645_0058731_1671_2591 304
945 3300046543 Ga0495645_0083961 Ga0495645_0083961_113_1060 304
946 3300046543 Ga0495645_0162586 Ga0495645_0162586_55_975 304
947 3300046559 Ga0495667_0000153 Ga0495667_0000153_5755_6675 304
948 3300046559 Ga0495667_0002773 Ga0495667_0002773_8548_9471 304
949 3300046559 Ga0495667_0012091 Ga0495667_0012091_199_1119 304
950 3300046559 Ga0495667_0015633 Ga0495667_0015633_2397_3317 304
951 3300046559 Ga0495667_0068905 Ga0495667_0068905_677_1597 304
952 3300046616 Ga0495668_0050394 Ga0495668_0050394_207_1127 304
953 3300046642 Ga0495634_0000024 Ga0495634_0000024_94699_95622 304
954 3300046642 Ga0495634_0009617 Ga0495634_0009617_1303_2250 304
955 3300046642 Ga0495634_0011468 Ga0495634_0011468_3354_4274 304
956 3300046642 Ga0495634_0017269 Ga0495634_0017269_708_1628 304
957 3300046642 Ga0495634_0088085 Ga0495634_0088085_195_1115 304
958 3300046642 Ga0495634_0112171 Ga0495634_0112171_409_1335 304
959 3300046642 Ga0495634_0126580 Ga0495634_0126580_665_1585 304
960 3300046642 Ga0495634_0131121 Ga0495634_0131121_432_1352 304
961 3300046642 Ga0495634_0135769 Ga0495634_0135769_183_1103 304
962 3300046660 Ga0495625_0000204 Ga0495625_0000204_93319_94239 304
963 3300046663 Ga0495635_0000005 Ga0495635_0000005_128473_129399 304
964 3300046663 Ga0495635_0011439 Ga0495635_0011439_3591_4514 304
965 3300046663 Ga0495635_0026312 Ga0495635_0026312_568_1488 304
966 3300046663 Ga0495635_0132051 Ga0495635_0132051_672_1592 304
967 3300046674 Ga0495588_0031043 Ga0495588_0031043_1413_2333 304
968 3300046675 Ga0495657_0000007 Ga0495657_0000007_138383_139303 304
969 3300046675 Ga0495657_0000767 Ga0495657_0000767_5426_6346 304
970 3300046675 Ga0495657_0001164 Ga0495657_0001164_1972_2898 304
971 3300046675 Ga0495657_0001996 Ga0495657_0001996_255_1175 304
972 3300046675 Ga0495657_0008028 Ga0495657_0008028_6425_7348 304
973 3300046675 Ga0495657_0010072 Ga0495657_0010072_4672_5592 304
974 3300046675 Ga0495657_0017995 Ga0495657_0017995_1305_2225 304
975 3300046675 Ga0495657_0028039 Ga0495657_0028039_1319_2239 304
976 3300046675 Ga0495657_0044122 Ga0495657_0044122_1091_2011 304
977 3300046675 Ga0495657_0044689 Ga0495657_0044689_1908_2855 304
978 3300046678 Ga0495599_0000028 Ga0495599_0000028_5755_6675 304
979 3300046678 Ga0495599_0003834 Ga0495599_0003834_6566_7513 304
980 3300046678 Ga0495599_0015436 Ga0495599_0015436_2412_3332 304
981 3300046678 Ga0495599_0023570 Ga0495599_0023570_2179_3099 304
982 3300046678 Ga0495599_0025063 Ga0495599_0025063_1311_2231 304
983 3300046678 Ga0495599_0174389 Ga0495599_0174389_119_1039 304
984 3300046679 Ga0495623_0002366 Ga0495623_0002366_5454_6374 304
985 3300046679 Ga0495623_0004276 Ga0495623_0004276_248_1168 304
986 3300046680 Ga0495646_0006007 Ga0495646_0006007_6688_7635 304
987 3300046680 Ga0495646_0007679 Ga0495646_0007679_5483_6403 304
988 3300046680 Ga0495646_0014153 Ga0495646_0014153_3589_4509 304
989 3300046680 Ga0495646_0080540 Ga0495646_0080540_274_1194 304
990 3300046680 Ga0495646_0181750 Ga0495646_0181750_43_963 304
991 3300046681 Ga0495647_0000020 Ga0495647_0000020_63190_64116 304
992 3300046681 Ga0495647_0016087 Ga0495647_0016087_1675_2601 304
