F492466
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1275 | 657 | 2550 | 261 |
Family's Representative Sequence
| Representative Sequence | 3300026075|Ga0207708_10168070|Ga0207708_101680702 |
| Length | 303 |
| Sequence | MRPDVVTFWHGPLDGLRLTCLRSQVAAGHNVTVYSFDPLPGLPDGVGNAEAEAILPHSFSERLRPPEPDGSWRDWTILQFSDFFRMRLMAERAGLWLDADVLLLKPIEIDPAKPYFAWERRRQLGNSVLYLPANDPIVRAFEELMEQEDLTPDWLALRHRLTFMLRQLRRRSSRLSDIRVAIYGPAALTALARRSDELQHALSKQSFYAVHAEPKLFFEPTDFSGLIADPEIIGLHISPKGRGGEKPIPGSLYAWAAEKFGLLGQQVLQKLYPLVEFPAQRLSPDRDALTSTLKAVPKPRSKW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 70 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 71 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 73 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 74 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 75 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 79 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 80 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 81 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 86 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 89 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 92 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 122 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 123 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 124 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 125 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 126 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 193 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 194 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 195 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 196 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 201 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 202 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 203 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 204 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 205 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 206 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 207 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 208 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 209 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 210 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 211 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 212 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 213 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 214 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 215 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 216 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 217 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 218 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 219 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 220 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 221 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 222 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 223 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 224 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 225 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 226 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 227 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 228 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 229 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 230 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 231 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 232 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 233 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 234 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 235 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 236 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 237 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 238 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 239 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 240 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 241 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 242 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 243 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 244 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 245 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 246 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 247 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 248 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 249 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 250 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 252 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 253 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 254 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 255 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 256 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 257 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 258 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 259 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 260 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 261 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 262 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 263 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 264 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 265 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 266 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 267 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 268 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 269 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 270 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 271 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 272 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 273 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 274 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 353 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 354 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 355 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 356 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 357 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 358 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 359 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 360 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 361 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 362 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 363 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 364 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 365 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 366 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 367 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 368 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 369 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 370 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 371 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 372 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 373 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 374 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 375 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 376 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 377 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 378 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 379 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 387 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 388 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 389 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 390 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 391 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 392 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 403 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 404 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 405 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 406 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 407 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 408 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 409 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 410 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 411 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 412 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 413 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 414 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 415 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 416 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 417 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 418 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 419 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 420 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 421 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 422 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 423 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 424 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 425 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 426 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 427 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 428 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 429 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 430 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 431 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 432 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 433 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 434 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 435 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 436 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 437 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 438 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 439 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 440 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 441 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 442 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 443 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 444 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 445 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 446 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 447 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 448 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 449 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 450 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 451 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 452 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 453 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 454 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 455 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 456 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 457 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 458 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 459 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 460 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 461 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 462 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 463 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 464 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 465 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 466 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 467 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 468 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 469 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 470 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 471 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 472 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 473 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 474 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 475 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 476 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 477 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 478 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 479 | 2791355199 | |||
| 480 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 481 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 482 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 483 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 484 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 485 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 486 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 487 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 488 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 489 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 490 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 491 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 492 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 493 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 494 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 495 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 496 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 497 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 498 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 499 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 500 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 501 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 502 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 503 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 504 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 505 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 506 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 507 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 508 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 509 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 510 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 511 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 512 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 513 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 514 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 515 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 516 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 517 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 518 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 519 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 520 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 521 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 522 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 523 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 524 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 525 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 526 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 527 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 528 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 529 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 530 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 531 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 532 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 533 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 534 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 535 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 536 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 537 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 538 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 539 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 540 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 541 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 542 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 543 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 544 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 545 | 2904699407 | |||
| 546 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 547 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 548 | 2906610324 | |||
| 549 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 550 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 551 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 552 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 553 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 554 | 2922368715 | |||
| 555 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 556 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 557 | 2922425934 | |||
