F492509

General Info

Members Datasets Scaffolds Average Seq Length
1280 320 1279 110

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_100173854|Ga0070668_1001738543
Length 119
Sequence MDPELANVLDFVLKILPAVTLITVVCVGGWILNNWLRIKHGYPLDGAWGQALHPHTDKEAMERIKLLTGENAQLRAELGSVKDRLETIERIVTDQPHRLAKEIDALAIEANKVDRGGHA

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
46 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
47 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
48 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
49 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
50 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
84 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
85 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
97 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
129 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
133 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
134 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
135 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
140 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
205 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
206 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
207 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
208 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
209 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
210 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
211 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
212 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
213 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
214 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
215 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
216 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
217 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
218 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
220 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
221 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
222 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
223 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
224 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
225 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
226 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
227 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
228 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
229 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
230 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
231 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
232 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
233 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
234 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
235 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
236 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
237 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
238 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
239 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
240 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
241 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
242 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
243 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
244 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
245 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
246 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
247 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
248 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
249 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
250 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
251 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
252 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
253 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
254 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
255 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
256 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
257 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
258 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
259 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
260 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
261 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
262 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
263 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
264 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
265 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
266 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
267 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
268 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
269 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
270 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
271 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
272 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
281 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
282 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
283 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
284 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
285 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
286 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
287 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
288 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
289 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
290 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
291 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
292 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
293 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
294 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
295 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
296 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
297 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
298 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
299 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
300 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
301 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
302 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
303 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
305 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
306 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
307 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
308 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
309 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
310 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
311 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
312 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
313 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
314 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
315 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
316 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
317 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
318 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
319 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
320 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.52
Metatranscriptomes 1.48
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.56
Nodule 0
Rhizoplane 1.33
Rhizosphere 95.78
Stem 0
Stem Tuber 0
Unclassified 1.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_12418040 2162886012 Bacteria 822
2 JGI24736J21556_1000631 3300001904 Bacteria 6458
3 JGI24736J21556_1000667 3300001904 Bacteria 6296
4 JGI24741J21665_1000687 3300001915 Bacteria 10222
5 JGI24741J21665_1003236 3300001915 Bacteria 3947
6 JGI24740J21852_10000529 3300001979 Bacteria 16306
7 JGI24740J21852_10002598 3300001979 Bacteria 8144
8 JGI24740J21852_10008822 3300001979 Bacteria 3996
9 JGI24740J21852_10017073 3300001979 Bacteria 2605
10 JGI24740J21852_10055235 3300001979 Bacteria 1118
11 JGI24739J22299_10000448 3300001989 Bacteria 14383
12 JGI24739J22299_10002487 3300001989 Bacteria 7113
13 JGI24737J22298_10000438 3300001990 Bacteria 14246
14 JGI24737J22298_10003336 3300001990 Bacteria 5680
15 JGI24737J22298_10004580 3300001990 Bacteria 4810
16 JGI24737J22298_10010883 3300001990 Bacteria 2989
17 JGI24737J22298_10017305 3300001990 Bacteria 2323
18 JGI24737J22298_10035882 3300001990 Bacteria 1533
19 JGI24743J22301_10012397 3300001991 Bacteria 1550
20 JGI24735J21928_10000581 3300002067 Bacteria 12847
21 JGI24735J21928_10002676 3300002067 Bacteria 6157
22 JGI24738J21930_10002281 3300002075 Bacteria 5075
23 JGI24738J21930_10025900 3300002075 Bacteria 1205
24 JGI24738J21930_10041217 3300002075 Bacteria 938
25 JGI24742J22300_10110376 3300002244 Bacteria 537
26 rootH1_10284297 3300003323 Bacteria 1540
27 Ga0055526_1025219 3300003771 Bacteria 1914
28 Ga0055537_1005127 3300003773 Bacteria 3576
29 Ga0055528_1058109 3300003790 Bacteria 743
30 Ga0058863_11416882 3300004799 Bacteria 1111
31 Ga0065165_1004978 3300005262 Bacteria 7794
32 Ga0065714_10399877 3300005288 Bacteria 591
33 Ga0065714_10400992 3300005288 Bacteria 590
34 Ga0065704_10572568 3300005289 Bacteria 622
35 Ga0065712_10032326 3300005290 Bacteria 1374
36 Ga0065712_10165184 3300005290 Bacteria 1276
37 Ga0065712_10592176 3300005290 Bacteria 595
38 Ga0065712_10691901 3300005290 Bacteria 550
39 Ga0065715_10055508 3300005293 Bacteria 1086
40 Ga0065715_10092118 3300005293 Bacteria 5320
41 Ga0065715_10093949 3300005293 Bacteria 4491
42 Ga0065715_10231107 3300005293 Bacteria 1233
43 Ga0065715_10236651 3300005293 Bacteria 1207
44 Ga0065715_10963069 3300005293 Unclassified 556
45 Ga0070658_10008484 3300005327 Bacteria 8262
46 Ga0070658_10016452 3300005327 Bacteria 5920
47 Ga0070658_10051723 3300005327 Bacteria 3329
48 Ga0070658_10148776 3300005327 Bacteria 1959
49 Ga0070658_10215277 3300005327 Bacteria 1623
50 Ga0070658_10338167 3300005327 Bacteria 1287
51 Ga0070658_10487525 3300005327 Bacteria 1064
52 Ga0070658_10546222 3300005327 Bacteria 1002
53 Ga0070658_10666943 3300005327 Bacteria 902
54 Ga0070658_10700796 3300005327 Bacteria 879
55 Ga0070658_11096514 3300005327 Unclassified 692
56 Ga0070658_11105382 3300005327 Bacteria 689
57 Ga0070658_11632188 3300005327 Bacteria 558
58 Ga0070676_10015554 3300005328 Bacteria 4198
59 Ga0070676_10036730 3300005328 Bacteria 2823
60 Ga0070676_10192526 3300005328 Bacteria 1332
61 Ga0070683_100010252 3300005329 Bacteria 8052
62 Ga0070683_100087604 3300005329 Bacteria 2921
63 Ga0070683_100148122 3300005329 Bacteria 2225
64 Ga0070683_100262665 3300005329 Bacteria 1642
65 Ga0070670_100003973 3300005331 Bacteria 12349
66 Ga0070670_100011203 3300005331 Bacteria 7663
67 Ga0070670_100016862 3300005331 Bacteria 6269
68 Ga0070670_100034717 3300005331 Bacteria 4340
69 Ga0070670_100133963 3300005331 Bacteria 2140
70 Ga0070670_100368409 3300005331 Unclassified 1264
71 Ga0070670_100603816 3300005331 Bacteria 982
72 Ga0070670_100664942 3300005331 Bacteria 935
73 Ga0070677_10000633 3300005333 Bacteria 11793
74 Ga0070677_10001594 3300005333 Bacteria 7175
75 Ga0070677_10258193 3300005333 Bacteria 868
76 Ga0068869_100020176 3300005334 Bacteria 4566
77 Ga0068869_100075112 3300005334 Bacteria 2510
78 Ga0068869_100331144 3300005334 Unclassified 1237
79 Ga0070666_10001024 3300005335 Bacteria 17143
80 Ga0070666_10439414 3300005335 Bacteria 941
81 Ga0070666_10572366 3300005335 Bacteria 823
82 Ga0070666_10665397 3300005335 Bacteria 762
83 Ga0070680_100029933 3300005336 Bacteria 4371
84 Ga0070680_100141427 3300005336 Bacteria 2018
85 Ga0070680_100270585 3300005336 Bacteria 1438
86 Ga0070680_100501525 3300005336 Bacteria 1038
87 Ga0070680_101058576 3300005336 Unclassified 701
88 Ga0070680_101941698 3300005336 Bacteria 510
89 Ga0070682_100036210 3300005337 Bacteria 3016
90 Ga0070682_100063314 3300005337 Bacteria 2345
91 Ga0070682_100068961 3300005337 Bacteria 2257
92 Ga0070682_100589648 3300005337 Bacteria 876
93 Ga0068868_100180051 3300005338 Bacteria 1753
94 Ga0068868_100230504 3300005338 Bacteria 1554
95 Ga0068868_100362375 3300005338 Bacteria 1244
96 Ga0068868_100429152 3300005338 Bacteria 1146
97 Ga0068868_100664716 3300005338 Bacteria 929
98 Ga0070660_100000715 3300005339 Bacteria 21980
99 Ga0070660_100003410 3300005339 Bacteria 10928
100 Ga0070660_100005309 3300005339 Bacteria 8914
101 Ga0070660_100034107 3300005339 Bacteria 3843
102 Ga0070660_100050689 3300005339 Bacteria 3194
103 Ga0070660_100092237 3300005339 Bacteria 2390
104 Ga0070660_100230055 3300005339 Bacteria 1508
105 Ga0070660_100260534 3300005339 Bacteria 1416
106 Ga0070660_100278346 3300005339 Bacteria 1369
107 Ga0070660_100554458 3300005339 Bacteria 959
108 Ga0070660_101304310 3300005339 Bacteria 616
109 Ga0070689_100318208 3300005340 Bacteria 1299
110 Ga0070689_100905216 3300005340 Bacteria 781
111 Ga0070689_101210961 3300005340 Bacteria 678
112 Ga0070687_100244067 3300005343 Bacteria 1112
113 Ga0070661_100000055 3300005344 Bacteria 88266
114 Ga0070661_100005097 3300005344 Bacteria 9063
115 Ga0070661_100021398 3300005344 Bacteria 4618
116 Ga0070661_100030841 3300005344 Bacteria 3874
117 Ga0070661_100033588 3300005344 Bacteria 3717
118 Ga0070661_100186558 3300005344 Unclassified 1580
119 Ga0070661_100222829 3300005344 Bacteria 1447
120 Ga0070661_100281670 3300005344 Bacteria 1290
121 Ga0070661_100949488 3300005344 Bacteria 711
122 Ga0070661_101193437 3300005344 Bacteria 636
123 Ga0070692_10004390 3300005345 Bacteria 5882
124 Ga0070692_10015367 3300005345 Bacteria 3621
125 Ga0070692_10039400 3300005345 Bacteria 2413
126 Ga0070692_10156233 3300005345 Unclassified 1303
127 Ga0070692_10232582 3300005345 Bacteria 1095
128 Ga0070692_10470298 3300005345 Bacteria 808
129 Ga0070692_10862536 3300005345 Bacteria 623
130 Ga0070668_100092812 3300005347 Bacteria 2381
131 Ga0070668_100121240 3300005347 Bacteria 2090
132 Ga0070668_100138617 3300005347 Bacteria 1959
133 Ga0070668_100173854 3300005347 Bacteria 1755
134 Ga0070668_100184509 3300005347 Bacteria 1706
135 Ga0070668_100320264 3300005347 Bacteria 1305
136 Ga0070668_100435000 3300005347 Bacteria 1125
137 Ga0070669_100000565 3300005353 Bacteria 27565
138 Ga0070669_100020573 3300005353 Bacteria 4713
139 Ga0070669_100035259 3300005353 Bacteria 3624
140 Ga0070669_100071233 3300005353 Bacteria 2571
141 Ga0070675_100005534 3300005354 Bacteria 9669
142 Ga0070675_100131049 3300005354 Bacteria 2137
143 Ga0070675_100415622 3300005354 Bacteria 1202
144 Ga0070675_101620327 3300005354 Bacteria 597
145 Ga0070675_101717773 3300005354 Bacteria 579
146 Ga0070671_100015851 3300005355 Bacteria 6088
147 Ga0070671_100017555 3300005355 Bacteria 5798
148 Ga0070671_100024583 3300005355 Bacteria 4933
149 Ga0070671_100294528 3300005355 Bacteria 1381
150 Ga0070671_100323564 3300005355 Bacteria 1314
151 Ga0070674_100313838 3300005356 Bacteria 1254
152 Ga0070673_100007906 3300005364 Bacteria 7049
153 Ga0070673_100020542 3300005364 Bacteria 4765
154 Ga0070673_100475728 3300005364 Bacteria 1127
155 Ga0070673_100865468 3300005364 Bacteria 837
156 Ga0070673_100919256 3300005364 Bacteria 812
157 Ga0070673_101204807 3300005364 Bacteria 709
158 Ga0070673_101212555 3300005364 Bacteria 707
159 Ga0070688_100867368 3300005365 Bacteria 710
160 Ga0070688_101352594 3300005365 Bacteria 576
161 Ga0070659_100006080 3300005366 Bacteria 8707
162 Ga0070659_100016493 3300005366 Bacteria 5546
163 Ga0070659_100016905 3300005366 Bacteria 5483
164 Ga0070659_100025940 3300005366 Bacteria 4508
165 Ga0070659_100035688 3300005366 Bacteria 3873
166 Ga0070659_100036714 3300005366 Bacteria 3820
167 Ga0070659_100489938 3300005366 Bacteria 1047
168 Ga0070659_100810788 3300005366 Bacteria 814
169 Ga0070659_101237475 3300005366 Bacteria 661
170 Ga0070667_100002091 3300005367 Bacteria 17620
171 Ga0070667_100020312 3300005367 Bacteria 5513
172 Ga0070667_100057546 3300005367 Bacteria 3286
173 Ga0070667_100242865 3300005367 Bacteria 1608
174 Ga0070667_100518124 3300005367 Bacteria 1094
175 Ga0070667_100951325 3300005367 Bacteria 800
176 Ga0070667_100982775 3300005367 Unclassified 787
177 Ga0070667_101688708 3300005367 Bacteria 596
178 Ga0070703_10305748 3300005406 Unclassified 664
179 Ga0070714_100137572 3300005435 Bacteria 2189
180 Ga0070714_100966753 3300005435 Bacteria 828
181 Ga0070713_100014227 3300005436 Bacteria 5899
182 Ga0070701_10160408 3300005438 Unclassified 1302
183 Ga0070701_10954861 3300005438 Unclassified 595
184 Ga0070700_100767355 3300005441 Bacteria 773
185 Ga0070700_100780973 3300005441 Bacteria 767
186 Ga0070700_100790332 3300005441 Bacteria 763
187 Ga0070694_100025449 3300005444 Bacteria 3828
188 Ga0070663_100007313 3300005455 Bacteria 6713
189 Ga0070663_100010825 3300005455 Bacteria 5698
190 Ga0070663_100018818 3300005455 Bacteria 4538
191 Ga0070663_100033755 3300005455 Bacteria 3538
192 Ga0070663_100040950 3300005455 Bacteria 3246
193 Ga0070663_100070717 3300005455 Bacteria 2538
194 Ga0070663_100078191 3300005455 Bacteria 2424
195 Ga0070663_100096689 3300005455 Bacteria 2197
196 Ga0070663_100120104 3300005455 Bacteria 1984
197 Ga0070663_100615615 3300005455 Bacteria 915
198 Ga0070663_100778202 3300005455 Bacteria 819
199 Ga0070663_100788627 3300005455 Unclassified 814
200 Ga0070663_101206967 3300005455 Bacteria 665
201 Ga0070663_101215327 3300005455 Bacteria 663
202 Ga0070663_101575617 3300005455 Bacteria 585
203 Ga0070678_100016584 3300005456 Bacteria 4717
204 Ga0070678_100306094 3300005456 Bacteria 1352
205 Ga0070678_100467612 3300005456 Bacteria 1107
206 Ga0070662_100003479 3300005457 Bacteria 9817
207 Ga0070662_100008094 3300005457 Bacteria 6844
208 Ga0070662_100023235 3300005457 Bacteria 4257
209 Ga0070662_100038234 3300005457 Bacteria 3408
210 Ga0070662_100041628 3300005457 Bacteria 3278
211 Ga0070662_100044861 3300005457 Bacteria 3169
212 Ga0070662_100074908 3300005457 Bacteria 2505
213 Ga0070662_100087768 3300005457 Bacteria 2330
214 Ga0070662_100205461 3300005457 Bacteria 1565
215 Ga0070662_100699514 3300005457 Bacteria 857
216 Ga0070681_10043010 3300005458 Bacteria 4526
217 Ga0070681_10085866 3300005458 Bacteria 3100
218 Ga0070681_10122957 3300005458 Bacteria 2528
219 Ga0070681_10165574 3300005458 Bacteria 2133
220 Ga0070681_10378840 3300005458 Bacteria 1325
221 Ga0068867_100008041 3300005459 Bacteria 7453
222 Ga0068867_100017475 3300005459 Bacteria 5095