993 3300046681 Ga0495647_0025009 Ga0495647_0025009_222_1142 304
994 3300046681 Ga0495647_0077565 Ga0495647_0077565_259_1179 304
995 3300046683 Ga0495658_0000113 Ga0495658_0000113_13674_14600 304
996 3300046683 Ga0495658_0226897 Ga0495658_0226897_20_940 304
997 3300046689 Ga0495613_0000021 Ga0495613_0000021_84253_85179 304
998 3300046689 Ga0495613_0000040 Ga0495613_0000040_19495_20421 304
999 3300046689 Ga0495613_0023643 Ga0495613_0023643_1664_2584 304
1000 3300046689 Ga0495613_0037512 Ga0495613_0037512_2115_3035 304
1001 3300046689 Ga0495613_0231139 Ga0495613_0231139_137_1057 304
1002 3300046690 Ga0495624_0002255 Ga0495624_0002255_2802_3728 304
1003 3300046690 Ga0495624_0022354 Ga0495624_0022354_2978_4114 304
1004 3300046690 Ga0495624_0082464 Ga0495624_0082464_330_1250 304
1005 3300046690 Ga0495624_0117991 Ga0495624_0117991_33_953 304
1006 3300046809 Ga0495600_0001627 Ga0495600_0001627_3257_4177 304
1007 3300046809 Ga0495600_0004500 Ga0495600_0004500_695_1615 304
1008 3300046809 Ga0495600_0006499 Ga0495600_0006499_5415_6335 304
1009 3300046809 Ga0495600_0012726 Ga0495600_0012726_2445_3368 304
1010 3300046809 Ga0495600_0023222 Ga0495600_0023222_2016_2942 304
1011 3300046809 Ga0495600_0033443 Ga0495600_0033443_2180_3100 304
1012 3300046809 Ga0495600_0044807 Ga0495600_0044807_1885_2805 304
1013 3300046809 Ga0495600_0047683 Ga0495600_0047683_1361_2287 304
1014 3300046809 Ga0495600_0075917 Ga0495600_0075917_888_1808 304
1015 3300046809 Ga0495600_0107268 Ga0495600_0107268_502_1422 304
1016 3300047315 Ga0495581_0007179 Ga0495581_0007179_14_1150 304
1017 3300047315 Ga0495581_0046879 Ga0495581_0046879_413_1333 304
1018 3300047315 Ga0495581_0055045 Ga0495581_0055045_359_1279 304
1019 3300047315 Ga0495581_0074013 Ga0495581_0074013_772_1692 304
1020 3300047315 Ga0495581_0113098 Ga0495581_0113098_430_1350 304
1021 3300047315 Ga0495581_0148132 Ga0495581_0148132_48_968 304
1022 3300047315 Ga0495581_0179032 Ga0495581_0179032_80_1000 304
1023 3300047317 Ga0495604_0000497 Ga0495604_0000497_28193_29113 304
1024 3300047317 Ga0495604_0000872 Ga0495604_0000872_7330_8250 304
1025 3300047317 Ga0495604_0001134 Ga0495604_0001134_18796_19722 304
1026 3300047317 Ga0495604_0004140 Ga0495604_0004140_4812_5738 304
1027 3300047317 Ga0495604_0005531 Ga0495604_0005531_497_1417 304
1028 3300047317 Ga0495604_0009158 Ga0495604_0009158_1764_2687 304
1029 3300047317 Ga0495604_0026341 Ga0495604_0026341_1427_2347 304
1030 3300047317 Ga0495604_0032132 Ga0495604_0032132_3138_4058 304
1031 3300047317 Ga0495604_0053975 Ga0495604_0053975_258_1178 304
1032 3300047317 Ga0495604_0093595 Ga0495604_0093595_892_1818 304
1033 3300047317 Ga0495604_0149760 Ga0495604_0149760_552_1472 304
1034 3300047317 Ga0495604_0210439 Ga0495604_0210439_181_1101 304
1035 3300047317 Ga0495604_0217976 Ga0495604_0217976_239_1159 304
1036 3300047317 Ga0495604_0255642 Ga0495604_0255642_131_1051 304
1037 3300047319 Ga0495674_0000495 Ga0495674_0000495_22012_22932 304
1038 3300047319 Ga0495674_0006162 Ga0495674_0006162_8204_9124 304
1039 3300047319 Ga0495674_0008274 Ga0495674_0008274_4977_5897 304
1040 3300047319 Ga0495674_0016663 Ga0495674_0016663_2355_3278 304