| 558 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 559 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 560 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 561 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 562 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 563 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 564 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 565 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 566 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 567 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 568 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 569 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 570 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 571 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 572 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 573 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 574 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 575 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 576 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 577 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 578 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 579 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 580 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 581 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 582 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 583 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 584 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 585 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 586 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 587 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 588 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 589 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 590 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 591 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 592 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 593 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 594 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 595 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 596 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 597 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 598 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 599 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 600 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 601 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 602 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 603 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 604 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 605 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 606 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 607 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 608 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 609 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 610 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 611 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 612 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 613 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 614 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 615 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 616 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 617 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 618 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 619 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 620 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 621 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 622 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 623 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 624 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 625 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 626 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 627 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 628 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 629 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 630 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 631 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 632 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 633 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 634 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 635 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 636 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 637 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 638 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 639 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 640 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 641 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 642 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 643 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 644 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 645 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 646 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 647 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 648 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 649 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 650 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 651 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 652 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 653 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 654 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 655 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 656 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 657 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.86 |
| Metatranscriptomes | 0 |
| Isolates | 16.14 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.53 |
| Nodule | 12.94 |
| Rhizoplane | 6.27 |
| Rhizosphere | 60.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207708_10168070 | 3300026075 | Bacteria | 1735 |
| 2 | JGI24740J21852_10005020 | 3300001979 | Bacteria | 5618 |
| 3 | JGI24737J22298_10008460 | 3300001990 | Bacteria | 3441 |
| 4 | JGI25406J46586_10000915 | 3300003203 | Bacteria | 13864 |
| 5 | JGI25406J46586_10007375 | 3300003203 | Bacteria | 5021 |
| 6 | JGI25165J46597_1014680 | 3300003214 | Bacteria | 1064 |
| 7 | JGI25153J46596_10009437 | 3300003215 | Bacteria | 4534 |
| 8 | JGI25153J46596_10015245 | 3300003215 | Bacteria | 3144 |
| 9 | JGI25160J50197_1005997 | 3300003354 | Bacteria | 4978 |
| 10 | JGI25160J50197_1019333 | 3300003354 | Bacteria | 2091 |
| 11 | Ga0055539_1004550 | 3300003752 | Bacteria | 1842 |
| 12 | Ga0055531_10006765 | 3300003794 | Bacteria | 6412 |
| 13 | Ga0065165_1005936 | 3300005262 | Bacteria | 6613 |
| 14 | Ga0070658_10546748 | 3300005327 | Bacteria | 1002 |
| 15 | Ga0070676_10182125 | 3300005328 | Bacteria | 1366 |
| 16 | Ga0070683_100019475 | 3300005329 | Bacteria | 6027 |
| 17 | Ga0070690_100085911 | 3300005330 | Bacteria | 2064 |
| 18 | Ga0070670_100043583 | 3300005331 | Bacteria | 3856 |
| 19 | Ga0070670_100119653 | 3300005331 | Bacteria | 2271 |
| 20 | Ga0070670_100519945 | 3300005331 | Bacteria | 1060 |
| 21 | Ga0068869_100051564 | 3300005334 | Bacteria | 2985 |
| 22 | Ga0068869_100271958 | 3300005334 | Bacteria | 1360 |
| 23 | Ga0068869_100370751 | 3300005334 | Bacteria | 1171 |
| 24 | Ga0068869_100606099 | 3300005334 | Bacteria | 925 |
| 25 | Ga0068869_100683718 | 3300005334 | Bacteria | 874 |
| 26 | Ga0070680_100055433 | 3300005336 | Bacteria | 3239 |
| 27 | Ga0070680_100222463 | 3300005336 | Bacteria | 1593 |
| 28 | Ga0070660_100001075 | 3300005339 | Bacteria | 18360 |
| 29 | Ga0070660_100180794 | 3300005339 | Bacteria | 1706 |
| 30 | Ga0070660_100231833 | 3300005339 | Bacteria | 1502 |
| 31 | Ga0070689_100248673 | 3300005340 | Bacteria | 1466 |
| 32 | Ga0070691_10105060 | 3300005341 | Bacteria | 1407 |
| 33 | Ga0070687_100057024 | 3300005343 | Bacteria | 2046 |
| 34 | Ga0070661_100035628 | 3300005344 | Bacteria | 3614 |
| 35 | Ga0070661_100517174 | 3300005344 | Bacteria | 957 |
| 36 | Ga0070668_100188166 | 3300005347 | Bacteria | 1690 |
| 37 | Ga0070668_100228150 | 3300005347 | Bacteria | 1538 |
| 38 | Ga0070668_100313191 | 3300005347 | Bacteria | 1319 |
| 39 | Ga0070668_100550132 | 3300005347 | Bacteria | 1004 |
| 40 | Ga0070669_100071036 | 3300005353 | Bacteria | 2574 |
| 41 | Ga0070671_100165443 | 3300005355 | Bacteria | 1870 |
| 42 | Ga0070671_100514123 | 3300005355 | Bacteria | 1031 |
| 43 | Ga0070674_100188614 | 3300005356 | Bacteria | 1584 |
| 44 | Ga0070674_100350990 | 3300005356 | Bacteria | 1191 |
| 45 | Ga0070673_100243980 | 3300005364 | Bacteria | 1563 |
| 46 | Ga0070673_100332377 | 3300005364 | Bacteria | 1345 |
| 47 | Ga0070688_100238895 | 3300005365 | Bacteria | 1288 |
| 48 | Ga0070688_100362765 | 3300005365 | Bacteria | 1063 |
| 49 | Ga0070667_100261908 | 3300005367 | Bacteria | 1548 |
| 50 | Ga0070709_10007973 | 3300005434 | Bacteria | 5818 |
| 51 | Ga0070709_10025469 | 3300005434 | Bacteria | 3495 |
| 52 | Ga0070713_100016372 | 3300005436 | Bacteria | 5574 |
| 53 | Ga0070713_100040826 | 3300005436 | Bacteria | 3775 |
| 54 | Ga0070713_100046950 | 3300005436 | Bacteria | 3547 |
| 55 | Ga0070710_10002189 | 3300005437 | Bacteria | 9222 |
| 56 | Ga0070710_10017653 | 3300005437 | Bacteria | 3657 |
| 57 | Ga0070710_10053633 | 3300005437 | Bacteria | 2272 |
| 58 | Ga0070701_10271717 | 3300005438 | Bacteria | 1032 |
| 59 | Ga0070711_100001652 | 3300005439 | Bacteria | 12334 |
| 60 | Ga0070711_100020415 | 3300005439 | Bacteria | 4269 |
| 61 | Ga0070700_100127250 | 3300005441 | Bacteria | 1714 |
| 62 | Ga0070663_100044119 | 3300005455 | Bacteria | 3142 |
| 63 | Ga0070663_100046917 | 3300005455 | Bacteria | 3059 |
| 64 | Ga0070663_100072148 | 3300005455 | Bacteria | 2514 |
| 65 | Ga0070663_100168690 | 3300005455 | Bacteria | 1690 |
| 66 | Ga0070678_100120701 | 3300005456 | Bacteria | 2066 |
| 67 | Ga0070678_100123023 | 3300005456 | Bacteria | 2049 |
| 68 | Ga0070678_100134879 | 3300005456 | Bacteria | 1967 |
| 69 | Ga0070662_100094105 | 3300005457 | Bacteria | 2255 |
| 70 | Ga0070662_100328695 | 3300005457 | Bacteria | 1248 |
| 71 | Ga0070681_10009671 | 3300005458 | Bacteria | 9485 |
| 72 | Ga0070681_10025343 | 3300005458 | Bacteria | 5966 |
| 73 | Ga0068867_100195740 | 3300005459 | Bacteria | 1615 |
| 74 | Ga0068867_100509236 | 3300005459 | Bacteria | 1036 |
| 75 | Ga0070706_100167339 | 3300005467 | Bacteria | 2052 |
| 76 | Ga0070706_100430541 | 3300005467 | Bacteria | 1228 |
| 77 | Ga0070698_100041947 | 3300005471 | Bacteria | 4696 |
| 78 | Ga0070698_100555351 | 3300005471 | Bacteria | 1088 |
| 79 | Ga0070699_100142347 | 3300005518 | Bacteria | 2118 |
| 80 | Ga0070679_100019056 | 3300005530 | Bacteria | 6666 |
| 81 | Ga0070679_100045610 | 3300005530 | Bacteria | 4368 |
| 82 | Ga0070679_100048159 | 3300005530 | Bacteria | 4248 |
| 83 | Ga0070679_100108238 | 3300005530 | Bacteria | 2765 |
| 84 | Ga0070679_100481550 | 3300005530 | Bacteria | 1185 |
| 85 | Ga0070684_100007076 | 3300005535 | Bacteria | 8722 |
| 86 | Ga0070684_100011685 | 3300005535 | Bacteria | 7001 |
| 87 | Ga0070697_100013361 | 3300005536 | Bacteria | 6440 |
| 88 | Ga0068853_100052993 | 3300005539 | Bacteria | 3494 |
| 89 | Ga0068853_100210435 | 3300005539 | Bacteria | 1772 |
| 90 | Ga0068853_100302979 | 3300005539 | Bacteria | 1477 |
| 91 | Ga0070672_100109953 | 3300005543 | Bacteria | 2245 |
| 92 | Ga0070672_100153248 | 3300005543 | Bacteria | 1908 |
| 93 | Ga0070672_100217010 | 3300005543 | Bacteria | 1603 |
| 94 | Ga0070672_100376622 | 3300005543 | Bacteria | 1213 |
| 95 | Ga0070686_100197296 | 3300005544 | Bacteria | 1440 |
| 96 | Ga0070686_100269415 | 3300005544 | Bacteria | 1251 |
| 97 | Ga0070695_100286477 | 3300005545 | Bacteria | 1212 |
| 98 | Ga0070696_100485359 | 3300005546 | Bacteria | 980 |
| 99 | Ga0070665_100026811 | 3300005548 | Bacteria | 5804 |
| 100 | Ga0070665_100042207 | 3300005548 | Bacteria | 4584 |
| 101 | Ga0070665_100071603 | 3300005548 | Bacteria | 3473 |
| 102 | Ga0070665_100166368 | 3300005548 | Bacteria | 2207 |
| 103 | Ga0070665_100378656 | 3300005548 | Bacteria | 1422 |
| 104 | Ga0070665_100418995 | 3300005548 | Bacteria | 1348 |
| 105 | Ga0070665_100580881 | 3300005548 | Bacteria | 1133 |
| 106 | Ga0068855_100044373 | 3300005563 | Bacteria | 5261 |
| 107 | Ga0068855_100044540 | 3300005563 | Bacteria | 5250 |
| 108 | Ga0068855_100050100 | 3300005563 | Bacteria | 4922 |
| 109 | Ga0068855_100301187 | 3300005563 | Bacteria | 1775 |
| 110 | Ga0068855_100630919 | 3300005563 | Bacteria | 1153 |
| 111 | Ga0068855_100962064 | 3300005563 | Bacteria | 899 |
| 112 | Ga0070664_100158287 | 3300005564 | Bacteria | 2002 |
| 113 | Ga0070664_100325492 | 3300005564 | Bacteria | 1393 |
| 114 | Ga0070664_100463991 | 3300005564 | Bacteria | 1164 |
| 115 | Ga0068857_100008930 | 3300005577 | Bacteria | 8683 |
| 116 | Ga0068857_100013150 | 3300005577 | Bacteria | 7213 |
| 117 | Ga0068857_100022226 | 3300005577 | Bacteria | 5580 |
| 118 | Ga0068854_100018010 | 3300005578 | Bacteria | 4735 |
| 119 | Ga0068854_100028179 | 3300005578 | Bacteria | 3878 |
| 120 | Ga0068854_100352176 | 3300005578 | Bacteria | 1205 |
| 121 | Ga0068854_100437100 | 3300005578 | Bacteria | 1090 |
| 122 | Ga0068856_100013958 | 3300005614 | Bacteria | 7767 |
| 123 | Ga0068856_100037942 | 3300005614 | Bacteria | 4728 |
| 124 | Ga0068856_100042359 | 3300005614 | Bacteria | 4478 |
| 125 | Ga0068856_100261073 | 3300005614 | Bacteria | 1747 |
| 126 | Ga0068852_100076112 | 3300005616 | Bacteria | 2962 |
| 127 | Ga0068852_100082459 | 3300005616 | Bacteria | 2857 |
| 128 | Ga0068852_100092974 | 3300005616 | Bacteria | 2702 |
| 129 | Ga0068852_100118263 | 3300005616 | Bacteria | 2421 |
| 130 | Ga0068852_100934871 | 3300005616 | Bacteria | 885 |
| 131 | Ga0068859_100166910 | 3300005617 | Bacteria | 2281 |
| 132 | Ga0068859_100615841 | 3300005617 | Bacteria | 1178 |
| 133 | Ga0068859_100778995 | 3300005617 | Bacteria | 1045 |
| 134 | Ga0068864_100063118 | 3300005618 | Bacteria | 3210 |
| 135 | Ga0068864_100273938 | 3300005618 | Bacteria | 1573 |
| 136 | Ga0068866_10091135 | 3300005718 | Bacteria | 1660 |
| 137 | Ga0068861_100052851 | 3300005719 | Bacteria | 3089 |
| 138 | Ga0068861_100204526 | 3300005719 | Bacteria | 1659 |
| 139 | Ga0068851_10015565 | 3300005834 | Bacteria | 3626 |
| 140 | Ga0068851_10256226 | 3300005834 | Bacteria | 994 |
| 141 | Ga0068863_100170331 | 3300005841 | Bacteria | 2088 |
| 142 | Ga0068863_100214768 | 3300005841 | Bacteria | 1852 |
| 143 | Ga0068858_100064112 | 3300005842 | Bacteria | 3400 |
| 144 | Ga0068858_100110112 | 3300005842 | Bacteria | 2571 |
| 145 | Ga0068858_100127257 | 3300005842 | Bacteria | 2386 |
| 146 | Ga0068858_100317348 | 3300005842 | Bacteria | 1489 |
| 147 | Ga0068858_100412372 | 3300005842 | Bacteria | 1298 |
| 148 | Ga0068858_100534950 | 3300005842 | Bacteria | 1134 |
| 149 | Ga0068860_100000477 | 3300005843 | Bacteria | 49839 |
| 150 | Ga0068860_100148278 | 3300005843 | Bacteria | 2258 |
| 151 | Ga0068860_100428295 | 3300005843 | Bacteria | 1312 |
| 152 | Ga0068860_100586364 | 3300005843 | Bacteria | 1119 |
| 153 | Ga0068862_100233210 | 3300005844 | Bacteria | 1670 |
| 154 | Ga0068862_100402066 | 3300005844 | Bacteria | 1281 |
| 155 | Ga0081455_10017064 | 3300005937 | Bacteria | 6978 |
| 156 | Ga0081455_10019554 | 3300005937 | Bacteria | 6403 |
| 157 | Ga0081455_10079472 | 3300005937 | Bacteria | 2692 |
| 158 | Ga0081455_10365700 | 3300005937 | Bacteria | 1013 |
| 159 | Ga0081540_1001247 | 3300005983 | Bacteria | 22221 |
| 160 | Ga0081540_1006252 | 3300005983 | Bacteria | 8720 |
| 161 | Ga0081540_1007349 | 3300005983 | Bacteria | 7874 |
| 162 | Ga0081540_1009140 | 3300005983 | Bacteria | 6841 |
| 163 | Ga0081540_1011012 | 3300005983 | Bacteria | 6074 |
| 164 | Ga0081540_1014005 | 3300005983 | Bacteria | 5174 |
| 165 | Ga0081540_1023509 | 3300005983 | Bacteria | 3602 |
| 166 | Ga0081540_1029355 | 3300005983 | Bacteria | 3066 |
| 167 | Ga0081540_1036844 | 3300005983 | Bacteria | 2602 |
| 168 | Ga0081540_1042418 | 3300005983 | Bacteria | 2347 |
| 169 | Ga0081539_10000371 | 3300005985 | Bacteria | 98455 |
| 170 | Ga0081539_10003753 | 3300005985 | Bacteria | 18030 |
| 171 | Ga0081539_10027474 | 3300005985 | Bacteria | 3603 |
| 172 | Ga0081539_10033413 | 3300005985 | Bacteria | 3133 |
| 173 | Ga0070717_10007759 | 3300006028 | Bacteria | 7984 |
| 174 | Ga0070717_10010181 | 3300006028 | Bacteria | 7080 |
| 175 | Ga0070717_10217047 | 3300006028 | Bacteria | 1680 |
| 176 | Ga0070717_10676887 | 3300006028 | Bacteria | 937 |
| 177 | Ga0075365_10093004 | 3300006038 | Bacteria | 2056 |
| 178 | Ga0075365_10180396 | 3300006038 | Bacteria | 1476 |
| 179 | Ga0075365_10229685 | 3300006038 | Bacteria | 1302 |
| 180 | Ga0075365_10349106 | 3300006038 | Bacteria | 1043 |
| 181 | Ga0075368_10028196 | 3300006042 | Bacteria | 2168 |
| 182 | Ga0075363_100085594 | 3300006048 | Bacteria | 1729 |
| 183 | Ga0070715_10120031 | 3300006163 | Bacteria | 1252 |
| 184 | Ga0070716_100042649 | 3300006173 | Bacteria | 2533 |
| 185 | Ga0070716_100071251 | 3300006173 | Bacteria | 2043 |
| 186 | Ga0070716_100196355 | 3300006173 | Bacteria | 1338 |
| 187 | Ga0070712_100016641 | 3300006175 | Bacteria | 4751 |
| 188 | Ga0070712_100042188 | 3300006175 | Bacteria | 3137 |
| 189 | Ga0070712_100509458 | 3300006175 | Bacteria | 1010 |
| 190 | Ga0075362_10105188 | 3300006177 | Bacteria | 1323 |
| 191 | Ga0075367_10120046 | 3300006178 | Bacteria | 1619 |
| 192 | Ga0075369_10048814 | 3300006186 | Bacteria | 1827 |
| 193 | Ga0075369_10153452 | 3300006186 | Bacteria | 1053 |
| 194 | Ga0075366_10139489 | 3300006195 | Bacteria | 1465 |
| 195 | Ga0097621_100510710 | 3300006237 | Bacteria | 1090 |
| 196 | Ga0075370_10029972 | 3300006353 | Bacteria | 3033 |
| 197 | Ga0075370_10064727 | 3300006353 | Bacteria | 2085 |
| 198 | Ga0075370_10117821 | 3300006353 | Bacteria | 1544 |
| 199 | Ga0068871_100114354 | 3300006358 | Bacteria | 2273 |
| 200 | Ga0068871_100320516 | 3300006358 | Bacteria | 1365 |
| 201 | Ga0075430_100406551 | 3300006846 | Bacteria | 1124 |
| 202 | Ga0075436_100209016 | 3300006914 | Bacteria | 1383 |
| 203 | Ga0097620_100166923 | 3300006931 | Bacteria | 2281 |
| 204 | Ga0097620_100615817 | 3300006931 | Bacteria | 1178 |
| 205 | Ga0097620_100778902 | 3300006931 | Bacteria | 1045 |
| 206 | Ga0099824_1009377 | 3300006942 | Bacteria | 12072 |
| 207 | Ga0099822_1000918 | 3300006943 | Bacteria | 31646 |
| 208 | Ga0075435_100155550 | 3300007076 | Bacteria | 1923 |