223 Ga0068867_100071292 3300005459 Bacteria 2599
224 Ga0068867_101444260 3300005459 Unclassified 639
225 Ga0068867_101901735 3300005459 Bacteria 561
226 Ga0068867_102090146 3300005459 Bacteria 536
227 Ga0070685_10237222 3300005466 Unclassified 1202
228 Ga0070698_101286751 3300005471 Bacteria 681
229 Ga0070679_100000017 3300005530 Bacteria 129377
230 Ga0070679_100002411 3300005530 Bacteria 16949
231 Ga0070679_100122862 3300005530 Bacteria 2580
232 Ga0070679_100368315 3300005530 Bacteria 1384
233 Ga0070679_100482428 3300005530 Bacteria 1184
234 Ga0070679_101692443 3300005530 Bacteria 580
235 Ga0070679_101725901 3300005530 Unclassified 574
236 Ga0070684_100214642 3300005535 Unclassified 1754
237 Ga0070684_100500686 3300005535 Bacteria 1125
238 Ga0068853_100031336 3300005539 Bacteria 4497
239 Ga0068853_100070421 3300005539 Bacteria 3044
240 Ga0068853_100100839 3300005539 Bacteria 2553
241 Ga0068853_100180027 3300005539 Bacteria 1917
242 Ga0068853_100219975 3300005539 Bacteria 1734
243 Ga0068853_100286279 3300005539 Bacteria 1520
244 Ga0068853_100588097 3300005539 Bacteria 1056
245 Ga0068853_100750086 3300005539 Bacteria 933
246 Ga0070672_100010331 3300005543 Bacteria 6472
247 Ga0070672_100013009 3300005543 Bacteria 5865
248 Ga0070672_100050563 3300005543 Bacteria 3238
249 Ga0070672_100190970 3300005543 Bacteria 1710
250 Ga0070672_100243390 3300005543 Bacteria 1513
251 Ga0070672_100596019 3300005543 Bacteria 962
252 Ga0070695_100033770 3300005545 Bacteria 3202
253 Ga0070695_100253874 3300005545 Unclassified 1281
254 Ga0070696_100040501 3300005546 Bacteria 3217
255 Ga0070693_100088539 3300005547 Bacteria 1862
256 Ga0070693_100814804 3300005547 Bacteria 693
257 Ga0070665_100056976 3300005548 Bacteria 3919
258 Ga0070665_100925679 3300005548 Bacteria 884
259 Ga0070665_101888746 3300005548 Bacteria 603
260 Ga0070704_100138499 3300005549 Bacteria 1897
261 Ga0068855_100008542 3300005563 Bacteria 12379
262 Ga0068855_100142590 3300005563 Bacteria 2729
263 Ga0068855_100307868 3300005563 Bacteria 1753
264 Ga0068855_100320491 3300005563 Bacteria 1713
265 Ga0068855_100655939 3300005563 Bacteria 1126
266 Ga0068855_100792901 3300005563 Bacteria 1007
267 Ga0070664_100014233 3300005564 Bacteria 6488
268 Ga0070664_100021459 3300005564 Bacteria 5322
269 Ga0070664_100033166 3300005564 Bacteria 4323
270 Ga0070664_100107059 3300005564 Bacteria 2437
271 Ga0070664_100121711 3300005564 Bacteria 2285
272 Ga0070664_100126949 3300005564 Bacteria 2238
273 Ga0070664_100547756 3300005564 Unclassified 1069
274 Ga0070664_100750751 3300005564 Bacteria 911
275 Ga0070664_100975259 3300005564 Bacteria 796
276 Ga0068857_100016232 3300005577 Bacteria 6524
277 Ga0068857_100028162 3300005577 Bacteria 4956
278 Ga0068857_100077113 3300005577 Bacteria 2973
279 Ga0068857_100086051 3300005577 Bacteria 2810
280 Ga0068857_100100522 3300005577 Bacteria 2594
281 Ga0068857_100670230 3300005577 Bacteria 984
282 Ga0068857_102028936 3300005577 Bacteria 564
283 Ga0068854_100001621 3300005578 Bacteria 13690
284 Ga0068854_100031913 3300005578 Bacteria 3662
285 Ga0068854_100036249 3300005578 Bacteria 3457
286 Ga0068854_100050057 3300005578 Bacteria 2987
287 Ga0068854_100070209 3300005578 Bacteria 2560
288 Ga0068854_100110561 3300005578 Bacteria 2072
289 Ga0068854_100237794 3300005578 Bacteria 1449
290 Ga0068854_100327777 3300005578 Bacteria 1247
291 Ga0068854_100376705 3300005578 Bacteria 1168
292 Ga0068854_100425746 3300005578 Bacteria 1103
293 Ga0068854_100432941 3300005578 Bacteria 1095
294 Ga0068854_100665258 3300005578 Bacteria 895
295 Ga0068854_101588202 3300005578 Unclassified 596
296 Ga0068856_100021735 3300005614 Bacteria 6235
297 Ga0068856_100044647 3300005614 Bacteria 4362
298 Ga0068856_100148735 3300005614 Bacteria 2350
299 Ga0068856_100963591 3300005614 Bacteria 872
300 Ga0068852_100014470 3300005616 Bacteria 6076
301 Ga0068852_100052180 3300005616 Bacteria 3514
302 Ga0068852_100053492 3300005616 Bacteria 3475
303 Ga0068852_100058849 3300005616 Bacteria 3330
304 Ga0068852_100061243 3300005616 Bacteria 3270
305 Ga0068852_100363828 3300005616 Bacteria 1415
306 Ga0068852_100437954 3300005616 Bacteria 1292
307 Ga0068852_102312533 3300005616 Bacteria 558
308 Ga0068859_100005747 3300005617 Bacteria 12614
309 Ga0068859_100038456 3300005617 Bacteria 4801
310 Ga0068859_100044660 3300005617 Bacteria 4452
311 Ga0068859_100189251 3300005617 Bacteria 2142
312 Ga0068859_100448401 3300005617 Bacteria 1386
313 Ga0068859_101682065 3300005617 Bacteria 701
314 Ga0068859_102104865 3300005617 Bacteria 623
315 Ga0068864_100000773 3300005618 Bacteria 26846
316 Ga0068864_100027468 3300005618 Bacteria 4807
317 Ga0068864_100029656 3300005618 Bacteria 4636
318 Ga0068864_100287197 3300005618 Bacteria 1537
319 Ga0068864_100348827 3300005618 Bacteria 1396
320 Ga0068864_102256794 3300005618 Unclassified 551
321 Ga0068866_10108116 3300005718 Bacteria 1546
322 Ga0068866_10695275 3300005718 Unclassified 697
323 Ga0068861_100017138 3300005719 Bacteria 5136
324 Ga0068861_100112068 3300005719 Bacteria 2187
325 Ga0068861_100194737 3300005719 Bacteria 1697
326 Ga0068861_100263349 3300005719 Bacteria 1477
327 Ga0068861_100272571 3300005719 Bacteria 1454
328 Ga0068851_10009861 3300005834 Bacteria 4448
329 Ga0068851_10030870 3300005834 Bacteria 2659
330 Ga0068851_10046592 3300005834 Bacteria 2193
331 Ga0068851_10059944 3300005834 Bacteria 1947
332 Ga0068851_10514766 3300005834 Bacteria 719
333 Ga0068870_10066251 3300005840 Bacteria 1956
334 Ga0068863_100006362 3300005841 Bacteria 11582
335 Ga0068863_100008110 3300005841 Bacteria 10251
336 Ga0068863_100042997 3300005841 Bacteria 4290
337 Ga0068863_100064460 3300005841 Bacteria 3465
338 Ga0068863_100119307 3300005841 Bacteria 2514
339 Ga0068858_100001877 3300005842 Bacteria 21436
340 Ga0068858_100017656 3300005842 Bacteria 6688
341 Ga0068858_100104177 3300005842 Bacteria 2647
342 Ga0068860_100007821 3300005843 Bacteria 10673
343 Ga0068860_100071912 3300005843 Bacteria 3286
344 Ga0068860_100152954 3300005843 Bacteria 2222
345 Ga0068860_100509302 3300005843 Bacteria 1202
346 Ga0068860_100518205 3300005843 Bacteria 1192
347 Ga0068860_100548700 3300005843 Bacteria 1158
348 Ga0068860_101392246 3300005843 Bacteria 722
349 Ga0068862_100027812 3300005844 Bacteria 4762
350 Ga0068862_100035547 3300005844 Bacteria 4220
351 Ga0068862_100100800 3300005844 Bacteria 2525
352 Ga0068862_100256720 3300005844 Bacteria 1594
353 Ga0068862_100290107 3300005844 Bacteria 1502
354 Ga0068862_100321011 3300005844 Bacteria 1429
355 Ga0068862_100412322 3300005844 Bacteria 1266
356 Ga0068862_100669578 3300005844 Unclassified 1003
357 Ga0068862_100701042 3300005844 Bacteria 981
358 Ga0068862_101785890 3300005844 Bacteria 624
359 Ga0068862_102756117 3300005844 Bacteria 503
360 Ga0081540_1070866 3300005983 Bacteria 1612
361 Ga0070717_10003857 3300006028 Bacteria 10783
362 Ga0075365_11271041 3300006038 Bacteria 517
363 Ga0070716_100265685 3300006173 Bacteria 1176
364 Ga0068871_100314255 3300006358 Bacteria 1378
365 Ga0068871_100674506 3300006358 Bacteria 945
366 Ga0075428_100465962 3300006844 Bacteria 1353
367 Ga0075428_100493120 3300006844 Bacteria 1311
368 Ga0075428_100862602 3300006844 Unclassified 961
369 Ga0075431_100892313 3300006847 Unclassified 859
370 Ga0075431_101095226 3300006847 Bacteria 761
371 Ga0075433_10161937 3300006852 Bacteria 1991
372 Ga0075433_11559453 3300006852 Bacteria 570
373 Ga0075434_100654036 3300006871 Bacteria 1069
374 Ga0075434_101051778 3300006871 Bacteria 828
375 Ga0075429_100582856 3300006880 Bacteria 980
376 Ga0068865_100063956 3300006881 Bacteria 2588
377 Ga0068865_100802277 3300006881 Bacteria 812
378 Ga0097620_100005747 3300006931 Bacteria 12614
379 Ga0097620_100038455 3300006931 Bacteria 4801
380 Ga0097620_100044657 3300006931 Bacteria 4452
381 Ga0097620_100189261 3300006931 Bacteria 2142
382 Ga0097620_100448405 3300006931 Bacteria 1386
383 Ga0097620_101681915 3300006931 Bacteria 701
384 Ga0097620_102104647 3300006931 Bacteria 623
385 Ga0075435_100391840 3300007076 Bacteria 1194
386 Ga0105251_10407933 3300009011 Bacteria 625
387 Ga0105250_10018633 3300009092 Bacteria 2811
388 Ga0105240_10007704 3300009093 Bacteria 15580
389 Ga0105240_10042509 3300009093 Bacteria 5790
390 Ga0105240_10163002 3300009093 Bacteria 2647
391 Ga0105240_10797850 3300009093 Bacteria 1023
392 Ga0111539_10142858 3300009094 Bacteria 2802
393 Ga0111539_10282228 3300009094 Bacteria 1932
394 Ga0111539_11224894 3300009094 Bacteria 872
395 Ga0105245_10000782 3300009098 Bacteria 28837
396 Ga0105245_10019978 3300009098 Bacteria 5872
397 Ga0105247_10767699 3300009101 Bacteria 732
398 Ga0105247_11249030 3300009101 Bacteria 594
399 Ga0105243_10062418 3300009148 Bacteria 2983
400 Ga0105243_10555257 3300009148 Bacteria 1098
401 Ga0105243_10556987 3300009148 Bacteria 1096
402 Ga0105243_10561352 3300009148 Unclassified 1092
403 Ga0105241_10013855 3300009174 Bacteria 5906
404 Ga0105241_10021914 3300009174 Bacteria 4729
405 Ga0105241_10202587 3300009174 Bacteria 1658
406 Ga0105242_10064741 3300009176 Bacteria 3014
407 Ga0105242_10417135 3300009176 Bacteria 1257
408 Ga0105248_10004681 3300009177 Bacteria 15146
409 Ga0105248_10022307 3300009177 Bacteria 7019
410 Ga0105248_10184233 3300009177 Bacteria 2353
411 Ga0105248_10327650 3300009177 Bacteria 1725
412 Ga0105248_11566803 3300009177 Bacteria 746
413 Ga0105237_10097653 3300009545 Bacteria 2928
414 Ga0105238_10066429 3300009551 Bacteria 3608
415 Ga0105238_10079835 3300009551 Bacteria 3261
416 Ga0105238_10180190 3300009551 Bacteria 2090
417 Ga0105238_10747184 3300009551 Bacteria 992
418 Ga0105238_10960462 3300009551 Bacteria 874
419 Ga0105238_10978347 3300009551 Bacteria 867
420 Ga0105249_10008290 3300009553 Bacteria 9049
421 Ga0105249_10009121 3300009553 Bacteria 8676
422 Ga0105249_10034168 3300009553 Bacteria 4605
423 Ga0105249_10037802 3300009553 Bacteria 4380
424 Ga0105249_10309863 3300009553 Bacteria 1586
425 Ga0105239_10082368 3300010375 Bacteria 3543
426 Ga0105239_10217052 3300010375 Bacteria 2144
427 Ga0105239_11394296 3300010375 Bacteria 809
428 Ga0105239_11451541 3300010375 Bacteria 792
429 Ga0105239_11895441 3300010375 Bacteria 691
430 Ga0105246_10057807 3300011119 Bacteria 2685
431 Ga0105246_10122045 3300011119 Bacteria 1932
432 Ga0157373_10007888 3300013100 Bacteria 7921
433 Ga0157373_10021241 3300013100 Bacteria 4713
434 Ga0157373_10042025 3300013100 Bacteria 3268
435 Ga0157373_10049512 3300013100 Bacteria 2994
436 Ga0157373_10062897 3300013100 Bacteria 2628
437 Ga0157373_10088384 3300013100 Bacteria 2183
438 Ga0157373_10094016 3300013100 Bacteria 2111
439 Ga0157373_10117129 3300013100 Bacteria 1872
440 Ga0157373_10140155 3300013100 Unclassified 1700
441 Ga0157373_10226223 3300013100 Bacteria 1320
442 Ga0157373_10331829 3300013100 Unclassified 1083
443 Ga0157373_10356222 3300013100 Bacteria 1044
444 Ga0157371_10035363 3300013102 Bacteria 3579
445 Ga0157371_10063630 3300013102 Bacteria 2615
446 Ga0157371_10074846 3300013102 Bacteria 2398
447 Ga0157371_10100083 3300013102 Bacteria 2056
448 Ga0157371_10317913 3300013102 Bacteria 1129
449 Ga0157371_11068577 3300013102 Bacteria 618
450 Ga0157371_11178846 3300013102 Unclassified 590
451 Ga0157370_10015560 3300013104 Bacteria 7733
452 Ga0157370_10039668 3300013104 Bacteria 4550
453 Ga0157370_10072313 3300013104 Bacteria 3254
454 Ga0157370_10201348 3300013104 Bacteria 1847
455 Ga0157370_10313853 3300013104 Unclassified 1446
456 Ga0157370_10410249 3300013104 Bacteria 1246
457 Ga0157369_10000185 3300013105 Bacteria 86285
458 Ga0157369_10010900 3300013105 Bacteria 10354
459 Ga0157369_10012733 3300013105 Bacteria 9537
460 Ga0157369_10082219 3300013105 Bacteria 3446
461 Ga0157369_10306056 3300013105 Bacteria 1653
462 Ga0157369_10549134 3300013105 Bacteria 1194
463 Ga0157369_11833202 3300013105 Bacteria 616
464 Ga0157374_10001858 3300013296 Bacteria 17775
465 Ga0157374_10038141 3300013296 Bacteria 4415
466 Ga0157374_11507143 3300013296 Bacteria 696
467 Ga0157378_10022210 3300013297 Bacteria 5584
468 Ga0157378_11630073 3300013297 Unclassified 691
469 Ga0163162_10062646 3300013306 Bacteria 3760
470 Ga0163162_10114579 3300013306 Bacteria 2795
471 Ga0163162_10332022 3300013306 Bacteria 1653
472 Ga0163162_11357462 3300013306 Unclassified 808
473 Ga0163162_11369611 3300013306 Bacteria 805
474 Ga0157372_10022159 3300013307 Bacteria 6872
475 Ga0157372_10045683 3300013307 Bacteria 4860
476 Ga0157372_10096910 3300013307 Bacteria 3363
477 Ga0157372_10197417 3300013307 Unclassified 2331
478 Ga0157372_10434038 3300013307 Bacteria 1531
479 Ga0157372_10454393 3300013307 Bacteria 1493
480 Ga0157372_10806039 3300013307 Bacteria 1091
481 Ga0157372_10894090 3300013307 Bacteria 1030
482 Ga0157372_11039210 3300013307 Bacteria 948
483 Ga0157375_10001588 3300013308 Bacteria 19530
484 Ga0157375_10409996 3300013308 Bacteria 1521
485 Ga0157375_10853575 3300013308 Unclassified 1057
486 Ga0157375_11141162 3300013308 Bacteria 913
487 Ga0157375_11495082 3300013308 Bacteria 797
488 Ga0157375_11872934 3300013308 Bacteria 712
489 Ga0163163_10000486 3300014325 Bacteria 35941
490 Ga0163163_10118395 3300014325 Bacteria 2681
491 Ga0157380_10003443 3300014326 Bacteria 10867
492 Ga0157380_10009069 3300014326 Bacteria 7108
493 Ga0157380_10051386 3300014326 Bacteria 3260
494 Ga0157380_10209759 3300014326 Bacteria 1735
495 Ga0157380_10286471 3300014326 Bacteria 1510
496 Ga0157380_10328829 3300014326 Bacteria 1420
497 Ga0157380_10600500 3300014326 Bacteria 1089
498 Ga0157380_11959486 3300014326 Bacteria 647
499 Ga0157377_10475585 3300014745 Bacteria 868
500 Ga0157377_10481571 3300014745 Bacteria 863
501 Ga0157379_10013649 3300014968 Bacteria 7120
502 Ga0157379_10255540 3300014968 Bacteria 1591
503 Ga0163161_10002869 3300017792 Bacteria 12217
504 Ga0163161_10128818 3300017792 Bacteria 1907
505 Ga0197907_10831941 3300020069 Bacteria 1832
506 Ga0206356_10485130 3300020070 Bacteria 1611
507 Ga0206349_1625932 3300020075 Unclassified 551
508 Ga0206355_1207118 3300020076 Bacteria 2002
509 Ga0206352_10163851 3300020078 Bacteria 1018
510 Ga0206352_11103589 3300020078 Bacteria 1906
511 Ga0206353_11000466 3300020082 Bacteria 7140
512 Ga0206353_11764448 3300020082 Bacteria 538
513 Ga0154015_1397734 3300020610 Bacteria 647
514 Ga0213873_10000027 3300021358 Bacteria 73909
515 Ga0213874_10064075 3300021377 Bacteria 1158
516 Ga0213876_10000004 3300021384 Bacteria 943822
517 Ga0213876_10000395 3300021384 Bacteria 36646
518 Ga0213876_10122587 3300021384 Bacteria 1380
519 Ga0224712_10048653 3300022467 Bacteria 1638
520 Ga0224712_10411844 3300022467 Bacteria 645
521 Ga0209565_1000151 3300025263 Bacteria 93781
522 Ga0209673_1006474 3300025273 Bacteria 5650
523 Ga0209050_1018121 3300025298 Bacteria 2756
524 Ga0207426_1125309 3300025302 Bacteria 629
525 Ga0207697_10005048 3300025315 Bacteria 6185
526 Ga0207656_10004042 3300025321 Bacteria 5090
527 Ga0207656_10008631 3300025321 Bacteria 3758
528 Ga0207656_10011159 3300025321 Bacteria 3387
529 Ga0207682_10001996 3300025893 Bacteria 9230
530 Ga0207682_10002227 3300025893 Bacteria 8747
531 Ga0207682_10033528 3300025893 Bacteria 2068
532 Ga0207682_10065894 3300025893 Bacteria 1525
533 Ga0207642_10018322 3300025899 Bacteria 2685
534 Ga0207688_10026749 3300025901 Bacteria 3174
535 Ga0207688_10086365 3300025901 Bacteria 1797
536 Ga0207688_10328491 3300025901 Bacteria 939
537 Ga0207680_10023361 3300025903 Bacteria 3375
538 Ga0207680_10312175 3300025903 Bacteria 1098
539 Ga0207647_10000857 3300025904 Bacteria 23599
540 Ga0207647_10000984 3300025904 Bacteria 22104
541 Ga0207647_10001181 3300025904 Bacteria 20110
542 Ga0207647_10023741 3300025904 Bacteria 4052
543 Ga0207647_10025899 3300025904 Bacteria 3845
544 Ga0207647_10088225 3300025904 Bacteria 1852
545 Ga0207647_10112484 3300025904 Bacteria 1609
546 Ga0207645_10010873 3300025907 Bacteria 6237
547 Ga0207645_10053620 3300025907 Bacteria 2577
548 Ga0207645_10167752 3300025907 Bacteria 1438
549 Ga0207643_10286109 3300025908 Bacteria 1023
550 Ga0207643_10417528 3300025908 Bacteria 850
551 Ga0207705_10000002 3300025909 Bacteria 2046852
552 Ga0207705_10000003 3300025909 Bacteria 709270
553 Ga0207705_10000529 3300025909 Bacteria 32329
554 Ga0207705_10022603 3300025909 Bacteria 4485
555 Ga0207705_10037101 3300025909 Bacteria 3487
556 Ga0207705_10064681 3300025909 Bacteria 2643
557 Ga0207705_10107084 3300025909 Bacteria 2062
558 Ga0207705_10166206 3300025909 Bacteria 1659
559 Ga0207705_10268504 3300025909 Bacteria 1304
560 Ga0207705_11009526 3300025909 Bacteria 643
561 Ga0207654_10036987 3300025911 Bacteria 2731
562 Ga0207654_10602367 3300025911 Unclassified 784
563 Ga0207654_10606967 3300025911 Bacteria 781
564 Ga0207654_10880635 3300025911 Bacteria 649
565 Ga0207707_10012541 3300025912 Bacteria 7368
566 Ga0207707_10032886 3300025912 Bacteria 4539
567 Ga0207707_10067055 3300025912 Bacteria 3126
568 Ga0207707_10393859 3300025912 Bacteria 1190
569 Ga0207707_10460698 3300025912 Bacteria 1087
570 Ga0207695_10011187 3300025913 Bacteria 10887
571 Ga0207695_10012790 3300025913 Bacteria 10049
572 Ga0207695_10015638 3300025913 Bacteria 8925
573 Ga0207695_10044891 3300025913 Bacteria 4697
574 Ga0207695_10767798 3300025913 Bacteria 844
575 Ga0207671_10580553 3300025914 Bacteria 894
576 Ga0207660_10008800 3300025917 Bacteria 6526
577 Ga0207660_10038465 3300025917 Bacteria 3340
578 Ga0207660_10738400 3300025917 Bacteria 803
579 Ga0207660_11075729 3300025917 Unclassified 655
580 Ga0207662_10166571 3300025918 Bacteria 1411
581 Ga0207662_10355575 3300025918 Bacteria 985
582 Ga0207662_10667652 3300025918 Bacteria 727
583 Ga0207657_10000519 3300025919 Bacteria 40709
584 Ga0207657_10001346 3300025919 Bacteria 26150
585 Ga0207657_10008325 3300025919 Bacteria 10552
586 Ga0207657_10035996 3300025919 Bacteria 4434
587 Ga0207657_10045982 3300025919 Bacteria 3826
588 Ga0207657_10068899 3300025919 Bacteria 3004
589 Ga0207657_10095044 3300025919 Bacteria 2480
590 Ga0207657_10095180 3300025919 Bacteria 2478
591 Ga0207657_10471117 3300025919 Bacteria 985
592 Ga0207649_10000018 3300025920 Bacteria 225137
593 Ga0207649_10000244 3300025920 Bacteria 44088
594 Ga0207649_10032361 3300025920 Bacteria 3117
595 Ga0207649_10087641 3300025920 Bacteria 2031
596 Ga0207649_10197109 3300025920 Bacteria 1420
597 Ga0207649_11026332 3300025920 Bacteria 649
598 Ga0207649_11055683 3300025920 Bacteria 640