1041 3300047319 Ga0495674_0021142 Ga0495674_0021142_4048_4968 304
1042 3300047319 Ga0495674_0086207 Ga0495674_0086207_51_971 304
1043 3300047319 Ga0495674_0094576 Ga0495674_0094576_573_1493 304
1044 3300047319 Ga0495674_0109317 Ga0495674_0109317_627_1547 304
1045 3300047320 Ga0495672_0009199 Ga0495672_0009199_2492_3415 304
1046 3300047321 Ga0495676_0003199 Ga0495676_0003199_9293_10213 304
1047 3300047321 Ga0495676_0020303 Ga0495676_0020303_4736_5656 304
1048 3300047321 Ga0495676_0075380 Ga0495676_0075380_1085_2005 304
1049 3300047321 Ga0495676_0201821 Ga0495676_0201821_244_1164 304
1050 3300047321 Ga0495676_0215941 Ga0495676_0215941_167_1087 304
1051 3300047322 Ga0495680_0000007 Ga0495680_0000007_43899_44825 304
1052 3300047322 Ga0495680_0000843 Ga0495680_0000843_27645_28565 304
1053 3300047322 Ga0495680_0001076 Ga0495680_0001076_9219_10139 304
1054 3300047322 Ga0495680_0007749 Ga0495680_0007749_522_1442 304
1055 3300047322 Ga0495680_0017850 Ga0495680_0017850_4342_5262 304
1056 3300047322 Ga0495680_0024093 Ga0495680_0024093_2098_3021 304
1057 3300047322 Ga0495680_0083739 Ga0495680_0083739_697_1617 304
1058 3300047322 Ga0495680_0110758 Ga0495680_0110758_260_1180 304
1059 3300047444 Ga0495675_0001223 Ga0495675_0001223_5755_6675 304
1060 3300047444 Ga0495675_0004577 Ga0495675_0004577_6000_6920 304
1061 3300047444 Ga0495675_0042485 Ga0495675_0042485_404_1324 304
1062 3300047444 Ga0495675_0060681 Ga0495675_0060681_130_1077 304
1063 3300047444 Ga0495675_0079991 Ga0495675_0079991_986_1906 304
1064 3300047446 Ga0495679_023732 Ga0495679_023732_1025_1945 304
1065 3300047447 Ga0495685_063385 Ga0495685_063385_125_1051 304
1066 3300047471 Ga0495684_0015078 Ga0495684_0015078_2993_3913 304
1067 3300047471 Ga0495684_0018090 Ga0495684_0018090_4364_5284 304
1068 3300047471 Ga0495684_0023894 Ga0495684_0023894_2212_3132 304
1069 3300047471 Ga0495684_0027171 Ga0495684_0027171_1516_2436 304
1070 3300047471 Ga0495684_0037745 Ga0495684_0037745_169_1089 304
1071 3300047471 Ga0495684_0080151 Ga0495684_0080151_1541_2464 304
1072 3300047471 Ga0495684_0100547 Ga0495684_0100547_763_1683 304
1073 3300047471 Ga0495684_0111644 Ga0495684_0111644_392_1312 304
1074 3300047471 Ga0495684_0235934 Ga0495684_0235934_274_1197 304
1075 3300047673 Ga0495593_0069903 Ga0495593_0069903_528_1448 304
1076 3300047673 Ga0495593_0070053 Ga0495593_0070053_48_974 304
1077 3300047673 Ga0495593_0096245 Ga0495593_0096245_219_1139 304
1078 3300048088 Ga0495602_0000113 Ga0495602_0000113_38312_39238 304
1079 3300048088 Ga0495602_0003428 Ga0495602_0003428_10018_10938 304
1080 3300048088 Ga0495602_0004519 Ga0495602_0004519_5405_6325 304
1081 3300048088 Ga0495602_0009419 Ga0495602_0009419_6809_7729 304
1082 3300048088 Ga0495602_0018767 Ga0495602_0018767_2016_2936 304
1083 3300048088 Ga0495602_0050996 Ga0495602_0050996_1677_2597 304
1084 3300048088 Ga0495602_0076593 Ga0495602_0076593_1677_2600 304
1085 3300048088 Ga0495602_0100478 Ga0495602_0100478_235_1155 304
1086 3300048088 Ga0495602_0114042 Ga0495602_0114042_33_953 304
1087 3300048088 Ga0495602_0168339 Ga0495602_0168339_148_1068 304
1088 3300048089 Ga0495614_0031429 Ga0495614_0031429_1240_2160 304