| 209 | Ga0099794_10006185 | 3300007265 | Bacteria | 4835 |
| 210 | Ga0099795_10028449 | 3300007788 | Bacteria | 1901 |
| 211 | Ga0099795_10083578 | 3300007788 | Bacteria | 1226 |
| 212 | Ga0105240_10002459 | 3300009093 | Bacteria | 29768 |
| 213 | Ga0105240_10014175 | 3300009093 | Bacteria | 10888 |
| 214 | Ga0105240_10018930 | 3300009093 | Bacteria | 9221 |
| 215 | Ga0105240_10067208 | 3300009093 | Bacteria | 4443 |
| 216 | Ga0105240_10146885 | 3300009093 | Bacteria | 2813 |
| 217 | Ga0105240_10226877 | 3300009093 | Bacteria | 2173 |
| 218 | Ga0111539_10588126 | 3300009094 | Bacteria | 1296 |
| 219 | Ga0105245_10070499 | 3300009098 | Bacteria | 3172 |
| 220 | Ga0105245_10157149 | 3300009098 | Bacteria | 2154 |
| 221 | Ga0105245_10729078 | 3300009098 | Bacteria | 1026 |
| 222 | Ga0105247_10035861 | 3300009101 | Bacteria | 3024 |
| 223 | Ga0105247_10257752 | 3300009101 | Bacteria | 1195 |
| 224 | Ga0105243_10214772 | 3300009148 | Bacteria | 1696 |
| 225 | Ga0105243_10275979 | 3300009148 | Bacteria | 1512 |
| 226 | Ga0105243_10481613 | 3300009148 | Bacteria | 1171 |
| 227 | Ga0105241_10000249 | 3300009174 | Bacteria | 40643 |
| 228 | Ga0105241_10056480 | 3300009174 | Bacteria | 3010 |
| 229 | Ga0105241_10124868 | 3300009174 | Bacteria | 2077 |
| 230 | Ga0105241_10252866 | 3300009174 | Bacteria | 1495 |
| 231 | Ga0105241_10297611 | 3300009174 | Bacteria | 1384 |
| 232 | Ga0105241_10456533 | 3300009174 | Bacteria | 1131 |
| 233 | Ga0105242_10077591 | 3300009176 | Bacteria | 2771 |
| 234 | Ga0105242_10202597 | 3300009176 | Bacteria | 1763 |
| 235 | Ga0105242_10302464 | 3300009176 | Bacteria | 1460 |
| 236 | Ga0105242_10378730 | 3300009176 | Bacteria | 1315 |
| 237 | Ga0105248_10179660 | 3300009177 | Bacteria | 2385 |
| 238 | Ga0105248_10347956 | 3300009177 | Bacteria | 1669 |
| 239 | Ga0105248_10622950 | 3300009177 | Bacteria | 1217 |
| 240 | Ga0105237_10010653 | 3300009545 | Bacteria | 9769 |
| 241 | Ga0105237_10014068 | 3300009545 | Bacteria | 8372 |
| 242 | Ga0105237_10031484 | 3300009545 | Bacteria | 5378 |
| 243 | Ga0105237_10539836 | 3300009545 | Bacteria | 1173 |
| 244 | Ga0105237_10585533 | 3300009545 | Bacteria | 1123 |
| 245 | Ga0105238_10005612 | 3300009551 | Bacteria | 12402 |
| 246 | Ga0105238_10013147 | 3300009551 | Bacteria | 8352 |
| 247 | Ga0105238_10192759 | 3300009551 | Bacteria | 2014 |
| 248 | Ga0105238_10199327 | 3300009551 | Bacteria | 1977 |
| 249 | Ga0105238_10726259 | 3300009551 | Bacteria | 1006 |
| 250 | Ga0105249_10354188 | 3300009553 | Bacteria | 1488 |
| 251 | Ga0105249_10480084 | 3300009553 | Bacteria | 1286 |
| 252 | Ga0099796_10008025 | 3300010159 | Bacteria | 2793 |
| 253 | Ga0099796_10030133 | 3300010159 | Bacteria | 1757 |
| 254 | Ga0105239_10012784 | 3300010375 | Bacteria | 9339 |
| 255 | Ga0105239_10014648 | 3300010375 | Bacteria | 8695 |
| 256 | Ga0105239_10043484 | 3300010375 | Bacteria | 4924 |
| 257 | Ga0105239_10150620 | 3300010375 | Bacteria | 2596 |
| 258 | Ga0105239_10151693 | 3300010375 | Bacteria | 2586 |
| 259 | Ga0105239_10653470 | 3300010375 | Bacteria | 1201 |
| 260 | Ga0105239_10711510 | 3300010375 | Bacteria | 1149 |
| 261 | Ga0105246_10062059 | 3300011119 | Bacteria | 2602 |
| 262 | Ga0105246_10526915 | 3300011119 | Bacteria | 1008 |
| 263 | Ga0157373_10192907 | 3300013100 | Bacteria | 1435 |
| 264 | Ga0157370_10042620 | 3300013104 | Bacteria | 4372 |
| 265 | Ga0157370_10070601 | 3300013104 | Bacteria | 3296 |
| 266 | Ga0157369_10303761 | 3300013105 | Bacteria | 1660 |
| 267 | Ga0157369_10640652 | 3300013105 | Bacteria | 1096 |
| 268 | Ga0157374_10248139 | 3300013296 | Bacteria | 1751 |
| 269 | Ga0157378_10112031 | 3300013297 | Bacteria | 2502 |
| 270 | Ga0157378_10705296 | 3300013297 | Bacteria | 1029 |
| 271 | Ga0163162_10134527 | 3300013306 | Bacteria | 2583 |
| 272 | Ga0163162_10495698 | 3300013306 | Bacteria | 1352 |
| 273 | Ga0163162_10509196 | 3300013306 | Bacteria | 1334 |
| 274 | Ga0157372_10164183 | 3300013307 | Bacteria | 2568 |
| 275 | Ga0157375_10055933 | 3300013308 | Bacteria | 3892 |
| 276 | Ga0157375_10655909 | 3300013308 | Bacteria | 1205 |
| 277 | Ga0157375_10834080 | 3300013308 | Bacteria | 1069 |
| 278 | Ga0163163_10333035 | 3300014325 | Bacteria | 1573 |
| 279 | Ga0163163_10399415 | 3300014325 | Bacteria | 1433 |
| 280 | Ga0163163_10529979 | 3300014325 | Bacteria | 1240 |
| 281 | Ga0163163_10740892 | 3300014325 | Bacteria | 1046 |
| 282 | Ga0157380_10075144 | 3300014326 | Bacteria | 2746 |
| 283 | Ga0157380_10393906 | 3300014326 | Bacteria | 1311 |
| 284 | Ga0157377_10108853 | 3300014745 | Bacteria | 1663 |
| 285 | Ga0157379_10060438 | 3300014968 | Bacteria | 3388 |
| 286 | Ga0157379_10088121 | 3300014968 | Bacteria | 2783 |
| 287 | Ga0157379_10106961 | 3300014968 | Bacteria | 2511 |
| 288 | Ga0157379_10532480 | 3300014968 | Bacteria | 1091 |
| 289 | Ga0157376_10090409 | 3300014969 | Bacteria | 2649 |
| 290 | Ga0157376_10180325 | 3300014969 | Bacteria | 1930 |
| 291 | Ga0157376_10862356 | 3300014969 | Bacteria | 921 |
| 292 | Ga0163161_10210421 | 3300017792 | Bacteria | 1502 |
| 293 | Ga0214544_1000056 | 3300021320 | Bacteria | 132760 |
| 294 | Ga0214542_1000071 | 3300021321 | Bacteria | 124568 |
| 295 | Ga0214545_1000033 | 3300021324 | Bacteria | 124568 |
| 296 | Ga0214543_1000105 | 3300021327 | Bacteria | 108404 |
| 297 | Ga0213876_10142204 | 3300021384 | Bacteria | 1276 |
| 298 | Ga0207425_1019783 | 3300025245 | Bacteria | 1446 |
| 299 | Ga0209677_100170 | 3300025253 | Bacteria | 55896 |
| 300 | Ga0209677_111529 | 3300025253 | Bacteria | 1373 |
| 301 | Ga0209148_1000295 | 3300025254 | Bacteria | 73660 |
| 302 | Ga0209233_1001518 | 3300025261 | Bacteria | 9101 |
| 303 | Ga0209233_1008835 | 3300025261 | Bacteria | 3090 |
| 304 | Ga0209455_1001656 | 3300025272 | Bacteria | 9651 |
| 305 | Ga0209564_1006432 | 3300025295 | Bacteria | 6337 |
| 306 | Ga0209564_1014608 | 3300025295 | Bacteria | 3251 |
| 307 | Ga0209564_1015692 | 3300025295 | Bacteria | 3064 |
| 308 | Ga0209758_1000069 | 3300025297 | Bacteria | 286161 |
| 309 | Ga0209758_1000253 | 3300025297 | Bacteria | 107937 |
| 310 | Ga0209758_1000397 | 3300025297 | Bacteria | 75408 |
| 311 | Ga0209758_1007518 | 3300025297 | Bacteria | 7385 |
| 312 | Ga0209758_1011392 | 3300025297 | Bacteria | 5158 |
| 313 | Ga0209758_1050116 | 3300025297 | Bacteria | 1467 |
| 314 | Ga0209758_1061866 | 3300025297 | Bacteria | 1229 |
| 315 | Ga0209758_1084644 | 3300025297 | Bacteria | 947 |
| 316 | Ga0209256_1007295 | 3300025299 | Bacteria | 5504 |
| 317 | Ga0209256_1025105 | 3300025299 | Bacteria | 1742 |
| 318 | Ga0209256_1034456 | 3300025299 | Bacteria | 1347 |
| 319 | Ga0207426_1001927 | 3300025302 | Bacteria | 14934 |
| 320 | Ga0207426_1002760 | 3300025302 | Bacteria | 10609 |
| 321 | Ga0207426_1005115 | 3300025302 | Bacteria | 6119 |
| 322 | Ga0207426_1005770 | 3300025302 | Bacteria | 5562 |
| 323 | Ga0207426_1028628 | 3300025302 | Bacteria | 1845 |
| 324 | Ga0209257_1005744 | 3300025304 | Bacteria | 8484 |
| 325 | Ga0207697_10040431 | 3300025315 | Bacteria | 1915 |
| 326 | Ga0207656_10016880 | 3300025321 | Bacteria | 2849 |
| 327 | Ga0207682_10116352 | 3300025893 | Bacteria | 1182 |
| 328 | Ga0207692_10004175 | 3300025898 | Bacteria | 5703 |
| 329 | Ga0207692_10103730 | 3300025898 | Bacteria | 1566 |
| 330 | Ga0207710_10146216 | 3300025900 | Bacteria | 1144 |
| 331 | Ga0207688_10104785 | 3300025901 | Bacteria | 1637 |
| 332 | Ga0207688_10211785 | 3300025901 | Bacteria | 1165 |
| 333 | Ga0207647_10016684 | 3300025904 | Bacteria | 5006 |
| 334 | Ga0207699_10005583 | 3300025906 | Bacteria | 6034 |
| 335 | Ga0207699_10096190 | 3300025906 | Bacteria | 1869 |
| 336 | Ga0207699_10178181 | 3300025906 | Bacteria | 1427 |
| 337 | Ga0207645_10161208 | 3300025907 | Bacteria | 1467 |
| 338 | Ga0207705_10088303 | 3300025909 | Bacteria | 2268 |
| 339 | Ga0207684_10238619 | 3300025910 | Bacteria | 1568 |
| 340 | Ga0207684_10309523 | 3300025910 | Bacteria | 1362 |
| 341 | Ga0207684_10401479 | 3300025910 | Bacteria | 1178 |
| 342 | Ga0207654_10000083 | 3300025911 | Bacteria | 62205 |
| 343 | Ga0207654_10178892 | 3300025911 | Bacteria | 1382 |
| 344 | Ga0207654_10242604 | 3300025911 | Bacteria | 1205 |
| 345 | Ga0207707_10000445 | 3300025912 | Bacteria | 42982 |
| 346 | Ga0207707_10001947 | 3300025912 | Bacteria | 18789 |
| 347 | Ga0207707_10004159 | 3300025912 | Bacteria | 12822 |
| 348 | Ga0207707_10243457 | 3300025912 | Bacteria | 1563 |
| 349 | Ga0207695_10000148 | 3300025913 | Bacteria | 208344 |
| 350 | Ga0207695_10000387 | 3300025913 | Bacteria | 99734 |
| 351 | Ga0207695_10106551 | 3300025913 | Bacteria | 2789 |
| 352 | Ga0207695_10205773 | 3300025913 | Bacteria | 1881 |
| 353 | Ga0207695_10304020 | 3300025913 | Bacteria | 1486 |
| 354 | Ga0207671_10095512 | 3300025914 | Bacteria | 2245 |
| 355 | Ga0207671_10119710 | 3300025914 | Bacteria | 2012 |
| 356 | Ga0207671_10176774 | 3300025914 | Bacteria | 1660 |
| 357 | Ga0207671_10210814 | 3300025914 | Bacteria | 1520 |
| 358 | Ga0207671_10273577 | 3300025914 | Bacteria | 1331 |
| 359 | Ga0207693_10020364 | 3300025915 | Bacteria | 5277 |
| 360 | Ga0207693_10026947 | 3300025915 | Bacteria | 4546 |
| 361 | Ga0207663_10005695 | 3300025916 | Bacteria | 6303 |
| 362 | Ga0207663_10006822 | 3300025916 | Bacteria | 5878 |
| 363 | Ga0207663_10015460 | 3300025916 | Bacteria | 4211 |
| 364 | Ga0207663_10371474 | 3300025916 | Bacteria | 1087 |
| 365 | Ga0207660_10074471 | 3300025917 | Bacteria | 2478 |
| 366 | Ga0207657_10003784 | 3300025919 | Bacteria | 16083 |
| 367 | Ga0207657_10062344 | 3300025919 | Bacteria | 3193 |
| 368 | Ga0207657_10238087 | 3300025919 | Bacteria | 1454 |
| 369 | Ga0207649_10092828 | 3300025920 | Bacteria | 1980 |
| 370 | Ga0207649_10159508 | 3300025920 | Bacteria | 1562 |
| 371 | Ga0207652_10076415 | 3300025921 | Bacteria | 2921 |
| 372 | Ga0207652_10095479 | 3300025921 | Bacteria | 2619 |
| 373 | Ga0207652_10405291 | 3300025921 | Bacteria | 1230 |
| 374 | Ga0207694_10000121 | 3300025924 | Bacteria | 83123 |
| 375 | Ga0207694_10160471 | 3300025924 | Bacteria | 1816 |
| 376 | Ga0207694_10304916 | 3300025924 | Bacteria | 1312 |
| 377 | Ga0207694_10389554 | 3300025924 | Bacteria | 1158 |
| 378 | Ga0207650_10286628 | 3300025925 | Bacteria | 1342 |
| 379 | Ga0207659_10123545 | 3300025926 | Bacteria | 1987 |
| 380 | Ga0207687_10049484 | 3300025927 | Bacteria | 2922 |
| 381 | Ga0207687_10151184 | 3300025927 | Bacteria | 1772 |
| 382 | Ga0207700_10019025 | 3300025928 | Bacteria | 4631 |
| 383 | Ga0207700_10100327 | 3300025928 | Bacteria | 2307 |
| 384 | Ga0207700_10371070 | 3300025928 | Bacteria | 1249 |
| 385 | Ga0207664_10114185 | 3300025929 | Bacteria | 2250 |
| 386 | Ga0207644_10284042 | 3300025931 | Bacteria | 1329 |
| 387 | Ga0207644_10440591 | 3300025931 | Bacteria | 1069 |
| 388 | Ga0207644_10615744 | 3300025931 | Bacteria | 902 |
| 389 | Ga0207706_10210582 | 3300025933 | Bacteria | 1704 |
| 390 | Ga0207706_10351551 | 3300025933 | Bacteria | 1281 |
| 391 | Ga0207706_10371531 | 3300025933 | Bacteria | 1242 |
| 392 | Ga0207706_10383472 | 3300025933 | Bacteria | 1219 |
| 393 | Ga0207686_10303706 | 3300025934 | Bacteria | 1186 |
| 394 | Ga0207686_10345265 | 3300025934 | Bacteria | 1119 |
| 395 | Ga0207686_10346993 | 3300025934 | Bacteria | 1116 |
| 396 | Ga0207709_10073054 | 3300025935 | Bacteria | 2184 |
| 397 | Ga0207709_10250846 | 3300025935 | Bacteria | 1292 |
| 398 | Ga0207709_10579158 | 3300025935 | Bacteria | 886 |
| 399 | Ga0207669_10022383 | 3300025937 | Bacteria | 3356 |
| 400 | Ga0207665_10012221 | 3300025939 | Bacteria | 5639 |
| 401 | Ga0207665_10092979 | 3300025939 | Bacteria | 2093 |
| 402 | Ga0207665_10147019 | 3300025939 | Bacteria | 1685 |
| 403 | Ga0207665_10201037 | 3300025939 | Bacteria | 1452 |
| 404 | Ga0207691_10121306 | 3300025940 | Bacteria | 2317 |
| 405 | Ga0207691_10270284 | 3300025940 | Bacteria | 1464 |
| 406 | Ga0207711_10310718 | 3300025941 | Bacteria | 1455 |
| 407 | Ga0207711_10315009 | 3300025941 | Bacteria | 1445 |
| 408 | Ga0207711_10800516 | 3300025941 | Bacteria | 878 |
| 409 | Ga0207689_10069376 | 3300025942 | Bacteria | 2896 |
| 410 | Ga0207689_10093451 | 3300025942 | Bacteria | 2470 |
| 411 | Ga0207689_10130195 | 3300025942 | Bacteria | 2071 |
| 412 | Ga0207661_10011706 | 3300025944 | Bacteria | 6367 |
| 413 | Ga0207661_10141606 | 3300025944 | Bacteria | 2070 |
| 414 | Ga0207679_10101728 | 3300025945 | Bacteria | 2248 |
| 415 | Ga0207679_10235615 | 3300025945 | Bacteria | 1548 |
| 416 | Ga0207679_10278286 | 3300025945 | Bacteria | 1434 |
| 417 | Ga0207667_10059290 | 3300025949 | Bacteria | 4009 |
| 418 | Ga0207667_10095652 | 3300025949 | Bacteria | 3066 |
| 419 | Ga0207667_10107566 | 3300025949 | Bacteria | 2877 |
| 420 | Ga0207667_10724014 | 3300025949 | Bacteria | 996 |
| 421 | Ga0207651_10392804 | 3300025960 | Bacteria | 1178 |
| 422 | Ga0207712_10281001 | 3300025961 | Bacteria | 1359 |
| 423 | Ga0207668_10077201 | 3300025972 | Bacteria | 2400 |
| 424 | Ga0207640_10116432 | 3300025981 | Bacteria | 1905 |
| 425 | Ga0207640_10410167 | 3300025981 | Bacteria | 1106 |
| 426 | Ga0207658_10150570 | 3300025986 | Bacteria | 1895 |
| 427 | Ga0207677_10044527 | 3300026023 | Bacteria | 2958 |
| 428 | Ga0207677_10298398 | 3300026023 | Bacteria | 1330 |
| 429 | Ga0207703_10104482 | 3300026035 | Bacteria | 2407 |
| 430 | Ga0207703_10201723 | 3300026035 | Bacteria | 1768 |
| 431 | Ga0207639_10066593 | 3300026041 | Bacteria | 2800 |
| 432 | Ga0207639_10109567 | 3300026041 | Bacteria | 2247 |
| 433 | Ga0207639_10240029 | 3300026041 | Bacteria | 1575 |
| 434 | Ga0207639_10338609 | 3300026041 | Bacteria | 1341 |
| 435 | Ga0207678_10017660 | 3300026067 | Bacteria | 6263 |
| 436 | Ga0207678_10102578 | 3300026067 | Bacteria | 2442 |
| 437 | Ga0207678_10235186 | 3300026067 | Bacteria | 1569 |
| 438 | Ga0207678_10331728 | 3300026067 | Bacteria | 1310 |
| 439 | Ga0207678_10435100 | 3300026067 | Bacteria | 1139 |
| 440 | Ga0207708_10197943 | 3300026075 | Bacteria | 1602 |
| 441 | Ga0207702_10000004 | 3300026078 | Bacteria | 422182 |
| 442 | Ga0207702_10010411 | 3300026078 | Bacteria | 7783 |
| 443 | Ga0207702_10164524 | 3300026078 | Bacteria | 2028 |
| 444 | Ga0207702_10402873 | 3300026078 | Bacteria | 1320 |
| 445 | Ga0207641_10368481 | 3300026088 | Bacteria | 1373 |
| 446 | Ga0207648_10043666 | 3300026089 | Bacteria | 3935 |
| 447 | Ga0207648_10348684 | 3300026089 | Bacteria | 1334 |
| 448 | Ga0207676_10118366 | 3300026095 | Bacteria | 2229 |
| 449 | Ga0207674_10005754 | 3300026116 | Bacteria | 14710 |
| 450 | Ga0207674_10051030 | 3300026116 | Bacteria | 4223 |
| 451 | Ga0207674_10060831 | 3300026116 | Bacteria | 3818 |
| 452 | Ga0207675_100066332 | 3300026118 | Bacteria | 3373 |
| 453 | Ga0207675_100227027 | 3300026118 | Bacteria | 1800 |
| 454 | Ga0207675_100581960 | 3300026118 | Bacteria | 1121 |
| 455 | Ga0207683_10120243 | 3300026121 | Bacteria | 2357 |
| 456 | Ga0207683_10152798 | 3300026121 | Bacteria | 2084 |
| 457 | Ga0207683_10245760 | 3300026121 | Bacteria | 1632 |
| 458 | Ga0207683_10268193 | 3300026121 | Bacteria | 1559 |
| 459 | Ga0207683_10452079 | 3300026121 | Bacteria | 1184 |
| 460 | Ga0207683_10475670 | 3300026121 | Bacteria | 1153 |
| 461 | Ga0207698_10055584 | 3300026142 | Bacteria | 3052 |
| 462 | Ga0207698_10062251 | 3300026142 | Bacteria | 2913 |
| 463 | Ga0207698_10092809 | 3300026142 | Bacteria | 2476 |
| 464 | Ga0209389_1000157 | 3300027296 | Bacteria | 56696 |
| 465 | Ga0209589_1000035 | 3300027357 | Bacteria | 134091 |
| 466 | Ga0209489_100079 | 3300027361 | Bacteria | 134091 |
| 467 | Ga0209489_101111 | 3300027361 | Bacteria | 54702 |
| 468 | Ga0209489_108314 | 3300027361 | Bacteria | 14326 |
| 469 | Ga0209700_100011 | 3300027363 | Bacteria | 362159 |
| 470 | Ga0209700_100077 | 3300027363 | Bacteria | 134091 |
| 471 | Ga0209813_10103818 | 3300027866 | Bacteria | 970 |
| 472 | Ga0268266_10001236 | 3300028379 | Bacteria | 31292 |
| 473 | Ga0268266_10017196 | 3300028379 | Bacteria | 6175 |
| 474 | Ga0268266_10024061 | 3300028379 | Bacteria | 5183 |
| 475 | Ga0268266_10115835 | 3300028379 | Bacteria | 2380 |
| 476 | Ga0268266_10207072 | 3300028379 | Bacteria | 1797 |
| 477 | Ga0268266_10295642 | 3300028379 | Bacteria | 1509 |
| 478 | Ga0268266_10370197 | 3300028379 | Bacteria | 1349 |
| 479 | Ga0268265_10235020 | 3300028380 | Bacteria | 1613 |
| 480 | Ga0268265_10284298 | 3300028380 | Bacteria | 1481 |
| 481 | Ga0268265_10314928 | 3300028380 | Bacteria | 1414 |
| 482 | Ga0268264_10000062 | 3300028381 | Bacteria | 302110 |
| 483 | Ga0265326_10032836 | 3300028558 | Bacteria | 1478 |
| 484 | Ga0265334_10057274 | 3300028573 | Bacteria | 1477 |
| 485 | Ga0265323_10002052 | 3300028653 | Bacteria | 9454 |
| 486 | Ga0265336_10001641 | 3300028666 | Bacteria | 9917 |
| 487 | Ga0307517_10000175 | 3300028786 | Bacteria | 105567 |
| 488 | Ga0307515_10042883 | 3300028794 | Bacteria | 7056 |
| 489 | Ga0265338_10001066 | 3300028800 | Bacteria | 45588 |
| 490 | Ga0307511_10090017 | 3300030521 | Bacteria | 2087 |
| 491 | Ga0265330_10029710 | 3300031235 | Bacteria | 2456 |
| 492 | Ga0265330_10058641 | 3300031235 | Bacteria | 1678 |
| 493 | Ga0265332_10012261 | 3300031238 | Bacteria | 3803 |
| 494 | Ga0265328_10080363 | 3300031239 | Bacteria | 1201 |
| 495 | Ga0265325_10076700 | 3300031241 | Bacteria | 1667 |
| 496 | Ga0265340_10030670 | 3300031247 | Bacteria | 2694 |
| 497 | Ga0265339_10000738 | 3300031249 | Bacteria | 25301 |
| 498 | Ga0265339_10031597 | 3300031249 | Bacteria | 2991 |
| 499 | Ga0265331_10019666 | 3300031250 | Bacteria | 3483 |
| 500 | Ga0265316_10100380 | 3300031344 | Bacteria | 2200 |
| 501 | Ga0307513_10094234 | 3300031456 | Bacteria | 3040 |
| 502 | Ga0307509_10038191 | 3300031507 | Bacteria | 5240 |