599 Ga0207652_10000001 3300025921 Bacteria 1006643
600 Ga0207652_10000453 3300025921 Bacteria 42225
601 Ga0207652_10560513 3300025921 Unclassified 1026
602 Ga0207652_10956272 3300025921 Bacteria 754
603 Ga0207652_11004368 3300025921 Bacteria 733
604 Ga0207681_10010000 3300025923 Bacteria 5806
605 Ga0207681_10022394 3300025923 Bacteria 4030
606 Ga0207681_10066945 3300025923 Bacteria 2488
607 Ga0207681_10198135 3300025923 Bacteria 1540
608 Ga0207681_10516834 3300025923 Bacteria 979
609 Ga0207681_11148058 3300025923 Bacteria 652
610 Ga0207694_10108032 3300025924 Bacteria 2211
611 Ga0207694_10200517 3300025924 Bacteria 1623
612 Ga0207694_10481105 3300025924 Bacteria 1038
613 Ga0207694_10808700 3300025924 Bacteria 792
614 Ga0207694_11282684 3300025924 Bacteria 619
615 Ga0207650_10032491 3300025925 Bacteria 3775
616 Ga0207650_10049500 3300025925 Bacteria 3103
617 Ga0207650_10121885 3300025925 Bacteria 2031
618 Ga0207650_10231678 3300025925 Bacteria 1490
619 Ga0207650_10276444 3300025925 Bacteria 1366
620 Ga0207650_10607087 3300025925 Bacteria 920
621 Ga0207650_11059768 3300025925 Bacteria 690
622 Ga0207650_11181759 3300025925 Bacteria 651
623 Ga0207650_11751833 3300025925 Bacteria 526
624 Ga0207659_10011868 3300025926 Bacteria 5519
625 Ga0207659_10078713 3300025926 Bacteria 2429
626 Ga0207659_11419835 3300025926 Bacteria 595
627 Ga0207659_11563354 3300025926 Bacteria 563
628 Ga0207687_10013795 3300025927 Bacteria 5278
629 Ga0207687_10102362 3300025927 Bacteria 2110
630 Ga0207700_10237788 3300025928 Bacteria 1551
631 Ga0207664_10864504 3300025929 Bacteria 813
632 Ga0207644_10012576 3300025931 Bacteria 5626
633 Ga0207644_10022730 3300025931 Bacteria 4287
634 Ga0207644_10066932 3300025931 Bacteria 2617
635 Ga0207644_10159122 3300025931 Bacteria 1754
636 Ga0207644_10264063 3300025931 Bacteria 1377
637 Ga0207644_10274866 3300025931 Bacteria 1351
638 Ga0207644_10745341 3300025931 Bacteria 818
639 Ga0207690_10002067 3300025932 Bacteria 12299
640 Ga0207690_10007110 3300025932 Bacteria 6650
641 Ga0207690_10076941 3300025932 Bacteria 2318
642 Ga0207690_10079944 3300025932 Bacteria 2280
643 Ga0207690_10163096 3300025932 Bacteria 1663
644 Ga0207690_10771844 3300025932 Bacteria 793
645 Ga0207706_10000187 3300025933 Bacteria 69090
646 Ga0207706_10005896 3300025933 Bacteria 11395
647 Ga0207706_10007738 3300025933 Bacteria 9919
648 Ga0207706_10021485 3300025933 Bacteria 5796
649 Ga0207706_10028348 3300025933 Bacteria 5002
650 Ga0207706_10043613 3300025933 Bacteria 3974
651 Ga0207706_10044534 3300025933 Bacteria 3933
652 Ga0207706_10144699 3300025933 Bacteria 2091
653 Ga0207706_10147424 3300025933 Bacteria 2070
654 Ga0207706_10245953 3300025933 Bacteria 1563
655 Ga0207686_10078886 3300025934 Bacteria 2142
656 Ga0207709_10122822 3300025935 Bacteria 1756
657 Ga0207709_10180447 3300025935 Bacteria 1490
658 Ga0207709_10461538 3300025935 Bacteria 984
659 Ga0207709_10911512 3300025935 Bacteria 715
660 Ga0207669_10035657 3300025937 Bacteria 2833
661 Ga0207669_10081268 3300025937 Bacteria 2076
662 Ga0207669_11748807 3300025937 Bacteria 531
663 Ga0207704_10583715 3300025938 Bacteria 913
664 Ga0207704_11696615 3300025938 Bacteria 543
665 Ga0207665_10123086 3300025939 Bacteria 1834
666 Ga0207691_10132099 3300025940 Bacteria 2204
667 Ga0207691_10164637 3300025940 Bacteria 1944
668 Ga0207691_10178038 3300025940 Bacteria 1859
669 Ga0207691_10235510 3300025940 Bacteria 1584
670 Ga0207691_10238908 3300025940 Bacteria 1571
671 Ga0207691_10364696 3300025940 Unclassified 1235
672 Ga0207691_10392782 3300025940 Bacteria 1183
673 Ga0207711_10001615 3300025941 Bacteria 20798
674 Ga0207711_10032103 3300025941 Bacteria 4439
675 Ga0207711_10119352 3300025941 Bacteria 2353
676 Ga0207711_10181000 3300025941 Bacteria 1917
677 Ga0207689_10022793 3300025942 Bacteria 5261
678 Ga0207689_10026962 3300025942 Bacteria 4810
679 Ga0207661_10007816 3300025944 Bacteria 7616
680 Ga0207661_10317718 3300025944 Bacteria 1399
681 Ga0207661_11221549 3300025944 Bacteria 691
682 Ga0207679_10029350 3300025945 Bacteria 3828
683 Ga0207679_10036282 3300025945 Bacteria 3495
684 Ga0207679_10076790 3300025945 Bacteria 2539
685 Ga0207679_10198440 3300025945 Bacteria 1674
686 Ga0207679_10269613 3300025945 Bacteria 1455
687 Ga0207679_10476787 3300025945 Unclassified 1110
688 Ga0207679_10748953 3300025945 Bacteria 888
689 Ga0207679_11013687 3300025945 Bacteria 761
690 Ga0207679_11143965 3300025945 Bacteria 714
691 Ga0207667_10020794 3300025949 Bacteria 7289
692 Ga0207667_10035328 3300025949 Bacteria 5362
693 Ga0207667_10085414 3300025949 Bacteria 3267
694 Ga0207667_10130304 3300025949 Bacteria 2590
695 Ga0207667_10318726 3300025949 Bacteria 1588
696 Ga0207651_10016919 3300025960 Bacteria 4291
697 Ga0207651_10072999 3300025960 Bacteria 2438
698 Ga0207651_10472412 3300025960 Bacteria 1079
699 Ga0207651_10756753 3300025960 Bacteria 859
700 Ga0207651_10793657 3300025960 Bacteria 839
701 Ga0207651_10884157 3300025960 Bacteria 795
702 Ga0207712_10000566 3300025961 Bacteria 29904
703 Ga0207712_10039116 3300025961 Bacteria 3248
704 Ga0207712_10051403 3300025961 Bacteria 2882
705 Ga0207712_10309182 3300025961 Bacteria 1300
706 Ga0207712_11758144 3300025961 Unclassified 556
707 Ga0207668_10003630 3300025972 Bacteria 9065
708 Ga0207668_10072402 3300025972 Bacteria 2466
709 Ga0207668_10084519 3300025972 Bacteria 2313
710 Ga0207668_10102862 3300025972 Bacteria 2126
711 Ga0207668_10141087 3300025972 Bacteria 1853
712 Ga0207668_10281769 3300025972 Bacteria 1363
713 Ga0207668_10330869 3300025972 Bacteria 1267
714 Ga0207640_10002555 3300025981 Bacteria 9753
715 Ga0207640_10008684 3300025981 Bacteria 5650
716 Ga0207640_10019097 3300025981 Bacteria 4043
717 Ga0207640_10033768 3300025981 Bacteria 3186
718 Ga0207640_10077650 3300025981 Bacteria 2258
719 Ga0207640_10087036 3300025981 Bacteria 2153
720 Ga0207640_10153582 3300025981 Bacteria 1694
721 Ga0207640_10774665 3300025981 Bacteria 829
722 Ga0207640_12112071 3300025981 Bacteria 511
723 Ga0207658_10029117 3300025986 Bacteria 3896
724 Ga0207658_10031515 3300025986 Bacteria 3766
725 Ga0207658_10047512 3300025986 Bacteria 3141
726 Ga0207658_10302422 3300025986 Bacteria 1378
727 Ga0207658_11105911 3300025986 Bacteria 724
728 Ga0207658_11263015 3300025986 Unclassified 675
729 Ga0207658_11556726 3300025986 Bacteria 604
730 Ga0207677_10042259 3300026023 Bacteria 3021
731 Ga0207677_10122142 3300026023 Bacteria 1961
732 Ga0207677_10185665 3300026023 Bacteria 1640
733 Ga0207677_10353316 3300026023 Bacteria 1232
734 Ga0207703_10001835 3300026035 Bacteria 18932
735 Ga0207703_10007646 3300026035 Bacteria 8564
736 Ga0207703_10382459 3300026035 Bacteria 1302
737 Ga0207639_10044888 3300026041 Bacteria 3326
738 Ga0207639_10071478 3300026041 Bacteria 2714
739 Ga0207639_10091163 3300026041 Bacteria 2440
740 Ga0207639_10256627 3300026041 Bacteria 1527
741 Ga0207639_10386270 3300026041 Bacteria 1258
742 Ga0207639_10540097 3300026041 Bacteria 1069
743 Ga0207678_10000068 3300026067 Bacteria 81610
744 Ga0207678_10001365 3300026067 Bacteria 22501
745 Ga0207678_10001768 3300026067 Bacteria 19781
746 Ga0207678_10005637 3300026067 Bacteria 11192
747 Ga0207678_10006075 3300026067 Bacteria 10740
748 Ga0207678_10010189 3300026067 Bacteria 8252
749 Ga0207678_10093485 3300026067 Bacteria 2569
750 Ga0207678_10108375 3300026067 Bacteria 2369
751 Ga0207678_10326270 3300026067 Bacteria 1321
752 Ga0207678_10818395 3300026067 Bacteria 823
753 Ga0207678_10889538 3300026067 Bacteria 787
754 Ga0207708_10218981 3300026075 Bacteria 1525
755 Ga0207708_10728530 3300026075 Unclassified 849
756 Ga0207702_10013173 3300026078 Bacteria 6876
757 Ga0207702_10026785 3300026078 Bacteria 4787
758 Ga0207702_10046707 3300026078 Bacteria 3646
759 Ga0207702_10050398 3300026078 Bacteria 3515
760 Ga0207702_10073760 3300026078 Bacteria 2943
761 Ga0207702_10842812 3300026078 Bacteria 907
762 Ga0207641_10000659 3300026088 Bacteria 37671
763 Ga0207641_10041868 3300026088 Bacteria 3840
764 Ga0207641_10043141 3300026088 Bacteria 3786
765 Ga0207641_10165515 3300026088 Bacteria 2013
766 Ga0207641_11539308 3300026088 Bacteria 667
767 Ga0207641_12476573 3300026088 Bacteria 517
768 Ga0207648_10016014 3300026089 Bacteria 6869
769 Ga0207648_10098447 3300026089 Bacteria 2561
770 Ga0207648_10409771 3300026089 Bacteria 1229
771 Ga0207648_11339710 3300026089 Unclassified 673
772 Ga0207676_10032440 3300026095 Bacteria 3935
773 Ga0207676_10045960 3300026095 Bacteria 3376
774 Ga0207676_10048610 3300026095 Bacteria 3294
775 Ga0207676_10299283 3300026095 Bacteria 1468
776 Ga0207676_10838266 3300026095 Bacteria 899
777 Ga0207674_10006319 3300026116 Bacteria 13963
778 Ga0207674_10021655 3300026116 Bacteria 6920
779 Ga0207674_10032272 3300026116 Bacteria 5495
780 Ga0207674_10039134 3300026116 Bacteria 4917
781 Ga0207674_10078939 3300026116 Bacteria 3297
782 Ga0207674_10166861 3300026116 Bacteria 2156
783 Ga0207674_10406103 3300026116 Bacteria 1316
784 Ga0207675_100006920 3300026118 Bacteria 10730
785 Ga0207675_100204155 3300026118 Bacteria 1899
786 Ga0207683_10019836 3300026121 Bacteria 5743
787 Ga0207683_10526723 3300026121 Bacteria 1092
788 Ga0207698_10022420 3300026142 Bacteria 4387
789 Ga0207698_10026332 3300026142 Bacteria 4113
790 Ga0207698_10042149 3300026142 Bacteria 3407
791 Ga0207698_10045600 3300026142 Bacteria 3304
792 Ga0207698_10067403 3300026142 Bacteria 2822
793 Ga0207698_10283693 3300026142 Bacteria 1533
794 Ga0207698_10488088 3300026142 Bacteria 1196
795 Ga0207698_10801191 3300026142 Bacteria 944
796 Ga0207698_11429163 3300026142 Bacteria 707
797 Ga0209968_1097482 3300027526 Bacteria 535
798 Ga0209983_1050778 3300027665 Unclassified 908
799 Ga0209974_10100144 3300027876 Bacteria 1012
800 Ga0209974_10137567 3300027876 Bacteria 874
801 Ga0268266_10828334 3300028379 Bacteria 894
802 Ga0268265_10004271 3300028380 Bacteria 9974
803 Ga0268265_10014855 3300028380 Bacteria 5315
804 Ga0268265_10032697 3300028380 Bacteria 3773
805 Ga0268265_10044455 3300028380 Bacteria 3307
806 Ga0268265_10074599 3300028380 Bacteria 2654
807 Ga0268265_10085494 3300028380 Bacteria 2503
808 Ga0268265_10132419 3300028380 Bacteria 2074
809 Ga0268265_10791647 3300028380 Bacteria 923
810 Ga0268265_12633360 3300028380 Bacteria 508
811 Ga0268264_10001316 3300028381 Bacteria 23380
812 Ga0268264_10010683 3300028381 Bacteria 7584
813 Ga0268264_10022846 3300028381 Bacteria 5103
814 Ga0268264_10046189 3300028381 Bacteria 3616
815 Ga0268264_10092845 3300028381 Bacteria 2606
816 Ga0268264_11346388 3300028381 Bacteria 724
817 Ga0316182_1015430 3300030745 Bacteria 1721
818 Ga0316182_1131865 3300030745 Bacteria 572
819 Ga0307513_10323641 3300031456 Bacteria 1299
820 Ga0307513_10378479 3300031456 Bacteria 1156
821 Ga0307408_100059500 3300031548 Bacteria 2780
822 Ga0307408_100079168 3300031548 Bacteria 2451
823 Ga0307408_100110162 3300031548 Bacteria 2114
824 Ga0307408_100145139 3300031548 Bacteria 1867
825 Ga0307408_100146609 3300031548 Bacteria 1858
826 Ga0307408_100325449 3300031548 Bacteria 1296
827 Ga0307408_100326530 3300031548 Bacteria 1294
828 Ga0307408_100419527 3300031548 Bacteria 1153
829 Ga0307408_100448064 3300031548 Bacteria 1119
830 Ga0307408_101146304 3300031548 Bacteria 723
831 Ga0307408_101492265 3300031548 Bacteria 639
832 Ga0307405_10015003 3300031731 Bacteria 4182
833 Ga0307405_10029652 3300031731 Bacteria 3199
834 Ga0307405_10072947 3300031731 Bacteria 2214
835 Ga0307405_10092866 3300031731 Bacteria 2003
836 Ga0307405_10096466 3300031731 Bacteria 1971
837 Ga0307405_10113678 3300031731 Bacteria 1838
838 Ga0307405_10131335 3300031731 Bacteria 1731
839 Ga0307405_10144236 3300031731 Bacteria 1665
840 Ga0307405_10203576 3300031731 Bacteria 1439
841 Ga0307405_10245055 3300031731 Bacteria 1330
842 Ga0307405_10264977 3300031731 Unclassified 1285
843 Ga0307405_10269709 3300031731 Bacteria 1275
844 Ga0307405_10273059 3300031731 Bacteria 1269
845 Ga0307405_10355655 3300031731 Bacteria 1131
846 Ga0307405_10392958 3300031731 Bacteria 1083
847 Ga0307405_10403252 3300031731 Bacteria 1071
848 Ga0307405_10483917 3300031731 Bacteria 988
849 Ga0307405_10574135 3300031731 Bacteria 916
850 Ga0307405_10843840 3300031731 Bacteria 771
851 Ga0307405_10873887 3300031731 Bacteria 758
852 Ga0307405_10968781 3300031731 Bacteria 724
853 Ga0307405_11395063 3300031731 Bacteria 612
854 Ga0307413_10008774 3300031824 Bacteria 4796
855 Ga0307413_10009336 3300031824 Bacteria 4690
856 Ga0307413_10031246 3300031824 Bacteria 3002
857 Ga0307413_10031253 3300031824 Bacteria 3002
858 Ga0307413_10037623 3300031824 Bacteria 2796
859 Ga0307413_10039441 3300031824 Bacteria 2746
860 Ga0307413_10075680 3300031824 Bacteria 2137
861 Ga0307413_10076537 3300031824 Bacteria 2127
862 Ga0307413_10083427 3300031824 Bacteria 2056
863 Ga0307413_10160203 3300031824 Bacteria 1580
864 Ga0307413_10190324 3300031824 Bacteria 1472
865 Ga0307413_10197665 3300031824 Bacteria 1449
866 Ga0307413_10204500 3300031824 Bacteria 1429
867 Ga0307413_10265835 3300031824 Bacteria 1281
868 Ga0307413_10319304 3300031824 Bacteria 1186
869 Ga0307413_10403378 3300031824 Bacteria 1072
870 Ga0307413_10673122 3300031824 Bacteria 856
871 Ga0307413_10925578 3300031824 Bacteria 742
872 Ga0307413_10938454 3300031824 Bacteria 737
873 Ga0307413_11025803 3300031824 Bacteria 708
874 Ga0307413_11362447 3300031824 Bacteria 623
875 Ga0307413_11388954 3300031824 Bacteria 617
876 Ga0307413_11588726 3300031824 Bacteria 580
877 Ga0307413_11787263 3300031824 Bacteria 550
878 Ga0307413_11857387 3300031824 Unclassified 540
879 Ga0307410_10006719 3300031852 Bacteria 6234
880 Ga0307410_10027938 3300031852 Bacteria 3571
881 Ga0307410_10047471 3300031852 Bacteria 2870
882 Ga0307410_10055519 3300031852 Bacteria 2689
883 Ga0307410_10119547 3300031852 Bacteria 1919
884 Ga0307410_10120428 3300031852 Bacteria 1913
885 Ga0307410_10238639 3300031852 Bacteria 1407
886 Ga0307410_10253416 3300031852 Bacteria 1369
887 Ga0307410_10432839 3300031852 Bacteria 1069
888 Ga0307410_10475286 3300031852 Bacteria 1024
889 Ga0307410_10480959 3300031852 Bacteria 1019
890 Ga0307410_10720786 3300031852 Unclassified 842
891 Ga0307406_10009016 3300031901 Bacteria 5579
892 Ga0307406_10015515 3300031901 Bacteria 4411
893 Ga0307406_10032412 3300031901 Bacteria 3190
894 Ga0307406_10074110 3300031901 Bacteria 2240
895 Ga0307406_10086653 3300031901 Bacteria 2097
896 Ga0307406_10155622 3300031901 Bacteria 1636
897 Ga0307406_10191701 3300031901 Bacteria 1497
898 Ga0307406_10202849 3300031901 Bacteria 1461
899 Ga0307406_10367041 3300031901 Bacteria 1130
900 Ga0307406_10405842 3300031901 Bacteria 1081
901 Ga0307406_10642097 3300031901 Bacteria 880
902 Ga0307406_10695799 3300031901 Bacteria 848
903 Ga0307407_10004853 3300031903 Bacteria 5769
904 Ga0307407_10014470 3300031903 Bacteria 3865
905 Ga0307407_10071520 3300031903 Bacteria 2065
906 Ga0307407_10118373 3300031903 Bacteria 1675
907 Ga0307407_10124655 3300031903 Bacteria 1639
908 Ga0307407_10133799 3300031903 Bacteria 1590
909 Ga0307407_10137587 3300031903 Bacteria 1571
910 Ga0307407_10152657 3300031903 Bacteria 1502
911 Ga0307407_10188056 3300031903 Bacteria 1374
912 Ga0307407_10202734 3300031903 Unclassified 1330
913 Ga0307407_10383954 3300031903 Bacteria 1003
914 Ga0307407_10421333 3300031903 Bacteria 962
915 Ga0307407_10830279 3300031903 Bacteria 705
916 Ga0307407_11314154 3300031903 Bacteria 568
917 Ga0307412_10002944 3300031911 Bacteria 9448
918 Ga0307412_10012304 3300031911 Bacteria 4983
919 Ga0307412_10030423 3300031911 Bacteria 3399
920 Ga0307412_10037020 3300031911 Bacteria 3131
921 Ga0307412_10056839 3300031911 Bacteria 2609
922 Ga0307412_10057194 3300031911 Bacteria 2602
923 Ga0307412_10228747 3300031911 Bacteria 1430
924 Ga0307412_10303235 3300031911 Bacteria 1263
925 Ga0307412_10305655 3300031911 Bacteria 1259
926 Ga0307412_10673832 3300031911 Bacteria 885
927 Ga0307412_11060449 3300031911 Bacteria 719
928 Ga0307412_11130581 3300031911 Bacteria 698
929 Ga0307412_11230443 3300031911 Unclassified 671
930 Ga0307412_11328556 3300031911 Bacteria 648
931 Ga0307412_12049864 3300031911 Bacteria 530
932 Ga0307412_12121817 3300031911 Bacteria 522
933 Ga0307409_100003524 3300031995 Bacteria 8531
934 Ga0307409_100053123 3300031995 Bacteria 3111
935 Ga0307409_100058816 3300031995 Bacteria 2987
936 Ga0307409_100062807 3300031995 Bacteria 2909
937 Ga0307409_100123812 3300031995 Bacteria 2195
938 Ga0307409_100195645 3300031995 Bacteria 1804
939 Ga0307409_100227292 3300031995 Bacteria 1689
940 Ga0307409_100235561 3300031995 Bacteria 1663
941 Ga0307409_100255568 3300031995 Bacteria 1604
942 Ga0307409_100335538 3300031995 Bacteria 1420
943 Ga0307409_100419010 3300031995 Bacteria 1284
944 Ga0307409_100560457 3300031995 Unclassified 1123
945 Ga0307409_100711001 3300031995 Bacteria 1005
946 Ga0307409_100728863 3300031995 Bacteria 993
947 Ga0307409_100916075 3300031995 Bacteria 891
948 Ga0307409_101005542 3300031995 Bacteria 852
949 Ga0307409_101318519 3300031995 Bacteria 747
950 Ga0307409_101336228 3300031995 Bacteria 742
951 Ga0307409_101423616 3300031995 Bacteria 720
952 Ga0307409_101783138 3300031995 Bacteria 644
953 Ga0307409_102297817 3300031995 Bacteria 568
954 Ga0307416_100012769 3300032002 Bacteria 5677
955 Ga0307416_100046625 3300032002 Bacteria 3422
956 Ga0307416_100079594 3300032002 Bacteria 2762
957 Ga0307416_100092780 3300032002 Bacteria 2598
958 Ga0307416_100131227 3300032002 Bacteria 2256
959 Ga0307416_100147250 3300032002 Bacteria 2152
960 Ga0307416_100147481 3300032002 Bacteria 2151
961 Ga0307416_100166406 3300032002 Bacteria 2046
962 Ga0307416_100166761 3300032002 Bacteria 2044
963 Ga0307416_100329264 3300032002 Bacteria 1534
964 Ga0307416_100407348 3300032002 Bacteria 1399
965 Ga0307416_100421592 3300032002 Bacteria 1379
966 Ga0307416_100517889 3300032002 Bacteria 1260
967 Ga0307416_100612150 3300032002 Unclassified 1170
968 Ga0307416_100630894 3300032002 Bacteria 1154
969 Ga0307416_100704047 3300032002 Bacteria 1099
970 Ga0307416_100979418 3300032002 Bacteria 948
971 Ga0307416_101458988 3300032002 Bacteria 790
972 Ga0307416_102232143 3300032002 Unclassified 648
973 Ga0307414_10032913 3300032004 Bacteria 3419
974 Ga0307414_10047924 3300032004 Bacteria 2944
975 Ga0307414_10071272 3300032004 Bacteria 2506
976 Ga0307414_10073009 3300032004 Bacteria 2480
977 Ga0307414_10082737 3300032004 Bacteria 2355
978 Ga0307414_10089290 3300032004 Bacteria 2283