1089 3300048903 Ga0496100_0000046 Ga0496100_0000046_2424_3344 304
1090 3300048903 Ga0496100_0085257 Ga0496100_0085257_247_1167 304
1091 3300048903 Ga0496100_0345450 Ga0496100_0345450_137_1069 304
1092 3300048904 Ga0496101_0000124 Ga0496101_0000124_74329_75249 304
1093 3300048904 Ga0496101_0011878 Ga0496101_0011878_4201_5124 304
1094 3300048904 Ga0496101_0219389 Ga0496101_0219389_22_942 304
1095 3300048905 Ga0496102_0000019 Ga0496102_0000019_53841_54761 304
1096 3300048905 Ga0496102_0033747 Ga0496102_0033747_1899_2819 304
1097 3300048905 Ga0496102_0038814 Ga0496102_0038814_3312_4229 304
1098 3300048905 Ga0496102_0208631 Ga0496102_0208631_228_1148 304
1099 3300048906 Ga0496103_0000104 Ga0496103_0000104_42613_43533 304
1100 3300048906 Ga0496103_0079780 Ga0496103_0079780_574_1494 304
1101 3300048907 Ga0496104_0000008 Ga0496104_0000008_52752_53672 304
1102 3300048907 Ga0496104_0000063 Ga0496104_0000063_6350_7270 304
1103 3300048907 Ga0496104_0002266 Ga0496104_0002266_9558_10478 304
1104 3300048907 Ga0496104_0040748 Ga0496104_0040748_3352_4266 304
1105 3300048907 Ga0496104_0043187 Ga0496104_0043187_2093_3013 304
1106 3300048907 Ga0496104_0130889 Ga0496104_0130889_1473_2396 304
1107 3300048908 Ga0496105_0000003 Ga0496105_0000003_52752_53672 304
1108 3300048908 Ga0496105_0000041 Ga0496105_0000041_109349_110269 304
1109 3300048908 Ga0496105_0001527 Ga0496105_0001527_8192_9112 304
1110 3300048908 Ga0496105_0024910 Ga0496105_0024910_1991_2911 304
1111 3300048908 Ga0496105_0026943 Ga0496105_0026943_3012_3932 304
1112 3300048908 Ga0496105_0037423 Ga0496105_0037423_201_1115 304
1113 3300048908 Ga0496105_0215983 Ga0496105_0215983_249_1169 304
1114 3300048909 Ga0496106_0000059 Ga0496106_0000059_74257_75177 304
1115 3300048909 Ga0496106_0060484 Ga0496106_0060484_367_1287 304
1116 3300048909 Ga0496106_0080390 Ga0496106_0080390_921_1841 304
1117 3300048909 Ga0496106_0114566 Ga0496106_0114566_785_1708 304
1118 3300048910 Ga0496107_0000018 Ga0496107_0000018_247_1167 304
1119 3300048910 Ga0496107_0025902 Ga0496107_0025902_2773_3693 304
1120 3300048910 Ga0496107_0052849 Ga0496107_0052849_1465_2385 304
1121 3300048911 Ga0496108_0000631 Ga0496108_0000631_16596_17519 304
1122 3300048911 Ga0496108_0011681 Ga0496108_0011681_1649_2569 304
1123 3300048911 Ga0496108_0049132 Ga0496108_0049132_1525_2445 304
1124 3300048912 Ga0496109_0000085 Ga0496109_0000085_88530_89453 304
1125 3300048912 Ga0496109_0009210 Ga0496109_0009210_1858_2778 304
1126 3300048912 Ga0496109_0010556 Ga0496109_0010556_1802_2722 304
1127 3300048912 Ga0496109_0019326 Ga0496109_0019326_1918_2838 304
1128 3300048912 Ga0496109_0249419 Ga0496109_0249419_482_1402 304
1129 3300048913 Ga0496110_0013768 Ga0496110_0013768_156_1076 304
1130 3300048913 Ga0496110_0022340 Ga0496110_0022340_3016_3936 304
1131 3300048913 Ga0496110_0055192 Ga0496110_0055192_2145_3065 304
1132 3300048913 Ga0496110_0334548 Ga0496110_0334548_317_1237 304
1133 3300048913 Ga0496110_0489610 Ga0496110_0489610_14_934 304
1134 3300048914 Ga0496111_0006525 Ga0496111_0006525_1508_2428 304
1135 3300048914 Ga0496111_0103361 Ga0496111_0103361_643_1563 304