| 503 | Ga0307508_10040818 | 3300031616 | Bacteria | 4166 |
| 504 | Ga0307508_10062296 | 3300031616 | Bacteria | 3293 |
| 505 | Ga0307508_10175097 | 3300031616 | Bacteria | 1748 |
| 506 | Ga0265314_10010574 | 3300031711 | Bacteria | 7681 |
| 507 | Ga0265314_10011119 | 3300031711 | Bacteria | 7459 |
| 508 | Ga0265314_10150027 | 3300031711 | Bacteria | 1431 |
| 509 | Ga0265314_10212342 | 3300031711 | Bacteria | 1136 |
| 510 | Ga0265342_10008380 | 3300031712 | Bacteria | 7418 |
| 511 | Ga0265342_10129631 | 3300031712 | Bacteria | 1414 |
| 512 | Ga0307516_10065364 | 3300031730 | Bacteria | 3513 |
| 513 | Ga0307516_10110468 | 3300031730 | Bacteria | 2553 |
| 514 | Ga0307405_10081471 | 3300031731 | Bacteria | 2116 |
| 515 | Ga0307405_10101218 | 3300031731 | Bacteria | 1933 |
| 516 | Ga0307410_10108325 | 3300031852 | Bacteria | 2006 |
| 517 | Ga0307412_10397853 | 3300031911 | Bacteria | 1120 |
| 518 | Ga0307414_10053559 | 3300032004 | Bacteria | 2815 |
| 519 | Ga0307411_10144646 | 3300032005 | Bacteria | 1758 |
| 520 | Ga0307415_100277040 | 3300032126 | Bacteria | 1377 |
| 521 | Ga0307415_100341699 | 3300032126 | Bacteria | 1256 |
| 522 | Ga0307507_10057529 | 3300033179 | Bacteria | 3661 |
| 523 | Ga0307510_10013138 | 3300033180 | Bacteria | 9823 |
| 524 | Ga0307510_10014518 | 3300033180 | Bacteria | 9322 |
| 525 | Ga0307510_10188060 | 3300033180 | Bacteria | 1617 |
| 526 | Ga0307510_10281329 | 3300033180 | Bacteria | 1134 |
| 527 | Ga0315911_1000008 | 3300033442 | Bacteria | 381285 |
| 528 | Ga0373926_0040287 | 3300035083 | Bacteria | 1667 |
| 529 | Ga0373929_0020069 | 3300035085 | Bacteria | 1344 |
| 530 | Ga0373934_0000780 | 3300035086 | Bacteria | 11447 |
| 531 | Ga0373934_0080894 | 3300035086 | Bacteria | 1305 |
| 532 | Ga0373923_0014616 | 3300035111 | Bacteria | 2952 |
| 533 | Ga0373936_0021542 | 3300035113 | Bacteria | 2507 |
| 534 | Ga0373945_0006256 | 3300035116 | Bacteria | 3834 |
| 535 | Ga0373953_0004338 | 3300035117 | Bacteria | 4513 |
| 536 | Ga0373953_0010472 | 3300035117 | Bacteria | 3229 |
| 537 | Ga0373953_0074161 | 3300035117 | Bacteria | 1407 |
| 538 | Ga0373954_0002052 | 3300035118 | Bacteria | 8373 |
| 539 | Ga0373954_0045857 | 3300035118 | Bacteria | 2042 |
| 540 | Ga0373954_0076967 | 3300035118 | Bacteria | 1591 |
| 541 | Ga0373956_0001732 | 3300035119 | Bacteria | 8991 |
| 542 | Ga0373956_0042301 | 3300035119 | Bacteria | 2025 |
| 543 | Ga0373957_0024130 | 3300035120 | Bacteria | 2181 |
| 544 | Ga0373943_0004587 | 3300035170 | Bacteria | 6242 |
| 545 | Ga0373943_0030231 | 3300035170 | Bacteria | 2563 |
| 546 | Ga0373943_0046469 | 3300035170 | Bacteria | 2119 |
| 547 | Ga0373946_0001716 | 3300035171 | Bacteria | 7640 |
| 548 | Ga0373955_0022637 | 3300035172 | Bacteria | 3190 |
| 549 | Ga0373955_0045630 | 3300035172 | Bacteria | 2365 |
| 550 | Ga0373961_0030269 | 3300035241 | Bacteria | 1505 |
| 551 | Ga0373935_0030701 | 3300035692 | Bacteria | 3331 |
| 552 | Ga0373935_0031532 | 3300035692 | Bacteria | 3290 |
| 553 | Ga0373935_0109190 | 3300035692 | Bacteria | 1834 |
| 554 | Ga0373935_0304249 | 3300035692 | Bacteria | 1128 |
| 555 | Ga0373927_0001064 | 3300035695 | Bacteria | 20972 |
| 556 | Ga0373927_0001972 | 3300035695 | Bacteria | 15136 |
| 557 | Ga0373927_0010111 | 3300035695 | Bacteria | 6313 |
| 558 | Ga0373927_0010444 | 3300035695 | Bacteria | 6189 |
| 559 | Ga0373927_0134807 | 3300035695 | Bacteria | 1613 |
| 560 | Ga0373927_0240830 | 3300035695 | Bacteria | 1189 |
| 561 | Ga0373933_0000068 | 3300035724 | Bacteria | 63195 |
| 562 | Ga0373933_0001999 | 3300035724 | Bacteria | 11767 |
| 563 | Ga0373933_0063756 | 3300035724 | Bacteria | 2228 |
| 564 | Ga0373933_0083825 | 3300035724 | Bacteria | 1958 |
| 565 | Ga0373933_0087959 | 3300035724 | Bacteria | 1914 |
| 566 | Ga0373947_0002167 | 3300035725 | Bacteria | 11925 |
| 567 | Ga0373947_0011961 | 3300035725 | Bacteria | 4972 |
| 568 | Ga0373947_0019455 | 3300035725 | Bacteria | 3915 |
| 569 | Ga0373947_0048102 | 3300035725 | Bacteria | 2558 |
| 570 | Ga0373937_0043074 | 3300036401 | Bacteria | 4120 |
| 571 | Ga0373937_0283010 | 3300036401 | Bacteria | 1566 |
| 572 | Ga0373937_0357620 | 3300036401 | Bacteria | 1383 |
| 573 | Ga0373925_0022749 | 3300037068 | Bacteria | 4573 |
| 574 | Ga0373925_0053231 | 3300037068 | Bacteria | 3025 |
| 575 | Ga0373925_0075368 | 3300037068 | Bacteria | 2556 |
| 576 | Ga0373925_0079530 | 3300037068 | Bacteria | 2491 |
| 577 | Ga0395900_0006757 | 3300037418 | Bacteria | 11904 |
| 578 | Ga0395898_0016369 | 3300037466 | Bacteria | 7589 |
| 579 | Ga0395905_0001948 | 3300037471 | Bacteria | 23653 |
| 580 | Ga0395905_0302388 | 3300037471 | Bacteria | 1487 |
| 581 | Ga0395905_0408093 | 3300037471 | Bacteria | 1254 |
| 582 | Ga0395905_0439600 | 3300037471 | Bacteria | 1202 |
| 583 | Ga0395901_0079195 | 3300038443 | Bacteria | 3431 |
| 584 | Ga0395901_0263302 | 3300038443 | Bacteria | 1794 |
| 585 | Ga0395901_0572591 | 3300038443 | Bacteria | 1142 |
| 586 | Ga0436365_0112616 | 3300039437 | Bacteria | 4886 |
| 587 | Ga0436365_0572660 | 3300039437 | Bacteria | 2254 |
| 588 | Ga0436360_0046295 | 3300039438 | Bacteria | 2933 |
| 589 | Ga0436360_0435233 | 3300039438 | Bacteria | 1136 |
| 590 | Ga0436361_0430718 | 3300039447 | Bacteria | 3841 |
| 591 | Ga0436363_0702892 | 3300039450 | Bacteria | 2351 |
| 592 | Ga0436363_0977790 | 3300039450 | Bacteria | 7072 |
| 593 | Ga0436362_0237800 | 3300039453 | Bacteria | 2255 |
| 594 | Ga0436362_1039149 | 3300039453 | Bacteria | 2513 |
| 595 | Ga0451807_0848413 | 3300041486 | Bacteria | 893 |
| 596 | Ga0451841_0221733 | 3300041498 | Bacteria | 854 |
| 597 | Ga0466969_0016565 | 3300044656 | Bacteria | 3855 |
| 598 | Ga0466969_0199813 | 3300044656 | Bacteria | 912 |
| 599 | Ga0466972_0002927 | 3300044658 | Bacteria | 8463 |
| 600 | Ga0466965_0142381 | 3300044683 | Bacteria | 1249 |
| 601 | Ga0466966_0004373 | 3300044684 | Bacteria | 9318 |
| 602 | Ga0466961_0000709 | 3300044693 | Bacteria | 20961 |
| 603 | Ga0466963_0048779 | 3300044694 | Bacteria | 2799 |
| 604 | Ga0466963_0100195 | 3300044694 | Bacteria | 1982 |
| 605 | Ga0466963_0242140 | 3300044694 | Bacteria | 1265 |
| 606 | Ga0466964_0274297 | 3300044706 | Bacteria | 840 |
| 607 | Ga0466968_0122276 | 3300044735 | Bacteria | 1178 |
| 608 | Ga0466970_0111188 | 3300044765 | Bacteria | 1496 |
| 609 | Ga0466960_0166054 | 3300044901 | Bacteria | 1188 |
| 610 | Ga0466960_0201586 | 3300044901 | Bacteria | 1087 |
| 611 | Ga0466959_0003898 | 3300045049 | Bacteria | 9905 |
| 612 | Ga0466959_0073096 | 3300045049 | Bacteria | 2481 |
| 613 | Ga0466958_0054521 | 3300045836 | Bacteria | 2425 |
| 614 | Ga0495617_029845 | 3300046452 | Bacteria | 1833 |
| 615 | Ga0495592_0012829 | 3300046454 | Bacteria | 6371 |
| 616 | Ga0495592_0117103 | 3300046454 | Bacteria | 1879 |
| 617 | Ga0495592_0223526 | 3300046454 | Bacteria | 1257 |
| 618 | Ga0495592_0237127 | 3300046454 | Bacteria | 1212 |
| 619 | Ga0495603_0005523 | 3300046455 | Bacteria | 7543 |
| 620 | Ga0495603_0022697 | 3300046455 | Bacteria | 3797 |
| 621 | Ga0495603_0028072 | 3300046455 | Bacteria | 3394 |
| 622 | Ga0495603_0047068 | 3300046455 | Bacteria | 2569 |
| 623 | Ga0495603_0092711 | 3300046455 | Bacteria | 1765 |
| 624 | Ga0495590_0104751 | 3300046457 | Bacteria | 1007 |
| 625 | Ga0495629_0003619 | 3300046459 | Bacteria | 11680 |
| 626 | Ga0495629_0014105 | 3300046459 | Bacteria | 5757 |
| 627 | Ga0495629_0026528 | 3300046459 | Bacteria | 4115 |
| 628 | Ga0495629_0083584 | 3300046459 | Bacteria | 2228 |
| 629 | Ga0495638_0027840 | 3300046460 | Bacteria | 3655 |
| 630 | Ga0495638_0041939 | 3300046460 | Bacteria | 2892 |
| 631 | Ga0495641_0002985 | 3300046461 | Bacteria | 12986 |
| 632 | Ga0495641_0105705 | 3300046461 | Bacteria | 1256 |
| 633 | Ga0495651_0022801 | 3300046462 | Bacteria | 4867 |
| 634 | Ga0495651_0029728 | 3300046462 | Bacteria | 4260 |
| 635 | Ga0495651_0076698 | 3300046462 | Bacteria | 2531 |
| 636 | Ga0495651_0332985 | 3300046462 | Bacteria | 1008 |
| 637 | Ga0495653_0001635 | 3300046463 | Bacteria | 17593 |
| 638 | Ga0495653_0019937 | 3300046463 | Bacteria | 5435 |
| 639 | Ga0495580_0001546 | 3300046472 | Bacteria | 20242 |
| 640 | Ga0495582_0000535 | 3300046473 | Bacteria | 20995 |
| 641 | Ga0495582_0015124 | 3300046473 | Bacteria | 4244 |
| 642 | Ga0495582_0035512 | 3300046473 | Bacteria | 2742 |
| 643 | Ga0495582_0066499 | 3300046473 | Bacteria | 1992 |
| 644 | Ga0495605_0110771 | 3300046474 | Bacteria | 1253 |
| 645 | Ga0495639_0001501 | 3300046475 | Bacteria | 10399 |
| 646 | Ga0495639_0022686 | 3300046475 | Bacteria | 2754 |
| 647 | Ga0495639_0075670 | 3300046475 | Bacteria | 1561 |
| 648 | Ga0495639_0076497 | 3300046475 | Bacteria | 1553 |
| 649 | Ga0495639_0147813 | 3300046475 | Bacteria | 1132 |
| 650 | Ga0495662_0000510 | 3300046476 | Bacteria | 17683 |
| 651 | Ga0495664_0006101 | 3300046477 | Bacteria | 6651 |
| 652 | Ga0495664_0016598 | 3300046477 | Bacteria | 4197 |
| 653 | Ga0495664_0126000 | 3300046477 | Bacteria | 1549 |
| 654 | Ga0495664_0143413 | 3300046477 | Bacteria | 1448 |
| 655 | Ga0495584_0176996 | 3300046491 | Bacteria | 1084 |
| 656 | Ga0495594_0000467 | 3300046499 | Bacteria | 20554 |
| 657 | Ga0495594_0051805 | 3300046499 | Bacteria | 2259 |
| 658 | Ga0495594_0185764 | 3300046499 | Bacteria | 1184 |
| 659 | Ga0495594_0189732 | 3300046499 | Bacteria | 1171 |
| 660 | Ga0495596_0063658 | 3300046500 | Bacteria | 1435 |
| 661 | Ga0495596_0117617 | 3300046500 | Bacteria | 1032 |
| 662 | Ga0495607_0062876 | 3300046501 | Bacteria | 2102 |
| 663 | Ga0495607_0128050 | 3300046501 | Bacteria | 1325 |
| 664 | Ga0495583_0052132 | 3300046506 | Bacteria | 1863 |
| 665 | Ga0495583_0176440 | 3300046506 | Bacteria | 876 |
| 666 | Ga0495606_0000831 | 3300046507 | Bacteria | 46699 |
| 667 | Ga0495606_0038505 | 3300046507 | Bacteria | 3234 |
| 668 | Ga0495608_0018999 | 3300046511 | Bacteria | 4736 |
| 669 | Ga0495608_0044574 | 3300046511 | Bacteria | 2960 |
| 670 | Ga0495608_0081839 | 3300046511 | Bacteria | 2097 |
| 671 | Ga0495610_0016195 | 3300046512 | Bacteria | 4303 |
| 672 | Ga0495610_0048587 | 3300046512 | Bacteria | 2082 |
| 673 | Ga0495618_0047715 | 3300046514 | Bacteria | 2703 |
| 674 | Ga0495620_0051841 | 3300046515 | Bacteria | 1745 |
| 675 | Ga0495620_0117379 | 3300046515 | Bacteria | 1051 |
| 676 | Ga0495628_0061000 | 3300046516 | Bacteria | 2958 |
| 677 | Ga0495628_0105392 | 3300046516 | Bacteria | 2172 |
| 678 | Ga0495628_0151294 | 3300046516 | Bacteria | 1768 |
| 679 | Ga0495630_0009913 | 3300046517 | Bacteria | 6861 |
| 680 | Ga0495630_0076688 | 3300046517 | Bacteria | 2519 |
| 681 | Ga0495630_0278762 | 3300046517 | Bacteria | 1277 |
| 682 | Ga0495630_0418479 | 3300046517 | Bacteria | 1027 |
| 683 | Ga0495643_0020700 | 3300046522 | Bacteria | 3787 |
| 684 | Ga0495644_0101563 | 3300046523 | Bacteria | 1088 |
| 685 | Ga0495648_0002812 | 3300046524 | Bacteria | 15664 |
| 686 | Ga0495648_0027211 | 3300046524 | Bacteria | 3833 |
| 687 | Ga0495648_0053583 | 3300046524 | Bacteria | 2443 |
| 688 | Ga0495648_0067554 | 3300046524 | Bacteria | 2090 |
| 689 | Ga0495648_0082316 | 3300046524 | Bacteria | 1827 |
| 690 | Ga0495648_0213126 | 3300046524 | Bacteria | 958 |
| 691 | Ga0495666_0008155 | 3300046526 | Bacteria | 5252 |
| 692 | Ga0495652_0020210 | 3300046529 | Bacteria | 5919 |
| 693 | Ga0495652_0059935 | 3300046529 | Bacteria | 3218 |
| 694 | Ga0495652_0073765 | 3300046529 | Bacteria | 2840 |
| 695 | Ga0495652_0075106 | 3300046529 | Bacteria | 2809 |
| 696 | Ga0495652_0110030 | 3300046529 | Bacteria | 2217 |
| 697 | Ga0495652_0192054 | 3300046529 | Bacteria | 1557 |
| 698 | Ga0495654_0015350 | 3300046530 | Bacteria | 4068 |
| 699 | Ga0495665_0000128 | 3300046531 | Bacteria | 36043 |
| 700 | Ga0495665_0046233 | 3300046531 | Bacteria | 2312 |
| 701 | Ga0495640_0007295 | 3300046533 | Bacteria | 8711 |
| 702 | Ga0495640_0007536 | 3300046533 | Bacteria | 8553 |
| 703 | Ga0495640_0018011 | 3300046533 | Bacteria | 5251 |
| 704 | Ga0495640_0034708 | 3300046533 | Bacteria | 3573 |
| 705 | Ga0495640_0139408 | 3300046533 | Bacteria | 1564 |
| 706 | Ga0495640_0146778 | 3300046533 | Bacteria | 1517 |
| 707 | Ga0495586_0085311 | 3300046535 | Bacteria | 1740 |
| 708 | Ga0495587_0005610 | 3300046536 | Bacteria | 8189 |
| 709 | Ga0495587_0031355 | 3300046536 | Bacteria | 3219 |
| 710 | Ga0495587_0137669 | 3300046536 | Bacteria | 1394 |
| 711 | Ga0495621_0077626 | 3300046539 | Bacteria | 1233 |
| 712 | Ga0495597_0108909 | 3300046542 | Bacteria | 1163 |
| 713 | Ga0495597_0127204 | 3300046542 | Bacteria | 1059 |
| 714 | Ga0495645_0064772 | 3300046543 | Bacteria | 2644 |
| 715 | Ga0495645_0148321 | 3300046543 | Bacteria | 1632 |
| 716 | Ga0495645_0164715 | 3300046543 | Bacteria | 1530 |
| 717 | Ga0495645_0274347 | 3300046543 | Bacteria | 1112 |
| 718 | Ga0495645_0304727 | 3300046543 | Bacteria | 1039 |
| 719 | Ga0495622_0008565 | 3300046557 | Bacteria | 4740 |
| 720 | Ga0495622_0026867 | 3300046557 | Bacteria | 2686 |
| 721 | Ga0495622_0035907 | 3300046557 | Bacteria | 2311 |
| 722 | Ga0495622_0053041 | 3300046557 | Bacteria | 1881 |
| 723 | Ga0495667_0010575 | 3300046559 | Bacteria | 6244 |
| 724 | Ga0495656_0023665 | 3300046615 | Bacteria | 2419 |
| 725 | Ga0495656_0138886 | 3300046615 | Bacteria | 1163 |
| 726 | Ga0495668_0045650 | 3300046616 | Bacteria | 2436 |
| 727 | Ga0495634_0011829 | 3300046642 | Bacteria | 6346 |
| 728 | Ga0495634_0020602 | 3300046642 | Bacteria | 4674 |
| 729 | Ga0495634_0032241 | 3300046642 | Bacteria | 3604 |
| 730 | Ga0495634_0060513 | 3300046642 | Bacteria | 2519 |
| 731 | Ga0495634_0158476 | 3300046642 | Bacteria | 1428 |
| 732 | Ga0495634_0264793 | 3300046642 | Bacteria | 1048 |
| 733 | Ga0495611_0077935 | 3300046648 | Bacteria | 1520 |
| 734 | Ga0495625_0059794 | 3300046660 | Bacteria | 2702 |
| 735 | Ga0495625_0341590 | 3300046660 | Bacteria | 948 |
| 736 | Ga0495635_0017402 | 3300046663 | Bacteria | 5021 |
| 737 | Ga0495635_0037977 | 3300046663 | Bacteria | 3333 |
| 738 | Ga0495635_0076564 | 3300046663 | Bacteria | 2292 |
| 739 | Ga0495635_0208653 | 3300046663 | Bacteria | 1323 |
| 740 | Ga0495659_0011312 | 3300046664 | Bacteria | 2875 |
| 741 | Ga0495661_0096740 | 3300046665 | Bacteria | 1669 |
| 742 | Ga0495661_0098835 | 3300046665 | Bacteria | 1646 |
| 743 | Ga0495588_0002722 | 3300046674 | Bacteria | 7577 |
| 744 | Ga0495588_0050332 | 3300046674 | Bacteria | 2143 |
| 745 | Ga0495588_0059466 | 3300046674 | Bacteria | 1977 |
| 746 | Ga0495588_0079867 | 3300046674 | Bacteria | 1707 |
| 747 | Ga0495588_0085186 | 3300046674 | Bacteria | 1652 |
| 748 | Ga0495657_0019410 | 3300046675 | Bacteria | 4904 |
| 749 | Ga0495657_0029086 | 3300046675 | Bacteria | 3878 |
| 750 | Ga0495657_0087691 | 3300046675 | Bacteria | 2002 |
| 751 | Ga0495657_0142917 | 3300046675 | Bacteria | 1490 |
| 752 | Ga0495599_0000562 | 3300046678 | Bacteria | 21198 |
| 753 | Ga0495599_0034765 | 3300046678 | Bacteria | 3165 |
| 754 | Ga0495599_0202726 | 3300046678 | Bacteria | 1218 |
| 755 | Ga0495623_0021634 | 3300046679 | Bacteria | 4153 |
| 756 | Ga0495623_0039103 | 3300046679 | Bacteria | 3032 |
| 757 | Ga0495623_0106377 | 3300046679 | Bacteria | 1704 |
| 758 | Ga0495646_0023262 | 3300046680 | Bacteria | 3902 |
| 759 | Ga0495646_0030160 | 3300046680 | Bacteria | 3387 |
| 760 | Ga0495646_0058421 | 3300046680 | Bacteria | 2306 |
| 761 | Ga0495646_0071204 | 3300046680 | Bacteria | 2046 |
| 762 | Ga0495646_0117774 | 3300046680 | Bacteria | 1506 |
| 763 | Ga0495647_0000600 | 3300046681 | Bacteria | 10656 |
| 764 | Ga0495658_0001083 | 3300046683 | Bacteria | 14340 |
| 765 | Ga0495658_0086125 | 3300046683 | Bacteria | 1853 |
| 766 | Ga0495658_0423370 | 3300046683 | Bacteria | 849 |
| 767 | Ga0495669_0016067 | 3300046684 | Bacteria | 3205 |
| 768 | Ga0495669_0068699 | 3300046684 | Bacteria | 1612 |
| 769 | Ga0495669_0083607 | 3300046684 | Bacteria | 1467 |
| 770 | Ga0495669_0092101 | 3300046684 | Bacteria | 1400 |
| 771 | Ga0495613_0005438 | 3300046689 | Bacteria | 9568 |
| 772 | Ga0495613_0043339 | 3300046689 | Bacteria | 3329 |
| 773 | Ga0495613_0081991 | 3300046689 | Bacteria | 2343 |
| 774 | Ga0495613_0256649 | 3300046689 | Bacteria | 1219 |
| 775 | Ga0495624_0005136 | 3300046690 | Bacteria | 9454 |
| 776 | Ga0495624_0157631 | 3300046690 | Bacteria | 1387 |
| 777 | Ga0495624_0199746 | 3300046690 | Bacteria | 1215 |
| 778 | Ga0495624_0254433 | 3300046690 | Bacteria | 1062 |
| 779 | Ga0495624_0337989 | 3300046690 | Bacteria | 906 |
| 780 | Ga0495670_0073193 | 3300046691 | Bacteria | 1736 |
| 781 | Ga0495670_0100722 | 3300046691 | Bacteria | 1487 |
| 782 | Ga0495649_0018602 | 3300046694 | Bacteria | 3906 |
| 783 | Ga0495649_0255742 | 3300046694 | Bacteria | 899 |
| 784 | Ga0495600_0016680 | 3300046809 | Bacteria | 4666 |
| 785 | Ga0495600_0022095 | 3300046809 | Bacteria | 4082 |
| 786 | Ga0495600_0038517 | 3300046809 | Bacteria | 3111 |
| 787 | Ga0495600_0202794 | 3300046809 | Bacteria | 1273 |
| 788 | Ga0495600_0220838 | 3300046809 | Bacteria | 1212 |
| 789 | Ga0495581_0003213 | 3300047315 | Bacteria | 9361 |
| 790 | Ga0495581_0139297 | 3300047315 | Bacteria | 1415 |
| 791 | Ga0495604_0006935 | 3300047317 | Bacteria | 8979 |
| 792 | Ga0495604_0021826 | 3300047317 | Bacteria | 5111 |
| 793 | Ga0495604_0036266 | 3300047317 | Bacteria | 3887 |
| 794 | Ga0495604_0082745 | 3300047317 | Bacteria | 2399 |
| 795 | Ga0495604_0220791 | 3300047317 | Bacteria | 1305 |
| 796 | Ga0495604_0329013 | 3300047317 | Bacteria | 1020 |
| 797 | Ga0495604_0333719 | 3300047317 | Bacteria | 1011 |
| 798 | Ga0495674_0010035 | 3300047319 | Bacteria | 8975 |
| 799 | Ga0495674_0034718 | 3300047319 | Bacteria | 4557 |
| 800 | Ga0495674_0036341 | 3300047319 | Bacteria | 4434 |