979 Ga0307414_10096509 3300032004 Bacteria 2212
980 Ga0307414_10146806 3300032004 Bacteria 1854
981 Ga0307414_10166425 3300032004 Bacteria 1757
982 Ga0307414_10272912 3300032004 Bacteria 1417
983 Ga0307414_10278077 3300032004 Bacteria 1405
984 Ga0307414_10299219 3300032004 Bacteria 1360
985 Ga0307414_10352156 3300032004 Bacteria 1264
986 Ga0307414_10564250 3300032004 Bacteria 1016
987 Ga0307414_10611389 3300032004 Bacteria 978
988 Ga0307414_10614408 3300032004 Bacteria 976
989 Ga0307414_10746929 3300032004 Bacteria 889
990 Ga0307414_10758059 3300032004 Bacteria 882
991 Ga0307414_10820489 3300032004 Bacteria 849
992 Ga0307414_10965789 3300032004 Bacteria 783
993 Ga0307414_10992873 3300032004 Bacteria 772
994 Ga0307414_11148768 3300032004 Bacteria 718
995 Ga0307414_11236233 3300032004 Bacteria 692
996 Ga0307414_11315764 3300032004 Bacteria 671
997 Ga0307414_11529892 3300032004 Unclassified 621
998 Ga0307414_11567070 3300032004 Bacteria 614
999 Ga0307414_11817708 3300032004 Bacteria 568
1000 Ga0307414_11947737 3300032004 Bacteria 548
1001 Ga0307411_10001485 3300032005 Bacteria 9629
1002 Ga0307411_10004027 3300032005 Bacteria 6950
1003 Ga0307411_10009804 3300032005 Bacteria 5063
1004 Ga0307411_10020705 3300032005 Bacteria 3833
1005 Ga0307411_10031260 3300032005 Bacteria 3273
1006 Ga0307411_10044181 3300032005 Bacteria 2856
1007 Ga0307411_10045736 3300032005 Bacteria 2817
1008 Ga0307411_10068399 3300032005 Bacteria 2393
1009 Ga0307411_10083347 3300032005 Bacteria 2208
1010 Ga0307411_10165547 3300032005 Bacteria 1661
1011 Ga0307411_10168155 3300032005 Bacteria 1650
1012 Ga0307411_10178940 3300032005 Bacteria 1607
1013 Ga0307411_10229997 3300032005 Bacteria 1445
1014 Ga0307411_10250103 3300032005 Bacteria 1393
1015 Ga0307411_10257375 3300032005 Bacteria 1376
1016 Ga0307411_10306827 3300032005 Bacteria 1275
1017 Ga0307411_10376295 3300032005 Bacteria 1166
1018 Ga0307411_10388728 3300032005 Bacteria 1150
1019 Ga0307411_10535632 3300032005 Bacteria 996
1020 Ga0307411_10555051 3300032005 Bacteria 980
1021 Ga0307411_11335514 3300032005 Bacteria 654
1022 Ga0307411_11718753 3300032005 Bacteria 581
1023 Ga0307411_11956664 3300032005 Bacteria 546
1024 Ga0307411_11988396 3300032005 Bacteria 542
1025 Ga0307415_100003431 3300032126 Bacteria 8062
1026 Ga0307415_100020759 3300032126 Bacteria 4018
1027 Ga0307415_100050974 3300032126 Bacteria 2807
1028 Ga0307415_100060455 3300032126 Bacteria 2618
1029 Ga0307415_100064736 3300032126 Bacteria 2545
1030 Ga0307415_100097201 3300032126 Bacteria 2148
1031 Ga0307415_100136390 3300032126 Bacteria 1867
1032 Ga0307415_100205486 3300032126 Bacteria 1566
1033 Ga0307415_100331712 3300032126 Bacteria 1273
1034 Ga0307415_100334583 3300032126 Bacteria 1268
1035 Ga0307415_100548087 3300032126 Bacteria 1020
1036 Ga0307415_100556437 3300032126 Unclassified 1013
1037 Ga0307415_100865590 3300032126 Bacteria 830
1038 Ga0307415_101112241 3300032126 Bacteria 740
1039 Ga0307415_101152078 3300032126 Bacteria 728
1040 Ga0307415_101583681 3300032126 Bacteria 629
1041 Ga0307415_101708358 3300032126 Unclassified 607
1042 Ga0307415_102045788 3300032126 Bacteria 558
1043 Ga0307415_102362320 3300032126 Bacteria 522
1044 Ga0373937_0413015 3300036401 Bacteria 1281
1045 Ga0395899_0021092 3300037312 Bacteria 4941
1046 Ga0395899_0022339 3300037312 Bacteria 4797
1047 Ga0395899_0043148 3300037312 Bacteria 3364
1048 Ga0395899_0089925 3300037312 Bacteria 2226
1049 Ga0395899_0157131 3300037312 Bacteria 1608
1050 Ga0395899_0719457 3300037312 Unclassified 624
1051 Ga0395899_0810759 3300037312 Unclassified 578
1052 Ga0395900_0008835 3300037418 Bacteria 10349
1053 Ga0395900_0009860 3300037418 Bacteria 9783
1054 Ga0395900_0034005 3300037418 Bacteria 5247
1055 Ga0395900_0040557 3300037418 Bacteria 4797
1056 Ga0395900_0046828 3300037418 Bacteria 4453
1057 Ga0395900_0256643 3300037418 Bacteria 1747
1058 Ga0395900_0289527 3300037418 Bacteria 1627
1059 Ga0395900_0345441 3300037418 Bacteria 1462
1060 Ga0395900_0365891 3300037418 Bacteria 1413
1061 Ga0395900_0380027 3300037418 Bacteria 1380
1062 Ga0395900_0531631 3300037418 Bacteria 1122
1063 Ga0395900_0597351 3300037418 Bacteria 1044
1064 Ga0395900_0625123 3300037418 Bacteria 1015
1065 Ga0395900_0648435 3300037418 Bacteria 993
1066 Ga0395900_0922985 3300037418 Bacteria 795
1067 Ga0395900_0980804 3300037418 Bacteria 765
1068 Ga0395898_0014192 3300037466 Bacteria 8192
1069 Ga0395898_0025210 3300037466 Bacteria 5995
1070 Ga0395898_0028810 3300037466 Bacteria 5566
1071 Ga0395898_0030491 3300037466 Bacteria 5396
1072 Ga0395898_0169292 3300037466 Bacteria 2088
1073 Ga0395898_0381931 3300037466 Unclassified 1343
1074 Ga0395898_0437744 3300037466 Bacteria 1245
1075 Ga0395898_0459300 3300037466 Bacteria 1212
1076 Ga0395898_0556328 3300037466 Bacteria 1089
1077 Ga0395905_0001037 3300037471 Bacteria 35267
1078 Ga0395905_0003845 3300037471 Bacteria 15843
1079 Ga0395905_0017818 3300037471 Bacteria 6747
1080 Ga0395905_0025999 3300037471 Bacteria 5519
1081 Ga0395905_0026027 3300037471 Bacteria 5517
1082 Ga0395905_0062309 3300037471 Bacteria 3488
1083 Ga0395905_0088113 3300037471 Bacteria 2910
1084 Ga0395905_0096392 3300037471 Bacteria 2777
1085 Ga0395905_0248535 3300037471 Bacteria 1662
1086 Ga0395905_0422649 3300037471 Bacteria 1229
1087 Ga0395905_0643511 3300037471 Bacteria 962
1088 Ga0395905_0676029 3300037471 Bacteria 935
1089 Ga0395905_1295599 3300037471 Bacteria 632
1090 Ga0395905_1490217 3300037471 Bacteria 581
1091 Ga0395905_1547620 3300037471 Bacteria 568
1092 Ga0395901_0000520 3300038443 Bacteria 44464
1093 Ga0395901_0023864 3300038443 Bacteria 6273
1094 Ga0395901_0024257 3300038443 Bacteria 6223
1095 Ga0395901_0024368 3300038443 Bacteria 6208
1096 Ga0395901_0028442 3300038443 Bacteria 5748
1097 Ga0395901_0048513 3300038443 Bacteria 4410
1098 Ga0395901_0080917 3300038443 Bacteria 3392
1099 Ga0395901_0301042 3300038443 Bacteria 1663
1100 Ga0395901_1518830 3300038443 Bacteria 625
1101 Ga0395901_2083940 3300038443 Unclassified 512
1102 Ga0237816_00332 3300039145 Bacteria 4002
1103 Ga0436365_0102423 3300039437 Bacteria 73123
1104 Ga0436365_0487522 3300039437 Bacteria 55925
1105 Ga0436365_1470013 3300039437 Bacteria 10663
1106 Ga0436363_0211821 3300039450 Bacteria 1558
1107 Ga0436363_0460446 3300039450 Bacteria 1185
1108 Ga0436363_0489471 3300039450 Bacteria 666
1109 Ga0436363_1113461 3300039450 Bacteria 1071
1110 Ga0436362_0724337 3300039453 Bacteria 1139
1111 Ga0436362_0740394 3300039453 Bacteria 73123
1112 Ga0451798_0742858 3300041458 Bacteria 590
1113 Ga0451843_0051574 3300041509 Unclassified 1394
1114 Ga0439445_0000220 3300042004 Bacteria 10583
1115 Ga0439432_004278 3300042006 Bacteria 5223
1116 Ga0439464_0000570 3300042439 Bacteria 7719
1117 Ga0466969_0139530 3300044656 Bacteria 1120
1118 Ga0466969_0258445 3300044656 Unclassified 789
1119 Ga0466966_0000004 3300044684 Bacteria 223594
1120 Ga0466966_0011248 3300044684 Bacteria 5938
1121 Ga0466966_0050913 3300044684 Bacteria 2634
1122 Ga0466966_0082777 3300044684 Bacteria 1997
1123 Ga0466966_0936326 3300044684 Bacteria 522
1124 Ga0466961_0008797 3300044693 Bacteria 6441
1125 Ga0466961_0010535 3300044693 Bacteria 5896
1126 Ga0466963_0165328 3300044694 Bacteria 1541
1127 Ga0466963_0459899 3300044694 Bacteria 898
1128 Ga0466963_0465469 3300044694 Unclassified 892
1129 Ga0466963_0519099 3300044694 Bacteria 841
1130 Ga0466971_0080314 3300044719 Bacteria 1486
1131 Ga0466971_0183327 3300044719 Bacteria 984
1132 Ga0466971_0516390 3300044719 Bacteria 591
1133 Ga0466970_0485221 3300044765 Bacteria 711
1134 Ga0466970_0725006 3300044765 Bacteria 580
1135 Ga0466957_0014505 3300044842 Bacteria 4588
1136 Ga0466957_0032415 3300044842 Bacteria 3128
1137 Ga0466957_0728254 3300044842 Bacteria 701
1138 Ga0466957_1096770 3300044842 Bacteria 574
1139 Ga0466957_1124739 3300044842 Bacteria 567
1140 Ga0466959_0005768 3300045049 Bacteria 8523
1141 Ga0466959_0396207 3300045049 Bacteria 939
1142 Ga0466959_0470759 3300045049 Bacteria 851
1143 Ga0466958_0004867 3300045836 Bacteria 7147
1144 Ga0466958_0059048 3300045836 Bacteria 2333
1145 Ga0466967_0051355 3300045976 Bacteria 3613
1146 Ga0466967_0123309 3300045976 Bacteria 2397
1147 Ga0466967_0846978 3300045976 Bacteria 908
1148 Ga0495596_0064467 3300046500 Bacteria 1425
1149 Ga0495583_0000260 3300046506 Bacteria 86495
1150 Ga0495663_0069720 3300046525 Bacteria 1117
1151 Ga0495663_0104883 3300046525 Bacteria 934
1152 Ga0495663_0135421 3300046525 Bacteria 833
1153 Ga0495663_0199525 3300046525 Unclassified 698
1154 Ga0495663_0217040 3300046525 Bacteria 671
1155 Ga0495663_0264590 3300046525 Bacteria 613
1156 Ga0495642_0059864 3300046528 Bacteria 1579
1157 Ga0495642_0133249 3300046528 Bacteria 1070
1158 Ga0495598_0158418 3300046537 Bacteria 795
1159 Ga0495621_0001333 3300046539 Bacteria 6383
1160 Ga0495621_0005841 3300046539 Bacteria 3561
1161 Ga0495621_0044083 3300046539 Bacteria 1575
1162 Ga0495621_0434053 3300046539 Bacteria 561
1163 Ga0495633_0064547 3300046558 Bacteria 1712
1164 Ga0495633_0110329 3300046558 Bacteria 1275
1165 Ga0495633_0381378 3300046558 Bacteria 638
1166 Ga0495656_0114507 3300046615 Bacteria 1266
1167 Ga0495668_0008250 3300046616 Bacteria 6528
1168 Ga0495625_0511517 3300046660 Bacteria 733
1169 Ga0495625_0537958 3300046660 Bacteria 709
1170 Ga0495659_0001113 3300046664 Bacteria 9355
1171 Ga0495659_0009203 3300046664 Bacteria 3150
1172 Ga0495659_0040579 3300046664 Bacteria 1660
1173 Ga0495659_0196851 3300046664 Bacteria 825
1174 Ga0495669_0016445 3300046684 Bacteria 3168
1175 Ga0495669_0021850 3300046684 Bacteria 2780
1176 Ga0495669_0035543 3300046684 Bacteria 2200
1177 Ga0495669_0240717 3300046684 Bacteria 868
1178 Ga0495669_0398454 3300046684 Bacteria 667
1179 Ga0495670_0014133 3300046691 Bacteria 3928
1180 Ga0495670_0014290 3300046691 Bacteria 3905
1181 Ga0495670_0023539 3300046691 Bacteria 3039
1182 Ga0495670_0024033 3300046691 Bacteria 3009
1183 Ga0495670_0134689 3300046691 Bacteria 1289
1184 Ga0495671_0000046 3300046692 Bacteria 157975
1185 Ga0495636_0254482 3300047318 Bacteria 813
1186 Ga0495636_0284738 3300047318 Bacteria 770
1187 Ga0495677_0006386 3300047445 Bacteria 4455
1188 Ga0495673_0000066 3300047469 Bacteria 221478
1189 Ga0495615_0012934 3300048090 Bacteria 1733
1190 Ga0495615_0267747 3300048090 Bacteria 546
1191 Ga0496100_1358069 3300048903 Bacteria 561
1192 Ga0496101_1177680 3300048904 Bacteria 601
1193 Ga0496107_0141643 3300048910 Bacteria 1777
1194 Ga0496107_1213511 3300048910 Unclassified 542
1195 Ga0496108_0464043 3300048911 Bacteria 1106
1196 Ga0496108_0547858 3300048911 Bacteria 1009
1197 Ga0496108_0984104 3300048911 Bacteria 721
1198 Ga0496109_0031681 3300048912 Bacteria 4748
1199 Ga0496109_0240402 3300048912 Bacteria 1704
1200 Ga0496109_1550992 3300048912 Bacteria 597
1201 Ga0496110_0367538 3300048913 Bacteria 1311
1202 Ga0496111_0278459 3300048914 Bacteria 1241
1203 Ga0496112_0015271 3300048915 Bacteria 7160
1204 Ga0496113_0419168 3300048916 Bacteria 1075
1205 Ga0496113_0476347 3300048916 Bacteria 1003
1206 Ga0496114_0123441 3300048917 Bacteria 2229
1207 Ga0496126_0426523 3300048929 Bacteria 1071
1208 Ga0501306_014825 3300049127 Bacteria 1032
1209 Ga0501310_055367 3300049130 Bacteria 582
1210 Ga0501323_038398 3300049539 Bacteria 695
1211 Ga0501324_016006 3300049540 Bacteria 732
1212 Ga0501333_004596 3300049549 Bacteria 873
1213 Ga0501335_031762 3300049551 Bacteria 599
1214 Ga0501340_011525 3300049556 Bacteria 660
1215 Ga0501034_1582708 3300049571 Bacteria 528
1216 Ga0501067_0047522 3300049583 Bacteria 2380
1217 Ga0501067_0187802 3300049583 Bacteria 1151
1218 Ga0501068_0377522 3300049584 Bacteria 912
1219 Ga0501069_0016937 3300049585 Bacteria 3917
1220 Ga0501069_0421233 3300049585 Bacteria 791
1221 Ga0501070_0952938 3300049586 Bacteria 667
1222 Ga0501207_017717 3300049654 Bacteria 1114
1223 Ga0501207_099191 3300049654 Bacteria 583
1224 Ga0501216_035922 3300049660 Bacteria 933
1225 Ga0501216_060925 3300049660 Bacteria 761
1226 Ga0501230_075804 3300049667 Bacteria 698
1227 Ga0501233_035446 3300049668 Bacteria 1150
1228 Ga0501235_095239 3300049669 Bacteria 722
1229 Ga0501235_151970 3300049669 Bacteria 600
1230 Ga0501242_012321 3300049674 Bacteria 1041
1231 Ga0501247_015366 3300049677 Bacteria 956
1232 Ga0501248_023859 3300049678 Bacteria 654
1233 Ga0501249_007508 3300049679 Bacteria 2254
1234 Ga0501249_076664 3300049679 Bacteria 784
1235 Ga0501250_012113 3300049680 Bacteria 1015
1236 Ga0501261_106700 3300049690 Bacteria 539
1237 Ga0501225_0023288 3300049705 Bacteria 1707
1238 Ga0501229_041510 3300049706 Bacteria 657
1239 Ga0501229_075219 3300049706 Bacteria 534
1240 Ga0501263_085517 3300049760 Bacteria 526
1241 Ga0501267_030111 3300049764 Bacteria 636
1242 Ga0501267_038029 3300049764 Bacteria 590
1243 Ga0501268_010905 3300049765 Bacteria 1424
1244 Ga0501268_041923 3300049765 Bacteria 864
1245 Ga0501268_045597 3300049765 Bacteria 836
1246 Ga0501268_078453 3300049765 Bacteria 679
1247 Ga0501268_091654 3300049765 Bacteria 641
1248 Ga0501270_027448 3300049767 Bacteria 916
1249 Ga0501272_020498 3300049769 Bacteria 792
1250 Ga0501273_024970 3300049770 Bacteria 827
1251 Ga0501273_060411 3300049770 Bacteria 596
1252 Ga0501044_0605709 3300049823 Bacteria 988
1253 Ga0501204_076684 3300049850 Bacteria 561
1254 nmdc:mga0yw44_1107938_c1 3300050492 Bacteria 535
1255 nmdc:mga09592_573334_c1 3300050508 Bacteria 968
1256 nmdc:mga06r32_254059_c1 3300050510 Bacteria 1745
1257 nmdc:mga06r32_37806_c1 3300050510 Bacteria 4567
1258 nmdc:mga08y16_1117587_c1 3300050511 Bacteria 762
1259 nmdc:mga08y16_151376_c1 3300050511 Bacteria 2411
1260 nmdc:mga08y16_233218_c1 3300050511 Bacteria 1903
1261 nmdc:mga0n895_152137_c1 3300050512 Bacteria 2344
1262 nmdc:mga0n895_701010_c1 3300050512 Bacteria 1008
1263 nmdc:mga0n895_7880_c1 3300050512 Bacteria 9183
1264 nmdc:mga0rr50_1014555_c1 3300050513 Bacteria 707
1265 nmdc:mga0a205_12844_c1 3300050515 Bacteria 7769
1266 nmdc:mga0a205_1315918_c1 3300050515 Bacteria 570
1267 Ga0500643_001097 3300053087 Bacteria 16258
1268 Ga0500643_034844 3300053087 Bacteria 1513
1269 Ga0500556_0060549 3300053104 Bacteria 1393
1270 Ga0500658_0000108 3300053134 Bacteria 38564
1271 Ga0500568_0002197 3300053139 Bacteria 11739
1272 Ga0500568_0264501 3300053139 Bacteria 626
1273 Ga0500573_0151044 3300053140 Bacteria 1272
1274 Ga0500616_0000742 3300053153 Bacteria 37589
1275 Ga0500645_001470 3300053730 Bacteria 11841
1276 Ga0500645_173222 3300053730 Bacteria 589
1277 Ga0466962_0003508 3300061719 Bacteria 7476
1278 Ga0466962_0206908 3300061719 Bacteria 959
1279 Ga0530510_1451453 3300061734 Bacteria 527

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005344 Ga0070661_100000055 Ga0070661_10000005558 94
2 3300025920 Ga0207649_10000018 Ga0207649_100000184 94
3 3300044842 Ga0466957_1096770 Ga0466957_1096770_262_561 95
4 3300046558 Ga0495633_0381378 Ga0495633_0381378_259_603 95
5 3300001979 JGI24740J21852_10000529 JGI24740J21852_1000052916 97
6 3300005327 Ga0070658_10051723 Ga0070658_100517235 97
7 3300005329 Ga0070683_100010252 Ga0070683_10001025211 97
8 3300005336 Ga0070680_100029933 Ga0070680_1000299338 97
9 3300005339 Ga0070660_100092237 Ga0070660_1000922372 97
10 3300005344 Ga0070661_100033588 Ga0070661_1000335885 97
11 3300005345 Ga0070692_10039400 Ga0070692_100394004 97
12 3300005455 Ga0070663_100010825 Ga0070663_1000108258 97
13 3300005458 Ga0070681_10043010 Ga0070681_100430106 97
14 3300005530 Ga0070679_100002411 Ga0070679_1000024118 97
15 3300005535 Ga0070684_100214642 Ga0070684_1002146424 97
16 3300005563 Ga0068855_100008542 Ga0068855_1000085427 97
17 3300005578 Ga0068854_100031913 Ga0068854_1000319133 97
18 3300005614 Ga0068856_100044647 Ga0068856_1000446476 97
19 3300005616 Ga0068852_100437954 Ga0068852_1004379542 97
20 3300013100 Ga0157373_10140155 Ga0157373_101401554 97
21 3300013104 Ga0157370_10015560 Ga0157370_100155606 97
22 3300013105 Ga0157369_10082219 Ga0157369_100822196 97
23 3300013307 Ga0157372_10806039 Ga0157372_108060393 97
24 3300020078 Ga0206352_10163851 Ga0206352_101638513 97
25 3300025904 Ga0207647_10088225 Ga0207647_100882255 97
26 3300025909 Ga0207705_10000529 Ga0207705_100005298 97
27 3300025912 Ga0207707_10032886 Ga0207707_100328866 97
28 3300025917 Ga0207660_10008800 Ga0207660_100088006 97
29 3300025919 Ga0207657_10095044 Ga0207657_100950445 97
30 3300025921 Ga0207652_10000453 Ga0207652_1000045317 97
31 3300025944 Ga0207661_10007816 Ga0207661_1000781610 97
32 3300025949 Ga0207667_10035328 Ga0207667_100353285 97
33 3300025981 Ga0207640_10087036 Ga0207640_100870362 97
34 3300026067 Ga0207678_10001365 Ga0207678_1000136523 97
35 3300026078 Ga0207702_10046707 Ga0207702_100467075 97
36 3300037312 Ga0395899_0022339 Ga0395899_0022339_3189_3482 97
37 3300037418 Ga0395900_0040557 Ga0395900_0040557_3189_3482 97
38 3300037466 Ga0395898_0030491 Ga0395898_0030491_3037_3330 97
39 3300037471 Ga0395905_0025999 Ga0395905_0025999_2348_2641 97
40 3300038443 Ga0395901_0024368 Ga0395901_0024368_2879_3172 97
41 3300049660 Ga0501216_060925 Ga0501216_060925_16_309 97
42 3300005983 Ga0081540_1070866 Ga0081540_10708663 98
43 3300009551 Ga0105238_10066429 Ga0105238_100664293 98
44 3300013105 Ga0157369_10306056 Ga0157369_103060564 98
45 3300001915 JGI24741J21665_1003236 JGI24741J21665_100323610 99
46 3300001979 JGI24740J21852_10008822 JGI24740J21852_100088226 99
47 3300001990 JGI24737J22298_10035882 JGI24737J22298_100358825 99
48 3300002067 JGI24735J21928_10000581 JGI24735J21928_1000058118 99
49 3300005327 Ga0070658_11096514 Ga0070658_110965141 99
50 3300005329 Ga0070683_100262665 Ga0070683_1002626653 99
51 3300005336 Ga0070680_100270585 Ga0070680_1002705852 99
52 3300005337 Ga0070682_100068961 Ga0070682_1000689616 99
53 3300005344 Ga0070661_100949488 Ga0070661_1009494882 99
54 3300005366 Ga0070659_100810788 Ga0070659_1008107882 99
55 3300005455 Ga0070663_100070717 Ga0070663_1000707174 99
56 3300005457 Ga0070662_100044861 Ga0070662_1000448615 99
57 3300005458 Ga0070681_10378840 Ga0070681_103788402 99
58 3300005530 Ga0070679_101692443 Ga0070679_1016924432 99
59 3300005539 Ga0068853_100070421 Ga0068853_1000704215 99
60 3300005547 Ga0070693_100814804 Ga0070693_1008148041 99
61 3300005563 Ga0068855_100655939 Ga0068855_1006559393 99
62 3300005564 Ga0070664_100121711 Ga0070664_1001217112 99
63 3300005577 Ga0068857_100100522 Ga0068857_1001005222 99
64 3300005578 Ga0068854_100050057 Ga0068854_1000500575 99