1136 3300048915 Ga0496112_0000002 Ga0496112_0000002_504196_505122 304
1137 3300048915 Ga0496112_0001367 Ga0496112_0001367_12177_13097 304
1138 3300048915 Ga0496112_0019624 Ga0496112_0019624_3060_3980 304
1139 3300048915 Ga0496112_0061758 Ga0496112_0061758_1921_2841 304
1140 3300048915 Ga0496112_0092579 Ga0496112_0092579_253_1173 304
1141 3300048916 Ga0496113_0122432 Ga0496113_0122432_569_1489 304
1142 3300048916 Ga0496113_0241126 Ga0496113_0241126_379_1299 304
1143 3300048917 Ga0496114_0000043 Ga0496114_0000043_2042_2962 304
1144 3300048918 Ga0496115_0000209 Ga0496115_0000209_680_1603 304
1145 3300048918 Ga0496115_0000211 Ga0496115_0000211_3224_4144 304
1146 3300048918 Ga0496115_0000259 Ga0496115_0000259_4394_5317 304
1147 3300048918 Ga0496115_0041224 Ga0496115_0041224_2517_3437 304
1148 3300048918 Ga0496115_0196061 Ga0496115_0196061_520_1440 304
1149 3300048918 Ga0496115_0214472 Ga0496115_0214472_423_1343 304
1150 3300048920 Ga0496117_0190247 Ga0496117_0190247_195_1112 304
1151 3300048921 Ga0496118_0005822 Ga0496118_0005822_55_972 304
1152 3300048922 Ga0496119_0042180 Ga0496119_0042180_1756_2670 304
1153 3300048923 Ga0496120_0006050 Ga0496120_0006050_7549_8466 304
1154 3300048924 Ga0496121_0026281 Ga0496121_0026281_3408_4325 304
1155 3300048924 Ga0496121_0112668 Ga0496121_0112668_1000_1914 304
1156 3300048927 Ga0496124_0060933 Ga0496124_0060933_1917_2831 304
1157 3300048927 Ga0496124_0076805 Ga0496124_0076805_591_1514 304
1158 3300048929 Ga0496126_0035003 Ga0496126_0035003_3435_4349 304
1159 3300048929 Ga0496126_0040619 Ga0496126_0040619_1822_2742 304
1160 3300048929 Ga0496126_0081080 Ga0496126_0081080_623_1540 304
1161 3300049568 Ga0501031_0004602 Ga0501031_0004602_7909_8823 304
1162 3300049569 Ga0501032_0002323 Ga0501032_0002323_90_1004 304
1163 3300049570 Ga0501033_0001255 Ga0501033_0001255_21706_22620 304
1164 3300049571 Ga0501034_0014402 Ga0501034_0014402_120_1040 304
1165 3300049571 Ga0501034_0026202 Ga0501034_0026202_4447_5367 304
1166 3300049571 Ga0501034_0056567 Ga0501034_0056567_543_1457 304
1167 3300049571 Ga0501034_0111844 Ga0501034_0111844_541_1461 304
1168 3300049571 Ga0501034_0249208 Ga0501034_0249208_120_1034 304
1169 3300049572 Ga0501036_0004619 Ga0501036_0004619_10098_11012 304
1170 3300049573 Ga0501037_0002105 Ga0501037_0002105_127_1041 304
1171 3300049574 Ga0501038_0003549 Ga0501038_0003549_28_942 304
1172 3300049574 Ga0501038_0306511 Ga0501038_0306511_266_1186 304
1173 3300049575 Ga0501039_0017629 Ga0501039_0017629_4530_5444 304
1174 3300049576 Ga0501040_0034211 Ga0501040_0034211_1359_2279 304
1175 3300049578 Ga0501042_0028550 Ga0501042_0028550_223_1143 304
1176 3300049578 Ga0501042_0065656 Ga0501042_0065656_73_987 304
1177 3300049578 Ga0501042_0347128 Ga0501042_0347128_86_1012 304
1178 3300049579 Ga0501043_0002925 Ga0501043_0002925_49_963 304
1179 3300049579 Ga0501043_0247705 Ga0501043_0247705_413_1333 304
1180 3300049580 Ga0501046_0003552 Ga0501046_0003552_13296_14210 304
1181 3300049580 Ga0501046_0038058 Ga0501046_0038058_1107_2027 304
1182 3300049581 Ga0501047_0002361 Ga0501047_0002361_3709_4623 304
1183 3300049581 Ga0501047_0009486 Ga0501047_0009486_4859_5773 304