| 801 | Ga0495674_0102980 | 3300047319 | Bacteria | 2427 |
| 802 | Ga0495674_0206151 | 3300047319 | Bacteria | 1630 |
| 803 | Ga0495674_0314206 | 3300047319 | Bacteria | 1278 |
| 804 | Ga0495672_0047426 | 3300047320 | Bacteria | 2555 |
| 805 | Ga0495672_0109929 | 3300047320 | Bacteria | 1481 |
| 806 | Ga0495676_0007949 | 3300047321 | Bacteria | 9724 |
| 807 | Ga0495676_0030366 | 3300047321 | Bacteria | 4588 |
| 808 | Ga0495676_0032842 | 3300047321 | Bacteria | 4377 |
| 809 | Ga0495680_0009468 | 3300047322 | Bacteria | 8758 |
| 810 | Ga0495680_0064965 | 3300047322 | Bacteria | 2796 |
| 811 | Ga0495683_0068905 | 3300047323 | Bacteria | 1739 |
| 812 | Ga0495687_033438 | 3300047443 | Bacteria | 2332 |
| 813 | Ga0495675_0003041 | 3300047444 | Bacteria | 10085 |
| 814 | Ga0495675_0106695 | 3300047444 | Bacteria | 1750 |
| 815 | Ga0495675_0130282 | 3300047444 | Bacteria | 1564 |
| 816 | Ga0495675_0320784 | 3300047444 | Bacteria | 916 |
| 817 | Ga0495673_0112638 | 3300047469 | Bacteria | 1086 |
| 818 | Ga0495684_0005455 | 3300047471 | Bacteria | 9899 |
| 819 | Ga0495684_0008298 | 3300047471 | Bacteria | 8046 |
| 820 | Ga0495684_0030796 | 3300047471 | Bacteria | 4119 |
| 821 | Ga0495684_0044813 | 3300047471 | Bacteria | 3385 |
| 822 | Ga0495686_0128372 | 3300047472 | Bacteria | 1505 |
| 823 | Ga0495593_0006937 | 3300047673 | Bacteria | 6634 |
| 824 | Ga0495593_0037818 | 3300047673 | Bacteria | 2608 |
| 825 | Ga0495593_0113872 | 3300047673 | Bacteria | 1380 |
| 826 | Ga0495602_0014209 | 3300048088 | Bacteria | 8091 |
| 827 | Ga0495602_0018054 | 3300048088 | Bacteria | 7057 |
| 828 | Ga0495602_0114893 | 3300048088 | Bacteria | 2178 |
| 829 | Ga0495602_0227954 | 3300048088 | Bacteria | 1402 |
| 830 | Ga0495615_0013748 | 3300048090 | Bacteria | 1697 |
| 831 | Ga0496100_0075974 | 3300048903 | Bacteria | 2254 |
| 832 | Ga0496100_0191984 | 3300048903 | Bacteria | 1483 |
| 833 | Ga0496100_0415744 | 3300048903 | Bacteria | 1026 |
| 834 | Ga0496100_0417219 | 3300048903 | Bacteria | 1024 |
| 835 | Ga0496101_0008819 | 3300048904 | Bacteria | 6598 |
| 836 | Ga0496101_0061673 | 3300048904 | Bacteria | 2724 |
| 837 | Ga0496101_0175729 | 3300048904 | Bacteria | 1647 |
| 838 | Ga0496101_0218671 | 3300048904 | Bacteria | 1478 |
| 839 | Ga0496101_0322261 | 3300048904 | Bacteria | 1212 |
| 840 | Ga0496101_0453340 | 3300048904 | Bacteria | 1012 |
| 841 | Ga0496102_0041671 | 3300048905 | Bacteria | 4159 |
| 842 | Ga0496102_0047085 | 3300048905 | Bacteria | 3917 |
| 843 | Ga0496102_0081377 | 3300048905 | Bacteria | 2986 |
| 844 | Ga0496102_0085911 | 3300048905 | Bacteria | 2905 |
| 845 | Ga0496102_0099110 | 3300048905 | Bacteria | 2704 |
| 846 | Ga0496102_0155050 | 3300048905 | Bacteria | 2153 |
| 847 | Ga0496102_0208937 | 3300048905 | Bacteria | 1840 |
| 848 | Ga0496102_0511275 | 3300048905 | Bacteria | 1123 |
| 849 | Ga0496103_0020714 | 3300048906 | Bacteria | 3953 |
| 850 | Ga0496104_0035714 | 3300048907 | Bacteria | 4642 |
| 851 | Ga0496104_0060516 | 3300048907 | Bacteria | 3587 |
| 852 | Ga0496104_0217985 | 3300048907 | Bacteria | 1820 |
| 853 | Ga0496104_0533738 | 3300048907 | Bacteria | 1084 |
| 854 | Ga0496104_0669214 | 3300048907 | Bacteria | 946 |
| 855 | Ga0496105_0005233 | 3300048908 | Bacteria | 9834 |
| 856 | Ga0496105_0171778 | 3300048908 | Bacteria | 1777 |
| 857 | Ga0496105_0187475 | 3300048908 | Bacteria | 1692 |
| 858 | Ga0496105_0210354 | 3300048908 | Bacteria | 1585 |
| 859 | Ga0496106_0001075 | 3300048909 | Bacteria | 20159 |
| 860 | Ga0496106_0006134 | 3300048909 | Bacteria | 8889 |
| 861 | Ga0496106_0033686 | 3300048909 | Bacteria | 3823 |
| 862 | Ga0496106_0034614 | 3300048909 | Bacteria | 3774 |
| 863 | Ga0496106_0057839 | 3300048909 | Bacteria | 2933 |
| 864 | Ga0496106_0120607 | 3300048909 | Bacteria | 2049 |
| 865 | Ga0496106_0337226 | 3300048909 | Bacteria | 1210 |
| 866 | Ga0496107_0002790 | 3300048910 | Bacteria | 11524 |
| 867 | Ga0496107_0017396 | 3300048910 | Bacteria | 5057 |
| 868 | Ga0496107_0111336 | 3300048910 | Bacteria | 2012 |
| 869 | Ga0496107_0275636 | 3300048910 | Bacteria | 1252 |
| 870 | Ga0496107_0291473 | 3300048910 | Bacteria | 1215 |
| 871 | Ga0496108_0000309 | 3300048911 | Bacteria | 41957 |
| 872 | Ga0496108_0016858 | 3300048911 | Bacteria | 5971 |
| 873 | Ga0496108_0028705 | 3300048911 | Bacteria | 4603 |
| 874 | Ga0496108_0121021 | 3300048911 | Bacteria | 2245 |
| 875 | Ga0496109_0000229 | 3300048912 | Bacteria | 54733 |
| 876 | Ga0496109_0091231 | 3300048912 | Bacteria | 2817 |
| 877 | Ga0496109_0106392 | 3300048912 | Bacteria | 2605 |
| 878 | Ga0496109_0153961 | 3300048912 | Bacteria | 2153 |
| 879 | Ga0496110_0011598 | 3300048913 | Bacteria | 7224 |
| 880 | Ga0496110_0034064 | 3300048913 | Bacteria | 4409 |
| 881 | Ga0496110_0038809 | 3300048913 | Bacteria | 4145 |
| 882 | Ga0496110_0138627 | 3300048913 | Bacteria | 2199 |
| 883 | Ga0496110_0275666 | 3300048913 | Bacteria | 1531 |
| 884 | Ga0496110_0359658 | 3300048913 | Bacteria | 1326 |
| 885 | Ga0496111_0011315 | 3300048914 | Bacteria | 6006 |
| 886 | Ga0496111_0131148 | 3300048914 | Bacteria | 1854 |
| 887 | Ga0496111_0265065 | 3300048914 | Bacteria | 1274 |
| 888 | Ga0496112_0000018 | 3300048915 | Bacteria | 188820 |
| 889 | Ga0496112_0053970 | 3300048915 | Bacteria | 3948 |
| 890 | Ga0496112_0074725 | 3300048915 | Bacteria | 3351 |
| 891 | Ga0496112_0143302 | 3300048915 | Bacteria | 2358 |
| 892 | Ga0496112_0157177 | 3300048915 | Bacteria | 2240 |
| 893 | Ga0496112_0455207 | 3300048915 | Bacteria | 1217 |
| 894 | Ga0496112_0722640 | 3300048915 | Bacteria | 923 |
| 895 | Ga0496113_0024174 | 3300048916 | Bacteria | 4315 |
| 896 | Ga0496113_0033720 | 3300048916 | Bacteria | 3730 |
| 897 | Ga0496113_0201756 | 3300048916 | Bacteria | 1581 |
| 898 | Ga0496113_0212151 | 3300048916 | Bacteria | 1541 |
| 899 | Ga0496114_0380658 | 3300048917 | Bacteria | 1249 |
| 900 | Ga0496114_0468702 | 3300048917 | Bacteria | 1115 |
| 901 | Ga0496115_0011619 | 3300048918 | Bacteria | 6606 |
| 902 | Ga0496115_0036077 | 3300048918 | Bacteria | 3913 |
| 903 | Ga0496115_0082294 | 3300048918 | Bacteria | 2622 |
| 904 | Ga0496115_0106272 | 3300048918 | Bacteria | 2304 |
| 905 | Ga0496115_0154204 | 3300048918 | Bacteria | 1897 |
| 906 | Ga0496115_0302273 | 3300048918 | Bacteria | 1311 |
| 907 | Ga0496115_0400346 | 3300048918 | Bacteria | 1114 |
| 908 | Ga0496116_0007008 | 3300048919 | Bacteria | 10091 |
| 909 | Ga0496116_0064921 | 3300048919 | Bacteria | 2344 |
| 910 | Ga0496116_0118276 | 3300048919 | Bacteria | 1540 |
| 911 | Ga0496117_0121490 | 3300048920 | Bacteria | 1603 |
| 912 | Ga0496118_0001623 | 3300048921 | Bacteria | 33200 |
| 913 | Ga0496118_0046366 | 3300048921 | Bacteria | 3382 |
| 914 | Ga0496119_0185423 | 3300048922 | Bacteria | 1088 |
| 915 | Ga0496120_0034831 | 3300048923 | Bacteria | 3012 |
| 916 | Ga0496120_0219111 | 3300048923 | Bacteria | 910 |
| 917 | Ga0496120_0246496 | 3300048923 | Bacteria | 841 |
| 918 | Ga0496121_0000278 | 3300048924 | Bacteria | 106838 |
| 919 | Ga0496121_0001257 | 3300048924 | Bacteria | 43906 |
| 920 | Ga0496121_0071161 | 3300048924 | Bacteria | 2798 |
| 921 | Ga0496121_0093161 | 3300048924 | Bacteria | 2346 |
| 922 | Ga0496121_0142647 | 3300048924 | Bacteria | 1774 |
| 923 | Ga0496121_0259554 | 3300048924 | Bacteria | 1200 |
| 924 | Ga0496121_0292090 | 3300048924 | Bacteria | 1110 |
| 925 | Ga0496122_0011998 | 3300048925 | Bacteria | 8690 |
| 926 | Ga0496122_0039152 | 3300048925 | Bacteria | 3784 |
| 927 | Ga0496123_0030316 | 3300048926 | Bacteria | 3961 |
| 928 | Ga0496124_0003799 | 3300048927 | Bacteria | 18136 |
| 929 | Ga0496124_0155417 | 3300048927 | Bacteria | 1789 |
| 930 | Ga0496124_0301611 | 3300048927 | Bacteria | 1157 |
| 931 | Ga0496124_0343759 | 3300048927 | Bacteria | 1058 |
| 932 | Ga0496125_0054026 | 3300048928 | Bacteria | 3287 |
| 933 | Ga0496125_0082443 | 3300048928 | Bacteria | 2451 |
| 934 | Ga0496125_0107960 | 3300048928 | Bacteria | 2026 |
| 935 | Ga0496125_0140980 | 3300048928 | Bacteria | 1676 |
| 936 | Ga0496126_0003267 | 3300048929 | Bacteria | 20694 |
| 937 | Ga0496126_0003347 | 3300048929 | Bacteria | 20346 |
| 938 | Ga0496126_0009942 | 3300048929 | Bacteria | 10046 |
| 939 | Ga0496126_0013009 | 3300048929 | Bacteria | 8491 |
| 940 | Ga0496126_0194593 | 3300048929 | Bacteria | 1715 |
| 941 | Ga0496126_0199109 | 3300048929 | Bacteria | 1692 |
| 942 | Ga0496126_0360942 | 3300048929 | Bacteria | 1186 |
| 943 | Ga0501046_0522547 | 3300049580 | Bacteria | 848 |
| 944 | Ga0501047_0006910 | 3300049581 | Bacteria | 10662 |
| 945 | Ga0501067_0026967 | 3300049583 | Bacteria | 3182 |
| 946 | Ga0501067_0076036 | 3300049583 | Bacteria | 1860 |
| 947 | Ga0501070_0004413 | 3300049586 | Bacteria | 12077 |
| 948 | Ga0501073_0128745 | 3300049589 | Bacteria | 1755 |
| 949 | Ga0501074_0041688 | 3300049590 | Bacteria | 3323 |
| 950 | Ga0501080_0044907 | 3300049742 | Bacteria | 4112 |
| 951 | nmdc:mga03n38_13142_c1 | 3300050490 | Bacteria | 3136 |
| 952 | nmdc:mga03n38_167578_c1 | 3300050490 | Bacteria | 1116 |
| 953 | nmdc:mga03n38_47675_c1 | 3300050490 | Bacteria | 1897 |
| 954 | nmdc:mga00v17_200478_c1 | 3300050491 | Bacteria | 1290 |
| 955 | nmdc:mga0yw44_115572_c1 | 3300050492 | Bacteria | 1724 |
| 956 | nmdc:mga0yw44_167396_c1 | 3300050492 | Bacteria | 1442 |
| 957 | nmdc:mga0yw44_176725_c1 | 3300050492 | Bacteria | 1404 |
| 958 | nmdc:mga0yw44_210893_c1 | 3300050492 | Bacteria | 1285 |
| 959 | nmdc:mga06z11_228314_c1 | 3300050494 | Bacteria | 1090 |
| 960 | nmdc:mga06z11_39634_c1 | 3300050494 | Bacteria | 2346 |
| 961 | nmdc:mga06z11_72147_c1 | 3300050494 | Bacteria | 1830 |
| 962 | nmdc:mga04h51_48171_c1 | 3300050495 | Bacteria | 1419 |
| 963 | nmdc:mga07m45_76209_c1 | 3300050496 | Bacteria | 1912 |
| 964 | nmdc:mga0qj67_388766_c1 | 3300050509 | Bacteria | 1126 |
| 965 | nmdc:mga08y16_172453_c1 | 3300050511 | Bacteria | 2247 |
| 966 | nmdc:mga0n895_380753_c1 | 3300050512 | Bacteria | 1428 |
| 967 | nmdc:mga0n895_87550_c1 | 3300050512 | Bacteria | 3112 |
| 968 | nmdc:mga0rr50_373787_c1 | 3300050513 | Bacteria | 1201 |
| 969 | nmdc:mga08x19_228219_c1 | 3300050514 | Bacteria | 1281 |
| 970 | Ga0495601_0039160 | 3300053077 | Bacteria | 2968 |
| 971 | Ga0495601_0072161 | 3300053077 | Bacteria | 2205 |
| 972 | Ga0495601_0135490 | 3300053077 | Bacteria | 1605 |
| 973 | Ga0495612_0023765 | 3300053078 | Bacteria | 2460 |
| 974 | Ga0495612_0036891 | 3300053078 | Bacteria | 1984 |
| 975 | Ga0495655_0039782 | 3300053083 | Bacteria | 1194 |
| 976 | Ga0495655_0058366 | 3300053083 | Bacteria | 1045 |
| 977 | Ga0495595_0068269 | 3300053084 | Bacteria | 1676 |
| 978 | Ga0495595_0167678 | 3300053084 | Bacteria | 1086 |
| 979 | Ga0495619_0014255 | 3300053085 | Bacteria | 5021 |
| 980 | Ga0495619_0014580 | 3300053085 | Bacteria | 4965 |
| 981 | Ga0495619_0253404 | 3300053085 | Bacteria | 1220 |
| 982 | Ga0500578_0126053 | 3300053086 | Bacteria | 1608 |
| 983 | Ga0500578_0360674 | 3300053086 | Bacteria | 847 |
| 984 | Ga0500643_000076 | 3300053087 | Bacteria | 106911 |
| 985 | Ga0500646_0024650 | 3300053090 | Bacteria | 1620 |
| 986 | Ga0500647_0155035 | 3300053091 | Bacteria | 1066 |
| 987 | Ga0500583_0195420 | 3300053092 | Bacteria | 1006 |
| 988 | Ga0500651_0117439 | 3300053093 | Bacteria | 1618 |
| 989 | Ga0500566_0000107 | 3300053094 | Bacteria | 42130 |
| 990 | Ga0500566_0000277 | 3300053094 | Bacteria | 27736 |
| 991 | Ga0500566_0027098 | 3300053094 | Bacteria | 3354 |
| 992 | Ga0500566_0141784 | 3300053094 | Bacteria | 1274 |
| 993 | Ga0500641_0008698 | 3300053096 | Bacteria | 3631 |
| 994 | Ga0500641_0025456 | 3300053096 | Bacteria | 2289 |
| 995 | Ga0500641_0037408 | 3300053096 | Bacteria | 1946 |
| 996 | Ga0500641_0092760 | 3300053096 | Bacteria | 1290 |
| 997 | Ga0500650_0000600 | 3300053098 | Bacteria | 9375 |
| 998 | Ga0500554_001768 | 3300053102 | Bacteria | 4170 |
| 999 | Ga0500555_023671 | 3300053103 | Bacteria | 1761 |
| 1000 | Ga0500556_0000081 | 3300053104 | Bacteria | 90508 |
| 1001 | Ga0500556_0017598 | 3300053104 | Bacteria | 2243 |
| 1002 | Ga0500557_000102 | 3300053105 | Bacteria | 26497 |
| 1003 | Ga0500562_004092 | 3300053108 | Bacteria | 3676 |
| 1004 | Ga0500572_000551 | 3300053111 | Bacteria | 12753 |
| 1005 | Ga0500592_005464 | 3300053116 | Bacteria | 2024 |
| 1006 | Ga0500593_120445 | 3300053117 | Bacteria | 1064 |
| 1007 | Ga0500594_0053185 | 3300053118 | Bacteria | 1146 |
| 1008 | Ga0500595_001181 | 3300053119 | Bacteria | 14424 |
| 1009 | Ga0500595_005078 | 3300053119 | Bacteria | 5783 |
| 1010 | Ga0500595_007372 | 3300053119 | Bacteria | 4567 |
| 1011 | Ga0500595_008629 | 3300053119 | Bacteria | 4158 |
| 1012 | Ga0500595_028755 | 3300053119 | Bacteria | 1893 |
| 1013 | Ga0500595_052637 | 3300053119 | Bacteria | 1256 |
| 1014 | Ga0500608_004273 | 3300053122 | Bacteria | 5499 |
| 1015 | Ga0500608_018401 | 3300053122 | Bacteria | 3187 |
| 1016 | Ga0500614_073082 | 3300053123 | Bacteria | 946 |
| 1017 | Ga0500618_009731 | 3300053125 | Bacteria | 2613 |
| 1018 | Ga0500618_029191 | 3300053125 | Bacteria | 1302 |
| 1019 | Ga0500642_0000042 | 3300053130 | Bacteria | 86476 |
| 1020 | Ga0500642_0000225 | 3300053130 | Bacteria | 22158 |
| 1021 | Ga0500642_0013084 | 3300053130 | Bacteria | 3036 |
| 1022 | Ga0500658_0086267 | 3300053134 | Bacteria | 1350 |
| 1023 | Ga0500658_0104976 | 3300053134 | Bacteria | 1237 |
| 1024 | Ga0500658_0130753 | 3300053134 | Bacteria | 1119 |
| 1025 | Ga0500559_0000857 | 3300053136 | Bacteria | 19581 |
| 1026 | Ga0500559_0001081 | 3300053136 | Bacteria | 16536 |
| 1027 | Ga0500559_0028198 | 3300053136 | Bacteria | 2398 |
| 1028 | Ga0500559_0066362 | 3300053136 | Bacteria | 1618 |
| 1029 | Ga0500568_0002631 | 3300053139 | Bacteria | 10435 |
| 1030 | Ga0500568_0078038 | 3300053139 | Bacteria | 1259 |
| 1031 | Ga0500573_0133350 | 3300053140 | Bacteria | 1373 |
| 1032 | Ga0500589_167996 | 3300053147 | Bacteria | 875 |
| 1033 | Ga0500590_110886 | 3300053148 | Bacteria | 1302 |
| 1034 | Ga0500590_141658 | 3300053148 | Bacteria | 1098 |
| 1035 | Ga0500603_005971 | 3300053150 | Bacteria | 2637 |
| 1036 | Ga0500603_037087 | 3300053150 | Bacteria | 1285 |
| 1037 | Ga0500603_040616 | 3300053150 | Bacteria | 1239 |
| 1038 | Ga0500604_0008728 | 3300053151 | Bacteria | 2692 |
| 1039 | Ga0500604_0016789 | 3300053151 | Bacteria | 2019 |
| 1040 | Ga0500622_0002743 | 3300053156 | Bacteria | 12429 |
| 1041 | Ga0500622_0004916 | 3300053156 | Bacteria | 8165 |
| 1042 | Ga0500627_0087881 | 3300053158 | Bacteria | 1390 |
| 1043 | Ga0500634_0088886 | 3300053161 | Bacteria | 1573 |
| 1044 | Ga0500638_000149 | 3300053162 | Bacteria | 13453 |
| 1045 | Ga0500638_075005 | 3300053162 | Bacteria | 1612 |
| 1046 | Ga0500638_078416 | 3300053162 | Bacteria | 1571 |
| 1047 | Ga0500639_087494 | 3300053163 | Bacteria | 1558 |
| 1048 | Ga0500636_0001169 | 3300053177 | Bacteria | 14139 |
| 1049 | Ga0500636_0003600 | 3300053177 | Bacteria | 8736 |
| 1050 | Ga0500636_0047546 | 3300053177 | Bacteria | 2526 |
| 1051 | Ga0500636_0050962 | 3300053177 | Bacteria | 2433 |
| 1052 | Ga0500637_0001223 | 3300053178 | Bacteria | 10739 |
| 1053 | Ga0500637_0002162 | 3300053178 | Bacteria | 8644 |
| 1054 | Ga0500637_0035867 | 3300053178 | Bacteria | 2782 |
| 1055 | Ga0500576_100726 | 3300053725 | Bacteria | 1180 |
| 1056 | Ga0500625_138188 | 3300053729 | Bacteria | 942 |
| 1057 | Ga0500645_011424 | 3300053730 | Bacteria | 2900 |
| 1058 | Ga0500645_026733 | 3300053730 | Bacteria | 1754 |
| 1059 | Ga0500609_004978 | 3300053731 | Bacteria | 1820 |
| 1060 | Ga0500552_005939 | 3300053733 | Bacteria | 1350 |
| 1061 | Ga0500596_000611 | 3300053735 | Bacteria | 6864 |
| 1062 | Ga0500596_014148 | 3300053735 | Bacteria | 1202 |
| 1063 | Ga0500601_002393 | 3300053737 | Bacteria | 2015 |
| 1064 | Ga0500601_010689 | 3300053737 | Bacteria | 1029 |
| 1065 | Ga0500661_005251 | 3300055283 | Bacteria | 2424 |
| 1066 | 2507505410 | 2507262055 | Bacteria | 8048963 |
| 1067 | 2508539296 | 2508501009 | Bacteria | 7784016 |
| 1068 | 2508695623 | 2508501042 | Bacteria | 8719808 |
| 1069 | 2509152137 | 2508501128 | Bacteria | 8613869 |
| 1070 | 2511394501 | 2511231028 | Bacteria | 8046582 |
| 1071 | 2513623967 | 2513237092 | Bacteria | 8341956 |
| 1072 | 2513642149 | 2513237094 | Bacteria | 8789602 |
| 1073 | 2513659466 | 2513237096 | Bacteria | 8722461 |
| 1074 | 2513675003 | 2513237098 | Bacteria | 9902361 |
| 1075 | 2513695247 | 2513237101 | Bacteria | 7952346 |
| 1076 | 2513704800 | 2513237102 | Bacteria | 7703324 |
| 1077 | 2513859428 | 2513237137 | Bacteria | 9558895 |
| 1078 | 2513873391 | 2513237139 | Bacteria | 8737671 |
| 1079 | 2513888618 | 2513237141 | Bacteria | 8496279 |
| 1080 | 2513921601 | 2513237145 | Bacteria | 8979722 |
| 1081 | 2514014721 | 2513237161 | Bacteria | 8871253 |
| 1082 | 2515627605 | 2515154112 | Bacteria | 8294334 |
| 1083 | 2517106324 | 2517093001 | Bacteria | 9002274 |
| 1084 | 2517889006 | 2517572143 | Bacteria | 9484767 |
| 1085 | 2524441396 | 2524023205 | Bacteria | 8918781 |
| 1086 | 2524467025 | 2524023210 | Bacteria | 9029266 |
| 1087 | 2524537432 | 2524023228 | Bacteria | 10118060 |
| 1088 | 2528855058 | 2528768022 | Bacteria | 10457665 |
| 1089 | 2603858334 | 2602042107 | Bacteria | 6226103 |
| 1090 | 2617352101 | 2617270735 | Bacteria | 9163226 |
| 1091 | 2617373570 | 2617270741 | Bacteria | 8201522 |
| 1092 | 2671122601 | 2667528175 | Bacteria | 7532676 |
| 1093 | 2728748475 | 2728368998 | Bacteria | 8720350 |
| 1094 | 2745077528 | 2744054633 | Bacteria | 8678936 |
| 1095 | 2793062188 | 2791355196 | Bacteria | 7323613 |
| 1096 | 2793073688 | 2791355197 | Bacteria | 8420563 |
| 1097 | 2793078351 | |||
| 1098 | 2805920739 | 2802429603 | Bacteria | 8777136 |
