F492466

General Info

Members Datasets Scaffolds Average Seq Length
1275 657 2550 261

Family's Representative Sequence

Representative Sequence 3300026075|Ga0207708_10168070|Ga0207708_101680702
Length 303
Sequence MRPDVVTFWHGPLDGLRLTCLRSQVAAGHNVTVYSFDPLPGLPDGVGNAEAEAILPHSFSERLRPPEPDGSWRDWTILQFSDFFRMRLMAERAGLWLDADVLLLKPIEIDPAKPYFAWERRRQLGNSVLYLPANDPIVRAFEELMEQEDLTPDWLALRHRLTFMLRQLRRRSSRLSDIRVAIYGPAALTALARRSDELQHALSKQSFYAVHAEPKLFFEPTDFSGLIADPEIIGLHISPKGRGGEKPIPGSLYAWAAEKFGLLGQQVLQKLYPLVEFPAQRLSPDRDALTSTLKAVPKPRSKW

Samples

Sample ID Description Type Environment
1 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
89 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
92 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
122 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
123 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
124 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
125 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
126 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
127 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
130 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
133 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
135 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
193 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
194 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
195 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
196 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
197 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
201 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
202 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
203 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
204 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
205 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
206 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
207 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
208 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
209 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
210 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
211 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
212 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
213 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
214 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
215 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
216 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
217 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
218 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
219 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
220 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
221 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
222 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
223 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
224 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
225 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
226 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
227 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
228 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
229 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
230 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
231 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
232 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
233 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
234 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
235 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
236 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
237 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
238 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
239 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
240 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
241 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
242 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
243 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
244 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
245 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
246 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
247 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
248 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
249 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
250 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
251 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
252 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
253 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
254 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
255 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
256 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
257 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
258 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
259 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
260 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
261 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
262 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
263 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
264 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
265 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
266 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
267 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
268 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
269 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
270 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
271 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
272 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
273 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
274 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
275 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
276 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
277 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
278 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
279 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
280 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
281 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
282 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
283 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
284 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
285 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
286 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
287 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
288 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
289 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
290 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
291 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
292 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
293 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