1184 3300049581 Ga0501047_0011271 Ga0501047_0011271_3715_4635 304
1185 3300049581 Ga0501047_0048106 Ga0501047_0048106_3122_4042 304
1186 3300049581 Ga0501047_0478983 Ga0501047_0478983_90_1004 304
1187 3300049582 Ga0501048_0002577 Ga0501048_0002577_12870_13784 304
1188 3300049583 Ga0501067_0211871 Ga0501067_0211871_123_1040 304
1189 3300049584 Ga0501068_0242415 Ga0501068_0242415_28_942 304
1190 3300049585 Ga0501069_0004102 Ga0501069_0004102_5531_6445 304
1191 3300049586 Ga0501070_0000425 Ga0501070_0000425_22368_23294 304
1192 3300049586 Ga0501070_0000832 Ga0501070_0000832_12034_12948 304
1193 3300049586 Ga0501070_0092619 Ga0501070_0092619_780_1706 304
1194 3300049586 Ga0501070_0251937 Ga0501070_0251937_187_1101 304
1195 3300049586 Ga0501070_0254391 Ga0501070_0254391_284_1204 304
1196 3300049587 Ga0501071_0029402 Ga0501071_0029402_1298_2224 304
1197 3300049587 Ga0501071_0111901 Ga0501071_0111901_137_1051 304
1198 3300049587 Ga0501071_0155681 Ga0501071_0155681_670_1584 304
1199 3300049587 Ga0501071_0194595 Ga0501071_0194595_582_1502 304
1200 3300049588 Ga0501072_0076481 Ga0501072_0076481_682_1602 304
1201 3300049589 Ga0501073_0011740 Ga0501073_0011740_159_1073 304
1202 3300049590 Ga0501074_0010539 Ga0501074_0010539_4584_5501 304
1203 3300049590 Ga0501074_0021590 Ga0501074_0021590_3721_4635 304
1204 3300049590 Ga0501074_0155716 Ga0501074_0155716_16_936 304
1205 3300049592 Ga0501076_0091145 Ga0501076_0091145_1139_2059 304
1206 3300049593 Ga0501077_0153400 Ga0501077_0153400_151_1071 304
1207 3300049741 Ga0501079_0119347 Ga0501079_0119347_1030_1944 304
1208 3300049742 Ga0501080_0000203 Ga0501080_0000203_36807_37733 304
1209 3300049742 Ga0501080_0007024 Ga0501080_0007024_71_985 304
1210 3300049742 Ga0501080_0117774 Ga0501080_0117774_1331_2251 304
1211 3300049743 Ga0501081_0040683 Ga0501081_0040683_1984_2904 304
1212 3300049744 Ga0501083_0020412 Ga0501083_0020412_3601_4521 304
1213 3300049822 Ga0501035_0004128 Ga0501035_0004128_93_1007 304
1214 3300049823 Ga0501044_0000684 Ga0501044_0000684_26238_27152 304
1215 3300049823 Ga0501044_0066157 Ga0501044_0066157_1025_1945 304
1216 3300049823 Ga0501044_0098401 Ga0501044_0098401_841_1761 304
1217 3300049823 Ga0501044_0263966 Ga0501044_0263966_390_1304 304
1218 3300049824 Ga0501045_0139507 Ga0501045_0139507_596_1516 304
1219 3300049824 Ga0501045_0147890 Ga0501045_0147890_788_1714 304
1220 3300050492 nmdc:mga0yw44_41935_c2 nmdc:mga0yw44_41935_c2_348_1268 304
1221 3300050507 nmdc:mga05p37_139307_c1 nmdc:mga05p37_139307_c1_1262_2182 304
1222 3300050507 nmdc:mga05p37_1476_c1 nmdc:mga05p37_1476_c1_12065_12985 304
1223 3300050507 nmdc:mga05p37_180735_c2 nmdc:mga05p37_180735_c2_947_1867 304
1224 3300050507 nmdc:mga05p37_26277_c1 nmdc:mga05p37_26277_c1_4953_5876 304
1225 3300050508 nmdc:mga09592_416752_c1 nmdc:mga09592_416752_c1_185_1105 304
1226 3300050510 nmdc:mga06r32_176246_c1 nmdc:mga06r32_176246_c1_266_1189 304
1227 3300050510 nmdc:mga06r32_24750_c1 nmdc:mga06r32_24750_c1_4022_4942 304
1228 3300050511 nmdc:mga08y16_114032_c1 nmdc:mga08y16_114032_c1_617_1537 304
1229 3300050511 nmdc:mga08y16_18718_c1 nmdc:mga08y16_18718_c1_1449_2369 304