| 1099 | 2818237811 | 2816332527 | Bacteria | 8933356 |
| 1100 | 2824607323 | 2824600985 | Bacteria | 8488197 |
| 1101 | 2824616887 | 2824609381 | Bacteria | 8672835 |
| 1102 | 2824624404 | 2824617872 | Bacteria | 8814715 |
| 1103 | 2824632773 | 2824626560 | Bacteria | 8813858 |
| 1104 | 2824642055 | 2824635225 | Bacteria | 8785348 |
| 1105 | 2824649489 | 2824644064 | Bacteria | 8743947 |
| 1106 | 2824659691 | 2824653114 | Bacteria | 8493680 |
| 1107 | 2824669411 | 2824661429 | Bacteria | 9877870 |
| 1108 | 2824686305 | 2824679649 | Bacteria | 8248951 |
| 1109 | 2824702723 | 2824696289 | Bacteria | 8335049 |
| 1110 | 2824711444 | 2824704595 | Bacteria | 9667483 |
| 1111 | 2824719374 | 2824714736 | Bacteria | 8717648 |
| 1112 | 2824729879 | 2824723954 | Bacteria | 8758240 |
| 1113 | 2824738928 | 2824732956 | Bacteria | 7810675 |
| 1114 | 2824751656 | 2824746037 | Bacteria | 7911610 |
| 1115 | 2824762550 | 2824753945 | Bacteria | 9787441 |
| 1116 | 2824771884 | 2824763712 | Bacteria | 9792355 |
| 1117 | 2824780793 | 2824773399 | Bacteria | 8360218 |
| 1118 | 2838124653 | 2838122688 | Bacteria | 8803140 |
| 1119 | 2841945344 | 2841941048 | Bacteria | 8688029 |
| 1120 | 2841952129 | 2841949485 | Bacteria | 8680857 |
| 1121 | 2841965457 | 2841957949 | Bacteria | 8652217 |
| 1122 | 2841970483 | 2841966195 | Bacteria | 8673214 |
| 1123 | 2841981731 | 2841974524 | Bacteria | 8931498 |
| 1124 | 2841985012 | 2841983080 | Bacteria | 8395090 |
| 1125 | 2842043368 | 2842038055 | Bacteria | 8002051 |
| 1126 | 2842052642 | 2842045827 | Bacteria | 8006841 |
| 1127 | 2844315500 | 2844315083 | Bacteria | 8138177 |
| 1128 | 2847931206 | 2847930680 | Bacteria | 9342022 |
| 1129 | 2847942296 | 2847939898 | Bacteria | 8606328 |
| 1130 | 2849083170 | 2849076700 | Bacteria | 7039503 |
| 1131 | 2857516397 | 2857509624 | Bacteria | 7472071 |
| 1132 | 2874591673 | 2874590934 | Bacteria | 8299676 |
| 1133 | 2874607930 | 2874604998 | Bacteria | 7834745 |
| 1134 | 2874619101 | 2874612657 | Bacteria | 8252029 |
| 1135 | 2874621246 | 2874620515 | Bacteria | 8290088 |
| 1136 | 2874628645 | 2874628541 | Bacteria | 8630250 |
| 1137 | 2874646158 | 2874645413 | Bacteria | 8214782 |
| 1138 | 2876769596 | 2876761206 | Bacteria | 10111113 |
| 1139 | 2876771774 | 2876771140 | Bacteria | 8287509 |
| 1140 | 2876812457 | 2876808645 | Bacteria | 8824342 |
| 1141 | 2876819118 | 2876818435 | Bacteria | 8274608 |
| 1142 | 2879075635 | 2879074833 | Bacteria | 8279565 |
| 1143 | 2879085545 | 2879083081 | Bacteria | 8587928 |
| 1144 | 2879105883 | 2879099564 | Bacteria | 10442239 |
| 1145 | 2879113357 | 2879110137 | Bacteria | 8907982 |
| 1146 | 2879128444 | 2879127579 | Bacteria | 8294491 |
| 1147 | 2879143578 | 2879142872 | Bacteria | 8267021 |
| 1148 | 2881369268 | 2881364244 | Bacteria | 7710352 |
| 1149 | 2881669951 | 2881665667 | Bacteria | 8175609 |
| 1150 | 2885369377 | 2885366525 | Bacteria | 8326213 |
| 1151 | 2885382794 | 2885374607 | Bacteria | 8927485 |
| 1152 | 2885388542 | 2885383462 | Bacteria | 9473874 |
| 1153 | 2885411836 | 2885409591 | Bacteria | 9235467 |
| 1154 | 2888379448 | 2888378607 | Bacteria | 9652610 |
| 1155 | 2888390543 | 2888388044 | Bacteria | 7304136 |
| 1156 | 2888420166 | 2888419890 | Bacteria | 7857137 |
| 1157 | 2889035346 | 2889033259 | Bacteria | 9099371 |
| 1158 | 2903733453 | 2903727486 | Bacteria | 8281579 |
| 1159 | 2903758966 | 2903748898 | Bacteria | 9972761 |
| 1160 | 2903775479 | 2903768456 | Bacteria | 9749579 |
| 1161 | 2904667791 | 2904666416 | Bacteria | 8226587 |
| 1162 | 2904691051 | 2904690495 | Bacteria | 9412302 |
| 1163 | 2904708456 | |||
| 1164 | 2904716372 | 2904711408 | Bacteria | 9771557 |
| 1165 | 2906608589 | 2906602504 | Bacteria | 8295279 |
| 1166 | 2906613624 | |||
| 1167 | 2906628549 | 2906626472 | Bacteria | 8826946 |
| 1168 | 2906651401 | 2906643746 | Bacteria | 8722424 |
| 1169 | 2908747604 | 2908739725 | Bacteria | 8628932 |
| 1170 | 2908757109 | 2908756301 | Bacteria | 8864324 |
| 1171 | 2908776043 | 2908775508 | Bacteria | 8092255 |
| 1172 | 2922369433 | |||
| 1173 | 2922388532 | 2922386360 | Bacteria | 7017218 |
| 1174 | 2922398132 | 2922393267 | Bacteria | 8285685 |
| 1175 | 2922434059 | |||
| 1176 | 2929618738 | 2929615660 | Bacteria | 9193770 |
| 1177 | 2929628577 | 2929624759 | Bacteria | 9339455 |
| 1178 | 2932790919 | 2932784394 | Bacteria | 9704911 |
| 1179 | 2932794185 | 2932794094 | Bacteria | 7915132 |
| 1180 | 2932809259 | 2932801729 | Bacteria | 7987968 |
| 1181 | 2932812028 | 2932809354 | Bacteria | 9135765 |
| 1182 | 2932825521 | 2932818245 | Bacteria | 9955613 |
| 1183 | 2932833635 | 2932828146 | Bacteria | 9745859 |
| 1184 | 2933580552 | 2933577622 | Bacteria | 9116884 |
| 1185 | 2935615562 | 2935608549 | Bacteria | 8203142 |
| 1186 | 2935623161 | 2935616580 | Bacteria | 9032984 |
| 1187 | 2935636090 | 2935630451 | Bacteria | 8169952 |
| 1188 | 2935644236 | 2935638405 | Bacteria | 10015038 |
| 1189 | 2935654492 | 2935648319 | Bacteria | 8801166 |
| 1190 | 2935663372 | 2935656913 | Bacteria | 8965014 |
| 1191 | 2935672182 | 2935665750 | Bacteria | 9571747 |
| 1192 | 2935679297 | 2935675223 | Bacteria | 9928132 |
| 1193 | 2935686538 | 2935684952 | Bacteria | 9590419 |
| 1194 | 2935700321 | 2935694250 | Bacteria | 9291695 |
| 1195 | 2935710269 | 2935703347 | Bacteria | 10242284 |
| 1196 | 2935716226 | 2935713505 | Bacteria | 9608509 |
| 1197 | 2935723650 | 2935722832 | Bacteria | 9608746 |
| 1198 | 2935735205 | 2935732158 | Bacteria | 9706831 |
| 1199 | 2935744004 | 2935741537 | Bacteria | 9707219 |
| 1200 | 2935752504 | 2935750917 | Bacteria | 9590372 |
| 1201 | 2935763362 | 2935760218 | Bacteria | 9817913 |
| 1202 | 2935808260 | 2935801545 | Bacteria | 9301974 |
| 1203 | 2935816127 | 2935810662 | Bacteria | 9401221 |
| 1204 | 2935825637 | 2935819856 | Bacteria | 8261050 |
| 1205 | 2935833520 | 2935827899 | Bacteria | 10038562 |
| 1206 | 2935844473 | 2935837841 | Bacteria | 9454360 |
| 1207 | 2935853401 | 2935847175 | Bacteria | 8228321 |
| 1208 | 2935861409 | 2935855204 | Bacteria | 9035059 |
| 1209 | 2935869528 | 2935864058 | Bacteria | 9784707 |
| 1210 | 2935879857 | 2935873716 | Bacteria | 9632195 |
| 1211 | 2935889210 | 2935883170 | Bacteria | 7964738 |
| 1212 | 2935915003 | 2935908558 | Bacteria | 8568796 |
| 1213 | 2935918851 | 2935916978 | Bacteria | 9113783 |
| 1214 | 2935931432 | 2935926038 | Bacteria | 8601059 |
| 1215 | 2935940029 | 2935934488 | Bacteria | 8602579 |
| 1216 | 2935947624 | 2935942939 | Bacteria | 8599779 |
| 1217 | 2935956395 | 2935951376 | Bacteria | 8602333 |
| 1218 | 2935966765 | 2935959822 | Bacteria | 7869783 |
| 1219 | 2935973189 | 2935967501 | Bacteria | 8603075 |
| 1220 | 2935980567 | 2935975950 | Bacteria | 8347125 |
| 1221 | 2935990081 | 2935984226 | Bacteria | 8302647 |
| 1222 | 2935997920 | 2935992306 | Bacteria | 9802711 |
| 1223 | 2936008815 | 2936002035 | Bacteria | 9362176 |
| 1224 | 2936017469 | 2936011229 | Bacteria | 8801034 |
| 1225 | 2936026030 | 2936019824 | Bacteria | 8804134 |
| 1226 | 2936034872 | 2936028420 | Bacteria | 8965941 |
| 1227 | 2936041132 | 2936037263 | Bacteria | 9446081 |
| 1228 | 2936052870 | 2936046547 | Bacteria | 8903709 |
| 1229 | 2936060273 | 2936055302 | Bacteria | 8785755 |
| 1230 | 2940558417 | 2940556831 | Bacteria | 9590747 |
| 1231 | 2941512606 | 2941507105 | Bacteria | 8166816 |
| 1232 | 2941520556 | 2941515067 | Bacteria | 8166720 |
| 1233 | 2941528570 | 2941523033 | Bacteria | 8169134 |
| 1234 | 2941535384 | 2941531003 | Bacteria | 7653939 |
| 1235 | 2941543354 | 2941538514 | Bacteria | 9402094 |
| 1236 | 3005475226 | 3005474847 | Bacteria | 9259049 |
| 1237 | 3005486719 | 3005483717 | Bacteria | 7877331 |
| 1238 | 3005509024 | 3005506211 | Bacteria | 6943378 |
| 1239 | 3005594089 | 3005587118 | Bacteria | 7794411 |
| 1240 | 3005595188 | 3005594810 | Bacteria | 8716512 |
| 1241 | 3005711134 | 3005710791 | Bacteria | 7622528 |
| 1242 | 3005718432 | 3005718088 | Bacteria | 8283608 |
| 1243 | 8006936053 | 8006933436 | Bacteria | 10410654 |
| 1244 | 8006967593 | 8006964411 | Bacteria | 8966052 |
| 1245 | 8006975823 | 8006973647 | Bacteria | 10679141 |
| 1246 | 8006991062 | 8006984368 | Bacteria | 9651211 |
| 1247 | 8007000392 | 8006994254 | Bacteria | 8309700 |
| 1248 | 8016518042 | 8016511872 | Bacteria | 9921665 |
| 1249 | 8016526285 | 8016522445 | Bacteria | 8156687 |
| 1250 | 8016531344 | 8016530956 | Bacteria | 8155261 |
| 1251 | 8016544562 | 8016539877 | Bacteria | 8155419 |
| 1252 | 8016557515 | 8016548790 | Bacteria | 8155074 |
| 1253 | 8016565871 | 8016557553 | Bacteria | 8154380 |
| 1254 | 8016603470 | 8016595262 | Bacteria | 8149947 |
| 1255 | 8016606412 | 8016603502 | Bacteria | 8731218 |
| 1256 | 8016635469 | 8016630954 | Bacteria | 9217207 |
| 1257 | 8017058603 | 8017057580 | Bacteria | 10023680 |
| 1258 | 8019531179 | 8019530166 | Bacteria | 8155624 |
| 1259 | 8019562604 | 8019555841 | Bacteria | 9642137 |
| 1260 | 8019572682 | 8019565922 | Bacteria | 9639779 |
| 1261 | 8019577056 | 8019576017 | Bacteria | 10049540 |
| 1262 | 8019595125 | 8019586578 | Bacteria | 10212056 |
| 1263 | 8019606618 | 8019597564 | Bacteria | 10041141 |
| 1264 | 8019611895 | 8019608314 | Bacteria | 10042931 |
| 1265 | 8019623121 | 8019619141 | Bacteria | 9218857 |
| 1266 | 8019629979 | 8019629233 | Bacteria | 8687553 |
| 1267 | 8019640628 | 8019638758 | Bacteria | 9062356 |
| 1268 | 8019666819 | 8019659431 | Bacteria | 8577854 |
| 1269 | 8019676576 | 8019668869 | Bacteria | 8791617 |
| 1270 | 8019679414 | 8019678201 | Bacteria | 8863603 |
| 1271 | 8055742587 | 8055742211 | Bacteria | 9226248 |
| 1272 | 8056676097 | 8056673599 | Bacteria | 7871253 |
| 1273 | 8056682898 | 8056681323 | Bacteria | 8472857 |
| 1274 | 8056691101 | 8056689827 | Bacteria | 6712655 |
| 1275 | 8056971444 | 8056967851 | Bacteria | 9038162 |
| 1276 | Ga0207708_10168070 | |||
| 1277 | JGI24740J21852_10005020 | |||
| 1278 | JGI24737J22298_10008460 | |||
| 1279 | JGI25406J46586_10000915 | |||
| 1280 | JGI25406J46586_10007375 | |||
| 1281 | JGI25165J46597_1014680 | |||
| 1282 | JGI25153J46596_10009437 | |||
| 1283 | JGI25153J46596_10015245 | |||
| 1284 | JGI25160J50197_1005997 | |||
| 1285 | JGI25160J50197_1019333 | |||
| 1286 | Ga0055539_1004550 | |||
| 1287 | Ga0055531_10006765 | |||
| 1288 | Ga0065165_1005936 | |||
| 1289 | Ga0070658_10546748 | |||
| 1290 | Ga0070676_10182125 | |||
| 1291 | Ga0070683_100019475 | |||
| 1292 | Ga0070690_100085911 | |||
| 1293 | Ga0070670_100043583 | |||
| 1294 | Ga0070670_100119653 | |||
| 1295 | Ga0070670_100519945 | |||
| 1296 | Ga0068869_100051564 | |||
| 1297 | Ga0068869_100271958 | |||
| 1298 | Ga0068869_100370751 | |||
| 1299 | Ga0068869_100606099 | |||
| 1300 | Ga0068869_100683718 | |||
| 1301 | Ga0070680_100055433 | |||
| 1302 | Ga0070680_100222463 | |||
| 1303 | Ga0070660_100001075 | |||
| 1304 | Ga0070660_100180794 | |||
| 1305 | Ga0070660_100231833 | |||
| 1306 | Ga0070689_100248673 | |||
| 1307 | Ga0070691_10105060 | |||
| 1308 | Ga0070687_100057024 | |||
| 1309 | Ga0070661_100035628 | |||
| 1310 | Ga0070661_100517174 | |||
| 1311 | Ga0070668_100188166 | |||
| 1312 | Ga0070668_100228150 | |||
| 1313 | Ga0070668_100313191 | |||
| 1314 | Ga0070668_100550132 | |||
| 1315 | Ga0070669_100071036 | |||
| 1316 | Ga0070671_100165443 | |||
| 1317 | Ga0070671_100514123 | |||
| 1318 | Ga0070674_100188614 | |||
| 1319 | Ga0070674_100350990 | |||
| 1320 | Ga0070673_100243980 | |||
| 1321 | Ga0070673_100332377 | |||
| 1322 | Ga0070688_100238895 | |||
| 1323 | Ga0070688_100362765 | |||
| 1324 | Ga0070667_100261908 | |||
| 1325 | Ga0070709_10007973 | |||
| 1326 | Ga0070709_10025469 | |||
| 1327 | Ga0070713_100016372 | |||
| 1328 | Ga0070713_100040826 | |||
| 1329 | Ga0070713_100046950 | |||
| 1330 | Ga0070710_10002189 | |||
| 1331 | Ga0070710_10017653 | |||
| 1332 | Ga0070710_10053633 | |||
| 1333 | Ga0070701_10271717 | |||
| 1334 | Ga0070711_100001652 | |||
| 1335 | Ga0070711_100020415 | |||
| 1336 | Ga0070700_100127250 | |||
| 1337 | Ga0070663_100044119 | |||
| 1338 | Ga0070663_100046917 | |||
| 1339 | Ga0070663_100072148 | |||
| 1340 | Ga0070663_100168690 | |||
| 1341 | Ga0070678_100120701 | |||
| 1342 | Ga0070678_100123023 | |||
| 1343 | Ga0070678_100134879 | |||
| 1344 | Ga0070662_100094105 | |||
| 1345 | Ga0070662_100328695 | |||
| 1346 | Ga0070681_10009671 | |||
| 1347 | Ga0070681_10025343 | |||
| 1348 | Ga0068867_100195740 | |||
| 1349 | Ga0068867_100509236 | |||
| 1350 | Ga0070706_100167339 | |||
| 1351 | Ga0070706_100430541 | |||
| 1352 | Ga0070698_100041947 | |||
| 1353 | Ga0070698_100555351 | |||
| 1354 | Ga0070699_100142347 | |||
| 1355 | Ga0070679_100019056 | |||
| 1356 | Ga0070679_100045610 | |||
| 1357 | Ga0070679_100048159 | |||
| 1358 | Ga0070679_100108238 | |||
| 1359 | Ga0070679_100481550 | |||
| 1360 | Ga0070684_100007076 | |||
| 1361 | Ga0070684_100011685 | |||
| 1362 | Ga0070697_100013361 | |||
| 1363 | Ga0068853_100052993 | |||
| 1364 | Ga0068853_100210435 | |||
| 1365 | Ga0068853_100302979 | |||
| 1366 | Ga0070672_100109953 | |||
| 1367 | Ga0070672_100153248 | |||
| 1368 | Ga0070672_100217010 | |||
| 1369 | Ga0070672_100376622 | |||
| 1370 | Ga0070686_100197296 | |||
| 1371 | Ga0070686_100269415 | |||
| 1372 | Ga0070695_100286477 | |||
| 1373 | Ga0070696_100485359 | |||
| 1374 | Ga0070665_100026811 | |||
| 1375 | Ga0070665_100042207 | |||
| 1376 | Ga0070665_100071603 | |||
| 1377 | Ga0070665_100166368 | |||
| 1378 | Ga0070665_100378656 | |||
| 1379 | Ga0070665_100418995 | |||
| 1380 | Ga0070665_100580881 | |||
| 1381 | Ga0068855_100044373 | |||
| 1382 | Ga0068855_100044540 | |||
| 1383 | Ga0068855_100050100 | |||
| 1384 | Ga0068855_100301187 | |||
| 1385 | Ga0068855_100630919 | |||
| 1386 | Ga0068855_100962064 | |||
| 1387 | Ga0070664_100158287 | |||
| 1388 | Ga0070664_100325492 | |||
| 1389 | Ga0070664_100463991 | |||
| 1390 | Ga0068857_100008930 | |||
| 1391 | Ga0068857_100013150 | |||
| 1392 | Ga0068857_100022226 | |||
| 1393 | Ga0068854_100018010 | |||
| 1394 | Ga0068854_100028179 | |||
| 1395 | Ga0068854_100352176 | |||
| 1396 | Ga0068854_100437100 | |||
| 1397 | Ga0068856_100013958 | |||
| 1398 | Ga0068856_100037942 | |||
| 1399 | Ga0068856_100042359 | |||
| 1400 | Ga0068856_100261073 | |||
| 1401 | Ga0068852_100076112 | |||
| 1402 | Ga0068852_100082459 | |||
| 1403 | Ga0068852_100092974 | |||
| 1404 | Ga0068852_100118263 | |||
| 1405 | Ga0068852_100934871 | |||
| 1406 | Ga0068859_100166910 | |||
| 1407 | Ga0068859_100615841 | |||
| 1408 | Ga0068859_100778995 | |||
| 1409 | Ga0068864_100063118 | |||
| 1410 | Ga0068864_100273938 | |||
| 1411 | Ga0068866_10091135 | |||
| 1412 | Ga0068861_100052851 | |||
| 1413 | Ga0068861_100204526 | |||
| 1414 | Ga0068851_10015565 | |||
| 1415 | Ga0068851_10256226 | |||
| 1416 | Ga0068863_100170331 | |||
| 1417 | Ga0068863_100214768 | |||
| 1418 | Ga0068858_100064112 | |||
| 1419 | Ga0068858_100110112 | |||
| 1420 | Ga0068858_100127257 | |||
| 1421 | Ga0068858_100317348 | |||
| 1422 | Ga0068858_100412372 | |||
| 1423 | Ga0068858_100534950 | |||
| 1424 | Ga0068860_100000477 | |||
| 1425 | Ga0068860_100148278 | |||
| 1426 | Ga0068860_100428295 | |||
| 1427 | Ga0068860_100586364 | |||
| 1428 | Ga0068862_100233210 | |||
| 1429 | Ga0068862_100402066 | |||
| 1430 | Ga0081455_10017064 | |||
| 1431 | Ga0081455_10019554 | |||
| 1432 | Ga0081455_10079472 | |||
| 1433 | Ga0081455_10365700 | |||
| 1434 | Ga0081540_1001247 | |||
| 1435 | Ga0081540_1006252 | |||
| 1436 | Ga0081540_1007349 | |||
| 1437 | Ga0081540_1009140 | |||
| 1438 | Ga0081540_1011012 | |||
| 1439 | Ga0081540_1014005 | |||
| 1440 | Ga0081540_1023509 | |||
| 1441 | Ga0081540_1029355 | |||
| 1442 | Ga0081540_1036844 | |||
| 1443 | Ga0081540_1042418 | |||
| 1444 | Ga0081539_10000371 | |||
| 1445 | Ga0081539_10003753 | |||
| 1446 | Ga0081539_10027474 | |||
| 1447 | Ga0081539_10033413 | |||
| 1448 | Ga0070717_10007759 | |||
| 1449 | Ga0070717_10010181 | |||
| 1450 | Ga0070717_10217047 | |||
| 1451 | Ga0070717_10676887 | |||
| 1452 | Ga0075365_10093004 | |||
| 1453 | Ga0075365_10180396 | |||
| 1454 | Ga0075365_10229685 | |||
| 1455 | Ga0075365_10349106 | |||
| 1456 | Ga0075368_10028196 | |||
| 1457 | Ga0075363_100085594 | |||
| 1458 | Ga0070715_10120031 | |||
| 1459 | Ga0070716_100042649 | |||
| 1460 | Ga0070716_100071251 | |||
| 1461 | Ga0070716_100196355 | |||
| 1462 | Ga0070712_100016641 | |||
| 1463 | Ga0070712_100042188 | |||
| 1464 | Ga0070712_100509458 | |||
| 1465 | Ga0075362_10105188 | |||
| 1466 | Ga0075367_10120046 | |||
| 1467 | Ga0075369_10048814 | |||
| 1468 | Ga0075369_10153452 | |||
| 1469 | Ga0075366_10139489 | |||
| 1470 | Ga0097621_100510710 | |||
| 1471 | Ga0075370_10029972 | |||
| 1472 | Ga0075370_10064727 | |||
| 1473 | Ga0075370_10117821 | |||
| 1474 | Ga0068871_100114354 | |||
| 1475 | Ga0068871_100320516 | |||
| 1476 | Ga0075430_100406551 | |||
| 1477 | Ga0075436_100209016 | |||
| 1478 | Ga0097620_100166923 | |||
| 1479 | Ga0097620_100615817 | |||
| 1480 | Ga0097620_100778902 | |||
| 1481 | Ga0099824_1009377 | |||
| 1482 | Ga0099822_1000918 | |||
| 1483 | Ga0075435_100155550 | |||
| 1484 | Ga0099794_10006185 | |||
| 1485 | Ga0099795_10028449 | |||
| 1486 | Ga0099795_10083578 | |||
| 1487 | Ga0105240_10002459 | |||
| 1488 | Ga0105240_10014175 | |||
| 1489 | Ga0105240_10018930 | |||
| 1490 | Ga0105240_10067208 | |||
| 1491 | Ga0105240_10146885 | |||
| 1492 | Ga0105240_10226877 | |||
| 1493 | Ga0111539_10588126 | |||
| 1494 | Ga0105245_10070499 | |||
| 1495 | Ga0105245_10157149 | |||
| 1496 | Ga0105245_10729078 | |||
| 1497 | Ga0105247_10035861 | |||
| 1498 | Ga0105247_10257752 | |||
| 1499 | Ga0105243_10214772 | |||
| 1500 | Ga0105243_10275979 | |||
| 1501 | Ga0105243_10481613 | |||