294 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
295 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
296 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
297 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
298 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
299 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
300 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
301 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
302 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
303 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
304 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
305 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
306 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
307 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
308 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
309 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
310 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
311 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
312 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
313 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
314 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
315 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
316 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
317 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
318 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
319 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
320 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
321 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
322 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
323 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
324 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
325 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
326 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
327 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
328 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
329 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
330 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
331 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
332 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
333 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
334 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
335 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
336 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
337 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
338 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
339 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
340 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
341 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
342 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
343 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
344 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
345 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
346 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
347 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
348 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
349 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
350 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
351 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
352 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
353 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
354 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
355 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
356 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
357 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
358 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
359 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
360 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
361 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
362 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
363 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
364 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
365 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
366 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
367 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
368 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
369 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
370 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
371 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
372 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
373 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
374 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
375 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
376 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
377 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
378 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
379 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
382 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
383 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
384 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
385 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
386 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
387 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
388 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
389 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
390 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
391 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
392 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
393 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
394 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
395 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
396 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
397 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
398 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
399 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
400 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
401 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
402 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
403 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
404 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
405 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
406 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
407 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
408 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
409 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
410 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
411 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
412 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
413 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
414 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
415 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
416 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
417 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
418 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
419 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
420 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
421 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
422 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
423 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
424 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
425 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
426 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
427 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
428 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
429 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
430 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
431 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
432 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
433 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
434 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
435 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
436 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
437 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
438 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
439 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
440 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
441 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
442 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
443 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
444 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
445 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
446 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
447 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
448 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
449 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
450 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
451 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
452 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
453 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
454 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
455 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
456 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
457 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
458 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
459 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
460 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
461 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
462 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
463 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
464 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
465 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
466 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
467 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
468 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
469 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
470 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
471 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
472 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
473 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
474 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
475 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
476 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
477 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
478 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
479 2791355199
480 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
481 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
482 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
483 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
484 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
485 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
486 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
487 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
488 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
489 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
490 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
491 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
492 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
493 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
494 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
495 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
496 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
497 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
498 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
499 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
500 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
501 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
502 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
503 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
504 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
505 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
506 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
507 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
508 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
509 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
510 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
511 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
512 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
513 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
514 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
515 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
516 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
517 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
518 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
519 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
520 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
521 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
522 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
523 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
524 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
525 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
526 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
527 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
528 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
529 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
530 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
531 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
532 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
533 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
534 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
535 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