1230 3300050511 nmdc:mga08y16_234657_c1 nmdc:mga08y16_234657_c1_853_1773 304
1231 3300050511 nmdc:mga08y16_381365_c1 nmdc:mga08y16_381365_c1_267_1187 304
1232 3300050512 nmdc:mga0n895_117238_c1 nmdc:mga0n895_117238_c1_1370_2290 304
1233 3300050512 nmdc:mga0n895_203828_c1 nmdc:mga0n895_203828_c1_723_1643 304
1234 3300050512 nmdc:mga0n895_243157_c1 nmdc:mga0n895_243157_c1_589_1509 304
1235 3300050512 nmdc:mga0n895_251756_c1 nmdc:mga0n895_251756_c1_795_1715 304
1236 3300050512 nmdc:mga0n895_283510_c1 nmdc:mga0n895_283510_c1_520_1530 304
1237 3300050512 nmdc:mga0n895_336200_c1 nmdc:mga0n895_336200_c1_177_1097 304
1238 3300050512 nmdc:mga0n895_63088_c1 nmdc:mga0n895_63088_c1_52_981 304
1239 3300050512 nmdc:mga0n895_83833_c1 nmdc:mga0n895_83833_c1_385_1305 304
1240 3300050513 nmdc:mga0rr50_24688_c1 nmdc:mga0rr50_24688_c1_735_1655 304
1241 3300050513 nmdc:mga0rr50_424421_c1 nmdc:mga0rr50_424421_c1_171_1091 304
1242 3300050513 nmdc:mga0rr50_50198_c1 nmdc:mga0rr50_50198_c1_2151_3071 304
1243 3300050513 nmdc:mga0rr50_63607_c1 nmdc:mga0rr50_63607_c1_635_1555 304
1244 3300050514 nmdc:mga08x19_26371_c1 nmdc:mga08x19_26371_c1_795_1715 304
1245 3300050514 nmdc:mga08x19_297218_c1 nmdc:mga08x19_297218_c1_40_960 304
1246 3300050514 nmdc:mga08x19_7286_c2 nmdc:mga08x19_7286_c2_1823_2743 304
1247 3300050514 nmdc:mga08x19_89829_c1 nmdc:mga08x19_89829_c1_625_1545 304
1248 3300050514 nmdc:mga08x19_97275_c1 nmdc:mga08x19_97275_c1_193_1113 304
1249 3300050514 nmdc:mga08x19_99277_c1 nmdc:mga08x19_99277_c1_245_1255 304
1250 3300050515 nmdc:mga0a205_11001_c1 nmdc:mga0a205_11001_c1_827_1753 304
1251 3300050515 nmdc:mga0a205_12859_c1 nmdc:mga0a205_12859_c1_4081_5001 304
1252 3300050515 nmdc:mga0a205_13616_c1 nmdc:mga0a205_13616_c1_3605_4525 304
1253 3300050515 nmdc:mga0a205_14047_c1 nmdc:mga0a205_14047_c1_3782_4702 304
1254 3300050515 nmdc:mga0a205_165481_c1 nmdc:mga0a205_165481_c1_1146_2066 304
1255 3300050515 nmdc:mga0a205_1_c2 nmdc:mga0a205_1_c2_239095_240015 304
1256 3300053077 Ga0495601_0000022 Ga0495601_0000022_46018_46938 304
1257 3300053077 Ga0495601_0000028 Ga0495601_0000028_70941_71867 304
1258 3300053077 Ga0495601_0000240 Ga0495601_0000240_19572_20498 304
1259 3300053077 Ga0495601_0001051 Ga0495601_0001051_4789_5715 304
1260 3300053077 Ga0495601_0020574 Ga0495601_0020574_2909_3856 304
1261 3300053077 Ga0495601_0027960 Ga0495601_0027960_1325_2245 304
1262 3300053077 Ga0495601_0050002 Ga0495601_0050002_1396_2319 304
1263 3300053077 Ga0495601_0050942 Ga0495601_0050942_903_1823 304
1264 3300053077 Ga0495601_0055209 Ga0495601_0055209_673_1593 304
1265 3300053077 Ga0495601_0089612 Ga0495601_0089612_543_1466 304
1266 3300053077 Ga0495601_0100137 Ga0495601_0100137_269_1189 304
1267 3300053077 Ga0495601_0189334 Ga0495601_0189334_245_1165 304
1268 3300053078 Ga0495612_0000023 Ga0495612_0000023_39088_40014 304
1269 3300053078 Ga0495612_0005461 Ga0495612_0005461_2122_3042 304
1270 3300053078 Ga0495612_0005726 Ga0495612_0005726_127_1263 304
1271 3300053078 Ga0495612_0019760 Ga0495612_0019760_1097_2017 304
1272 3300053078 Ga0495612_0030967 Ga0495612_0030967_268_1188 304
1273 3300053078 Ga0495612_0098385 Ga0495612_0098385_240_1160 304