| 1502 | Ga0105241_10000249 | |||
| 1503 | Ga0105241_10056480 | |||
| 1504 | Ga0105241_10124868 | |||
| 1505 | Ga0105241_10252866 | |||
| 1506 | Ga0105241_10297611 | |||
| 1507 | Ga0105241_10456533 | |||
| 1508 | Ga0105242_10077591 | |||
| 1509 | Ga0105242_10202597 | |||
| 1510 | Ga0105242_10302464 | |||
| 1511 | Ga0105242_10378730 | |||
| 1512 | Ga0105248_10179660 | |||
| 1513 | Ga0105248_10347956 | |||
| 1514 | Ga0105248_10622950 | |||
| 1515 | Ga0105237_10010653 | |||
| 1516 | Ga0105237_10014068 | |||
| 1517 | Ga0105237_10031484 | |||
| 1518 | Ga0105237_10539836 | |||
| 1519 | Ga0105237_10585533 | |||
| 1520 | Ga0105238_10005612 | |||
| 1521 | Ga0105238_10013147 | |||
| 1522 | Ga0105238_10192759 | |||
| 1523 | Ga0105238_10199327 | |||
| 1524 | Ga0105238_10726259 | |||
| 1525 | Ga0105249_10354188 | |||
| 1526 | Ga0105249_10480084 | |||
| 1527 | Ga0099796_10008025 | |||
| 1528 | Ga0099796_10030133 | |||
| 1529 | Ga0105239_10012784 | |||
| 1530 | Ga0105239_10014648 | |||
| 1531 | Ga0105239_10043484 | |||
| 1532 | Ga0105239_10150620 | |||
| 1533 | Ga0105239_10151693 | |||
| 1534 | Ga0105239_10653470 | |||
| 1535 | Ga0105239_10711510 | |||
| 1536 | Ga0105246_10062059 | |||
| 1537 | Ga0105246_10526915 | |||
| 1538 | Ga0157373_10192907 | |||
| 1539 | Ga0157370_10042620 | |||
| 1540 | Ga0157370_10070601 | |||
| 1541 | Ga0157369_10303761 | |||
| 1542 | Ga0157369_10640652 | |||
| 1543 | Ga0157374_10248139 | |||
| 1544 | Ga0157378_10112031 | |||
| 1545 | Ga0157378_10705296 | |||
| 1546 | Ga0163162_10134527 | |||
| 1547 | Ga0163162_10495698 | |||
| 1548 | Ga0163162_10509196 | |||
| 1549 | Ga0157372_10164183 | |||
| 1550 | Ga0157375_10055933 | |||
| 1551 | Ga0157375_10655909 | |||
| 1552 | Ga0157375_10834080 | |||
| 1553 | Ga0163163_10333035 | |||
| 1554 | Ga0163163_10399415 | |||
| 1555 | Ga0163163_10529979 | |||
| 1556 | Ga0163163_10740892 | |||
| 1557 | Ga0157380_10075144 | |||
| 1558 | Ga0157380_10393906 | |||
| 1559 | Ga0157377_10108853 | |||
| 1560 | Ga0157379_10060438 | |||
| 1561 | Ga0157379_10088121 | |||
| 1562 | Ga0157379_10106961 | |||
| 1563 | Ga0157379_10532480 | |||
| 1564 | Ga0157376_10090409 | |||
| 1565 | Ga0157376_10180325 | |||
| 1566 | Ga0157376_10862356 | |||
| 1567 | Ga0163161_10210421 | |||
| 1568 | Ga0214544_1000056 | |||
| 1569 | Ga0214542_1000071 | |||
| 1570 | Ga0214545_1000033 | |||
| 1571 | Ga0214543_1000105 | |||
| 1572 | Ga0213876_10142204 | |||
| 1573 | Ga0207425_1019783 | |||
| 1574 | Ga0209677_100170 | |||
| 1575 | Ga0209677_111529 | |||
| 1576 | Ga0209148_1000295 | |||
| 1577 | Ga0209233_1001518 | |||
| 1578 | Ga0209233_1008835 | |||
| 1579 | Ga0209455_1001656 | |||
| 1580 | Ga0209564_1006432 | |||
| 1581 | Ga0209564_1014608 | |||
| 1582 | Ga0209564_1015692 | |||
| 1583 | Ga0209758_1000069 | |||
| 1584 | Ga0209758_1000253 | |||
| 1585 | Ga0209758_1000397 | |||
| 1586 | Ga0209758_1007518 | |||
| 1587 | Ga0209758_1011392 | |||
| 1588 | Ga0209758_1050116 | |||
| 1589 | Ga0209758_1061866 | |||
| 1590 | Ga0209758_1084644 | |||
| 1591 | Ga0209256_1007295 | |||
| 1592 | Ga0209256_1025105 | |||
| 1593 | Ga0209256_1034456 | |||
| 1594 | Ga0207426_1001927 | |||
| 1595 | Ga0207426_1002760 | |||
| 1596 | Ga0207426_1005115 | |||
| 1597 | Ga0207426_1005770 | |||
| 1598 | Ga0207426_1028628 | |||
| 1599 | Ga0209257_1005744 | |||
| 1600 | Ga0207697_10040431 | |||
| 1601 | Ga0207656_10016880 | |||
| 1602 | Ga0207682_10116352 | |||
| 1603 | Ga0207692_10004175 | |||
| 1604 | Ga0207692_10103730 | |||
| 1605 | Ga0207710_10146216 | |||
| 1606 | Ga0207688_10104785 | |||
| 1607 | Ga0207688_10211785 | |||
| 1608 | Ga0207647_10016684 | |||
| 1609 | Ga0207699_10005583 | |||
| 1610 | Ga0207699_10096190 | |||
| 1611 | Ga0207699_10178181 | |||
| 1612 | Ga0207645_10161208 | |||
| 1613 | Ga0207705_10088303 | |||
| 1614 | Ga0207684_10238619 | |||
| 1615 | Ga0207684_10309523 | |||
| 1616 | Ga0207684_10401479 | |||
| 1617 | Ga0207654_10000083 | |||
| 1618 | Ga0207654_10178892 | |||
| 1619 | Ga0207654_10242604 | |||
| 1620 | Ga0207707_10000445 | |||
| 1621 | Ga0207707_10001947 | |||
| 1622 | Ga0207707_10004159 | |||
| 1623 | Ga0207707_10243457 | |||
| 1624 | Ga0207695_10000148 | |||
| 1625 | Ga0207695_10000387 | |||
| 1626 | Ga0207695_10106551 | |||
| 1627 | Ga0207695_10205773 | |||
| 1628 | Ga0207695_10304020 | |||
| 1629 | Ga0207671_10095512 | |||
| 1630 | Ga0207671_10119710 | |||
| 1631 | Ga0207671_10176774 | |||
| 1632 | Ga0207671_10210814 | |||
| 1633 | Ga0207671_10273577 | |||
| 1634 | Ga0207693_10020364 | |||
| 1635 | Ga0207693_10026947 | |||
| 1636 | Ga0207663_10005695 | |||
| 1637 | Ga0207663_10006822 | |||
| 1638 | Ga0207663_10015460 | |||
| 1639 | Ga0207663_10371474 | |||
| 1640 | Ga0207660_10074471 | |||
| 1641 | Ga0207657_10003784 | |||
| 1642 | Ga0207657_10062344 | |||
| 1643 | Ga0207657_10238087 | |||
| 1644 | Ga0207649_10092828 | |||
| 1645 | Ga0207649_10159508 | |||
| 1646 | Ga0207652_10076415 | |||
| 1647 | Ga0207652_10095479 | |||
| 1648 | Ga0207652_10405291 | |||
| 1649 | Ga0207694_10000121 | |||
| 1650 | Ga0207694_10160471 | |||
| 1651 | Ga0207694_10304916 | |||
| 1652 | Ga0207694_10389554 | |||
| 1653 | Ga0207650_10286628 | |||
| 1654 | Ga0207659_10123545 | |||
| 1655 | Ga0207687_10049484 | |||
| 1656 | Ga0207687_10151184 | |||
| 1657 | Ga0207700_10019025 | |||
| 1658 | Ga0207700_10100327 | |||
| 1659 | Ga0207700_10371070 | |||
| 1660 | Ga0207664_10114185 | |||
| 1661 | Ga0207644_10284042 | |||
| 1662 | Ga0207644_10440591 | |||
| 1663 | Ga0207644_10615744 | |||
| 1664 | Ga0207706_10210582 | |||
| 1665 | Ga0207706_10351551 | |||
| 1666 | Ga0207706_10371531 | |||
| 1667 | Ga0207706_10383472 | |||
| 1668 | Ga0207686_10303706 | |||
| 1669 | Ga0207686_10345265 | |||
| 1670 | Ga0207686_10346993 | |||
| 1671 | Ga0207709_10073054 | |||
| 1672 | Ga0207709_10250846 | |||
| 1673 | Ga0207709_10579158 | |||
| 1674 | Ga0207669_10022383 | |||
| 1675 | Ga0207665_10012221 | |||
| 1676 | Ga0207665_10092979 | |||
| 1677 | Ga0207665_10147019 | |||
| 1678 | Ga0207665_10201037 | |||
| 1679 | Ga0207691_10121306 | |||
| 1680 | Ga0207691_10270284 | |||
| 1681 | Ga0207711_10310718 | |||
| 1682 | Ga0207711_10315009 | |||
| 1683 | Ga0207711_10800516 | |||
| 1684 | Ga0207689_10069376 | |||
| 1685 | Ga0207689_10093451 | |||
| 1686 | Ga0207689_10130195 | |||
| 1687 | Ga0207661_10011706 | |||
| 1688 | Ga0207661_10141606 | |||
| 1689 | Ga0207679_10101728 | |||
| 1690 | Ga0207679_10235615 | |||
| 1691 | Ga0207679_10278286 | |||
| 1692 | Ga0207667_10059290 | |||
| 1693 | Ga0207667_10095652 | |||
| 1694 | Ga0207667_10107566 | |||
| 1695 | Ga0207667_10724014 | |||
| 1696 | Ga0207651_10392804 | |||
| 1697 | Ga0207712_10281001 | |||
| 1698 | Ga0207668_10077201 | |||
| 1699 | Ga0207640_10116432 | |||
| 1700 | Ga0207640_10410167 | |||
| 1701 | Ga0207658_10150570 | |||
| 1702 | Ga0207677_10044527 | |||
| 1703 | Ga0207677_10298398 | |||
| 1704 | Ga0207703_10104482 | |||
| 1705 | Ga0207703_10201723 | |||
| 1706 | Ga0207639_10066593 | |||
| 1707 | Ga0207639_10109567 | |||
| 1708 | Ga0207639_10240029 | |||
| 1709 | Ga0207639_10338609 | |||
| 1710 | Ga0207678_10017660 | |||
| 1711 | Ga0207678_10102578 | |||
| 1712 | Ga0207678_10235186 | |||
| 1713 | Ga0207678_10331728 | |||
| 1714 | Ga0207678_10435100 | |||
| 1715 | Ga0207708_10197943 | |||
| 1716 | Ga0207702_10000004 | |||
| 1717 | Ga0207702_10010411 | |||
| 1718 | Ga0207702_10164524 | |||
| 1719 | Ga0207702_10402873 | |||
| 1720 | Ga0207641_10368481 | |||
| 1721 | Ga0207648_10043666 | |||
| 1722 | Ga0207648_10348684 | |||
| 1723 | Ga0207676_10118366 | |||
| 1724 | Ga0207674_10005754 | |||
| 1725 | Ga0207674_10051030 | |||
| 1726 | Ga0207674_10060831 | |||
| 1727 | Ga0207675_100066332 | |||
| 1728 | Ga0207675_100227027 | |||
| 1729 | Ga0207675_100581960 | |||
| 1730 | Ga0207683_10120243 | |||
| 1731 | Ga0207683_10152798 | |||
| 1732 | Ga0207683_10245760 | |||
| 1733 | Ga0207683_10268193 | |||
| 1734 | Ga0207683_10452079 | |||
| 1735 | Ga0207683_10475670 | |||
| 1736 | Ga0207698_10055584 | |||
| 1737 | Ga0207698_10062251 | |||
| 1738 | Ga0207698_10092809 | |||
| 1739 | Ga0209389_1000157 | |||
| 1740 | Ga0209589_1000035 | |||
| 1741 | Ga0209489_100079 | |||
| 1742 | Ga0209489_101111 | |||
| 1743 | Ga0209489_108314 | |||
| 1744 | Ga0209700_100011 | |||
| 1745 | Ga0209700_100077 | |||
| 1746 | Ga0209813_10103818 | |||
| 1747 | Ga0268266_10001236 | |||
| 1748 | Ga0268266_10017196 | |||
| 1749 | Ga0268266_10024061 | |||
| 1750 | Ga0268266_10115835 | |||
| 1751 | Ga0268266_10207072 | |||
| 1752 | Ga0268266_10295642 | |||
| 1753 | Ga0268266_10370197 | |||
| 1754 | Ga0268265_10235020 | |||
| 1755 | Ga0268265_10284298 | |||
| 1756 | Ga0268265_10314928 | |||
| 1757 | Ga0268264_10000062 | |||
| 1758 | Ga0265326_10032836 | |||
| 1759 | Ga0265334_10057274 | |||
| 1760 | Ga0265323_10002052 | |||
| 1761 | Ga0265336_10001641 | |||
| 1762 | Ga0307517_10000175 | |||
| 1763 | Ga0307515_10042883 | |||
| 1764 | Ga0265338_10001066 | |||
| 1765 | Ga0307511_10090017 | |||
| 1766 | Ga0265330_10029710 | |||
| 1767 | Ga0265330_10058641 | |||
| 1768 | Ga0265332_10012261 | |||
| 1769 | Ga0265328_10080363 | |||
| 1770 | Ga0265325_10076700 | |||
| 1771 | Ga0265340_10030670 | |||
| 1772 | Ga0265339_10000738 | |||
| 1773 | Ga0265339_10031597 | |||
| 1774 | Ga0265331_10019666 | |||
| 1775 | Ga0265316_10100380 | |||
| 1776 | Ga0307513_10094234 | |||
| 1777 | Ga0307509_10038191 | |||
| 1778 | Ga0307508_10040818 | |||
| 1779 | Ga0307508_10062296 | |||
| 1780 | Ga0307508_10175097 | |||
| 1781 | Ga0265314_10010574 | |||
| 1782 | Ga0265314_10011119 | |||
| 1783 | Ga0265314_10150027 | |||
| 1784 | Ga0265314_10212342 | |||
| 1785 | Ga0265342_10008380 | |||
| 1786 | Ga0265342_10129631 | |||
| 1787 | Ga0307516_10065364 | |||
| 1788 | Ga0307516_10110468 | |||
| 1789 | Ga0307405_10081471 | |||
| 1790 | Ga0307405_10101218 | |||
| 1791 | Ga0307410_10108325 | |||
| 1792 | Ga0307412_10397853 | |||
| 1793 | Ga0307414_10053559 | |||
| 1794 | Ga0307411_10144646 | |||
| 1795 | Ga0307415_100277040 | |||
| 1796 | Ga0307415_100341699 | |||
| 1797 | Ga0307507_10057529 | |||
| 1798 | Ga0307510_10013138 | |||
| 1799 | Ga0307510_10014518 | |||
| 1800 | Ga0307510_10188060 | |||
| 1801 | Ga0307510_10281329 | |||
| 1802 | Ga0315911_1000008 | |||
| 1803 | Ga0373926_0040287 | |||
| 1804 | Ga0373929_0020069 | |||
| 1805 | Ga0373934_0000780 | |||
| 1806 | Ga0373934_0080894 | |||
| 1807 | Ga0373923_0014616 | |||
| 1808 | Ga0373936_0021542 | |||
| 1809 | Ga0373945_0006256 | |||
| 1810 | Ga0373953_0004338 | |||
| 1811 | Ga0373953_0010472 | |||
| 1812 | Ga0373953_0074161 | |||
| 1813 | Ga0373954_0002052 | |||
| 1814 | Ga0373954_0045857 | |||
| 1815 | Ga0373954_0076967 | |||
| 1816 | Ga0373956_0001732 | |||
| 1817 | Ga0373956_0042301 | |||
| 1818 | Ga0373957_0024130 | |||
| 1819 | Ga0373943_0004587 | |||
| 1820 | Ga0373943_0030231 | |||
| 1821 | Ga0373943_0046469 | |||
| 1822 | Ga0373946_0001716 | |||
| 1823 | Ga0373955_0022637 | |||
| 1824 | Ga0373955_0045630 | |||
| 1825 | Ga0373961_0030269 | |||
| 1826 | Ga0373935_0030701 | |||
| 1827 | Ga0373935_0031532 | |||
| 1828 | Ga0373935_0109190 | |||
| 1829 | Ga0373935_0304249 | |||
| 1830 | Ga0373927_0001064 | |||
| 1831 | Ga0373927_0001972 | |||
| 1832 | Ga0373927_0010111 | |||
| 1833 | Ga0373927_0010444 | |||
| 1834 | Ga0373927_0134807 | |||
| 1835 | Ga0373927_0240830 | |||
| 1836 | Ga0373933_0000068 | |||
| 1837 | Ga0373933_0001999 | |||
| 1838 | Ga0373933_0063756 | |||
| 1839 | Ga0373933_0083825 | |||
| 1840 | Ga0373933_0087959 | |||
| 1841 | Ga0373947_0002167 | |||
| 1842 | Ga0373947_0011961 | |||
| 1843 | Ga0373947_0019455 | |||
| 1844 | Ga0373947_0048102 | |||
| 1845 | Ga0373937_0043074 | |||
| 1846 | Ga0373937_0283010 | |||
| 1847 | Ga0373937_0357620 | |||
| 1848 | Ga0373925_0022749 | |||
| 1849 | Ga0373925_0053231 | |||
| 1850 | Ga0373925_0075368 | |||
| 1851 | Ga0373925_0079530 | |||
| 1852 | Ga0395900_0006757 | |||
| 1853 | Ga0395898_0016369 | |||
| 1854 | Ga0395905_0001948 | |||
| 1855 | Ga0395905_0302388 | |||
| 1856 | Ga0395905_0408093 | |||
| 1857 | Ga0395905_0439600 | |||
| 1858 | Ga0395901_0079195 | |||
| 1859 | Ga0395901_0263302 | |||
| 1860 | Ga0395901_0572591 | |||
| 1861 | Ga0436365_0112616 | |||
| 1862 | Ga0436365_0572660 | |||
| 1863 | Ga0436360_0046295 | |||
| 1864 | Ga0436360_0435233 | |||
| 1865 | Ga0436361_0430718 | |||
| 1866 | Ga0436363_0702892 | |||
| 1867 | Ga0436363_0977790 | |||
| 1868 | Ga0436362_0237800 | |||
| 1869 | Ga0436362_1039149 | |||
| 1870 | Ga0451807_0848413 | |||
| 1871 | Ga0451841_0221733 | |||
| 1872 | Ga0466969_0016565 | |||
| 1873 | Ga0466969_0199813 | |||
| 1874 | Ga0466972_0002927 | |||
| 1875 | Ga0466965_0142381 | |||
| 1876 | Ga0466966_0004373 | |||
| 1877 | Ga0466961_0000709 | |||
| 1878 | Ga0466963_0048779 | |||
| 1879 | Ga0466963_0100195 | |||
| 1880 | Ga0466963_0242140 | |||
| 1881 | Ga0466964_0274297 | |||
| 1882 | Ga0466968_0122276 | |||
| 1883 | Ga0466970_0111188 | |||
| 1884 | Ga0466960_0166054 | |||
| 1885 | Ga0466960_0201586 | |||
| 1886 | Ga0466959_0003898 | |||
| 1887 | Ga0466959_0073096 | |||
| 1888 | Ga0466958_0054521 | |||
| 1889 | Ga0495617_029845 | |||
| 1890 | Ga0495592_0012829 | |||
| 1891 | Ga0495592_0117103 | |||
| 1892 | Ga0495592_0223526 | |||
| 1893 | Ga0495592_0237127 | |||
| 1894 | Ga0495603_0005523 | |||
| 1895 | Ga0495603_0022697 | |||
| 1896 | Ga0495603_0028072 | |||
| 1897 | Ga0495603_0047068 | |||
| 1898 | Ga0495603_0092711 | |||
| 1899 | Ga0495590_0104751 | |||
| 1900 | Ga0495629_0003619 | |||
| 1901 | Ga0495629_0014105 | |||
| 1902 | Ga0495629_0026528 | |||
| 1903 | Ga0495629_0083584 | |||
| 1904 | Ga0495638_0027840 | |||
| 1905 | Ga0495638_0041939 | |||
| 1906 | Ga0495641_0002985 | |||
| 1907 | Ga0495641_0105705 | |||
| 1908 | Ga0495651_0022801 | |||
| 1909 | Ga0495651_0029728 | |||
| 1910 | Ga0495651_0076698 | |||
| 1911 | Ga0495651_0332985 | |||
| 1912 | Ga0495653_0001635 | |||
| 1913 | Ga0495653_0019937 | |||
| 1914 | Ga0495580_0001546 | |||
| 1915 | Ga0495582_0000535 | |||
| 1916 | Ga0495582_0015124 | |||
| 1917 | Ga0495582_0035512 | |||
| 1918 | Ga0495582_0066499 | |||
| 1919 | Ga0495605_0110771 | |||
| 1920 | Ga0495639_0001501 | |||
| 1921 | Ga0495639_0022686 | |||
| 1922 | Ga0495639_0075670 | |||
| 1923 | Ga0495639_0076497 | |||
| 1924 | Ga0495639_0147813 | |||
| 1925 | Ga0495662_0000510 | |||
| 1926 | Ga0495664_0006101 | |||
| 1927 | Ga0495664_0016598 | |||
| 1928 | Ga0495664_0126000 | |||
| 1929 | Ga0495664_0143413 | |||
| 1930 | Ga0495584_0176996 | |||
| 1931 | Ga0495594_0000467 | |||
| 1932 | Ga0495594_0051805 | |||
| 1933 | Ga0495594_0185764 | |||
| 1934 | Ga0495594_0189732 | |||
| 1935 | Ga0495596_0063658 | |||
| 1936 | Ga0495596_0117617 | |||
| 1937 | Ga0495607_0062876 | |||
| 1938 | Ga0495607_0128050 | |||
| 1939 | Ga0495583_0052132 | |||
| 1940 | Ga0495583_0176440 | |||
| 1941 | Ga0495606_0000831 | |||
| 1942 | Ga0495606_0038505 | |||
| 1943 | Ga0495608_0018999 | |||
| 1944 | Ga0495608_0044574 | |||
| 1945 | Ga0495608_0081839 | |||
| 1946 | Ga0495610_0016195 | |||
| 1947 | Ga0495610_0048587 | |||
| 1948 | Ga0495618_0047715 | |||
| 1949 | Ga0495620_0051841 | |||
| 1950 | Ga0495620_0117379 | |||
| 1951 | Ga0495628_0061000 | |||
| 1952 | Ga0495628_0105392 | |||
| 1953 | Ga0495628_0151294 | |||
| 1954 | Ga0495630_0009913 | |||
| 1955 | Ga0495630_0076688 | |||
| 1956 | Ga0495630_0278762 | |||
| 1957 | Ga0495630_0418479 | |||
| 1958 | Ga0495643_0020700 | |||
| 1959 | Ga0495644_0101563 | |||
| 1960 | Ga0495648_0002812 | |||
| 1961 | Ga0495648_0027211 | |||
| 1962 | Ga0495648_0053583 | |||
| 1963 | Ga0495648_0067554 | |||
| 1964 | Ga0495648_0082316 | |||
| 1965 | Ga0495648_0213126 | |||
| 1966 | Ga0495666_0008155 | |||
| 1967 | Ga0495652_0020210 | |||
| 1968 | Ga0495652_0059935 | |||
| 1969 | Ga0495652_0073765 | |||
| 1970 | Ga0495652_0075106 | |||
| 1971 | Ga0495652_0110030 | |||
| 1972 | Ga0495652_0192054 | |||
| 1973 | Ga0495654_0015350 | |||
| 1974 | Ga0495665_0000128 | |||
| 1975 | Ga0495665_0046233 | |||
| 1976 | Ga0495640_0007295 | |||
| 1977 | Ga0495640_0007536 | |||
| 1978 | Ga0495640_0018011 | |||
| 1979 | Ga0495640_0034708 | |||
| 1980 | Ga0495640_0139408 | |||
| 1981 | Ga0495640_0146778 | |||
| 1982 | Ga0495586_0085311 | |||
| 1983 | Ga0495587_0005610 | |||
| 1984 | Ga0495587_0031355 | |||
| 1985 | Ga0495587_0137669 | |||
| 1986 | Ga0495621_0077626 | |||
| 1987 | Ga0495597_0108909 | |||
| 1988 | Ga0495597_0127204 | |||
| 1989 | Ga0495645_0064772 | |||
| 1990 | Ga0495645_0148321 | |||
| 1991 | Ga0495645_0164715 | |||
| 1992 | Ga0495645_0274347 | |||
| 1993 | Ga0495645_0304727 | |||
| 1994 | Ga0495622_0008565 | |||
| 1995 | Ga0495622_0026867 | |||
| 1996 | Ga0495622_0035907 | |||
| 1997 | Ga0495622_0053041 | |||
| 1998 | Ga0495667_0010575 | |||
| 1999 | Ga0495656_0023665 | |||
| 2000 | Ga0495656_0138886 | |||
| 2001 | Ga0495668_0045650 | |||
| 2002 | Ga0495634_0011829 | |||
| 2003 | Ga0495634_0020602 | |||
| 2004 | Ga0495634_0032241 | |||
| 2005 | Ga0495634_0060513 | |||
| 2006 | Ga0495634_0158476 | |||
| 2007 | Ga0495634_0264793 | |||
| 2008 | Ga0495611_0077935 | |||
| 2009 | Ga0495625_0059794 | |||
| 2010 | Ga0495625_0341590 | |||
| 2011 | Ga0495635_0017402 | |||
| 2012 | Ga0495635_0037977 | |||
| 2013 | Ga0495635_0076564 | |||
| 2014 | Ga0495635_0208653 | |||
| 2015 | Ga0495659_0011312 | |||
| 2016 | Ga0495661_0096740 | |||
| 2017 | Ga0495661_0098835 | |||
| 2018 | Ga0495588_0002722 | |||
| 2019 | Ga0495588_0050332 | |||
| 2020 | Ga0495588_0059466 | |||
| 2021 | Ga0495588_0079867 | |||
| 2022 | Ga0495588_0085186 | |||
| 2023 | Ga0495657_0019410 | |||
| 2024 | Ga0495657_0029086 | |||
| 2025 | Ga0495657_0087691 | |||
| 2026 | Ga0495657_0142917 | |||
| 2027 | Ga0495599_0000562 | |||