536 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
537 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
538 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
539 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
540 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
541 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
542 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
543 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
544 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
545 2904699407
546 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
547 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
548 2906610324
549 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
550 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
551 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
552 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
553 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
554 2922368715
555 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
556 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
557 2922425934
558 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
559 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
560 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
561 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
562 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
563 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
564 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
565 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
566 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
567 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
568 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
569 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
570 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
571 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
572 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
573 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
574 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
575 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
576 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
577 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
578 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
579 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
580 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
581 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
582 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
583 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
584 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
585 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
586 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
587 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
588 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
589 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
590 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
591 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
592 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
593 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
594 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
595 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
596 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
597 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
598 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
599 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
600 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
601 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
602 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
603 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
604 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
605 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
606 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
607 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
608 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
609 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
610 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
611 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
612 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
613 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
614 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
615 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
616 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
617 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
618 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
619 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
620 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
621 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
622 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
623 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
624 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
625 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
626 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
627 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
628 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
629 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
630 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
631 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
632 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
633 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
634 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
635 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
636 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
637 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
638 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
639 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
640 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
641 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
642 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
643 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
644 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
645 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
646 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
647 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
648 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
649 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
650 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
651 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
652 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
653 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
654 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
655 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
656 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
657 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.86
Metatranscriptomes 0
Isolates 16.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.53
Nodule 12.94
Rhizoplane 6.27
Rhizosphere 60.47
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207708_10168070 3300026075 Bacteria 1735
2 JGI24740J21852_10005020 3300001979 Bacteria 5618
3 JGI24737J22298_10008460 3300001990 Bacteria 3441
4 JGI25406J46586_10000915 3300003203 Bacteria 13864
5 JGI25406J46586_10007375 3300003203 Bacteria 5021
6 JGI25165J46597_1014680 3300003214 Bacteria 1064
7 JGI25153J46596_10009437 3300003215 Bacteria 4534
8 JGI25153J46596_10015245 3300003215 Bacteria 3144
9 JGI25160J50197_1005997 3300003354 Bacteria 4978
10 JGI25160J50197_1019333 3300003354 Bacteria 2091
11 Ga0055539_1004550 3300003752 Bacteria 1842
12 Ga0055531_10006765 3300003794 Bacteria 6412
13 Ga0065165_1005936 3300005262 Bacteria 6613
14 Ga0070658_10546748 3300005327 Bacteria 1002
15 Ga0070676_10182125 3300005328 Bacteria 1366
16 Ga0070683_100019475 3300005329 Bacteria 6027
17 Ga0070690_100085911 3300005330 Bacteria 2064
18 Ga0070670_100043583 3300005331 Bacteria 3856
19 Ga0070670_100119653 3300005331 Bacteria 2271
20 Ga0070670_100519945 3300005331 Bacteria 1060
21 Ga0068869_100051564 3300005334 Bacteria 2985
22 Ga0068869_100271958 3300005334 Bacteria 1360
23 Ga0068869_100370751 3300005334 Bacteria 1171
24 Ga0068869_100606099 3300005334 Bacteria 925
25 Ga0068869_100683718 3300005334 Bacteria 874
26 Ga0070680_100055433 3300005336 Bacteria 3239
27 Ga0070680_100222463 3300005336 Bacteria 1593
28 Ga0070660_100001075 3300005339 Bacteria 18360
29 Ga0070660_100180794 3300005339 Bacteria 1706
30 Ga0070660_100231833 3300005339 Bacteria 1502
31 Ga0070689_100248673 3300005340 Bacteria 1466
32 Ga0070691_10105060 3300005341 Bacteria 1407
33 Ga0070687_100057024 3300005343 Bacteria 2046
34 Ga0070661_100035628 3300005344 Bacteria 3614
35 Ga0070661_100517174 3300005344 Bacteria 957
36 Ga0070668_100188166 3300005347 Bacteria 1690
37 Ga0070668_100228150 3300005347 Bacteria 1538
38 Ga0070668_100313191 3300005347 Bacteria 1319
39 Ga0070668_100550132 3300005347 Bacteria 1004
40 Ga0070669_100071036 3300005353 Bacteria 2574
41 Ga0070671_100165443 3300005355 Bacteria 1870
42 Ga0070671_100514123 3300005355 Bacteria 1031
43 Ga0070674_100188614 3300005356 Bacteria 1584
44 Ga0070674_100350990 3300005356 Bacteria 1191
45 Ga0070673_100243980 3300005364 Bacteria 1563
46 Ga0070673_100332377 3300005364 Bacteria 1345
47 Ga0070688_100238895 3300005365 Bacteria 1288
48 Ga0070688_100362765 3300005365 Bacteria 1063
49 Ga0070667_100261908 3300005367 Bacteria 1548
50 Ga0070709_10007973 3300005434 Bacteria 5818
51 Ga0070709_10025469 3300005434 Bacteria 3495
52 Ga0070713_100016372 3300005436 Bacteria 5574
53 Ga0070713_100040826 3300005436 Bacteria 3775
54 Ga0070713_100046950 3300005436 Bacteria 3547
55 Ga0070710_10002189 3300005437 Bacteria 9222
56 Ga0070710_10017653 3300005437 Bacteria 3657
57 Ga0070710_10053633 3300005437 Bacteria 2272
58 Ga0070701_10271717 3300005438 Bacteria 1032
59 Ga0070711_100001652 3300005439 Bacteria 12334
60 Ga0070711_100020415 3300005439 Bacteria 4269
61 Ga0070700_100127250 3300005441 Bacteria 1714
62 Ga0070663_100044119 3300005455 Bacteria 3142
63 Ga0070663_100046917 3300005455 Bacteria 3059
64 Ga0070663_100072148 3300005455 Bacteria 2514
65 Ga0070663_100168690 3300005455 Bacteria 1690
66 Ga0070678_100120701 3300005456 Bacteria 2066
67 Ga0070678_100123023 3300005456 Bacteria 2049
68 Ga0070678_100134879 3300005456 Bacteria 1967
69 Ga0070662_100094105 3300005457 Bacteria 2255
70 Ga0070662_100328695 3300005457 Bacteria 1248
71 Ga0070681_10009671 3300005458 Bacteria 9485
72 Ga0070681_10025343 3300005458 Bacteria 5966
73 Ga0068867_100195740 3300005459 Bacteria 1615
74 Ga0068867_100509236 3300005459 Bacteria 1036
75 Ga0070706_100167339 3300005467 Bacteria 2052
76 Ga0070706_100430541 3300005467 Bacteria 1228
77 Ga0070698_100041947 3300005471 Bacteria 4696
78 Ga0070698_100555351 3300005471 Bacteria 1088
79 Ga0070699_100142347 3300005518 Bacteria 2118
80 Ga0070679_100019056 3300005530 Bacteria 6666
81 Ga0070679_100045610 3300005530 Bacteria 4368
82 Ga0070679_100048159 3300005530 Bacteria 4248
83 Ga0070679_100108238 3300005530 Bacteria 2765
84 Ga0070679_100481550 3300005530 Bacteria 1185
85 Ga0070684_100007076 3300005535 Bacteria 8722
86 Ga0070684_100011685 3300005535 Bacteria 7001
87 Ga0070697_100013361 3300005536 Bacteria 6440
88 Ga0068853_100052993 3300005539 Bacteria 3494
89 Ga0068853_100210435 3300005539 Bacteria 1772
90 Ga0068853_100302979 3300005539 Bacteria 1477
91 Ga0070672_100109953 3300005543 Bacteria 2245
92 Ga0070672_100153248 3300005543 Bacteria 1908
93 Ga0070672_100217010 3300005543 Bacteria 1603
94 Ga0070672_100376622 3300005543 Bacteria 1213
95 Ga0070686_100197296 3300005544 Bacteria 1440
96 Ga0070686_100269415 3300005544 Bacteria 1251
97 Ga0070695_100286477 3300005545 Bacteria 1212
98 Ga0070696_100485359 3300005546 Bacteria 980
99 Ga0070665_100026811 3300005548 Bacteria 5804
100 Ga0070665_100042207 3300005548 Bacteria 4584
101 Ga0070665_100071603 3300005548 Bacteria 3473
102 Ga0070665_100166368 3300005548 Bacteria 2207
103 Ga0070665_100378656 3300005548 Bacteria 1422
104 Ga0070665_100418995 3300005548 Bacteria 1348
105 Ga0070665_100580881 3300005548 Bacteria 1133
106 Ga0068855_100044373 3300005563 Bacteria 5261
107 Ga0068855_100044540 3300005563 Bacteria 5250
108 Ga0068855_100050100 3300005563 Bacteria 4922
109 Ga0068855_100301187 3300005563 Bacteria 1775
110 Ga0068855_100630919 3300005563 Bacteria 1153
111 Ga0068855_100962064 3300005563 Bacteria 899
112 Ga0070664_100158287 3300005564 Bacteria 2002
113 Ga0070664_100325492 3300005564 Bacteria 1393
114 Ga0070664_100463991 3300005564 Bacteria 1164
115 Ga0068857_100008930 3300005577 Bacteria 8683
116 Ga0068857_100013150 3300005577 Bacteria 7213
117 Ga0068857_100022226 3300005577 Bacteria 5580
118 Ga0068854_100018010 3300005578 Bacteria 4735
119 Ga0068854_100028179 3300005578 Bacteria 3878
120 Ga0068854_100352176 3300005578 Bacteria 1205
121 Ga0068854_100437100 3300005578 Bacteria 1090
122 Ga0068856_100013958 3300005614 Bacteria 7767
123 Ga0068856_100037942 3300005614 Bacteria 4728
124 Ga0068856_100042359 3300005614 Bacteria 4478
125 Ga0068856_100261073 3300005614 Bacteria 1747
126 Ga0068852_100076112 3300005616 Bacteria 2962
127 Ga0068852_100082459 3300005616 Bacteria 2857
128 Ga0068852_100092974 3300005616 Bacteria 2702
129 Ga0068852_100118263 3300005616 Bacteria 2421
130 Ga0068852_100934871 3300005616 Bacteria 885
131 Ga0068859_100166910 3300005617 Bacteria 2281
132 Ga0068859_100615841 3300005617 Bacteria 1178
133 Ga0068859_100778995 3300005617 Bacteria 1045
134 Ga0068864_100063118 3300005618 Bacteria 3210
135 Ga0068864_100273938 3300005618 Bacteria 1573
136 Ga0068866_10091135 3300005718 Bacteria 1660
137 Ga0068861_100052851 3300005719 Bacteria 3089
138 Ga0068861_100204526 3300005719 Bacteria 1659
139 Ga0068851_10015565 3300005834 Bacteria 3626
140 Ga0068851_10256226 3300005834 Bacteria 994