65 3300005614 Ga0068856_100963591 Ga0068856_1009635912 99
66 3300005616 Ga0068852_100363828 Ga0068852_1003638281 99
67 3300005834 Ga0068851_10046592 Ga0068851_100465924 99
68 3300009174 Ga0105241_10202587 Ga0105241_102025873 99
69 3300009551 Ga0105238_10180190 Ga0105238_101801902 99
70 3300010375 Ga0105239_11451541 Ga0105239_114515413 99
71 3300013100 Ga0157373_10062897 Ga0157373_100628975 99
72 3300013102 Ga0157371_10063630 Ga0157371_100636302 99
73 3300013104 Ga0157370_10201348 Ga0157370_102013483 99
74 3300013105 Ga0157369_11833202 Ga0157369_118332022 99
75 3300025904 Ga0207647_10000857 Ga0207647_100008575 99
76 3300025909 Ga0207705_10268504 Ga0207705_102685042 99
77 3300025911 Ga0207654_10880635 Ga0207654_108806352 99
78 3300025912 Ga0207707_10460698 Ga0207707_104606982 99
79 3300025917 Ga0207660_10738400 Ga0207660_107384002 99
80 3300025918 Ga0207662_10166571 Ga0207662_101665712 99
81 3300025919 Ga0207657_10008325 Ga0207657_100083254 99
82 3300025921 Ga0207652_11004368 Ga0207652_110043682 99
83 3300025924 Ga0207694_11282684 Ga0207694_112826842 99
84 3300025933 Ga0207706_10007738 Ga0207706_100077386 99
85 3300025944 Ga0207661_11221549 Ga0207661_112215492 99
86 3300025945 Ga0207679_11143965 Ga0207679_111439652 99
87 3300026041 Ga0207639_10386270 Ga0207639_103862703 99
88 3300026067 Ga0207678_10005637 Ga0207678_1000563714 99
89 3300026078 Ga0207702_10073760 Ga0207702_100737603 99
90 3300026116 Ga0207674_10078939 Ga0207674_100789394 99
91 3300032004 Ga0307414_10820489 Ga0307414_108204892 99
92 3300036401 Ga0373937_0413015 Ga0373937_0413015_210_518 99
93 3300037312 Ga0395899_0043148 Ga0395899_0043148_335_634 99
94 3300037418 Ga0395900_0531631 Ga0395900_0531631_463_762 99
95 3300037466 Ga0395898_0437744 Ga0395898_0437744_591_890 99
96 3300037471 Ga0395905_0062309 Ga0395905_0062309_2829_3128 99
97 3300038443 Ga0395901_0024257 Ga0395901_0024257_570_869 99
98 3300013105 Ga0157369_10000185 Ga0157369_1000018521 101
99 3300025938 Ga0207704_10583715 Ga0207704_105837153 101
100 3300031824 Ga0307413_10319304 Ga0307413_103193042 101
101 3300032005 Ga0307411_10257375 Ga0307411_102573753 101
102 3300032126 Ga0307415_101152078 Ga0307415_1011520782 101
103 3300037312 Ga0395899_0157131 Ga0395899_0157131_912_1241 101
104 3300037418 Ga0395900_0597351 Ga0395900_0597351_345_674 101
105 3300037418 Ga0395900_0625123 Ga0395900_0625123_569_889 101
106 3300037466 Ga0395898_0459300 Ga0395898_0459300_516_845 101
107 3300038443 Ga0395901_0080917 Ga0395901_0080917_1042_1371 101
108 3300044684 Ga0466966_0050913 Ga0466966_0050913_153_482 101
109 3300044694 Ga0466963_0459899 Ga0466963_0459899_540_869 101
110 3300044694 Ga0466963_0519099 Ga0466963_0519099_92_421 101
111 3300044719 Ga0466971_0516390 Ga0466971_0516390_190_519 101
112 3300044765 Ga0466970_0485221 Ga0466970_0485221_297_626 101
113 3300045836 Ga0466958_0059048 Ga0466958_0059048_1553_1882 101
114 3300045976 Ga0466967_0123309 Ga0466967_0123309_225_554 101
115 3300061719 Ga0466962_0206908 Ga0466962_0206908_58_387 101
116 3300001990 JGI24737J22298_10004580 JGI24737J22298_100045807 102
117 3300002244 JGI24742J22300_10110376 JGI24742J22300_101103761 102
118 3300005290 Ga0065712_10592176 Ga0065712_105921761 102
119 3300005293 Ga0065715_10055508 Ga0065715_100555081 102
120 3300005293 Ga0065715_10963069 Ga0065715_109630691 102
121 3300005327 Ga0070658_10546222 Ga0070658_105462221 102
122 3300005334 Ga0068869_100020176 Ga0068869_1000201766 102
123 3300005334 Ga0068869_100331144 Ga0068869_1003311441 102
124 3300005335 Ga0070666_10665397 Ga0070666_106653972 102
125 3300005336 Ga0070680_101058576 Ga0070680_1010585761 102
126 3300005338 Ga0068868_100230504 Ga0068868_1002305044 102
127 3300005338 Ga0068868_100429152 Ga0068868_1004291522 102
128 3300005339 Ga0070660_100003410 Ga0070660_1000034107 102
129 3300005340 Ga0070689_100905216 Ga0070689_1009052162 102
130 3300005345 Ga0070692_10004390 Ga0070692_100043907 102
131 3300005347 Ga0070668_100092812 Ga0070668_1000928124 102
132 3300005347 Ga0070668_100138617 Ga0070668_1001386174 102
133 3300005354 Ga0070675_100415622 Ga0070675_1004156221 102
134 3300005355 Ga0070671_100024583 Ga0070671_1000245834 102
135 3300005364 Ga0070673_100475728 Ga0070673_1004757281 102
136 3300005366 Ga0070659_100016493 Ga0070659_1000164939 102
137 3300005367 Ga0070667_100057546 Ga0070667_1000575466 102
138 3300005367 Ga0070667_100951325 Ga0070667_1009513251 102
139 3300005367 Ga0070667_101688708 Ga0070667_1016887082 102
140 3300005406 Ga0070703_10305748 Ga0070703_103057482 102
141 3300005438 Ga0070701_10954861 Ga0070701_109548612 102
142 3300005444 Ga0070694_100025449 Ga0070694_1000254496 102
143 3300005455 Ga0070663_100615615 Ga0070663_1006156152 102
144 3300005455 Ga0070663_100788627 Ga0070663_1007886272 102
145 3300005456 Ga0070678_100306094 Ga0070678_1003060943 102
146 3300005457 Ga0070662_100008094 Ga0070662_1000080949 102
147 3300005459 Ga0068867_101444260 Ga0068867_1014442602 102
148 3300005530 Ga0070679_101725901 Ga0070679_1017259011 102
149 3300005539 Ga0068853_100180027 Ga0068853_1001800272 102
150 3300005543 Ga0070672_100013009 Ga0070672_1000130091 102
151 3300005543 Ga0070672_100243390 Ga0070672_1002433904 102
152 3300005545 Ga0070695_100033770 Ga0070695_1000337703 102
153 3300005548 Ga0070665_101888746 Ga0070665_1018887462 102
154 3300005549 Ga0070704_100138499 Ga0070704_1001384993 102
155 3300005563 Ga0068855_100142590 Ga0068855_1001425904 102
156 3300005564 Ga0070664_100547756 Ga0070664_1005477562 102
157 3300005577 Ga0068857_100077113 Ga0068857_1000771134 102
158 3300005578 Ga0068854_101588202 Ga0068854_1015882022 102
159 3300005616 Ga0068852_100014470 Ga0068852_1000144703 102
160 3300005617 Ga0068859_100005747 Ga0068859_1000057474 102
161 3300005617 Ga0068859_100038456 Ga0068859_1000384565 102
162 3300005617 Ga0068859_100448401 Ga0068859_1004484011 102
163 3300005618 Ga0068864_100000773 Ga0068864_10000077317 102
164 3300005618 Ga0068864_102256794 Ga0068864_1022567941 102
165 3300005718 Ga0068866_10108116 Ga0068866_101081162 102
166 3300005719 Ga0068861_100112068 Ga0068861_1001120685 102
167 3300005719 Ga0068861_100263349 Ga0068861_1002633492 102
168 3300005841 Ga0068863_100064460 Ga0068863_1000644604 102
169 3300005841 Ga0068863_100119307 Ga0068863_1001193073 102
170 3300005842 Ga0068858_100001877 Ga0068858_10000187719 102
171 3300005842 Ga0068858_100017656 Ga0068858_1000176569 102
172 3300005843 Ga0068860_100007821 Ga0068860_1000078217 102
173 3300005843 Ga0068860_100071912 Ga0068860_1000719126 102
174 3300005843 Ga0068860_100152954 Ga0068860_1001529545 102
175 3300005843 Ga0068860_101392246 Ga0068860_1013922462 102
176 3300005844 Ga0068862_100027812 Ga0068862_1000278128 102
177 3300005844 Ga0068862_100256720 Ga0068862_1002567204 102
178 3300005844 Ga0068862_100321011 Ga0068862_1003210114 102
179 3300006844 Ga0075428_100862602 Ga0075428_1008626023 102
180 3300006847 Ga0075431_100892313 Ga0075431_1008923132 102
181 3300006852 Ga0075433_10161937 Ga0075433_101619376 102
182 3300006871 Ga0075434_101051778 Ga0075434_1010517782 102
183 3300006881 Ga0068865_100063956 Ga0068865_1000639563 102
184 3300006931 Ga0097620_100005747 Ga0097620_10000574716 102
185 3300006931 Ga0097620_100038455 Ga0097620_1000384555 102
186 3300006931 Ga0097620_100448405 Ga0097620_1004484054 102
187 3300007076 Ga0075435_100391840 Ga0075435_1003918404 102
188 3300009011 Ga0105251_10407933 Ga0105251_104079331 102
189 3300009092 Ga0105250_10018633 Ga0105250_100186336 102
190 3300009098 Ga0105245_10019978 Ga0105245_100199789 102
191 3300009101 Ga0105247_10767699 Ga0105247_107676992 102
192 3300009148 Ga0105243_10556987 Ga0105243_105569871 102
193 3300009176 Ga0105242_10064741 Ga0105242_100647414 102
194 3300009177 Ga0105248_10004681 Ga0105248_1000468118 102
195 3300009177 Ga0105248_10022307 Ga0105248_100223078 102
196 3300009553 Ga0105249_10008290 Ga0105249_100082908 102
197 3300009553 Ga0105249_10037802 Ga0105249_100378027 102
198 3300010375 Ga0105239_10082368 Ga0105239_100823684 102
199 3300011119 Ga0105246_10057807 Ga0105246_100578076 102
200 3300013100 Ga0157373_10331829 Ga0157373_103318292 102
201 3300013102 Ga0157371_11178846 Ga0157371_111788461 102
202 3300013297 Ga0157378_11630073 Ga0157378_116300732 102
203 3300013306 Ga0163162_10062646 Ga0163162_100626465 102
204 3300013306 Ga0163162_10332022 Ga0163162_103320222 102
205 3300013306 Ga0163162_11357462 Ga0163162_113574621 102
206 3300013306 Ga0163162_11369611 Ga0163162_113696112 102
207 3300013308 Ga0157375_10409996 Ga0157375_104099963 102
208 3300013308 Ga0157375_11495082 Ga0157375_114950822 102
209 3300014325 Ga0163163_10000486 Ga0163163_1000048619 102
210 3300014745 Ga0157377_10475585 Ga0157377_104755852 102
211 3300014968 Ga0157379_10013649 Ga0157379_100136499 102
212 3300014968 Ga0157379_10255540 Ga0157379_102555404 102
213 3300025899 Ga0207642_10018322 Ga0207642_100183225 102
214 3300025901 Ga0207688_10086365 Ga0207688_100863652 102
215 3300025904 Ga0207647_10000984 Ga0207647_1000098418 102
216 3300025909 Ga0207705_11009526 Ga0207705_110095261 102
217 3300025913 Ga0207695_10767798 Ga0207695_107677982 102
218 3300025919 Ga0207657_10068899 Ga0207657_100688997 102
219 3300025923 Ga0207681_10022394 Ga0207681_100223944 102
220 3300025923 Ga0207681_11148058 Ga0207681_111480581 102
221 3300025925 Ga0207650_11181759 Ga0207650_111817592 102
222 3300025926 Ga0207659_11563354 Ga0207659_115633541 102
223 3300025927 Ga0207687_10102362 Ga0207687_101023622 102
224 3300025931 Ga0207644_10066932 Ga0207644_100669325 102
225 3300025932 Ga0207690_10007110 Ga0207690_100071109 102
226 3300025933 Ga0207706_10043613 Ga0207706_100436137 102
227 3300025934 Ga0207686_10078886 Ga0207686_100788864 102
228 3300025935 Ga0207709_10461538 Ga0207709_104615382 102
229 3300025940 Ga0207691_10132099 Ga0207691_101320994 102
230 3300025940 Ga0207691_10178038 Ga0207691_101780385 102
231 3300025941 Ga0207711_10001615 Ga0207711_100016157 102
232 3300025941 Ga0207711_10032103 Ga0207711_100321037 102
233 3300025942 Ga0207689_10022793 Ga0207689_100227936 102
234 3300025945 Ga0207679_10748953 Ga0207679_107489533 102
235 3300025949 Ga0207667_10020794 Ga0207667_100207948 102
236 3300025961 Ga0207712_10000566 Ga0207712_1000056628 102
237 3300025961 Ga0207712_10039116 Ga0207712_100391166 102
238 3300025972 Ga0207668_10084519 Ga0207668_100845194 102
239 3300025972 Ga0207668_10141087 Ga0207668_101410871 102
240 3300025986 Ga0207658_10302422 Ga0207658_103024222 102
241 3300025986 Ga0207658_11556726 Ga0207658_115567262 102
242 3300026023 Ga0207677_10042259 Ga0207677_100422595 102
243 3300026023 Ga0207677_10185665 Ga0207677_101856654 102
244 3300026035 Ga0207703_10001835 Ga0207703_1000183518 102
245 3300026035 Ga0207703_10007646 Ga0207703_1000764612 102
246 3300026041 Ga0207639_10071478 Ga0207639_100714784 102
247 3300026067 Ga0207678_10818395 Ga0207678_108183953 102
248 3300026088 Ga0207641_10000659 Ga0207641_1000065915 102
249 3300026088 Ga0207641_10041868 Ga0207641_100418687 102
250 3300026089 Ga0207648_11339710 Ga0207648_113397102 102
251 3300026142 Ga0207698_10067403 Ga0207698_100674035 102
252 3300028380 Ga0268265_10004271 Ga0268265_1000427113 102
253 3300028380 Ga0268265_10085494 Ga0268265_100854944 102
254 3300028380 Ga0268265_10132419 Ga0268265_101324192 102
255 3300028381 Ga0268264_10001316 Ga0268264_1000131623 102
256 3300028381 Ga0268264_10010683 Ga0268264_100106839 102
257 3300028381 Ga0268264_10046189 Ga0268264_100461897 102
258 3300031456 Ga0307513_10323641 Ga0307513_103236413 102
259 3300031824 Ga0307413_10204500 Ga0307413_102045004 102
260 3300031901 Ga0307406_10695799 Ga0307406_106957992 102
261 3300031995 Ga0307409_101005542 Ga0307409_1010055423 102
262 3300032004 Ga0307414_10614408 Ga0307414_106144082 102
263 3300044684 Ga0466966_0082777 Ga0466966_0082777_1074_1397 102
264 3300045049 Ga0466959_0396207 Ga0466959_0396207_514_837 102
265 3300045976 Ga0466967_0051355 Ga0466967_0051355_3067_3390 102
266 3300045976 Ga0466967_0846978 Ga0466967_0846978_60_383 102
267 3300046660 Ga0495625_0537958 Ga0495625_0537958_203_526 102
268 3300046684 Ga0495669_0021850 Ga0495669_0021850_1702_2025 102
269 3300048910 Ga0496107_1213511 Ga0496107_1213511_88_402 102
270 3300050510 nmdc:mga06r32_254059_c1 nmdc:mga06r32_254059_c1_11_325 102
271 3300050512 nmdc:mga0n895_152137_c1 nmdc:mga0n895_152137_c1_475_789 102
272 3300050513 nmdc:mga0rr50_1014555_c1 nmdc:mga0rr50_1014555_c1_366_680 102
273 3300050515 nmdc:mga0a205_12844_c1 nmdc:mga0a205_12844_c1_5572_5886 102
274 3300053140 Ga0500573_0151044 Ga0500573_0151044_946_1257 102
275 3300001904 JGI24736J21556_1000631 JGI24736J21556_10006316 103
276 3300001915 JGI24741J21665_1000687 JGI24741J21665_10006877 103
277 3300001979 JGI24740J21852_10002598 JGI24740J21852_100025986 103
278 3300001989 JGI24739J22299_10002487 JGI24739J22299_100024876 103
279 3300001990 JGI24737J22298_10003336 JGI24737J22298_100033367 103
280 3300002067 JGI24735J21928_10002676 JGI24735J21928_1000267611 103
281 3300002075 JGI24738J21930_10025900 JGI24738J21930_100259002 103
282 3300003771 Ga0055526_1025219 Ga0055526_10252193 103
283 3300003773 Ga0055537_1005127 Ga0055537_10051275 103
284 3300003790 Ga0055528_1058109 Ga0055528_10581091 103
285 3300004799 Ga0058863_11416882 Ga0058863_114168822 103
286 3300005262 Ga0065165_1004978 Ga0065165_10049787 103
287 3300005336 Ga0070680_100141427 Ga0070680_1001414271 103
288 3300005337 Ga0070682_100589648 Ga0070682_1005896482 103
289 3300005339 Ga0070660_100000715 Ga0070660_10000071516 103
290 3300005339 Ga0070660_100005309 Ga0070660_10000530913 103
291 3300005339 Ga0070660_100050689 Ga0070660_1000506894 103
292 3300005339 Ga0070660_100260534 Ga0070660_1002605344 103
293 3300005340 Ga0070689_101210961 Ga0070689_1012109611 103
294 3300005345 Ga0070692_10015367 Ga0070692_100153675 103
295 3300005345 Ga0070692_10470298 Ga0070692_104702981 103
296 3300005366 Ga0070659_100006080 Ga0070659_1000060807 103
297 3300005366 Ga0070659_100036714 Ga0070659_1000367142 103
298 3300005455 Ga0070663_100007313 Ga0070663_1000073134 103
299 3300005457 Ga0070662_100074908 Ga0070662_1000749083 103
300 3300005458 Ga0070681_10122957 Ga0070681_101229571 103
301 3300005530 Ga0070679_100000017 Ga0070679_1000000174 103
302 3300005539 Ga0068853_100588097 Ga0068853_1005880971 103
303 3300005563 Ga0068855_100320491 Ga0068855_1003204914 103
304 3300005564 Ga0070664_100750751 Ga0070664_1007507512 103
305 3300005578 Ga0068854_100376705 Ga0068854_1003767053 103
306 3300005834 Ga0068851_10030870 Ga0068851_100308703 103
307 3300005834 Ga0068851_10514766 Ga0068851_105147661 103
308 3300009093 Ga0105240_10163002 Ga0105240_101630024 103
309 3300009174 Ga0105241_10013855 Ga0105241_100138558 103
310 3300009176 Ga0105242_10417135 Ga0105242_104171352 103
311 3300009545 Ga0105237_10097653 Ga0105237_100976532 103
312 3300009551 Ga0105238_10978347 Ga0105238_109783471 103
313 3300010375 Ga0105239_10217052 Ga0105239_102170524 103
314 3300013100 Ga0157373_10021241 Ga0157373_100212412 103
315 3300013105 Ga0157369_10010900 Ga0157369_100109007 103
316 3300013307 Ga0157372_10434038 Ga0157372_104340384 103
317 3300013307 Ga0157372_10454393 Ga0157372_104543931 103
318 3300013307 Ga0157372_10894090 Ga0157372_108940903 103
319 3300013307 Ga0157372_11039210 Ga0157372_110392102 103
320 3300020078 Ga0206352_11103589 Ga0206352_111035891 103
321 3300020082 Ga0206353_11000466 Ga0206353_110004669 103
322 3300020610 Ga0154015_1397734 Ga0154015_13977341 103
323 3300021358 Ga0213873_10000027 Ga0213873_1000002731 103
324 3300021384 Ga0213876_10000004 Ga0213876_10000004346 103
325 3300021384 Ga0213876_10000395 Ga0213876_1000039530 103
326 3300025263 Ga0209565_1000151 Ga0209565_10001514 103
327 3300025273 Ga0209673_1006474 Ga0209673_100647411 103
328 3300025298 Ga0209050_1018121 Ga0209050_10181215 103
329 3300025302 Ga0207426_1125309 Ga0207426_11253092 103
330 3300025321 Ga0207656_10008631 Ga0207656_100086312 103
331 3300025904 Ga0207647_10001181 Ga0207647_1000118117 103
332 3300025908 Ga0207643_10417528 Ga0207643_104175283 103
333 3300025909 Ga0207705_10000002 Ga0207705_10000002881 103
334 3300025911 Ga0207654_10036987 Ga0207654_100369876 103
335 3300025912 Ga0207707_10012541 Ga0207707_1001254113 103
336 3300025913 Ga0207695_10012790 Ga0207695_1001279010 103
337 3300025914 Ga0207671_10580553 Ga0207671_105805531 103
338 3300025917 Ga0207660_10038465 Ga0207660_100384652 103
339 3300025919 Ga0207657_10000519 Ga0207657_1000051937 103
340 3300025919 Ga0207657_10035996 Ga0207657_100359967 103
341 3300025919 Ga0207657_10095180 Ga0207657_100951805 103
342 3300025921 Ga0207652_10000001 Ga0207652_10000001855 103
343 3300025932 Ga0207690_10076941 Ga0207690_100769414 103
344 3300025933 Ga0207706_10028348 Ga0207706_100283487 103
345 3300025935 Ga0207709_10180447 Ga0207709_101804474 103
346 3300025945 Ga0207679_10269613 Ga0207679_102696131 103
347 3300025981 Ga0207640_10153582 Ga0207640_101535822 103
348 3300026067 Ga0207678_10000068 Ga0207678_1000006823 103
349 3300026078 Ga0207702_10842812 Ga0207702_108428122 103
350 3300026116 Ga0207674_10021655 Ga0207674_100216559 103
351 3300026142 Ga0207698_10022420 Ga0207698_100224207 103
352 3300031548 Ga0307408_100145139 Ga0307408_1001451395 103
353 3300031548 Ga0307408_100146609 Ga0307408_1001466094 103
354 3300031731 Ga0307405_10015003 Ga0307405_100150035 103
355 3300031731 Ga0307405_10096466 Ga0307405_100964662 103
356 3300031731 Ga0307405_10355655 Ga0307405_103556552 103
357 3300031731 Ga0307405_10403252 Ga0307405_104032523 103
358 3300031731 Ga0307405_10873887 Ga0307405_108738872 103
359 3300031731 Ga0307405_11395063 Ga0307405_113950631 103
360 3300031824 Ga0307413_10160203 Ga0307413_101602034 103
361 3300031824 Ga0307413_11388954 Ga0307413_113889542 103
362 3300031824 Ga0307413_11588726 Ga0307413_115887261 103
363 3300031901 Ga0307406_10642097 Ga0307406_106420972 103
364 3300031903 Ga0307407_10133799 Ga0307407_101337991 103
365 3300031911 Ga0307412_10012304 Ga0307412_100123043 103
366 3300031911 Ga0307412_10037020 Ga0307412_100370203 103
367 3300031911 Ga0307412_12121817 Ga0307412_121218172 103
368 3300031995 Ga0307409_100062807 Ga0307409_1000628076 103
369 3300032002 Ga0307416_100517889 Ga0307416_1005178891 103
370 3300032004 Ga0307414_11148768 Ga0307414_111487682 103
371 3300032004 Ga0307414_11567070 Ga0307414_115670702 103
372 3300032004 Ga0307414_11817708 Ga0307414_118177081 103