| 2028 | Ga0495599_0034765 | |||
| 2029 | Ga0495599_0202726 | |||
| 2030 | Ga0495623_0021634 | |||
| 2031 | Ga0495623_0039103 | |||
| 2032 | Ga0495623_0106377 | |||
| 2033 | Ga0495646_0023262 | |||
| 2034 | Ga0495646_0030160 | |||
| 2035 | Ga0495646_0058421 | |||
| 2036 | Ga0495646_0071204 | |||
| 2037 | Ga0495646_0117774 | |||
| 2038 | Ga0495647_0000600 | |||
| 2039 | Ga0495658_0001083 | |||
| 2040 | Ga0495658_0086125 | |||
| 2041 | Ga0495658_0423370 | |||
| 2042 | Ga0495669_0016067 | |||
| 2043 | Ga0495669_0068699 | |||
| 2044 | Ga0495669_0083607 | |||
| 2045 | Ga0495669_0092101 | |||
| 2046 | Ga0495613_0005438 | |||
| 2047 | Ga0495613_0043339 | |||
| 2048 | Ga0495613_0081991 | |||
| 2049 | Ga0495613_0256649 | |||
| 2050 | Ga0495624_0005136 | |||
| 2051 | Ga0495624_0157631 | |||
| 2052 | Ga0495624_0199746 | |||
| 2053 | Ga0495624_0254433 | |||
| 2054 | Ga0495624_0337989 | |||
| 2055 | Ga0495670_0073193 | |||
| 2056 | Ga0495670_0100722 | |||
| 2057 | Ga0495649_0018602 | |||
| 2058 | Ga0495649_0255742 | |||
| 2059 | Ga0495600_0016680 | |||
| 2060 | Ga0495600_0022095 | |||
| 2061 | Ga0495600_0038517 | |||
| 2062 | Ga0495600_0202794 | |||
| 2063 | Ga0495600_0220838 | |||
| 2064 | Ga0495581_0003213 | |||
| 2065 | Ga0495581_0139297 | |||
| 2066 | Ga0495604_0006935 | |||
| 2067 | Ga0495604_0021826 | |||
| 2068 | Ga0495604_0036266 | |||
| 2069 | Ga0495604_0082745 | |||
| 2070 | Ga0495604_0220791 | |||
| 2071 | Ga0495604_0329013 | |||
| 2072 | Ga0495604_0333719 | |||
| 2073 | Ga0495674_0010035 | |||
| 2074 | Ga0495674_0034718 | |||
| 2075 | Ga0495674_0036341 | |||
| 2076 | Ga0495674_0102980 | |||
| 2077 | Ga0495674_0206151 | |||
| 2078 | Ga0495674_0314206 | |||
| 2079 | Ga0495672_0047426 | |||
| 2080 | Ga0495672_0109929 | |||
| 2081 | Ga0495676_0007949 | |||
| 2082 | Ga0495676_0030366 | |||
| 2083 | Ga0495676_0032842 | |||
| 2084 | Ga0495680_0009468 | |||
| 2085 | Ga0495680_0064965 | |||
| 2086 | Ga0495683_0068905 | |||
| 2087 | Ga0495687_033438 | |||
| 2088 | Ga0495675_0003041 | |||
| 2089 | Ga0495675_0106695 | |||
| 2090 | Ga0495675_0130282 | |||
| 2091 | Ga0495675_0320784 | |||
| 2092 | Ga0495673_0112638 | |||
| 2093 | Ga0495684_0005455 | |||
| 2094 | Ga0495684_0008298 | |||
| 2095 | Ga0495684_0030796 | |||
| 2096 | Ga0495684_0044813 | |||
| 2097 | Ga0495686_0128372 | |||
| 2098 | Ga0495593_0006937 | |||
| 2099 | Ga0495593_0037818 | |||
| 2100 | Ga0495593_0113872 | |||
| 2101 | Ga0495602_0014209 | |||
| 2102 | Ga0495602_0018054 | |||
| 2103 | Ga0495602_0114893 | |||
| 2104 | Ga0495602_0227954 | |||
| 2105 | Ga0495615_0013748 | |||
| 2106 | Ga0496100_0075974 | |||
| 2107 | Ga0496100_0191984 | |||
| 2108 | Ga0496100_0415744 | |||
| 2109 | Ga0496100_0417219 | |||
| 2110 | Ga0496101_0008819 | |||
| 2111 | Ga0496101_0061673 | |||
| 2112 | Ga0496101_0175729 | |||
| 2113 | Ga0496101_0218671 | |||
| 2114 | Ga0496101_0322261 | |||
| 2115 | Ga0496101_0453340 | |||
| 2116 | Ga0496102_0041671 | |||
| 2117 | Ga0496102_0047085 | |||
| 2118 | Ga0496102_0081377 | |||
| 2119 | Ga0496102_0085911 | |||
| 2120 | Ga0496102_0099110 | |||
| 2121 | Ga0496102_0155050 | |||
| 2122 | Ga0496102_0208937 | |||
| 2123 | Ga0496102_0511275 | |||
| 2124 | Ga0496103_0020714 | |||
| 2125 | Ga0496104_0035714 | |||
| 2126 | Ga0496104_0060516 | |||
| 2127 | Ga0496104_0217985 | |||
| 2128 | Ga0496104_0533738 | |||
| 2129 | Ga0496104_0669214 | |||
| 2130 | Ga0496105_0005233 | |||
| 2131 | Ga0496105_0171778 | |||
| 2132 | Ga0496105_0187475 | |||
| 2133 | Ga0496105_0210354 | |||
| 2134 | Ga0496106_0001075 | |||
| 2135 | Ga0496106_0006134 | |||
| 2136 | Ga0496106_0033686 | |||
| 2137 | Ga0496106_0034614 | |||
| 2138 | Ga0496106_0057839 | |||
| 2139 | Ga0496106_0120607 | |||
| 2140 | Ga0496106_0337226 | |||
| 2141 | Ga0496107_0002790 | |||
| 2142 | Ga0496107_0017396 | |||
| 2143 | Ga0496107_0111336 | |||
| 2144 | Ga0496107_0275636 | |||
| 2145 | Ga0496107_0291473 | |||
| 2146 | Ga0496108_0000309 | |||
| 2147 | Ga0496108_0016858 | |||
| 2148 | Ga0496108_0028705 | |||
| 2149 | Ga0496108_0121021 | |||
| 2150 | Ga0496109_0000229 | |||
| 2151 | Ga0496109_0091231 | |||
| 2152 | Ga0496109_0106392 | |||
| 2153 | Ga0496109_0153961 | |||
| 2154 | Ga0496110_0011598 | |||
| 2155 | Ga0496110_0034064 | |||
| 2156 | Ga0496110_0038809 | |||
| 2157 | Ga0496110_0138627 | |||
| 2158 | Ga0496110_0275666 | |||
| 2159 | Ga0496110_0359658 | |||
| 2160 | Ga0496111_0011315 | |||
| 2161 | Ga0496111_0131148 | |||
| 2162 | Ga0496111_0265065 | |||
| 2163 | Ga0496112_0000018 | |||
| 2164 | Ga0496112_0053970 | |||
| 2165 | Ga0496112_0074725 | |||
| 2166 | Ga0496112_0143302 | |||
| 2167 | Ga0496112_0157177 | |||
| 2168 | Ga0496112_0455207 | |||
| 2169 | Ga0496112_0722640 | |||
| 2170 | Ga0496113_0024174 | |||
| 2171 | Ga0496113_0033720 | |||
| 2172 | Ga0496113_0201756 | |||
| 2173 | Ga0496113_0212151 | |||
| 2174 | Ga0496114_0380658 | |||
| 2175 | Ga0496114_0468702 | |||
| 2176 | Ga0496115_0011619 | |||
| 2177 | Ga0496115_0036077 | |||
| 2178 | Ga0496115_0082294 | |||
| 2179 | Ga0496115_0106272 | |||
| 2180 | Ga0496115_0154204 | |||
| 2181 | Ga0496115_0302273 | |||
| 2182 | Ga0496115_0400346 | |||
| 2183 | Ga0496116_0007008 | |||
| 2184 | Ga0496116_0064921 | |||
| 2185 | Ga0496116_0118276 | |||
| 2186 | Ga0496117_0121490 | |||
| 2187 | Ga0496118_0001623 | |||
| 2188 | Ga0496118_0046366 | |||
| 2189 | Ga0496119_0185423 | |||
| 2190 | Ga0496120_0034831 | |||
| 2191 | Ga0496120_0219111 | |||
| 2192 | Ga0496120_0246496 | |||
| 2193 | Ga0496121_0000278 | |||
| 2194 | Ga0496121_0001257 | |||
| 2195 | Ga0496121_0071161 | |||
| 2196 | Ga0496121_0093161 | |||
| 2197 | Ga0496121_0142647 | |||
| 2198 | Ga0496121_0259554 | |||
| 2199 | Ga0496121_0292090 | |||
| 2200 | Ga0496122_0011998 | |||
| 2201 | Ga0496122_0039152 | |||
| 2202 | Ga0496123_0030316 | |||
| 2203 | Ga0496124_0003799 | |||
| 2204 | Ga0496124_0155417 | |||
| 2205 | Ga0496124_0301611 | |||
| 2206 | Ga0496124_0343759 | |||
| 2207 | Ga0496125_0054026 | |||
| 2208 | Ga0496125_0082443 | |||
| 2209 | Ga0496125_0107960 | |||
| 2210 | Ga0496125_0140980 | |||
| 2211 | Ga0496126_0003267 | |||
| 2212 | Ga0496126_0003347 | |||
| 2213 | Ga0496126_0009942 | |||
| 2214 | Ga0496126_0013009 | |||
| 2215 | Ga0496126_0194593 | |||
| 2216 | Ga0496126_0199109 | |||
| 2217 | Ga0496126_0360942 | |||
| 2218 | Ga0501046_0522547 | |||
| 2219 | Ga0501047_0006910 | |||
| 2220 | Ga0501067_0026967 | |||
| 2221 | Ga0501067_0076036 | |||
| 2222 | Ga0501070_0004413 | |||
| 2223 | Ga0501073_0128745 | |||
| 2224 | Ga0501074_0041688 | |||
| 2225 | Ga0501080_0044907 | |||
| 2226 | nmdc:mga03n38_13142_c1 | |||
| 2227 | nmdc:mga03n38_167578_c1 | |||
| 2228 | nmdc:mga03n38_47675_c1 | |||
| 2229 | nmdc:mga00v17_200478_c1 | |||
| 2230 | nmdc:mga0yw44_115572_c1 | |||
| 2231 | nmdc:mga0yw44_167396_c1 | |||
| 2232 | nmdc:mga0yw44_176725_c1 | |||
| 2233 | nmdc:mga0yw44_210893_c1 | |||
| 2234 | nmdc:mga06z11_228314_c1 | |||
| 2235 | nmdc:mga06z11_39634_c1 | |||
| 2236 | nmdc:mga06z11_72147_c1 | |||
| 2237 | nmdc:mga04h51_48171_c1 | |||
| 2238 | nmdc:mga07m45_76209_c1 | |||
| 2239 | nmdc:mga0qj67_388766_c1 | |||
| 2240 | nmdc:mga08y16_172453_c1 | |||
| 2241 | nmdc:mga0n895_380753_c1 | |||
| 2242 | nmdc:mga0n895_87550_c1 | |||
| 2243 | nmdc:mga0rr50_373787_c1 | |||
| 2244 | nmdc:mga08x19_228219_c1 | |||
| 2245 | Ga0495601_0039160 | |||
| 2246 | Ga0495601_0072161 | |||
| 2247 | Ga0495601_0135490 | |||
| 2248 | Ga0495612_0023765 | |||
| 2249 | Ga0495612_0036891 | |||
| 2250 | Ga0495655_0039782 | |||
| 2251 | Ga0495655_0058366 | |||
| 2252 | Ga0495595_0068269 | |||
| 2253 | Ga0495595_0167678 | |||
| 2254 | Ga0495619_0014255 | |||
| 2255 | Ga0495619_0014580 | |||
| 2256 | Ga0495619_0253404 | |||
| 2257 | Ga0500578_0126053 | |||
| 2258 | Ga0500578_0360674 | |||
| 2259 | Ga0500643_000076 | |||
| 2260 | Ga0500646_0024650 | |||
| 2261 | Ga0500647_0155035 | |||
| 2262 | Ga0500583_0195420 | |||
| 2263 | Ga0500651_0117439 | |||
| 2264 | Ga0500566_0000107 | |||
| 2265 | Ga0500566_0000277 | |||
| 2266 | Ga0500566_0027098 | |||
| 2267 | Ga0500566_0141784 | |||
| 2268 | Ga0500641_0008698 | |||
| 2269 | Ga0500641_0025456 | |||
| 2270 | Ga0500641_0037408 | |||
| 2271 | Ga0500641_0092760 | |||
| 2272 | Ga0500650_0000600 | |||
| 2273 | Ga0500554_001768 | |||
| 2274 | Ga0500555_023671 | |||
| 2275 | Ga0500556_0000081 | |||
| 2276 | Ga0500556_0017598 | |||
| 2277 | Ga0500557_000102 | |||
| 2278 | Ga0500562_004092 | |||
| 2279 | Ga0500572_000551 | |||
| 2280 | Ga0500592_005464 | |||
| 2281 | Ga0500593_120445 | |||
| 2282 | Ga0500594_0053185 | |||
| 2283 | Ga0500595_001181 | |||
| 2284 | Ga0500595_005078 | |||
| 2285 | Ga0500595_007372 | |||
| 2286 | Ga0500595_008629 | |||
| 2287 | Ga0500595_028755 | |||
| 2288 | Ga0500595_052637 | |||
| 2289 | Ga0500608_004273 | |||
| 2290 | Ga0500608_018401 | |||
| 2291 | Ga0500614_073082 | |||
| 2292 | Ga0500618_009731 | |||
| 2293 | Ga0500618_029191 | |||
| 2294 | Ga0500642_0000042 | |||
| 2295 | Ga0500642_0000225 | |||
| 2296 | Ga0500642_0013084 | |||
| 2297 | Ga0500658_0086267 | |||
| 2298 | Ga0500658_0104976 | |||
| 2299 | Ga0500658_0130753 | |||
| 2300 | Ga0500559_0000857 | |||
| 2301 | Ga0500559_0001081 | |||
| 2302 | Ga0500559_0028198 | |||
| 2303 | Ga0500559_0066362 | |||
| 2304 | Ga0500568_0002631 | |||
| 2305 | Ga0500568_0078038 | |||
| 2306 | Ga0500573_0133350 | |||
| 2307 | Ga0500589_167996 | |||
| 2308 | Ga0500590_110886 | |||
| 2309 | Ga0500590_141658 | |||
| 2310 | Ga0500603_005971 | |||
| 2311 | Ga0500603_037087 | |||
| 2312 | Ga0500603_040616 | |||
| 2313 | Ga0500604_0008728 | |||
| 2314 | Ga0500604_0016789 | |||
| 2315 | Ga0500622_0002743 | |||
| 2316 | Ga0500622_0004916 | |||
| 2317 | Ga0500627_0087881 | |||
| 2318 | Ga0500634_0088886 | |||
| 2319 | Ga0500638_000149 | |||
| 2320 | Ga0500638_075005 | |||
| 2321 | Ga0500638_078416 | |||
| 2322 | Ga0500639_087494 | |||
| 2323 | Ga0500636_0001169 | |||
| 2324 | Ga0500636_0003600 | |||
| 2325 | Ga0500636_0047546 | |||
| 2326 | Ga0500636_0050962 | |||
| 2327 | Ga0500637_0001223 | |||
| 2328 | Ga0500637_0002162 | |||
| 2329 | Ga0500637_0035867 | |||
| 2330 | Ga0500576_100726 | |||
| 2331 | Ga0500625_138188 | |||
| 2332 | Ga0500645_011424 | |||
| 2333 | Ga0500645_026733 | |||
| 2334 | Ga0500609_004978 | |||
| 2335 | Ga0500552_005939 | |||
| 2336 | Ga0500596_000611 | |||
| 2337 | Ga0500596_014148 | |||
| 2338 | Ga0500601_002393 | |||
| 2339 | Ga0500601_010689 | |||
| 2340 | Ga0500661_005251 | |||
| 2341 | 2507505410 | |||
| 2342 | 2508539296 | |||
| 2343 | 2508695623 | |||
| 2344 | 2509152137 | |||
| 2345 | 2511394501 | |||
| 2346 | 2513623967 | |||
| 2347 | 2513642149 | |||
| 2348 | 2513659466 | |||
| 2349 | 2513675003 | |||
| 2350 | 2513695247 | |||
| 2351 | 2513704800 | |||
| 2352 | 2513859428 | |||
| 2353 | 2513873391 | |||
| 2354 | 2513888618 | |||
| 2355 | 2513921601 | |||
| 2356 | 2514014721 | |||
| 2357 | 2515627605 | |||
| 2358 | 2517106324 | |||
| 2359 | 2517889006 | |||
| 2360 | 2524441396 | |||
| 2361 | 2524467025 | |||
| 2362 | 2524537432 | |||
| 2363 | 2528855058 | |||
| 2364 | 2603858334 | |||
| 2365 | 2617352101 | |||
| 2366 | 2617373570 | |||
| 2367 | 2671122601 | |||
| 2368 | 2728748475 | |||
| 2369 | 2745077528 | |||
| 2370 | 2793062188 | |||
| 2371 | 2793073688 | |||
| 2372 | 2793078351 | |||
| 2373 | 2805920739 | |||
| 2374 | 2818237811 | |||
| 2375 | 2824607323 | |||
| 2376 | 2824616887 | |||
| 2377 | 2824624404 | |||
| 2378 | 2824632773 | |||
| 2379 | 2824642055 | |||
| 2380 | 2824649489 | |||
| 2381 | 2824659691 | |||
| 2382 | 2824669411 | |||
| 2383 | 2824686305 | |||
| 2384 | 2824702723 | |||
| 2385 | 2824711444 | |||
| 2386 | 2824719374 | |||
| 2387 | 2824729879 | |||
| 2388 | 2824738928 | |||
| 2389 | 2824751656 | |||
| 2390 | 2824762550 | |||
| 2391 | 2824771884 | |||
| 2392 | 2824780793 | |||
| 2393 | 2838124653 | |||
| 2394 | 2841945344 | |||
| 2395 | 2841952129 | |||
| 2396 | 2841965457 | |||
| 2397 | 2841970483 | |||
| 2398 | 2841981731 | |||
| 2399 | 2841985012 | |||
| 2400 | 2842043368 | |||
| 2401 | 2842052642 | |||
| 2402 | 2844315500 | |||
| 2403 | 2847931206 | |||
| 2404 | 2847942296 | |||
| 2405 | 2849083170 | |||
| 2406 | 2857516397 | |||
| 2407 | 2874591673 | |||
| 2408 | 2874607930 | |||
| 2409 | 2874619101 | |||
| 2410 | 2874621246 | |||
| 2411 | 2874628645 | |||
| 2412 | 2874646158 | |||
| 2413 | 2876769596 | |||
| 2414 | 2876771774 | |||
| 2415 | 2876812457 | |||
| 2416 | 2876819118 | |||
| 2417 | 2879075635 | |||
| 2418 | 2879085545 | |||
| 2419 | 2879105883 | |||
| 2420 | 2879113357 | |||
| 2421 | 2879128444 | |||
| 2422 | 2879143578 | |||
| 2423 | 2881369268 | |||
| 2424 | 2881669951 | |||
| 2425 | 2885369377 | |||
| 2426 | 2885382794 | |||
| 2427 | 2885388542 | |||
| 2428 | 2885411836 | |||
| 2429 | 2888379448 | |||
| 2430 | 2888390543 | |||
| 2431 | 2888420166 | |||
| 2432 | 2889035346 | |||
| 2433 | 2903733453 | |||
| 2434 | 2903758966 | |||
| 2435 | 2903775479 | |||
| 2436 | 2904667791 | |||
| 2437 | 2904691051 | |||
| 2438 | 2904708456 | |||
| 2439 | 2904716372 | |||
| 2440 | 2906608589 | |||
| 2441 | 2906613624 | |||
| 2442 | 2906628549 | |||
| 2443 | 2906651401 | |||
| 2444 | 2908747604 | |||
| 2445 | 2908757109 | |||
| 2446 | 2908776043 | |||
| 2447 | 2922369433 | |||
| 2448 | 2922388532 | |||
| 2449 | 2922398132 | |||
| 2450 | 2922434059 | |||
| 2451 | 2929618738 | |||
| 2452 | 2929628577 | |||
| 2453 | 2932790919 | |||
| 2454 | 2932794185 | |||
| 2455 | 2932809259 | |||
| 2456 | 2932812028 | |||
| 2457 | 2932825521 | |||
| 2458 | 2932833635 | |||
| 2459 | 2933580552 | |||
| 2460 | 2935615562 | |||
| 2461 | 2935623161 | |||
| 2462 | 2935636090 | |||
| 2463 | 2935644236 | |||
| 2464 | 2935654492 | |||
| 2465 | 2935663372 | |||
| 2466 | 2935672182 | |||
| 2467 | 2935679297 | |||
| 2468 | 2935686538 | |||
| 2469 | 2935700321 | |||
| 2470 | 2935710269 | |||
| 2471 | 2935716226 | |||
| 2472 | 2935723650 | |||
| 2473 | 2935735205 | |||
| 2474 | 2935744004 | |||
| 2475 | 2935752504 | |||
| 2476 | 2935763362 | |||
| 2477 | 2935808260 | |||
| 2478 | 2935816127 | |||
| 2479 | 2935825637 | |||
| 2480 | 2935833520 | |||
| 2481 | 2935844473 | |||
| 2482 | 2935853401 | |||
| 2483 | 2935861409 | |||
| 2484 | 2935869528 | |||
| 2485 | 2935879857 | |||
| 2486 | 2935889210 | |||
| 2487 | 2935915003 | |||
| 2488 | 2935918851 | |||
| 2489 | 2935931432 | |||
| 2490 | 2935940029 | |||
| 2491 | 2935947624 | |||
| 2492 | 2935956395 | |||
| 2493 | 2935966765 | |||
| 2494 | 2935973189 | |||
| 2495 | 2935980567 | |||
| 2496 | 2935990081 | |||
| 2497 | 2935997920 | |||
| 2498 | 2936008815 | |||
| 2499 | 2936017469 | |||
| 2500 | 2936026030 | |||
| 2501 | 2936034872 | |||
| 2502 | 2936041132 | |||
| 2503 | 2936052870 | |||
| 2504 | 2936060273 | |||
| 2505 | 2940558417 | |||
| 2506 | 2941512606 | |||
| 2507 | 2941520556 | |||
| 2508 | 2941528570 | |||
| 2509 | 2941535384 | |||
| 2510 | 2941543354 | |||
| 2511 | 3005475226 | |||
| 2512 | 3005486719 | |||
| 2513 | 3005509024 | |||
| 2514 | 3005594089 | |||
| 2515 | 3005595188 | |||
| 2516 | 3005711134 | |||
| 2517 | 3005718432 | |||
| 2518 | 8006936053 | |||
| 2519 | 8006967593 | |||
| 2520 | 8006975823 | |||
| 2521 | 8006991062 | |||
| 2522 | 8007000392 | |||
| 2523 | 8016518042 | |||
| 2524 | 8016526285 | |||
| 2525 | 8016531344 | |||
| 2526 | 8016544562 | |||
| 2527 | 8016557515 | |||
| 2528 | 8016565871 | |||
| 2529 | 8016603470 | |||
| 2530 | 8016606412 | |||
| 2531 | 8016635469 | |||
| 2532 | 8017058603 | |||
| 2533 | 8019531179 | |||
| 2534 | 8019562604 | |||
| 2535 | 8019572682 | |||
| 2536 | 8019577056 | |||
| 2537 | 8019595125 | |||
| 2538 | 8019606618 | |||
| 2539 | 8019611895 | |||
| 2540 | 8019623121 | |||
| 2541 | 8019629979 | |||
| 2542 | 8019640628 | |||
| 2543 | 8019666819 | |||
| 2544 | 8019676576 | |||
| 2545 | 8019679414 | |||
| 2546 | 8055742587 | |||
| 2547 | 8056676097 | |||
| 2548 | 8056682898 | |||
| 2549 | 8056691101 | |||
| 2550 | 8056971444 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1kjj-assembly1.cif.gz_A | crystal structure of glycniamide ribonucleotide transformylase in complex with mg-atp-gamma-s | 0.6912 | 4 | 50 |
| 4hgr-assembly1.cif.gz_D | crystal structure of e56a/k67a mutant of 2-keto-3-deoxy-d-glycero-d-galactonononate-9-phosphate phosphohydrolase from bacteroides thetaiotaomicron | 0.6772 | 5 | 38 |
| 3aw8-assembly1.cif.gz_B | crystal structure of n5-carboxyaminoimidazole ribonucleotide synthetase from thermus thermophilus hb8 | 0.6704 | 5 | 50 |
| 3n1u-assembly1.cif.gz_A | structure of putative had superfamily (subfamily iii a) hydrolase from legionella pneumophila | 0.6703 | 5 | 50 |
| 1ltx-assembly1.cif.gz_R | structure of rab escort protein-1 in complex with rab geranylgeranyl transferase and isoprenoid | 0.6668 | 3 | 35 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G0L8_3_282_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.7776 | 5 | 38 | 3.40.50.1000 |
| 4ap9D01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.7199 | 2 | 37 | 3.40.50.1000 |
| af_O07810_7_266_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.6962 | 5 | 38 | 3.40.50.2020 |
| af_Q922P9_265_423_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.6901 | 1 | 49 | 3.40.50.720 |
| af_K7LWV7_39_162_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.6864 | 1 | 49 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A520ZL80-F1-model_v4 | Uncharacterized protein | 0.9598 | 1 | 58 |
|
| AF-A0A439QNM7-F1-model_v4 | Glycosyltransferase family 1 protein | 0.9528 | 3 | 58 |
|
| AF-A0A163XJ97-F1-model_v4 | Mannosyltransferase | 0.9491 | 1 | 250 |
|
| AF-A0A163XJ97-F1-model_v4 | Mannosyltransferase | 0.9418 | 1 | 250 |
|
| AF-A0A067W3T2-F1-model_v4 | BAH domain-containing protein | 0.9377 | 4 | 69 |
|