141 Ga0068863_100170331 3300005841 Bacteria 2088
142 Ga0068863_100214768 3300005841 Bacteria 1852
143 Ga0068858_100064112 3300005842 Bacteria 3400
144 Ga0068858_100110112 3300005842 Bacteria 2571
145 Ga0068858_100127257 3300005842 Bacteria 2386
146 Ga0068858_100317348 3300005842 Bacteria 1489
147 Ga0068858_100412372 3300005842 Bacteria 1298
148 Ga0068858_100534950 3300005842 Bacteria 1134
149 Ga0068860_100000477 3300005843 Bacteria 49839
150 Ga0068860_100148278 3300005843 Bacteria 2258
151 Ga0068860_100428295 3300005843 Bacteria 1312
152 Ga0068860_100586364 3300005843 Bacteria 1119
153 Ga0068862_100233210 3300005844 Bacteria 1670
154 Ga0068862_100402066 3300005844 Bacteria 1281
155 Ga0081455_10017064 3300005937 Bacteria 6978
156 Ga0081455_10019554 3300005937 Bacteria 6403
157 Ga0081455_10079472 3300005937 Bacteria 2692
158 Ga0081455_10365700 3300005937 Bacteria 1013
159 Ga0081540_1001247 3300005983 Bacteria 22221
160 Ga0081540_1006252 3300005983 Bacteria 8720
161 Ga0081540_1007349 3300005983 Bacteria 7874
162 Ga0081540_1009140 3300005983 Bacteria 6841
163 Ga0081540_1011012 3300005983 Bacteria 6074
164 Ga0081540_1014005 3300005983 Bacteria 5174
165 Ga0081540_1023509 3300005983 Bacteria 3602
166 Ga0081540_1029355 3300005983 Bacteria 3066
167 Ga0081540_1036844 3300005983 Bacteria 2602
168 Ga0081540_1042418 3300005983 Bacteria 2347
169 Ga0081539_10000371 3300005985 Bacteria 98455
170 Ga0081539_10003753 3300005985 Bacteria 18030
171 Ga0081539_10027474 3300005985 Bacteria 3603
172 Ga0081539_10033413 3300005985 Bacteria 3133
173 Ga0070717_10007759 3300006028 Bacteria 7984
174 Ga0070717_10010181 3300006028 Bacteria 7080
175 Ga0070717_10217047 3300006028 Bacteria 1680
176 Ga0070717_10676887 3300006028 Bacteria 937
177 Ga0075365_10093004 3300006038 Bacteria 2056
178 Ga0075365_10180396 3300006038 Bacteria 1476
179 Ga0075365_10229685 3300006038 Bacteria 1302
180 Ga0075365_10349106 3300006038 Bacteria 1043
181 Ga0075368_10028196 3300006042 Bacteria 2168
182 Ga0075363_100085594 3300006048 Bacteria 1729
183 Ga0070715_10120031 3300006163 Bacteria 1252
184 Ga0070716_100042649 3300006173 Bacteria 2533
185 Ga0070716_100071251 3300006173 Bacteria 2043
186 Ga0070716_100196355 3300006173 Bacteria 1338
187 Ga0070712_100016641 3300006175 Bacteria 4751
188 Ga0070712_100042188 3300006175 Bacteria 3137
189 Ga0070712_100509458 3300006175 Bacteria 1010
190 Ga0075362_10105188 3300006177 Bacteria 1323
191 Ga0075367_10120046 3300006178 Bacteria 1619
192 Ga0075369_10048814 3300006186 Bacteria 1827
193 Ga0075369_10153452 3300006186 Bacteria 1053
194 Ga0075366_10139489 3300006195 Bacteria 1465
195 Ga0097621_100510710 3300006237 Bacteria 1090
196 Ga0075370_10029972 3300006353 Bacteria 3033
197 Ga0075370_10064727 3300006353 Bacteria 2085
198 Ga0075370_10117821 3300006353 Bacteria 1544
199 Ga0068871_100114354 3300006358 Bacteria 2273
200 Ga0068871_100320516 3300006358 Bacteria 1365
201 Ga0075430_100406551 3300006846 Bacteria 1124
202 Ga0075436_100209016 3300006914 Bacteria 1383
203 Ga0097620_100166923 3300006931 Bacteria 2281
204 Ga0097620_100615817 3300006931 Bacteria 1178
205 Ga0097620_100778902 3300006931 Bacteria 1045
206 Ga0099824_1009377 3300006942 Bacteria 12072
207 Ga0099822_1000918 3300006943 Bacteria 31646
208 Ga0075435_100155550 3300007076 Bacteria 1923
209 Ga0099794_10006185 3300007265 Bacteria 4835
210 Ga0099795_10028449 3300007788 Bacteria 1901
211 Ga0099795_10083578 3300007788 Bacteria 1226
212 Ga0105240_10002459 3300009093 Bacteria 29768
213 Ga0105240_10014175 3300009093 Bacteria 10888
214 Ga0105240_10018930 3300009093 Bacteria 9221
215 Ga0105240_10067208 3300009093 Bacteria 4443
216 Ga0105240_10146885 3300009093 Bacteria 2813
217 Ga0105240_10226877 3300009093 Bacteria 2173
218 Ga0111539_10588126 3300009094 Bacteria 1296
219 Ga0105245_10070499 3300009098 Bacteria 3172
220 Ga0105245_10157149 3300009098 Bacteria 2154
221 Ga0105245_10729078 3300009098 Bacteria 1026
222 Ga0105247_10035861 3300009101 Bacteria 3024
223 Ga0105247_10257752 3300009101 Bacteria 1195
224 Ga0105243_10214772 3300009148 Bacteria 1696
225 Ga0105243_10275979 3300009148 Bacteria 1512
226 Ga0105243_10481613 3300009148 Bacteria 1171
227 Ga0105241_10000249 3300009174 Bacteria 40643
228 Ga0105241_10056480 3300009174 Bacteria 3010
229 Ga0105241_10124868 3300009174 Bacteria 2077
230 Ga0105241_10252866 3300009174 Bacteria 1495
231 Ga0105241_10297611 3300009174 Bacteria 1384
232 Ga0105241_10456533 3300009174 Bacteria 1131
233 Ga0105242_10077591 3300009176 Bacteria 2771
234 Ga0105242_10202597 3300009176 Bacteria 1763
235 Ga0105242_10302464 3300009176 Bacteria 1460
236 Ga0105242_10378730 3300009176 Bacteria 1315
237 Ga0105248_10179660 3300009177 Bacteria 2385
238 Ga0105248_10347956 3300009177 Bacteria 1669
239 Ga0105248_10622950 3300009177 Bacteria 1217
240 Ga0105237_10010653 3300009545 Bacteria 9769
241 Ga0105237_10014068 3300009545 Bacteria 8372
242 Ga0105237_10031484 3300009545 Bacteria 5378
243 Ga0105237_10539836 3300009545 Bacteria 1173
244 Ga0105237_10585533 3300009545 Bacteria 1123
245 Ga0105238_10005612 3300009551 Bacteria 12402
246 Ga0105238_10013147 3300009551 Bacteria 8352
247 Ga0105238_10192759 3300009551 Bacteria 2014
248 Ga0105238_10199327 3300009551 Bacteria 1977
249 Ga0105238_10726259 3300009551 Bacteria 1006
250 Ga0105249_10354188 3300009553 Bacteria 1488
251 Ga0105249_10480084 3300009553 Bacteria 1286
252 Ga0099796_10008025 3300010159 Bacteria 2793
253 Ga0099796_10030133 3300010159 Bacteria 1757
254 Ga0105239_10012784 3300010375 Bacteria 9339
255 Ga0105239_10014648 3300010375 Bacteria 8695
256 Ga0105239_10043484 3300010375 Bacteria 4924
257 Ga0105239_10150620 3300010375 Bacteria 2596
258 Ga0105239_10151693 3300010375 Bacteria 2586
259 Ga0105239_10653470 3300010375 Bacteria 1201
260 Ga0105239_10711510 3300010375 Bacteria 1149
261 Ga0105246_10062059 3300011119 Bacteria 2602
262 Ga0105246_10526915 3300011119 Bacteria 1008
263 Ga0157373_10192907 3300013100 Bacteria 1435
264 Ga0157370_10042620 3300013104 Bacteria 4372
265 Ga0157370_10070601 3300013104 Bacteria 3296
266 Ga0157369_10303761 3300013105 Bacteria 1660
267 Ga0157369_10640652 3300013105 Bacteria 1096
268 Ga0157374_10248139 3300013296 Bacteria 1751
269 Ga0157378_10112031 3300013297 Bacteria 2502
270 Ga0157378_10705296 3300013297 Bacteria 1029
271 Ga0163162_10134527 3300013306 Bacteria 2583
272 Ga0163162_10495698 3300013306 Bacteria 1352
273 Ga0163162_10509196 3300013306 Bacteria 1334
274 Ga0157372_10164183 3300013307 Bacteria 2568
275 Ga0157375_10055933 3300013308 Bacteria 3892
276 Ga0157375_10655909 3300013308 Bacteria 1205
277 Ga0157375_10834080 3300013308 Bacteria 1069
278 Ga0163163_10333035 3300014325 Bacteria 1573
279 Ga0163163_10399415 3300014325 Bacteria 1433
280 Ga0163163_10529979 3300014325 Bacteria 1240
281 Ga0163163_10740892 3300014325 Bacteria 1046
282 Ga0157380_10075144 3300014326 Bacteria 2746
283 Ga0157380_10393906 3300014326 Bacteria 1311
284 Ga0157377_10108853 3300014745 Bacteria 1663