373 3300032005 Ga0307411_10168155 Ga0307411_101681553 103
374 3300032005 Ga0307411_10376295 Ga0307411_103762952 103
375 3300032005 Ga0307411_10388728 Ga0307411_103887283 103
376 3300032126 Ga0307415_101583681 Ga0307415_1015836812 103
377 3300039145 Ga0237816_00332 Ga0237816_00332_2589_2924 103
378 3300039437 Ga0436365_0102423 Ga0436365_0102423_24555_24866 103
379 3300039437 Ga0436365_0487522 Ga0436365_0487522_10796_11122 103
380 3300039450 Ga0436363_0460446 Ga0436363_0460446_69_383 103
381 3300039450 Ga0436363_0489471 Ga0436363_0489471_208_534 103
382 3300039450 Ga0436363_1113461 Ga0436363_1113461_155_481 103
383 3300039453 Ga0436362_0724337 Ga0436362_0724337_609_923 103
384 3300039453 Ga0436362_0740394 Ga0436362_0740394_24555_24866 103
385 3300044765 Ga0466970_0725006 Ga0466970_0725006_224_547 103
386 3300044842 Ga0466957_1124739 Ga0466957_1124739_42_356 103
387 3300046506 Ga0495583_0000260 Ga0495583_0000260_16262_16591 103
388 3300046528 Ga0495642_0133249 Ga0495642_0133249_347_670 103
389 3300046558 Ga0495633_0064547 Ga0495633_0064547_113_442 103
390 3300046692 Ga0495671_0000046 Ga0495671_0000046_151245_151574 103
391 3300047469 Ga0495673_0000066 Ga0495673_0000066_69905_70234 103
392 3300048090 Ga0495615_0267747 Ga0495615_0267747_170_496 103
393 3300048903 Ga0496100_1358069 Ga0496100_1358069_55_369 103
394 3300048929 Ga0496126_0426523 Ga0496126_0426523_439_762 103
395 3300049571 Ga0501034_1582708 Ga0501034_1582708_31_357 103
396 3300049585 Ga0501069_0421233 Ga0501069_0421233_281_607 103
397 3300049823 Ga0501044_0605709 Ga0501044_0605709_231_557 103
398 3300050512 nmdc:mga0n895_7880_c1 nmdc:mga0n895_7880_c1_6070_6396 103
399 3300053087 Ga0500643_001097 Ga0500643_001097_14800_15135 103
400 3300053087 Ga0500643_034844 Ga0500643_034844_1123_1458 103
401 3300053104 Ga0500556_0060549 Ga0500556_0060549_703_1014 103
402 3300053139 Ga0500568_0002197 Ga0500568_0002197_6901_7224 103
403 3300053139 Ga0500568_0264501 Ga0500568_0264501_192_527 103
404 3300053153 Ga0500616_0000742 Ga0500616_0000742_33234_33557 103
405 3300053730 Ga0500645_001470 Ga0500645_001470_1000_1311 103
406 3300053730 Ga0500645_173222 Ga0500645_173222_246_557 103
407 3300005327 Ga0070658_10215277 Ga0070658_102152774 104
408 3300005327 Ga0070658_10666943 Ga0070658_106669433 104
409 3300005327 Ga0070658_11632188 Ga0070658_116321882 104
410 3300005337 Ga0070682_100036210 Ga0070682_1000362105 104
411 3300005338 Ga0068868_100664716 Ga0068868_1006647163 104
412 3300005344 Ga0070661_100005097 Ga0070661_1000050973 104
413 3300005345 Ga0070692_10232582 Ga0070692_102325821 104
414 3300005366 Ga0070659_100035688 Ga0070659_1000356885 104
415 3300005366 Ga0070659_101237475 Ga0070659_1012374752 104
416 3300005455 Ga0070663_100078191 Ga0070663_1000781915 104
417 3300005459 Ga0068867_102090146 Ga0068867_1020901461 104
418 3300005530 Ga0070679_100482428 Ga0070679_1004824282 104
419 3300005539 Ga0068853_100031336 Ga0068853_1000313367 104
420 3300005564 Ga0070664_100014233 Ga0070664_10001423310 104
421 3300005578 Ga0068854_100425746 Ga0068854_1004257463 104
422 3300005616 Ga0068852_100052180 Ga0068852_1000521807 104
423 3300005616 Ga0068852_102312533 Ga0068852_1023125332 104
424 3300005834 Ga0068851_10059944 Ga0068851_100599444 104
425 3300013296 Ga0157374_10038141 Ga0157374_100381417 104
426 3300025321 Ga0207656_10011159 Ga0207656_100111591 104
427 3300025909 Ga0207705_10037101 Ga0207705_100371016 104
428 3300025909 Ga0207705_10107084 Ga0207705_101070845 104
429 3300025920 Ga0207649_10032361 Ga0207649_100323617 104
430 3300025920 Ga0207649_11026332 Ga0207649_110263321 104
431 3300025921 Ga0207652_10956272 Ga0207652_109562722 104
432 3300025945 Ga0207679_10076790 Ga0207679_100767905 104
433 3300025981 Ga0207640_10774665 Ga0207640_107746653 104
434 3300026023 Ga0207677_10353316 Ga0207677_103533162 104
435 3300026041 Ga0207639_10044888 Ga0207639_100448887 104
436 3300026067 Ga0207678_10001768 Ga0207678_100017686 104
437 3300026142 Ga0207698_10042149 Ga0207698_100421497 104
438 3300031548 Ga0307408_100079168 Ga0307408_1000791684 104
439 3300031731 Ga0307405_10113678 Ga0307405_101136785 104
440 3300031824 Ga0307413_10083427 Ga0307413_100834275 104
441 3300031824 Ga0307413_10925578 Ga0307413_109255782 104
442 3300031824 Ga0307413_10938454 Ga0307413_109384542 104
443 3300031852 Ga0307410_10119547 Ga0307410_101195475 104
444 3300031852 Ga0307410_10238639 Ga0307410_102386393 104
445 3300031901 Ga0307406_10009016 Ga0307406_100090167 104
446 3300031901 Ga0307406_10367041 Ga0307406_103670413 104
447 3300031911 Ga0307412_11130581 Ga0307412_111305812 104
448 3300031911 Ga0307412_11328556 Ga0307412_113285562 104
449 3300031995 Ga0307409_100235561 Ga0307409_1002355615 104
450 3300031995 Ga0307409_100419010 Ga0307409_1004190104 104
451 3300032002 Ga0307416_100079594 Ga0307416_1000795945 104
452 3300032002 Ga0307416_100131227 Ga0307416_1001312275 104
453 3300032004 Ga0307414_10089290 Ga0307414_100892905 104
454 3300032004 Ga0307414_10166425 Ga0307414_101664253 104
455 3300032004 Ga0307414_11315764 Ga0307414_113157642 104
456 3300032005 Ga0307411_10004027 Ga0307411_1000402710 104
457 3300032005 Ga0307411_10555051 Ga0307411_105550511 104
458 3300032005 Ga0307411_11718753 Ga0307411_117187532 104
459 3300032126 Ga0307415_100097201 Ga0307415_1000972016 104
460 3300032126 Ga0307415_100865590 Ga0307415_1008655901 104
461 3300032126 Ga0307415_102045788 Ga0307415_1020457882 104
462 3300037471 Ga0395905_1547620 Ga0395905_1547620_112_441 104
463 3300046684 Ga0495669_0035543 Ga0495669_0035543_319_651 104
464 3300048911 Ga0496108_0984104 Ga0496108_0984104_302_628 104
465 3300049583 Ga0501067_0187802 Ga0501067_0187802_571_885 104
466 3300049585 Ga0501069_0016937 Ga0501069_0016937_486_800 104
467 3300031731 Ga0307405_10574135 Ga0307405_105741352 105
468 3300031901 Ga0307406_10191701 Ga0307406_101917013 105
469 3300031995 Ga0307409_100711001 Ga0307409_1007110012 105
470 3300032002 Ga0307416_100329264 Ga0307416_1003292642 105
471 3300032002 Ga0307416_100421592 Ga0307416_1004215922 105
472 3300032004 Ga0307414_10965789 Ga0307414_109657892 105
473 3300032004 Ga0307414_11236233 Ga0307414_112362332 105
474 3300032005 Ga0307411_11988396 Ga0307411_119883962 105
475 3300032126 Ga0307415_100548087 Ga0307415_1005480872 105
476 3300044842 Ga0466957_0728254 Ga0466957_0728254_341_673 105
477 3300049130 Ga0501310_055367 Ga0501310_055367_44_367 105
478 3300049549 Ga0501333_004596 Ga0501333_004596_182_505 105
479 3300049551 Ga0501335_031762 Ga0501335_031762_82_405 105
480 3300049556 Ga0501340_011525 Ga0501340_011525_285_608 105
481 3300049765 Ga0501268_078453 Ga0501268_078453_173_496 105
482 3300005327 Ga0070658_10008484 Ga0070658_100084849 106
483 3300005331 Ga0070670_100133963 Ga0070670_1001339634 106
484 3300005333 Ga0070677_10258193 Ga0070677_102581932 106
485 3300005334 Ga0068869_100075112 Ga0068869_1000751125 106
486 3300005336 Ga0070680_101941698 Ga0070680_1019416981 106
487 3300005338 Ga0068868_100362375 Ga0068868_1003623753 106
488 3300005340 Ga0070689_100318208 Ga0070689_1003182083 106
489 3300005344 Ga0070661_100281670 Ga0070661_1002816704 106
490 3300005353 Ga0070669_100071233 Ga0070669_1000712332 106
491 3300005354 Ga0070675_100131049 Ga0070675_1001310494 106
492 3300005364 Ga0070673_100865468 Ga0070673_1008654681 106
493 3300005366 Ga0070659_100489938 Ga0070659_1004899382 106
494 3300005435 Ga0070714_100137572 Ga0070714_1001375725 106
495 3300005436 Ga0070713_100014227 Ga0070713_1000142278 106
496 3300005455 Ga0070663_100040950 Ga0070663_1000409506 106
497 3300005457 Ga0070662_100205461 Ga0070662_1002054615 106
498 3300005546 Ga0070696_100040501 Ga0070696_1000405014 106
499 3300005547 Ga0070693_100088539 Ga0070693_1000885392 106
500 3300005564 Ga0070664_100126949 Ga0070664_1001269493 106
501 3300005577 Ga0068857_100016232 Ga0068857_1000162329 106
502 3300005578 Ga0068854_100070209 Ga0068854_1000702092 106
503 3300005617 Ga0068859_100189251 Ga0068859_1001892512 106
504 3300005618 Ga0068864_100027468 Ga0068864_1000274682 106
505 3300005719 Ga0068861_100272571 Ga0068861_1002725713 106
506 3300005841 Ga0068863_100008110 Ga0068863_10000811012 106
507 3300005842 Ga0068858_100104177 Ga0068858_1001041774 106
508 3300005843 Ga0068860_100509302 Ga0068860_1005093022 106
509 3300005844 Ga0068862_100100800 Ga0068862_1001008003 106
510 3300006028 Ga0070717_10003857 Ga0070717_1000385710 106
511 3300006173 Ga0070716_100265685 Ga0070716_1002656851 106
512 3300006844 Ga0075428_100465962 Ga0075428_1004659623 106
513 3300006931 Ga0097620_100189261 Ga0097620_1001892612 106
514 3300009148 Ga0105243_10561352 Ga0105243_105613523 106
515 3300009177 Ga0105248_10327650 Ga0105248_103276503 106
516 3300009553 Ga0105249_10034168 Ga0105249_100341686 106
517 3300011119 Ga0105246_10122045 Ga0105246_101220452 106
518 3300013100 Ga0157373_10117129 Ga0157373_101171293 106
519 3300013308 Ga0157375_10853575 Ga0157375_108535752 106
520 3300025907 Ga0207645_10053620 Ga0207645_100536203 106
521 3300025909 Ga0207705_10022603 Ga0207705_100226037 106
522 3300025911 Ga0207654_10602367 Ga0207654_106023672 106
523 3300025920 Ga0207649_10197109 Ga0207649_101971092 106
524 3300025923 Ga0207681_10066945 Ga0207681_100669454 106
525 3300025925 Ga0207650_10231678 Ga0207650_102316784 106
526 3300025926 Ga0207659_10078713 Ga0207659_100787135 106
527 3300025928 Ga0207700_10237788 Ga0207700_102377884 106
528 3300025932 Ga0207690_10771844 Ga0207690_107718442 106
529 3300025933 Ga0207706_10245953 Ga0207706_102459535 106
530 3300025935 Ga0207709_10122822 Ga0207709_101228224 106
531 3300025939 Ga0207665_10123086 Ga0207665_101230863 106
532 3300025940 Ga0207691_10164637 Ga0207691_101646375 106
533 3300025941 Ga0207711_10181000 Ga0207711_101810004 106
534 3300025942 Ga0207689_10026962 Ga0207689_100269622 106
535 3300025945 Ga0207679_10029350 Ga0207679_100293504 106
536 3300025949 Ga0207667_10318726 Ga0207667_103187264 106
537 3300025960 Ga0207651_10793657 Ga0207651_107936571 106
538 3300025961 Ga0207712_11758144 Ga0207712_117581442 106
539 3300025981 Ga0207640_10019097 Ga0207640_100190974 106
540 3300026035 Ga0207703_10382459 Ga0207703_103824592 106
541 3300026067 Ga0207678_10006075 Ga0207678_100060755 106
542 3300026088 Ga0207641_10165515 Ga0207641_101655152 106
543 3300026089 Ga0207648_10409771 Ga0207648_104097714 106
544 3300026095 Ga0207676_10032440 Ga0207676_100324405 106
545 3300026116 Ga0207674_10039134 Ga0207674_100391345 106
546 3300026118 Ga0207675_100204155 Ga0207675_1002041552 106
547 3300028381 Ga0268264_10022846 Ga0268264_100228468 106
548 3300030745 Ga0316182_1131865 Ga0316182_11318652 106
549 3300031731 Ga0307405_10483917 Ga0307405_104839172 106
550 3300031824 Ga0307413_10197665 Ga0307413_101976654 106
551 3300031852 Ga0307410_10006719 Ga0307410_100067196 106
552 3300031903 Ga0307407_10004853 Ga0307407_100048539 106
553 3300031995 Ga0307409_100003524 Ga0307409_10000352412 106
554 3300032002 Ga0307416_100046625 Ga0307416_1000466255 106
555 3300032004 Ga0307414_10047924 Ga0307414_100479242 106
556 3300032005 Ga0307411_10178940 Ga0307411_101789403 106
557 3300032005 Ga0307411_11335514 Ga0307411_113355142 106
558 3300032005 Ga0307411_11956664 Ga0307411_119566642 106
559 3300032126 Ga0307415_100003431 Ga0307415_10000343111 106
560 3300032126 Ga0307415_100136390 Ga0307415_1001363905 106
561 3300037418 Ga0395900_0046828 Ga0395900_0046828_73_402 106
562 3300037418 Ga0395900_0289527 Ga0395900_0289527_587_934 106
563 3300037471 Ga0395905_0026027 Ga0395905_0026027_3833_4180 106
564 3300046525 Ga0495663_0264590 Ga0495663_0264590_27_356 106
565 3300046664 Ga0495659_0009203 Ga0495659_0009203_539_865 106
566 3300046684 Ga0495669_0016445 Ga0495669_0016445_2236_2562 106
567 3300046691 Ga0495670_0014290 Ga0495670_0014290_1359_1685 106
568 3300048911 Ga0496108_0547858 Ga0496108_0547858_175_495 106
569 3300048912 Ga0496109_0031681 Ga0496109_0031681_2845_3165 106
570 3300048913 Ga0496110_0367538 Ga0496110_0367538_525_845 106
571 3300048914 Ga0496111_0278459 Ga0496111_0278459_866_1186 106
572 3300048915 Ga0496112_0015271 Ga0496112_0015271_2847_3167 106
573 3300048916 Ga0496113_0419168 Ga0496113_0419168_502_822 106
574 3300049669 Ga0501235_151970 Ga0501235_151970_197_526 106
575 3300049765 Ga0501268_091654 Ga0501268_091654_153_482 106
576 3300050510 nmdc:mga06r32_37806_c1 nmdc:mga06r32_37806_c1_1045_1365 106
577 3300005288 Ga0065714_10400992 Ga0065714_104009922 107
578 3300005289 Ga0065704_10572568 Ga0065704_105725681 107
579 3300026116 Ga0207674_10032272 Ga0207674_100322727 107
580 3300031548 Ga0307408_100326530 Ga0307408_1003265304 107
581 3300031548 Ga0307408_100419527 Ga0307408_1004195273 107
582 3300031731 Ga0307405_10131335 Ga0307405_101313353 107
583 3300031731 Ga0307405_10269709 Ga0307405_102697094 107
584 3300031731 Ga0307405_10392958 Ga0307405_103929582 107
585 3300031824 Ga0307413_10037623 Ga0307413_100376232 107
586 3300031824 Ga0307413_10190324 Ga0307413_101903243 107
587 3300031824 Ga0307413_11362447 Ga0307413_113624472 107
588 3300031852 Ga0307410_10432839 Ga0307410_104328391 107
589 3300031901 Ga0307406_10032412 Ga0307406_100324122 107
590 3300031903 Ga0307407_10137587 Ga0307407_101375872 107
591 3300031903 Ga0307407_10152657 Ga0307407_101526572 107
592 3300031903 Ga0307407_10383954 Ga0307407_103839542 107
593 3300031911 Ga0307412_10303235 Ga0307412_103032351 107
594 3300031995 Ga0307409_100195645 Ga0307409_1001956454 107
595 3300031995 Ga0307409_102297817 Ga0307409_1022978172 107
596 3300032002 Ga0307416_100092780 Ga0307416_1000927805 107
597 3300032002 Ga0307416_100166761 Ga0307416_1001667613 107
598 3300032002 Ga0307416_100704047 Ga0307416_1007040473 107
599 3300032004 Ga0307414_10146806 Ga0307414_101468064 107
600 3300032004 Ga0307414_10299219 Ga0307414_102992191 107
601 3300032004 Ga0307414_10611389 Ga0307414_106113893 107
602 3300032004 Ga0307414_11947737 Ga0307414_119477371 107
603 3300032005 Ga0307411_10068399 Ga0307411_100683992 107
604 3300032005 Ga0307411_10250103 Ga0307411_102501032 107
605 3300032126 Ga0307415_100050974 Ga0307415_1000509746 107
606 3300032126 Ga0307415_100334583 Ga0307415_1003345833 107
607 3300032126 Ga0307415_100556437 Ga0307415_1005564372 107
608 3300037312 Ga0395899_0089925 Ga0395899_0089925_636_971 107
609 3300037418 Ga0395900_0365891 Ga0395900_0365891_59_394 107
610 3300037418 Ga0395900_0625123 Ga0395900_0625123_223_558 107
611 3300037418 Ga0395900_0922985 Ga0395900_0922985_351_686 107
612 3300037471 Ga0395905_1490217 Ga0395905_1490217_232_567 107
613 3300038443 Ga0395901_0023864 Ga0395901_0023864_2996_3331 107
614 3300042004 Ga0439445_0000220 Ga0439445_0000220_7865_8194 107
615 3300042006 Ga0439432_004278 Ga0439432_004278_2502_2840 107
616 3300049539 Ga0501323_038398 Ga0501323_038398_322_651 107
617 3300049540 Ga0501324_016006 Ga0501324_016006_370_699 107
618 3300049654 Ga0501207_099191 Ga0501207_099191_83_412 107
619 3300049660 Ga0501216_035922 Ga0501216_035922_330_659 107
620 3300049674 Ga0501242_012321 Ga0501242_012321_484_813 107
621 3300049680 Ga0501250_012113 Ga0501250_012113_418_747 107
622 3300049706 Ga0501229_075219 Ga0501229_075219_34_363 107
623 3300049764 Ga0501267_030111 Ga0501267_030111_11_340 107
624 3300049765 Ga0501268_041923 Ga0501268_041923_32_361 107
625 3300049765 Ga0501268_045597 Ga0501268_045597_361_690 107
626 3300049770 Ga0501273_024970 Ga0501273_024970_87_416 107
627 3300025918 Ga0207662_10355575 Ga0207662_103555753 108
628 2162886012 MBSR1b_contig_12418040 MBSR1b_0285.00005530 109
629 3300001904 JGI24736J21556_1000667 JGI24736J21556_10006676 109
630 3300001979 JGI24740J21852_10017073 JGI24740J21852_100170734 109
631 3300001979 JGI24740J21852_10055235 JGI24740J21852_100552352 109
632 3300001989 JGI24739J22299_10000448 JGI24739J22299_1000044815 109
633 3300001990 JGI24737J22298_10000438 JGI24737J22298_100004389 109
634 3300001990 JGI24737J22298_10010883 JGI24737J22298_100108835 109
635 3300001990 JGI24737J22298_10017305 JGI24737J22298_100173052 109
636 3300001991 JGI24743J22301_10012397 JGI24743J22301_100123973 109
637 3300002075 JGI24738J21930_10002281 JGI24738J21930_100022815 109
638 3300002075 JGI24738J21930_10041217 JGI24738J21930_100412172 109
639 3300003323 rootH1_10284297 rootH1_102842972 109
640 3300005288 Ga0065714_10399877 Ga0065714_103998772 109
641 3300005290 Ga0065712_10032326 Ga0065712_100323263 109
642 3300005290 Ga0065712_10165184 Ga0065712_101651843 109
643 3300005290 Ga0065712_10691901 Ga0065712_106919011 109
644 3300005293 Ga0065715_10092118 Ga0065715_100921188 109
645 3300005293 Ga0065715_10093949 Ga0065715_100939495 109
646 3300005293 Ga0065715_10231107 Ga0065715_102311074 109
647 3300005293 Ga0065715_10236651 Ga0065715_102366513 109
648 3300005327 Ga0070658_10016452 Ga0070658_100164527 109
649 3300005327 Ga0070658_10148776 Ga0070658_101487764 109
650 3300005327 Ga0070658_10338167 Ga0070658_103381672 109
651 3300005327 Ga0070658_10487525 Ga0070658_104875252 109
652 3300005327 Ga0070658_10700796 Ga0070658_107007963 109
653 3300005327 Ga0070658_11105382 Ga0070658_111053822 109
654 3300005328 Ga0070676_10015554 Ga0070676_100155546 109
655 3300005328 Ga0070676_10036730 Ga0070676_100367307 109
656 3300005328 Ga0070676_10192526 Ga0070676_101925264 109
657 3300005329 Ga0070683_100087604 Ga0070683_1000876044 109
658 3300005329 Ga0070683_100148122 Ga0070683_1001481223 109
659 3300005331 Ga0070670_100003973 Ga0070670_1000039734 109
660 3300005331 Ga0070670_100011203 Ga0070670_10001120311 109
661 3300005331 Ga0070670_100016862 Ga0070670_10001686210 109
662 3300005331 Ga0070670_100034717 Ga0070670_1000347174 109
663 3300005331 Ga0070670_100368409 Ga0070670_1003684094 109
664 3300005331 Ga0070670_100603816 Ga0070670_1006038163 109
665 3300005331 Ga0070670_100664942 Ga0070670_1006649422 109
666 3300005333 Ga0070677_10000633 Ga0070677_100006335 109
667 3300005333 Ga0070677_10001594 Ga0070677_1000159410 109
668 3300005335 Ga0070666_10001024 Ga0070666_100010249 109
669 3300005335 Ga0070666_10439414 Ga0070666_104394142 109
670 3300005335 Ga0070666_10572366 Ga0070666_105723661 109
671 3300005336 Ga0070680_100501525 Ga0070680_1005015252 109
672 3300005337 Ga0070682_100063314 Ga0070682_1000633142 109
673 3300005338 Ga0068868_100180051 Ga0068868_1001800512 109
674 3300005339 Ga0070660_100034107 Ga0070660_1000341077 109
675 3300005339 Ga0070660_100230055 Ga0070660_1002300554 109