1274 3300053083 Ga0495655_0000375 Ga0495655_0000375_693_1619 304
1275 3300053084 Ga0495595_0000072 Ga0495595_0000072_12516_13442 304
1276 3300053084 Ga0495595_0000403 Ga0495595_0000403_3749_4669 304
1277 3300053084 Ga0495595_0001370 Ga0495595_0001370_3088_4008 304
1278 3300053084 Ga0495595_0002090 Ga0495595_0002090_6109_7035 304
1279 3300053084 Ga0495595_0002354 Ga0495595_0002354_736_1683 304
1280 3300053084 Ga0495595_0002872 Ga0495595_0002872_3616_4536 304
1281 3300053085 Ga0495619_0000024 Ga0495619_0000024_56445_57368 304
1282 3300053085 Ga0495619_0000127 Ga0495619_0000127_32190_33116 304
1283 3300053085 Ga0495619_0006055 Ga0495619_0006055_6656_7603 304
1284 3300053085 Ga0495619_0016649 Ga0495619_0016649_971_1897 304
1285 3300053085 Ga0495619_0062319 Ga0495619_0062319_1231_2151 304
1286 3300053085 Ga0495619_0208426 Ga0495619_0208426_126_1046 304
1287 3300053085 Ga0495619_0224756 Ga0495619_0224756_291_1211 304
1288 3300054114 Ga0501084_0231906 Ga0501084_0231906_625_1539 304
1289 3300054114 Ga0501084_0387216 Ga0501084_0387216_212_1132 304
1290 3300060353 Ga0501082_0076582 Ga0501082_0076582_1862_2776 304
1291 3300061719 Ga0466962_0043422 Ga0466962_0043422_190_1110 304
1292 3300061734 Ga0530510_0042099 Ga0530510_0042099_196_1116 304
1293 3300061734 Ga0530510_0152533 Ga0530510_0152533_701_1621 304
1294 3300061734 Ga0530510_0206497 Ga0530510_0206497_60_980 304

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19459

DUF5996

Family of unknown function (DUF5996)

30

316

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4geq-assembly1.cif.gz_B crystal structure of the spc24-spc25/cnn1 binding interface 0.7596 67 108
2ymz-assembly2.cif.gz_C crystal structure of chicken galectin 2 0.6984 64 89
2z2p-assembly1.cif.gz_B crystal structure of catalytically inactive h270a virginiamycin b lyase from staphylococcus aureus with quinupristin 0.6221 55 92
1hlc-assembly1.cif.gz_A x-ray crystal structure of the human dimeric s-lac lectin, l-14-ii, in complex with lactose at 2.9 angstroms resolution 0.614 63 89
4hw6-assembly4.cif.gz_D crystal structure of an auxiliary nutrient binding protein (bacova_00264) from bacteroides ovatus atcc 8483 at 1.70 a resolution 0.5922 43 87
ID Description Score Start End Superfamily
5ewsB00 Mainly Beta;Sandwich;Jelly Rolls; 0.6445 64 89 2.60.120.200
af_H2KYV2_42_295_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.6124 203 228 3.80.10.10
af_Q66H79_552_654_2.40.10.500 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.5949 43 87 2.40.10.500
af_Q4DDW3_172_579_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.5874 54 87 2.120.10.30
af_Q9FHU3_10_93_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.535 81 135 3.10.20.90
ID Description Score Start End GO Terms
AF-A0A2V9SI59-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9856 210 289
AF-A0A538LDL2-F1-model_v4 Uncharacterized protein 0.9854 1 304
AF-A0A2V7CK90-F1-model_v4 Uncharacterized protein 0.9844 233 289
AF-A0A7V9GKF5-F1-model_v4 Uncharacterized protein 0.9836 206 290
AF-A0A4Q5V4P6-F1-model_v4 deleted 0.9772 223 289

Feature Viewer

pLDDT pTM Quality
96.37 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map