285 Ga0157379_10060438 3300014968 Bacteria 3388
286 Ga0157379_10088121 3300014968 Bacteria 2783
287 Ga0157379_10106961 3300014968 Bacteria 2511
288 Ga0157379_10532480 3300014968 Bacteria 1091
289 Ga0157376_10090409 3300014969 Bacteria 2649
290 Ga0157376_10180325 3300014969 Bacteria 1930
291 Ga0157376_10862356 3300014969 Bacteria 921
292 Ga0163161_10210421 3300017792 Bacteria 1502
293 Ga0214544_1000056 3300021320 Bacteria 132760
294 Ga0214542_1000071 3300021321 Bacteria 124568
295 Ga0214545_1000033 3300021324 Bacteria 124568
296 Ga0214543_1000105 3300021327 Bacteria 108404
297 Ga0213876_10142204 3300021384 Bacteria 1276
298 Ga0207425_1019783 3300025245 Bacteria 1446
299 Ga0209677_100170 3300025253 Bacteria 55896
300 Ga0209677_111529 3300025253 Bacteria 1373
301 Ga0209148_1000295 3300025254 Bacteria 73660
302 Ga0209233_1001518 3300025261 Bacteria 9101
303 Ga0209233_1008835 3300025261 Bacteria 3090
304 Ga0209455_1001656 3300025272 Bacteria 9651
305 Ga0209564_1006432 3300025295 Bacteria 6337
306 Ga0209564_1014608 3300025295 Bacteria 3251
307 Ga0209564_1015692 3300025295 Bacteria 3064
308 Ga0209758_1000069 3300025297 Bacteria 286161
309 Ga0209758_1000253 3300025297 Bacteria 107937
310 Ga0209758_1000397 3300025297 Bacteria 75408
311 Ga0209758_1007518 3300025297 Bacteria 7385
312 Ga0209758_1011392 3300025297 Bacteria 5158
313 Ga0209758_1050116 3300025297 Bacteria 1467
314 Ga0209758_1061866 3300025297 Bacteria 1229
315 Ga0209758_1084644 3300025297 Bacteria 947
316 Ga0209256_1007295 3300025299 Bacteria 5504
317 Ga0209256_1025105 3300025299 Bacteria 1742
318 Ga0209256_1034456 3300025299 Bacteria 1347
319 Ga0207426_1001927 3300025302 Bacteria 14934
320 Ga0207426_1002760 3300025302 Bacteria 10609
321 Ga0207426_1005115 3300025302 Bacteria 6119
322 Ga0207426_1005770 3300025302 Bacteria 5562
323 Ga0207426_1028628 3300025302 Bacteria 1845
324 Ga0209257_1005744 3300025304 Bacteria 8484
325 Ga0207697_10040431 3300025315 Bacteria 1915
326 Ga0207656_10016880 3300025321 Bacteria 2849
327 Ga0207682_10116352 3300025893 Bacteria 1182
328 Ga0207692_10004175 3300025898 Bacteria 5703
329 Ga0207692_10103730 3300025898 Bacteria 1566
330 Ga0207710_10146216 3300025900 Bacteria 1144
331 Ga0207688_10104785 3300025901 Bacteria 1637
332 Ga0207688_10211785 3300025901 Bacteria 1165
333 Ga0207647_10016684 3300025904 Bacteria 5006
334 Ga0207699_10005583 3300025906 Bacteria 6034
335 Ga0207699_10096190 3300025906 Bacteria 1869
336 Ga0207699_10178181 3300025906 Bacteria 1427
337 Ga0207645_10161208 3300025907 Bacteria 1467
338 Ga0207705_10088303 3300025909 Bacteria 2268
339 Ga0207684_10238619 3300025910 Bacteria 1568
340 Ga0207684_10309523 3300025910 Bacteria 1362
341 Ga0207684_10401479 3300025910 Bacteria 1178
342 Ga0207654_10000083 3300025911 Bacteria 62205
343 Ga0207654_10178892 3300025911 Bacteria 1382
344 Ga0207654_10242604 3300025911 Bacteria 1205
345 Ga0207707_10000445 3300025912 Bacteria 42982
346 Ga0207707_10001947 3300025912 Bacteria 18789
347 Ga0207707_10004159 3300025912 Bacteria 12822
348 Ga0207707_10243457 3300025912 Bacteria 1563
349 Ga0207695_10000148 3300025913 Bacteria 208344
350 Ga0207695_10000387 3300025913 Bacteria 99734
351 Ga0207695_10106551 3300025913 Bacteria 2789
352 Ga0207695_10205773 3300025913 Bacteria 1881
353 Ga0207695_10304020 3300025913 Bacteria 1486
354 Ga0207671_10095512 3300025914 Bacteria 2245
355 Ga0207671_10119710 3300025914 Bacteria 2012
356 Ga0207671_10176774 3300025914 Bacteria 1660
357 Ga0207671_10210814 3300025914 Bacteria 1520
358 Ga0207671_10273577 3300025914 Bacteria 1331
359 Ga0207693_10020364 3300025915 Bacteria 5277
360 Ga0207693_10026947 3300025915 Bacteria 4546
361 Ga0207663_10005695 3300025916 Bacteria 6303
362 Ga0207663_10006822 3300025916 Bacteria 5878
363 Ga0207663_10015460 3300025916 Bacteria 4211
364 Ga0207663_10371474 3300025916 Bacteria 1087
365 Ga0207660_10074471 3300025917 Bacteria 2478
366 Ga0207657_10003784 3300025919 Bacteria 16083
367 Ga0207657_10062344 3300025919 Bacteria 3193
368 Ga0207657_10238087 3300025919 Bacteria 1454
369 Ga0207649_10092828 3300025920 Bacteria 1980
370 Ga0207649_10159508 3300025920 Bacteria 1562
371 Ga0207652_10076415 3300025921 Bacteria 2921
372 Ga0207652_10095479 3300025921 Bacteria 2619
373 Ga0207652_10405291 3300025921 Bacteria 1230
374 Ga0207694_10000121 3300025924 Bacteria 83123
375 Ga0207694_10160471 3300025924 Bacteria 1816
376 Ga0207694_10304916 3300025924 Bacteria 1312
377 Ga0207694_10389554 3300025924 Bacteria 1158
378 Ga0207650_10286628 3300025925 Bacteria 1342
379 Ga0207659_10123545 3300025926 Bacteria 1987
380 Ga0207687_10049484 3300025927 Bacteria 2922
381 Ga0207687_10151184 3300025927 Bacteria 1772
382 Ga0207700_10019025 3300025928 Bacteria 4631
383 Ga0207700_10100327 3300025928 Bacteria 2307
384 Ga0207700_10371070 3300025928 Bacteria 1249
385 Ga0207664_10114185 3300025929 Bacteria 2250
386 Ga0207644_10284042 3300025931 Bacteria 1329
387 Ga0207644_10440591 3300025931 Bacteria 1069
388 Ga0207644_10615744 3300025931 Bacteria 902
389 Ga0207706_10210582 3300025933 Bacteria 1704
390 Ga0207706_10351551 3300025933 Bacteria 1281
391 Ga0207706_10371531 3300025933 Bacteria 1242
392 Ga0207706_10383472 3300025933 Bacteria 1219
393 Ga0207686_10303706 3300025934 Bacteria 1186
394 Ga0207686_10345265 3300025934 Bacteria 1119
395 Ga0207686_10346993 3300025934 Bacteria 1116
396 Ga0207709_10073054 3300025935 Bacteria 2184
397 Ga0207709_10250846 3300025935 Bacteria 1292
398 Ga0207709_10579158 3300025935 Bacteria 886
399 Ga0207669_10022383 3300025937 Bacteria 3356
400 Ga0207665_10012221 3300025939 Bacteria 5639
401 Ga0207665_10092979 3300025939 Bacteria 2093
402 Ga0207665_10147019 3300025939 Bacteria 1685
403 Ga0207665_10201037 3300025939 Bacteria 1452
404 Ga0207691_10121306 3300025940 Bacteria 2317
405 Ga0207691_10270284 3300025940 Bacteria 1464
406 Ga0207711_10310718 3300025941 Bacteria 1455
407 Ga0207711_10315009 3300025941 Bacteria 1445
408 Ga0207711_10800516 3300025941 Bacteria 878
409 Ga0207689_10069376 3300025942 Bacteria 2896
410 Ga0207689_10093451 3300025942 Bacteria 2470
411 Ga0207689_10130195 3300025942 Bacteria 2071
412 Ga0207661_10011706 3300025944 Bacteria 6367
413 Ga0207661_10141606 3300025944 Bacteria 2070
414 Ga0207679_10101728 3300025945 Bacteria 2248
415 Ga0207679_10235615 3300025945 Bacteria 1548
416 Ga0207679_10278286 3300025945 Bacteria 1434
417 Ga0207667_10059290 3300025949 Bacteria 4009
418 Ga0207667_10095652 3300025949 Bacteria 3066
419 Ga0207667_10107566 3300025949 Bacteria 2877
420 Ga0207667_10724014 3300025949 Bacteria 996
421 Ga0207651_10392804 3300025960 Bacteria 1178
422 Ga0207712_10281001 3300025961 Bacteria 1359
423 Ga0207668_10077201 3300025972 Bacteria 2400
424 Ga0207640_10116432 3300025981 Bacteria 1905
425 Ga0207640_10410167 3300025981 Bacteria 1106
426 Ga0207658_10150570 3300025986 Bacteria 1895
427 Ga0207677_10044527 3300026023 Bacteria 2958
428 Ga0207677_10298398 3300026023 Bacteria 1330