676 3300005339 Ga0070660_100278346 Ga0070660_1002783463 109
677 3300005339 Ga0070660_100554458 Ga0070660_1005544583 109
678 3300005339 Ga0070660_101304310 Ga0070660_1013043101 109
679 3300005343 Ga0070687_100244067 Ga0070687_1002440672 109
680 3300005344 Ga0070661_100021398 Ga0070661_1000213988 109
681 3300005344 Ga0070661_100030841 Ga0070661_1000308415 109
682 3300005344 Ga0070661_100186558 Ga0070661_1001865585 109
683 3300005344 Ga0070661_100222829 Ga0070661_1002228294 109
684 3300005344 Ga0070661_101193437 Ga0070661_1011934372 109
685 3300005345 Ga0070692_10156233 Ga0070692_101562334 109
686 3300005345 Ga0070692_10862536 Ga0070692_108625362 109
687 3300005347 Ga0070668_100121240 Ga0070668_1001212405 109
688 3300005347 Ga0070668_100173854 Ga0070668_1001738543 109
689 3300005347 Ga0070668_100184509 Ga0070668_1001845093 109
690 3300005347 Ga0070668_100320264 Ga0070668_1003202643 109
691 3300005347 Ga0070668_100435000 Ga0070668_1004350003 109
692 3300005353 Ga0070669_100000565 Ga0070669_1000005659 109
693 3300005353 Ga0070669_100020573 Ga0070669_1000205736 109
694 3300005353 Ga0070669_100035259 Ga0070669_1000352595 109
695 3300005354 Ga0070675_100005534 Ga0070675_1000055349 109
696 3300005354 Ga0070675_101620327 Ga0070675_1016203271 109
697 3300005354 Ga0070675_101717773 Ga0070675_1017177731 109
698 3300005355 Ga0070671_100015851 Ga0070671_1000158514 109
699 3300005355 Ga0070671_100017555 Ga0070671_1000175555 109
700 3300005355 Ga0070671_100294528 Ga0070671_1002945283 109
701 3300005355 Ga0070671_100323564 Ga0070671_1003235643 109
702 3300005356 Ga0070674_100313838 Ga0070674_1003138384 109
703 3300005364 Ga0070673_100007906 Ga0070673_10000790611 109
704 3300005364 Ga0070673_100020542 Ga0070673_1000205428 109
705 3300005364 Ga0070673_100919256 Ga0070673_1009192562 109
706 3300005364 Ga0070673_101204807 Ga0070673_1012048072 109
707 3300005364 Ga0070673_101212555 Ga0070673_1012125552 109
708 3300005365 Ga0070688_100867368 Ga0070688_1008673682 109
709 3300005365 Ga0070688_101352594 Ga0070688_1013525941 109
710 3300005366 Ga0070659_100016905 Ga0070659_1000169055 109
711 3300005366 Ga0070659_100025940 Ga0070659_1000259408 109
712 3300005367 Ga0070667_100002091 Ga0070667_10000209112 109
713 3300005367 Ga0070667_100020312 Ga0070667_1000203128 109
714 3300005367 Ga0070667_100242865 Ga0070667_1002428654 109
715 3300005367 Ga0070667_100518124 Ga0070667_1005181242 109
716 3300005367 Ga0070667_100982775 Ga0070667_1009827752 109
717 3300005435 Ga0070714_100966753 Ga0070714_1009667532 109
718 3300005438 Ga0070701_10160408 Ga0070701_101604084 109
719 3300005441 Ga0070700_100767355 Ga0070700_1007673551 109
720 3300005441 Ga0070700_100780973 Ga0070700_1007809732 109
721 3300005441 Ga0070700_100790332 Ga0070700_1007903321 109
722 3300005455 Ga0070663_100018818 Ga0070663_1000188185 109
723 3300005455 Ga0070663_100033755 Ga0070663_1000337553 109
724 3300005455 Ga0070663_100096689 Ga0070663_1000966892 109
725 3300005455 Ga0070663_100120104 Ga0070663_1001201044 109
726 3300005455 Ga0070663_100778202 Ga0070663_1007782022 109
727 3300005455 Ga0070663_101206967 Ga0070663_1012069672 109
728 3300005455 Ga0070663_101215327 Ga0070663_1012153272 109
729 3300005455 Ga0070663_101575617 Ga0070663_1015756171 109
730 3300005456 Ga0070678_100016584 Ga0070678_1000165843 109
731 3300005456 Ga0070678_100467612 Ga0070678_1004676124 109
732 3300005457 Ga0070662_100003479 Ga0070662_10000347914 109
733 3300005457 Ga0070662_100023235 Ga0070662_1000232354 109
734 3300005457 Ga0070662_100038234 Ga0070662_1000382347 109
735 3300005457 Ga0070662_100041628 Ga0070662_1000416284 109
736 3300005457 Ga0070662_100087768 Ga0070662_1000877682 109
737 3300005457 Ga0070662_100699514 Ga0070662_1006995142 109
738 3300005458 Ga0070681_10085866 Ga0070681_100858664 109
739 3300005458 Ga0070681_10165574 Ga0070681_101655744 109
740 3300005459 Ga0068867_100008041 Ga0068867_1000080418 109
741 3300005459 Ga0068867_100017475 Ga0068867_1000174756 109
742 3300005459 Ga0068867_100071292 Ga0068867_1000712924 109
743 3300005459 Ga0068867_101901735 Ga0068867_1019017351 109
744 3300005466 Ga0070685_10237222 Ga0070685_102372222 109
745 3300005471 Ga0070698_101286751 Ga0070698_1012867512 109
746 3300005530 Ga0070679_100122862 Ga0070679_1001228622 109
747 3300005530 Ga0070679_100368315 Ga0070679_1003683152 109
748 3300005535 Ga0070684_100500686 Ga0070684_1005006861 109
749 3300005539 Ga0068853_100100839 Ga0068853_1001008394 109
750 3300005539 Ga0068853_100219975 Ga0068853_1002199753 109
751 3300005539 Ga0068853_100286279 Ga0068853_1002862793 109
752 3300005539 Ga0068853_100750086 Ga0068853_1007500862 109
753 3300005543 Ga0070672_100010331 Ga0070672_10001033110 109
754 3300005543 Ga0070672_100050563 Ga0070672_1000505636 109
755 3300005543 Ga0070672_100190970 Ga0070672_1001909702 109
756 3300005543 Ga0070672_100596019 Ga0070672_1005960193 109
757 3300005545 Ga0070695_100253874 Ga0070695_1002538742 109
758 3300005548 Ga0070665_100056976 Ga0070665_1000569769 109
759 3300005548 Ga0070665_100925679 Ga0070665_1009256792 109
760 3300005563 Ga0068855_100307868 Ga0068855_1003078682 109
761 3300005563 Ga0068855_100792901 Ga0068855_1007929012 109
762 3300005564 Ga0070664_100021459 Ga0070664_1000214598 109
763 3300005564 Ga0070664_100033166 Ga0070664_1000331666 109
764 3300005564 Ga0070664_100107059 Ga0070664_1001070593 109
765 3300005564 Ga0070664_100975259 Ga0070664_1009752592 109
766 3300005577 Ga0068857_100028162 Ga0068857_1000281623 109
767 3300005577 Ga0068857_100086051 Ga0068857_1000860515 109
768 3300005577 Ga0068857_100670230 Ga0068857_1006702303 109
769 3300005577 Ga0068857_102028936 Ga0068857_1020289361 109
770 3300005578 Ga0068854_100001621 Ga0068854_10000162117 109
771 3300005578 Ga0068854_100036249 Ga0068854_1000362494 109
772 3300005578 Ga0068854_100110561 Ga0068854_1001105614 109
773 3300005578 Ga0068854_100237794 Ga0068854_1002377943 109
774 3300005578 Ga0068854_100327777 Ga0068854_1003277771 109
775 3300005578 Ga0068854_100432941 Ga0068854_1004329413 109
776 3300005578 Ga0068854_100665258 Ga0068854_1006652582 109
777 3300005614 Ga0068856_100021735 Ga0068856_1000217357 109
778 3300005614 Ga0068856_100148735 Ga0068856_1001487353 109
779 3300005616 Ga0068852_100053492 Ga0068852_1000534923 109
780 3300005616 Ga0068852_100058849 Ga0068852_1000588495 109
781 3300005616 Ga0068852_100061243 Ga0068852_1000612435 109
782 3300005617 Ga0068859_100044660 Ga0068859_1000446607 109
783 3300005617 Ga0068859_101682065 Ga0068859_1016820651 109
784 3300005617 Ga0068859_102104865 Ga0068859_1021048651 109
785 3300005618 Ga0068864_100029656 Ga0068864_1000296565 109
786 3300005618 Ga0068864_100287197 Ga0068864_1002871974 109
787 3300005618 Ga0068864_100348827 Ga0068864_1003488272 109
788 3300005718 Ga0068866_10695275 Ga0068866_106952752 109
789 3300005719 Ga0068861_100017138 Ga0068861_1000171386 109
790 3300005719 Ga0068861_100194737 Ga0068861_1001947374 109
791 3300005834 Ga0068851_10009861 Ga0068851_100098617 109
792 3300005840 Ga0068870_10066251 Ga0068870_100662514 109
793 3300005841 Ga0068863_100006362 Ga0068863_10000636217 109
794 3300005841 Ga0068863_100042997 Ga0068863_1000429972 109
795 3300005843 Ga0068860_100518205 Ga0068860_1005182054 109
796 3300005843 Ga0068860_100548700 Ga0068860_1005487003 109
797 3300005844 Ga0068862_100035547 Ga0068862_1000355476 109
798 3300005844 Ga0068862_100290107 Ga0068862_1002901073 109
799 3300005844 Ga0068862_100412322 Ga0068862_1004123224 109
800 3300005844 Ga0068862_100669578 Ga0068862_1006695782 109
801 3300005844 Ga0068862_100701042 Ga0068862_1007010421 109
802 3300005844 Ga0068862_101785890 Ga0068862_1017858902 109
803 3300005844 Ga0068862_102756117 Ga0068862_1027561172 109
804 3300006038 Ga0075365_11271041 Ga0075365_112710411 109
805 3300006358 Ga0068871_100314255 Ga0068871_1003142554 109
806 3300006358 Ga0068871_100674506 Ga0068871_1006745063 109
807 3300006844 Ga0075428_100493120 Ga0075428_1004931202 109
808 3300006847 Ga0075431_101095226 Ga0075431_1010952262 109
809 3300006852 Ga0075433_11559453 Ga0075433_115594532 109
810 3300006871 Ga0075434_100654036 Ga0075434_1006540362 109
811 3300006880 Ga0075429_100582856 Ga0075429_1005828563 109
812 3300006881 Ga0068865_100802277 Ga0068865_1008022772 109
813 3300006931 Ga0097620_100044657 Ga0097620_1000446575 109
814 3300006931 Ga0097620_101681915 Ga0097620_1016819151 109
815 3300006931 Ga0097620_102104647 Ga0097620_1021046471 109
816 3300009093 Ga0105240_10007704 Ga0105240_100077042 109
817 3300009093 Ga0105240_10042509 Ga0105240_100425099 109
818 3300009093 Ga0105240_10797850 Ga0105240_107978502 109
819 3300009094 Ga0111539_10142858 Ga0111539_101428585 109
820 3300009094 Ga0111539_10282228 Ga0111539_102822285 109
821 3300009094 Ga0111539_11224894 Ga0111539_112248942 109
822 3300009098 Ga0105245_10000782 Ga0105245_1000078226 109
823 3300009101 Ga0105247_11249030 Ga0105247_112490302 109
824 3300009148 Ga0105243_10062418 Ga0105243_100624185 109
825 3300009148 Ga0105243_10555257 Ga0105243_105552572 109
826 3300009174 Ga0105241_10021914 Ga0105241_100219147 109
827 3300009177 Ga0105248_10184233 Ga0105248_101842337 109
828 3300009177 Ga0105248_11566803 Ga0105248_115668032 109
829 3300009551 Ga0105238_10079835 Ga0105238_100798354 109
830 3300009551 Ga0105238_10747184 Ga0105238_107471842 109
831 3300009551 Ga0105238_10960462 Ga0105238_109604621 109
832 3300009553 Ga0105249_10009121 Ga0105249_100091219 109
833 3300009553 Ga0105249_10309863 Ga0105249_103098635 109
834 3300010375 Ga0105239_11394296 Ga0105239_113942962 109
835 3300010375 Ga0105239_11895441 Ga0105239_118954412 109
836 3300013100 Ga0157373_10007888 Ga0157373_100078887 109
837 3300013100 Ga0157373_10042025 Ga0157373_100420252 109
838 3300013100 Ga0157373_10049512 Ga0157373_100495124 109
839 3300013100 Ga0157373_10088384 Ga0157373_100883844 109
840 3300013100 Ga0157373_10094016 Ga0157373_100940163 109
841 3300013100 Ga0157373_10226223 Ga0157373_102262233 109
842 3300013100 Ga0157373_10356222 Ga0157373_103562223 109
843 3300013102 Ga0157371_10035363 Ga0157371_100353634 109
844 3300013102 Ga0157371_10074846 Ga0157371_100748464 109
845 3300013102 Ga0157371_10100083 Ga0157371_101000835 109
846 3300013102 Ga0157371_10317913 Ga0157371_103179132 109
847 3300013102 Ga0157371_11068577 Ga0157371_110685772 109
848 3300013104 Ga0157370_10039668 Ga0157370_100396685 109
849 3300013104 Ga0157370_10072313 Ga0157370_100723138 109
850 3300013104 Ga0157370_10313853 Ga0157370_103138534 109
851 3300013104 Ga0157370_10410249 Ga0157370_104102491 109
852 3300013105 Ga0157369_10012733 Ga0157369_1001273313 109
853 3300013105 Ga0157369_10549134 Ga0157369_105491342 109
854 3300013296 Ga0157374_10001858 Ga0157374_1000185823 109
855 3300013296 Ga0157374_11507143 Ga0157374_115071431 109
856 3300013297 Ga0157378_10022210 Ga0157378_100222109 109
857 3300013306 Ga0163162_10114579 Ga0163162_101145795 109
858 3300013307 Ga0157372_10022159 Ga0157372_100221598 109
859 3300013307 Ga0157372_10045683 Ga0157372_100456837 109
860 3300013307 Ga0157372_10096910 Ga0157372_100969108 109
861 3300013307 Ga0157372_10197417 Ga0157372_101974175 109
862 3300013308 Ga0157375_10001588 Ga0157375_1000158814 109
863 3300013308 Ga0157375_11141162 Ga0157375_111411621 109
864 3300013308 Ga0157375_11872934 Ga0157375_118729342 109
865 3300014325 Ga0163163_10118395 Ga0163163_101183953 109
866 3300014326 Ga0157380_10003443 Ga0157380_100034432 109
867 3300014326 Ga0157380_10009069 Ga0157380_1000906910 109
868 3300014326 Ga0157380_10051386 Ga0157380_100513863 109
869 3300014326 Ga0157380_10209759 Ga0157380_102097594 109
870 3300014326 Ga0157380_10286471 Ga0157380_102864713 109
871 3300014326 Ga0157380_10328829 Ga0157380_103288294 109
872 3300014326 Ga0157380_10600500 Ga0157380_106005003 109
873 3300014326 Ga0157380_11959486 Ga0157380_119594862 109
874 3300014745 Ga0157377_10481571 Ga0157377_104815712 109
875 3300017792 Ga0163161_10002869 Ga0163161_100028694 109
876 3300017792 Ga0163161_10128818 Ga0163161_101288184 109
877 3300020069 Ga0197907_10831941 Ga0197907_108319414 109
878 3300020070 Ga0206356_10485130 Ga0206356_104851304 109
879 3300020075 Ga0206349_1625932 Ga0206349_16259321 109
880 3300020076 Ga0206355_1207118 Ga0206355_12071182 109
881 3300020082 Ga0206353_11764448 Ga0206353_117644482 109
882 3300021377 Ga0213874_10064075 Ga0213874_100640752 109
883 3300021384 Ga0213876_10122587 Ga0213876_101225873 109
884 3300022467 Ga0224712_10048653 Ga0224712_100486531 109
885 3300022467 Ga0224712_10411844 Ga0224712_104118442 109
886 3300025315 Ga0207697_10005048 Ga0207697_100050487 109
887 3300025321 Ga0207656_10004042 Ga0207656_100040424 109
888 3300025893 Ga0207682_10001996 Ga0207682_1000199610 109
889 3300025893 Ga0207682_10002227 Ga0207682_1000222710 109
890 3300025893 Ga0207682_10033528 Ga0207682_100335285 109
891 3300025893 Ga0207682_10065894 Ga0207682_100658942 109
892 3300025901 Ga0207688_10026749 Ga0207688_100267492 109
893 3300025901 Ga0207688_10328491 Ga0207688_103284913 109
894 3300025903 Ga0207680_10023361 Ga0207680_100233614 109
895 3300025903 Ga0207680_10312175 Ga0207680_103121752 109
896 3300025904 Ga0207647_10023741 Ga0207647_100237414 109
897 3300025904 Ga0207647_10025899 Ga0207647_100258994 109
898 3300025904 Ga0207647_10112484 Ga0207647_101124842 109
899 3300025907 Ga0207645_10010873 Ga0207645_100108736 109
900 3300025907 Ga0207645_10167752 Ga0207645_101677524 109
901 3300025908 Ga0207643_10286109 Ga0207643_102861092 109
902 3300025909 Ga0207705_10000003 Ga0207705_10000003270 109
903 3300025909 Ga0207705_10064681 Ga0207705_100646817 109
904 3300025909 Ga0207705_10166206 Ga0207705_101662064 109
905 3300025911 Ga0207654_10606967 Ga0207654_106069672 109
906 3300025912 Ga0207707_10067055 Ga0207707_100670554 109
907 3300025912 Ga0207707_10393859 Ga0207707_103938592 109
908 3300025913 Ga0207695_10011187 Ga0207695_100111876 109
909 3300025913 Ga0207695_10015638 Ga0207695_100156386 109
910 3300025913 Ga0207695_10044891 Ga0207695_100448912 109
911 3300025917 Ga0207660_11075729 Ga0207660_110757291 109
912 3300025918 Ga0207662_10667652 Ga0207662_106676522 109
913 3300025919 Ga0207657_10001346 Ga0207657_1000134616 109
914 3300025919 Ga0207657_10045982 Ga0207657_100459826 109
915 3300025919 Ga0207657_10471117 Ga0207657_104711172 109
916 3300025920 Ga0207649_10000244 Ga0207649_1000024469 109
917 3300025920 Ga0207649_10087641 Ga0207649_100876414 109
918 3300025920 Ga0207649_11055683 Ga0207649_110556832 109
919 3300025921 Ga0207652_10560513 Ga0207652_105605133 109
920 3300025923 Ga0207681_10010000 Ga0207681_100100008 109
921 3300025923 Ga0207681_10198135 Ga0207681_101981352 109
922 3300025923 Ga0207681_10516834 Ga0207681_105168342 109
923 3300025924 Ga0207694_10108032 Ga0207694_101080325 109
924 3300025924 Ga0207694_10200517 Ga0207694_102005174 109
925 3300025924 Ga0207694_10481105 Ga0207694_104811052 109
926 3300025924 Ga0207694_10808700 Ga0207694_108087002 109
927 3300025925 Ga0207650_10032491 Ga0207650_100324917 109
928 3300025925 Ga0207650_10049500 Ga0207650_100495003 109
929 3300025925 Ga0207650_10121885 Ga0207650_101218854 109
930 3300025925 Ga0207650_10276444 Ga0207650_102764441 109
931 3300025925 Ga0207650_10607087 Ga0207650_106070872 109
932 3300025925 Ga0207650_11059768 Ga0207650_110597682 109
933 3300025925 Ga0207650_11751833 Ga0207650_117518331 109
934 3300025926 Ga0207659_10011868 Ga0207659_100118686 109
935 3300025926 Ga0207659_11419835 Ga0207659_114198351 109
936 3300025927 Ga0207687_10013795 Ga0207687_100137957 109
937 3300025929 Ga0207664_10864504 Ga0207664_108645042 109
938 3300025931 Ga0207644_10012576 Ga0207644_100125768 109
939 3300025931 Ga0207644_10022730 Ga0207644_100227307 109
940 3300025931 Ga0207644_10159122 Ga0207644_101591221 109
941 3300025931 Ga0207644_10264063 Ga0207644_102640633 109
942 3300025931 Ga0207644_10274866 Ga0207644_102748662 109
943 3300025931 Ga0207644_10745341 Ga0207644_107453413 109
944 3300025932 Ga0207690_10002067 Ga0207690_1000206713 109
945 3300025932 Ga0207690_10079944 Ga0207690_100799444 109
946 3300025932 Ga0207690_10163096 Ga0207690_101630965 109
947 3300025933 Ga0207706_10000187 Ga0207706_1000018750 109
948 3300025933 Ga0207706_10005896 Ga0207706_1000589613 109
949 3300025933 Ga0207706_10021485 Ga0207706_100214857 109
950 3300025933 Ga0207706_10044534 Ga0207706_100445347 109
951 3300025933 Ga0207706_10144699 Ga0207706_101446994 109
952 3300025933 Ga0207706_10147424 Ga0207706_101474242 109
953 3300025935 Ga0207709_10911512 Ga0207709_109115121 109
954 3300025937 Ga0207669_10035657 Ga0207669_100356575 109
955 3300025937 Ga0207669_10081268 Ga0207669_100812681 109
956 3300025937 Ga0207669_11748807 Ga0207669_117488071 109
957 3300025938 Ga0207704_11696615 Ga0207704_116966151 109
958 3300025940 Ga0207691_10235510 Ga0207691_102355102 109
959 3300025940 Ga0207691_10238908 Ga0207691_102389082 109
960 3300025940 Ga0207691_10364696 Ga0207691_103646962 109
961 3300025940 Ga0207691_10392782 Ga0207691_103927823 109
962 3300025941 Ga0207711_10119352 Ga0207711_101193527 109
963 3300025944 Ga0207661_10317718 Ga0207661_103177184 109
964 3300025945 Ga0207679_10036282 Ga0207679_100362821 109
965 3300025945 Ga0207679_10198440 Ga0207679_101984404 109
966 3300025945 Ga0207679_10476787 Ga0207679_104767874 109
967 3300025945 Ga0207679_11013687 Ga0207679_110136872 109
968 3300025949 Ga0207667_10085414 Ga0207667_100854146 109
969 3300025949 Ga0207667_10130304 Ga0207667_101303045 109
970 3300025960 Ga0207651_10016919 Ga0207651_100169196 109
971 3300025960 Ga0207651_10072999 Ga0207651_100729993 109
972 3300025960 Ga0207651_10472412 Ga0207651_104724124 109
973 3300025960 Ga0207651_10756753 Ga0207651_107567532 109
974 3300025960 Ga0207651_10884157 Ga0207651_108841572 109
975 3300025961 Ga0207712_10051403 Ga0207712_100514036 109
976 3300025961 Ga0207712_10309182 Ga0207712_103091822 109
977 3300025972 Ga0207668_10003630 Ga0207668_100036302 109
978 3300025972 Ga0207668_10072402 Ga0207668_100724026 109
979 3300025972 Ga0207668_10102862 Ga0207668_101028623 109
980 3300025972 Ga0207668_10281769 Ga0207668_102817693 109
981 3300025972 Ga0207668_10330869 Ga0207668_103308693 109
982 3300025981 Ga0207640_10002555 Ga0207640_100025552 109
983 3300025981 Ga0207640_10008684 Ga0207640_1000868410 109
984 3300025981 Ga0207640_10033768 Ga0207640_100337686 109
985 3300025981 Ga0207640_10077650 Ga0207640_100776505 109
986 3300025981 Ga0207640_12112071 Ga0207640_121120711 109
987 3300025986 Ga0207658_10029117 Ga0207658_100291176 109
988 3300025986 Ga0207658_10031515 Ga0207658_100315154 109
989 3300025986 Ga0207658_10047512 Ga0207658_100475122 109
990 3300025986 Ga0207658_11105911 Ga0207658_111059112 109
991 3300025986 Ga0207658_11263015 Ga0207658_112630152 109
992 3300026023 Ga0207677_10122142 Ga0207677_101221425 109
993 3300026041 Ga0207639_10091163 Ga0207639_100911633 109
994 3300026041 Ga0207639_10256627 Ga0207639_102566273 109
995 3300026041 Ga0207639_10540097 Ga0207639_105400972 109
996 3300026067 Ga0207678_10010189 Ga0207678_1001018912 109
997 3300026067 Ga0207678_10093485 Ga0207678_100934855 109
998 3300026067 Ga0207678_10108375 Ga0207678_101083753 109
999 3300026067 Ga0207678_10326270 Ga0207678_103262701 109
1000 3300026067 Ga0207678_10889538 Ga0207678_108895382 109
1001 3300026075 Ga0207708_10218981 Ga0207708_102189814 109
1002 3300026075 Ga0207708_10728530 Ga0207708_107285301 109
1003 3300026078 Ga0207702_10013173 Ga0207702_100131734 109
1004 3300026078 Ga0207702_10026785 Ga0207702_100267856 109
1005 3300026078 Ga0207702_10050398 Ga0207702_100503982 109
1006 3300026088 Ga0207641_10043141 Ga0207641_100431415 109
1007 3300026088 Ga0207641_11539308 Ga0207641_115393082 109
1008 3300026088 Ga0207641_12476573 Ga0207641_124765732 109
1009 3300026089 Ga0207648_10016014 Ga0207648_100160149 109
1010 3300026089 Ga0207648_10098447 Ga0207648_100984476 109
1011 3300026095 Ga0207676_10045960 Ga0207676_100459604 109
1012 3300026095 Ga0207676_10048610 Ga0207676_100486106 109
1013 3300026095 Ga0207676_10299283 Ga0207676_102992833 109
1014 3300026095 Ga0207676_10838266 Ga0207676_108382662 109
1015 3300026116 Ga0207674_10006319 Ga0207674_1000631914 109
1016 3300026116 Ga0207674_10166861 Ga0207674_101668615 109
1017 3300026116 Ga0207674_10406103 Ga0207674_104061033 109
1018 3300026118 Ga0207675_100006920 Ga0207675_1000069206 109
1019 3300026121 Ga0207683_10019836 Ga0207683_100198369 109
1020 3300026121 Ga0207683_10526723 Ga0207683_105267234 109
1021 3300026142 Ga0207698_10026332 Ga0207698_100263325 109
1022 3300026142 Ga0207698_10045600 Ga0207698_100456002 109
1023 3300026142 Ga0207698_10283693 Ga0207698_102836931 109
1024 3300026142 Ga0207698_10488088 Ga0207698_104880883 109
1025 3300026142 Ga0207698_10801191 Ga0207698_108011912 109
1026 3300026142 Ga0207698_11429163 Ga0207698_114291632 109
1027 3300027526 Ga0209968_1097482 Ga0209968_10974822 109
1028 3300027665 Ga0209983_1050778 Ga0209983_10507783 109
1029 3300027876 Ga0209974_10100144 Ga0209974_101001442 109
1030 3300027876 Ga0209974_10137567 Ga0209974_101375672 109
1031 3300028379 Ga0268266_10828334 Ga0268266_108283342 109
1032 3300028380 Ga0268265_10014855 Ga0268265_100148553 109
1033 3300028380 Ga0268265_10032697 Ga0268265_100326976 109
1034 3300028380 Ga0268265_10044455 Ga0268265_100444556 109
1035 3300028380 Ga0268265_10074599 Ga0268265_100745992 109
1036 3300028380 Ga0268265_10791647 Ga0268265_107916473 109
1037 3300028380 Ga0268265_12633360 Ga0268265_126333602 109
1038 3300028381 Ga0268264_10092845 Ga0268264_100928455 109
1039 3300028381 Ga0268264_11346388 Ga0268264_113463882 109
1040 3300030745 Ga0316182_1015430 Ga0316182_10154302 109
1041 3300031456 Ga0307513_10378479 Ga0307513_103784793 109
1042 3300031548 Ga0307408_100059500 Ga0307408_1000595004 109
1043 3300031548 Ga0307408_100110162 Ga0307408_1001101623 109
1044 3300031548 Ga0307408_100325449 Ga0307408_1003254494 109
1045 3300031548 Ga0307408_100448064 Ga0307408_1004480642 109
1046 3300031548 Ga0307408_101146304 Ga0307408_1011463042 109
1047 3300031548 Ga0307408_101492265 Ga0307408_1014922651 109
1048 3300031731 Ga0307405_10029652 Ga0307405_100296524 109
1049 3300031731 Ga0307405_10072947 Ga0307405_100729476 109
1050 3300031731 Ga0307405_10092866 Ga0307405_100928664 109
1051 3300031731 Ga0307405_10144236 Ga0307405_101442364 109
1052 3300031731 Ga0307405_10203576 Ga0307405_102035763 109
1053 3300031731 Ga0307405_10245055 Ga0307405_102450552 109
1054 3300031731 Ga0307405_10264977 Ga0307405_102649774 109
1055 3300031731 Ga0307405_10273059 Ga0307405_102730593 109
1056 3300031731 Ga0307405_10843840 Ga0307405_108438402 109
1057 3300031731 Ga0307405_10968781 Ga0307405_109687812 109
1058 3300031824 Ga0307413_10008774 Ga0307413_100087746 109
1059 3300031824 Ga0307413_10009336 Ga0307413_100093366 109
1060 3300031824 Ga0307413_10031246 Ga0307413_100312464 109
1061 3300031824 Ga0307413_10031253 Ga0307413_100312532 109
1062 3300031824 Ga0307413_10039441 Ga0307413_100394414 109
1063 3300031824 Ga0307413_10075680 Ga0307413_100756805 109
1064 3300031824 Ga0307413_10076537 Ga0307413_100765373 109
1065 3300031824 Ga0307413_10265835 Ga0307413_102658353 109
1066 3300031824 Ga0307413_10403378 Ga0307413_104033783 109
1067 3300031824 Ga0307413_10673122 Ga0307413_106731222 109
1068 3300031824 Ga0307413_11025803 Ga0307413_110258032 109
1069 3300031824 Ga0307413_11787263 Ga0307413_117872632 109
1070 3300031824 Ga0307413_11857387 Ga0307413_118573871 109
1071 3300031852 Ga0307410_10027938 Ga0307410_100279386 109
1072 3300031852 Ga0307410_10047471 Ga0307410_100474715 109
1073 3300031852 Ga0307410_10055519 Ga0307410_100555194 109
1074 3300031852 Ga0307410_10120428 Ga0307410_101204283 109
1075 3300031852 Ga0307410_10253416 Ga0307410_102534162 109
1076 3300031852 Ga0307410_10475286 Ga0307410_104752861 109
1077 3300031852 Ga0307410_10480959 Ga0307410_104809592 109
1078 3300031852 Ga0307410_10720786 Ga0307410_107207862 109
1079 3300031901 Ga0307406_10015515 Ga0307406_100155154 109
1080 3300031901 Ga0307406_10074110 Ga0307406_100741102 109
1081 3300031901 Ga0307406_10086653 Ga0307406_100866533 109
1082 3300031901 Ga0307406_10155622 Ga0307406_101556223 109
1083 3300031901 Ga0307406_10202849 Ga0307406_102028492 109
1084 3300031901 Ga0307406_10405842 Ga0307406_104058422 109
1085 3300031903 Ga0307407_10014470 Ga0307407_100144706 109
1086 3300031903 Ga0307407_10071520 Ga0307407_100715203 109
1087 3300031903 Ga0307407_10118373 Ga0307407_101183733 109
1088 3300031903 Ga0307407_10124655 Ga0307407_101246554 109
1089 3300031903 Ga0307407_10188056 Ga0307407_101880562 109
1090 3300031903 Ga0307407_10202734 Ga0307407_102027343 109
1091 3300031903 Ga0307407_10421333 Ga0307407_104213332 109
1092 3300031903 Ga0307407_10830279 Ga0307407_108302792 109
1093 3300031903 Ga0307407_11314154 Ga0307407_113141541 109
1094 3300031911 Ga0307412_10002944 Ga0307412_1000294410 109
1095 3300031911 Ga0307412_10030423 Ga0307412_100304233 109
1096 3300031911 Ga0307412_10056839 Ga0307412_100568395 109
1097 3300031911 Ga0307412_10057194 Ga0307412_100571945 109
1098 3300031911 Ga0307412_10228747 Ga0307412_102287472 109
1099 3300031911 Ga0307412_10305655 Ga0307412_103056553 109
1100 3300031911 Ga0307412_10673832 Ga0307412_106738322 109
1101 3300031911 Ga0307412_11060449 Ga0307412_110604491 109
1102 3300031911 Ga0307412_11230443 Ga0307412_112304431 109
1103 3300031911 Ga0307412_12049864 Ga0307412_120498641 109
1104 3300031995 Ga0307409_100053123 Ga0307409_1000531233 109
1105 3300031995 Ga0307409_100058816 Ga0307409_1000588165 109
1106 3300031995 Ga0307409_100123812 Ga0307409_1001238122 109
1107 3300031995 Ga0307409_100227292 Ga0307409_1002272922 109
1108 3300031995 Ga0307409_100255568 Ga0307409_1002555684 109
1109 3300031995 Ga0307409_100335538 Ga0307409_1003355381 109
1110 3300031995 Ga0307409_100560457 Ga0307409_1005604571 109
1111 3300031995 Ga0307409_100728863 Ga0307409_1007288632 109
1112 3300031995 Ga0307409_100916075 Ga0307409_1009160752 109
1113 3300031995 Ga0307409_101318519 Ga0307409_1013185193 109
1114 3300031995 Ga0307409_101336228 Ga0307409_1013362282 109
1115 3300031995 Ga0307409_101423616 Ga0307409_1014236162 109
1116 3300031995 Ga0307409_101783138 Ga0307409_1017831382 109
1117 3300032002 Ga0307416_100012769 Ga0307416_1000127696 109
1118 3300032002 Ga0307416_100147250 Ga0307416_1001472504 109
1119 3300032002 Ga0307416_100147481 Ga0307416_1001474815 109
1120 3300032002 Ga0307416_100166406 Ga0307416_1001664065 109
1121 3300032002 Ga0307416_100407348 Ga0307416_1004073482 109
1122 3300032002 Ga0307416_100612150 Ga0307416_1006121502 109
1123 3300032002 Ga0307416_100630894 Ga0307416_1006308942 109
1124 3300032002 Ga0307416_100979418 Ga0307416_1009794181 109
1125 3300032002 Ga0307416_101458988 Ga0307416_1014589882 109
1126 3300032002 Ga0307416_102232143 Ga0307416_1022321431 109
1127 3300032004 Ga0307414_10032913 Ga0307414_100329136 109
1128 3300032004 Ga0307414_10071272 Ga0307414_100712724 109
1129 3300032004 Ga0307414_10073009 Ga0307414_100730095 109
1130 3300032004 Ga0307414_10082737 Ga0307414_100827375 109
1131 3300032004 Ga0307414_10096509 Ga0307414_100965095 109
1132 3300032004 Ga0307414_10272912 Ga0307414_102729122 109
1133 3300032004 Ga0307414_10278077 Ga0307414_102780773 109
1134 3300032004 Ga0307414_10352156 Ga0307414_103521563 109
1135 3300032004 Ga0307414_10564250 Ga0307414_105642502 109
1136 3300032004 Ga0307414_10746929 Ga0307414_107469292 109
1137 3300032004 Ga0307414_10758059 Ga0307414_107580593 109
1138 3300032004 Ga0307414_10992873 Ga0307414_109928732 109
1139 3300032004 Ga0307414_11529892 Ga0307414_115298922 109
1140 3300032005 Ga0307411_10001485 Ga0307411_100014853 109
1141 3300032005 Ga0307411_10009804 Ga0307411_100098047 109
1142 3300032005 Ga0307411_10020705 Ga0307411_100207055 109
1143 3300032005 Ga0307411_10031260 Ga0307411_100312605 109
1144 3300032005 Ga0307411_10044181 Ga0307411_100441814 109
1145 3300032005 Ga0307411_10045736 Ga0307411_100457362 109
1146 3300032005 Ga0307411_10083347 Ga0307411_100833476 109
1147 3300032005 Ga0307411_10165547 Ga0307411_101655472 109
1148 3300032005 Ga0307411_10229997 Ga0307411_102299972 109
1149 3300032005 Ga0307411_10306827 Ga0307411_103068273 109
1150 3300032005 Ga0307411_10535632 Ga0307411_105356322 109
1151 3300032126 Ga0307415_100020759 Ga0307415_1000207598 109
1152 3300032126 Ga0307415_100060455 Ga0307415_1000604554 109
1153 3300032126 Ga0307415_100064736 Ga0307415_1000647364 109
1154 3300032126 Ga0307415_100205486 Ga0307415_1002054864 109
1155 3300032126 Ga0307415_100331712 Ga0307415_1003317122 109
1156 3300032126 Ga0307415_101112241 Ga0307415_1011122412 109
1157 3300032126 Ga0307415_101708358 Ga0307415_1017083582 109
1158 3300032126 Ga0307415_102362320 Ga0307415_1023623202 109
1159 3300037312 Ga0395899_0021092 Ga0395899_0021092_3035_3379 109
1160 3300037312 Ga0395899_0719457 Ga0395899_0719457_148_492 109
1161 3300037312 Ga0395899_0810759 Ga0395899_0810759_202_546 109
1162 3300037418 Ga0395900_0008835 Ga0395900_0008835_3784_4128 109
1163 3300037418 Ga0395900_0009860 Ga0395900_0009860_5459_5803 109
1164 3300037418 Ga0395900_0034005 Ga0395900_0034005_3436_3780 109
1165 3300037418 Ga0395900_0256643 Ga0395900_0256643_104_448 109
1166 3300037418 Ga0395900_0345441 Ga0395900_0345441_105_449 109
1167 3300037418 Ga0395900_0380027 Ga0395900_0380027_1002_1346 109
1168 3300037418 Ga0395900_0648435 Ga0395900_0648435_469_813 109
1169 3300037418 Ga0395900_0980804 Ga0395900_0980804_17_361 109
1170 3300037466 Ga0395898_0014192 Ga0395898_0014192_1563_1907 109
1171 3300037466 Ga0395898_0025210 Ga0395898_0025210_4181_4525 109
1172 3300037466 Ga0395898_0028810 Ga0395898_0028810_3450_3794 109
1173 3300037466 Ga0395898_0169292 Ga0395898_0169292_1058_1402 109
1174 3300037466 Ga0395898_0381931 Ga0395898_0381931_68_412 109
1175 3300037466 Ga0395898_0556328 Ga0395898_0556328_713_1057 109
1176 3300037471 Ga0395905_0001037 Ga0395905_0001037_31571_31915 109
1177 3300037471 Ga0395905_0003845 Ga0395905_0003845_11226_11570 109
1178 3300037471 Ga0395905_0017818 Ga0395905_0017818_4319_4663 109
1179 3300037471 Ga0395905_0088113 Ga0395905_0088113_273_617 109
1180 3300037471 Ga0395905_0096392 Ga0395905_0096392_807_1151 109
1181 3300037471 Ga0395905_0248535 Ga0395905_0248535_531_875 109
1182 3300037471 Ga0395905_0422649 Ga0395905_0422649_802_1146 109
1183 3300037471 Ga0395905_0643511 Ga0395905_0643511_258_593 109
1184 3300037471 Ga0395905_0676029 Ga0395905_0676029_357_701 109
1185 3300037471 Ga0395905_1295599 Ga0395905_1295599_208_552 109
1186 3300038443 Ga0395901_0000520 Ga0395901_0000520_29835_30179 109
1187 3300038443 Ga0395901_0028442 Ga0395901_0028442_442_786 109
1188 3300038443 Ga0395901_0048513 Ga0395901_0048513_1957_2301 109
1189 3300038443 Ga0395901_0301042 Ga0395901_0301042_835_1179 109
1190 3300038443 Ga0395901_1518830 Ga0395901_1518830_116_460 109
1191 3300038443 Ga0395901_2083940 Ga0395901_2083940_16_360 109
1192 3300039437 Ga0436365_1470013 Ga0436365_1470013_6201_6545 109
1193 3300039450 Ga0436363_0211821 Ga0436363_0211821_670_1014 109
1194 3300041458 Ga0451798_0742858 Ga0451798_0742858_204_548 109
1195 3300041509 Ga0451843_0051574 Ga0451843_0051574_1024_1374 109
1196 3300042439 Ga0439464_0000570 Ga0439464_0000570_5914_6258 109
1197 3300044656 Ga0466969_0139530 Ga0466969_0139530_670_1014 109
1198 3300044656 Ga0466969_0258445 Ga0466969_0258445_273_617 109
1199 3300044684 Ga0466966_0000004 Ga0466966_0000004_143321_143665 109
1200 3300044684 Ga0466966_0011248 Ga0466966_0011248_4765_5109 109
1201 3300044684 Ga0466966_0936326 Ga0466966_0936326_146_490 109
1202 3300044693 Ga0466961_0008797 Ga0466961_0008797_186_530 109
1203 3300044693 Ga0466961_0010535 Ga0466961_0010535_4157_4501 109
1204 3300044694 Ga0466963_0165328 Ga0466963_0165328_843_1187 109
1205 3300044694 Ga0466963_0465469 Ga0466963_0465469_132_476 109
1206 3300044719 Ga0466971_0080314 Ga0466971_0080314_970_1314 109
1207 3300044719 Ga0466971_0183327 Ga0466971_0183327_134_478 109
1208 3300044842 Ga0466957_0014505 Ga0466957_0014505_153_497 109
1209 3300044842 Ga0466957_0032415 Ga0466957_0032415_2626_2970 109
1210 3300045049 Ga0466959_0005768 Ga0466959_0005768_2402_2746 109
1211 3300045049 Ga0466959_0470759 Ga0466959_0470759_254_598 109
1212 3300045836 Ga0466958_0004867 Ga0466958_0004867_4357_4701 109
1213 3300046500 Ga0495596_0064467 Ga0495596_0064467_1041_1385 109
1214 3300046525 Ga0495663_0069720 Ga0495663_0069720_319_663 109
1215 3300046525 Ga0495663_0104883 Ga0495663_0104883_243_587 109
1216 3300046525 Ga0495663_0135421 Ga0495663_0135421_371_715 109
1217 3300046525 Ga0495663_0199525 Ga0495663_0199525_202_531 109
1218 3300046525 Ga0495663_0217040 Ga0495663_0217040_71_415 109
1219 3300046528 Ga0495642_0059864 Ga0495642_0059864_542_886 109
1220 3300046537 Ga0495598_0158418 Ga0495598_0158418_212_541 109
1221 3300046539 Ga0495621_0001333 Ga0495621_0001333_3672_4016 109
1222 3300046539 Ga0495621_0005841 Ga0495621_0005841_1076_1420 109
1223 3300046539 Ga0495621_0044083 Ga0495621_0044083_237_581 109
1224 3300046539 Ga0495621_0434053 Ga0495621_0434053_19_363 109
1225 3300046558 Ga0495633_0110329 Ga0495633_0110329_884_1228 109
1226 3300046615 Ga0495656_0114507 Ga0495656_0114507_553_897 109
1227 3300046616 Ga0495668_0008250 Ga0495668_0008250_4215_4559 109
1228 3300046660 Ga0495625_0511517 Ga0495625_0511517_138_482 109
1229 3300046664 Ga0495659_0001113 Ga0495659_0001113_7796_8140 109
1230 3300046664 Ga0495659_0040579 Ga0495659_0040579_389_730 109
1231 3300046664 Ga0495659_0196851 Ga0495659_0196851_298_642 109
1232 3300046684 Ga0495669_0240717 Ga0495669_0240717_268_603 109
1233 3300046684 Ga0495669_0398454 Ga0495669_0398454_55_399 109
1234 3300046691 Ga0495670_0014133 Ga0495670_0014133_167_511 109
1235 3300046691 Ga0495670_0023539 Ga0495670_0023539_2301_2645 109
1236 3300046691 Ga0495670_0024033 Ga0495670_0024033_552_896 109
1237 3300046691 Ga0495670_0134689 Ga0495670_0134689_596_940 109
1238 3300047318 Ga0495636_0254482 Ga0495636_0254482_259_603 109
1239 3300047318 Ga0495636_0284738 Ga0495636_0284738_209_553 109
1240 3300047445 Ga0495677_0006386 Ga0495677_0006386_1803_2147 109
1241 3300048090 Ga0495615_0012934 Ga0495615_0012934_597_941 109
1242 3300048904 Ga0496101_1177680 Ga0496101_1177680_86_430 109
1243 3300048910 Ga0496107_0141643 Ga0496107_0141643_1239_1583 109
1244 3300048911 Ga0496108_0464043 Ga0496108_0464043_23_367 109
1245 3300048912 Ga0496109_0240402 Ga0496109_0240402_539_883 109
1246 3300048912 Ga0496109_1550992 Ga0496109_1550992_80_424 109
1247 3300048916 Ga0496113_0476347 Ga0496113_0476347_543_872 109
1248 3300048917 Ga0496114_0123441 Ga0496114_0123441_290_634 109
1249 3300049127 Ga0501306_014825 Ga0501306_014825_223_567 109
1250 3300049583 Ga0501067_0047522 Ga0501067_0047522_1084_1428 109
1251 3300049584 Ga0501068_0377522 Ga0501068_0377522_375_719 109
1252 3300049586 Ga0501070_0952938 Ga0501070_0952938_18_362 109
1253 3300049654 Ga0501207_017717 Ga0501207_017717_197_541 109
1254 3300049667 Ga0501230_075804 Ga0501230_075804_331_675 109
1255 3300049668 Ga0501233_035446 Ga0501233_035446_29_373 109
1256 3300049669 Ga0501235_095239 Ga0501235_095239_97_441 109
1257 3300049677 Ga0501247_015366 Ga0501247_015366_538_882 109
1258 3300049678 Ga0501248_023859 Ga0501248_023859_11_355 109
1259 3300049679 Ga0501249_007508 Ga0501249_007508_1335_1679 109
1260 3300049679 Ga0501249_076664 Ga0501249_076664_208_552 109
1261 3300049690 Ga0501261_106700 Ga0501261_106700_154_498 109
1262 3300049705 Ga0501225_0023288 Ga0501225_0023288_248_592 109
1263 3300049706 Ga0501229_041510 Ga0501229_041510_107_451 109
1264 3300049760 Ga0501263_085517 Ga0501263_085517_11_355 109
1265 3300049764 Ga0501267_038029 Ga0501267_038029_224_568 109
1266 3300049765 Ga0501268_010905 Ga0501268_010905_35_379 109
1267 3300049767 Ga0501270_027448 Ga0501270_027448_422_766 109
1268 3300049769 Ga0501272_020498 Ga0501272_020498_23_367 109
1269 3300049770 Ga0501273_060411 Ga0501273_060411_69_413 109
1270 3300049850 Ga0501204_076684 Ga0501204_076684_24_368 109
1271 3300050492 nmdc:mga0yw44_1107938_c1 nmdc:mga0yw44_1107938_c1_18_362 109
1272 3300050508 nmdc:mga09592_573334_c1 nmdc:mga09592_573334_c1_480_824 109
1273 3300050511 nmdc:mga08y16_1117587_c1 nmdc:mga08y16_1117587_c1_24_368 109
1274 3300050511 nmdc:mga08y16_151376_c1 nmdc:mga08y16_151376_c1_962_1306 109
1275 3300050511 nmdc:mga08y16_233218_c1 nmdc:mga08y16_233218_c1_1420_1764 109
1276 3300050512 nmdc:mga0n895_701010_c1 nmdc:mga0n895_701010_c1_54_398 109
1277 3300050515 nmdc:mga0a205_1315918_c1 nmdc:mga0a205_1315918_c1_137_481 109
1278 3300053134 Ga0500658_0000108 Ga0500658_0000108_5698_6042 109
1279 3300061719 Ga0466962_0003508 Ga0466962_0003508_3062_3406 109
1280 3300061734 Ga0530510_1451453 Ga0530510_1451453_16_360 109

Feature Viewer

pLDDT pTM Quality
70.48 0.3 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map