429 Ga0207703_10104482 3300026035 Bacteria 2407
430 Ga0207703_10201723 3300026035 Bacteria 1768
431 Ga0207639_10066593 3300026041 Bacteria 2800
432 Ga0207639_10109567 3300026041 Bacteria 2247
433 Ga0207639_10240029 3300026041 Bacteria 1575
434 Ga0207639_10338609 3300026041 Bacteria 1341
435 Ga0207678_10017660 3300026067 Bacteria 6263
436 Ga0207678_10102578 3300026067 Bacteria 2442
437 Ga0207678_10235186 3300026067 Bacteria 1569
438 Ga0207678_10331728 3300026067 Bacteria 1310
439 Ga0207678_10435100 3300026067 Bacteria 1139
440 Ga0207708_10197943 3300026075 Bacteria 1602
441 Ga0207702_10000004 3300026078 Bacteria 422182
442 Ga0207702_10010411 3300026078 Bacteria 7783
443 Ga0207702_10164524 3300026078 Bacteria 2028
444 Ga0207702_10402873 3300026078 Bacteria 1320
445 Ga0207641_10368481 3300026088 Bacteria 1373
446 Ga0207648_10043666 3300026089 Bacteria 3935
447 Ga0207648_10348684 3300026089 Bacteria 1334
448 Ga0207676_10118366 3300026095 Bacteria 2229
449 Ga0207674_10005754 3300026116 Bacteria 14710
450 Ga0207674_10051030 3300026116 Bacteria 4223
451 Ga0207674_10060831 3300026116 Bacteria 3818
452 Ga0207675_100066332 3300026118 Bacteria 3373
453 Ga0207675_100227027 3300026118 Bacteria 1800
454 Ga0207675_100581960 3300026118 Bacteria 1121
455 Ga0207683_10120243 3300026121 Bacteria 2357
456 Ga0207683_10152798 3300026121 Bacteria 2084
457 Ga0207683_10245760 3300026121 Bacteria 1632
458 Ga0207683_10268193 3300026121 Bacteria 1559
459 Ga0207683_10452079 3300026121 Bacteria 1184
460 Ga0207683_10475670 3300026121 Bacteria 1153
461 Ga0207698_10055584 3300026142 Bacteria 3052
462 Ga0207698_10062251 3300026142 Bacteria 2913
463 Ga0207698_10092809 3300026142 Bacteria 2476
464 Ga0209389_1000157 3300027296 Bacteria 56696
465 Ga0209589_1000035 3300027357 Bacteria 134091
466 Ga0209489_100079 3300027361 Bacteria 134091
467 Ga0209489_101111 3300027361 Bacteria 54702
468 Ga0209489_108314 3300027361 Bacteria 14326
469 Ga0209700_100011 3300027363 Bacteria 362159
470 Ga0209700_100077 3300027363 Bacteria 134091
471 Ga0209813_10103818 3300027866 Bacteria 970
472 Ga0268266_10001236 3300028379 Bacteria 31292
473 Ga0268266_10017196 3300028379 Bacteria 6175
474 Ga0268266_10024061 3300028379 Bacteria 5183
475 Ga0268266_10115835 3300028379 Bacteria 2380
476 Ga0268266_10207072 3300028379 Bacteria 1797
477 Ga0268266_10295642 3300028379 Bacteria 1509
478 Ga0268266_10370197 3300028379 Bacteria 1349
479 Ga0268265_10235020 3300028380 Bacteria 1613
480 Ga0268265_10284298 3300028380 Bacteria 1481
481 Ga0268265_10314928 3300028380 Bacteria 1414
482 Ga0268264_10000062 3300028381 Bacteria 302110
483 Ga0265326_10032836 3300028558 Bacteria 1478
484 Ga0265334_10057274 3300028573 Bacteria 1477
485 Ga0265323_10002052 3300028653 Bacteria 9454
486 Ga0265336_10001641 3300028666 Bacteria 9917
487 Ga0307517_10000175 3300028786 Bacteria 105567
488 Ga0307515_10042883 3300028794 Bacteria 7056
489 Ga0265338_10001066 3300028800 Bacteria 45588
490 Ga0307511_10090017 3300030521 Bacteria 2087
491 Ga0265330_10029710 3300031235 Bacteria 2456
492 Ga0265330_10058641 3300031235 Bacteria 1678
493 Ga0265332_10012261 3300031238 Bacteria 3803
494 Ga0265328_10080363 3300031239 Bacteria 1201
495 Ga0265325_10076700 3300031241 Bacteria 1667
496 Ga0265340_10030670 3300031247 Bacteria 2694
497 Ga0265339_10000738 3300031249 Bacteria 25301
498 Ga0265339_10031597 3300031249 Bacteria 2991
499 Ga0265331_10019666 3300031250 Bacteria 3483
500 Ga0265316_10100380 3300031344 Bacteria 2200
501 Ga0307513_10094234 3300031456 Bacteria 3040
502 Ga0307509_10038191 3300031507 Bacteria 5240
503 Ga0307508_10040818 3300031616 Bacteria 4166
504 Ga0307508_10062296 3300031616 Bacteria 3293
505 Ga0307508_10175097 3300031616 Bacteria 1748
506 Ga0265314_10010574 3300031711 Bacteria 7681
507 Ga0265314_10011119 3300031711 Bacteria 7459
508 Ga0265314_10150027 3300031711 Bacteria 1431
509 Ga0265314_10212342 3300031711 Bacteria 1136
510 Ga0265342_10008380 3300031712 Bacteria 7418
511 Ga0265342_10129631 3300031712 Bacteria 1414
512 Ga0307516_10065364 3300031730 Bacteria 3513
513 Ga0307516_10110468 3300031730 Bacteria 2553
514 Ga0307405_10081471 3300031731 Bacteria 2116
515 Ga0307405_10101218 3300031731 Bacteria 1933
516 Ga0307410_10108325 3300031852 Bacteria 2006
517 Ga0307412_10397853 3300031911 Bacteria 1120
518 Ga0307414_10053559 3300032004 Bacteria 2815
519 Ga0307411_10144646 3300032005 Bacteria 1758
520 Ga0307415_100277040 3300032126 Bacteria 1377
521 Ga0307415_100341699 3300032126 Bacteria 1256
522 Ga0307507_10057529 3300033179 Bacteria 3661
523 Ga0307510_10013138 3300033180 Bacteria 9823
524 Ga0307510_10014518 3300033180 Bacteria 9322
525 Ga0307510_10188060 3300033180 Bacteria 1617
526 Ga0307510_10281329 3300033180 Bacteria 1134
527 Ga0315911_1000008 3300033442 Bacteria 381285
528 Ga0373926_0040287 3300035083 Bacteria 1667
529 Ga0373929_0020069 3300035085 Bacteria 1344
530 Ga0373934_0000780 3300035086 Bacteria 11447
531 Ga0373934_0080894 3300035086 Bacteria 1305
532 Ga0373923_0014616 3300035111 Bacteria 2952
533 Ga0373936_0021542 3300035113 Bacteria 2507
534 Ga0373945_0006256 3300035116 Bacteria 3834
535 Ga0373953_0004338 3300035117 Bacteria 4513
536 Ga0373953_0010472 3300035117 Bacteria 3229
537 Ga0373953_0074161 3300035117 Bacteria 1407
538 Ga0373954_0002052 3300035118 Bacteria 8373
539 Ga0373954_0045857 3300035118 Bacteria 2042
540 Ga0373954_0076967 3300035118 Bacteria 1591
541 Ga0373956_0001732 3300035119 Bacteria 8991
542 Ga0373956_0042301 3300035119 Bacteria 2025
543 Ga0373957_0024130 3300035120 Bacteria 2181
544 Ga0373943_0004587 3300035170 Bacteria 6242
545 Ga0373943_0030231 3300035170 Bacteria 2563
546 Ga0373943_0046469 3300035170 Bacteria 2119
547 Ga0373946_0001716 3300035171 Bacteria 7640
548 Ga0373955_0022637 3300035172 Bacteria 3190
549 Ga0373955_0045630 3300035172 Bacteria 2365
550 Ga0373961_0030269 3300035241 Bacteria 1505
551 Ga0373935_0030701 3300035692 Bacteria 3331
552 Ga0373935_0031532 3300035692 Bacteria 3290
553 Ga0373935_0109190 3300035692 Bacteria 1834
554 Ga0373935_0304249 3300035692 Bacteria 1128
555 Ga0373927_0001064 3300035695 Bacteria 20972
556 Ga0373927_0001972 3300035695 Bacteria 15136
557 Ga0373927_0010111 3300035695 Bacteria 6313
558 Ga0373927_0010444 3300035695 Bacteria 6189
559 Ga0373927_0134807 3300035695 Bacteria 1613
560 Ga0373927_0240830 3300035695 Bacteria 1189
561 Ga0373933_0000068 3300035724 Bacteria 63195
562 Ga0373933_0001999 3300035724 Bacteria 11767
563 Ga0373933_0063756 3300035724 Bacteria 2228
564 Ga0373933_0083825 3300035724 Bacteria 1958
565 Ga0373933_0087959 3300035724 Bacteria 1914
566 Ga0373947_0002167 3300035725 Bacteria 11925
567 Ga0373947_0011961 3300035725 Bacteria 4972
568 Ga0373947_0019455 3300035725 Bacteria 3915
569 Ga0373947_0048102 3300035725 Bacteria 2558
570 Ga0373937_0043074 3300036401 Bacteria 4120
571 Ga0373937_0283010 3300036401 Bacteria 1566
572 Ga0373937_0357620 3300036401 Bacteria 1383
573 Ga0373925_0022749 3300037068 Bacteria 4573
574 Ga0373925_0053231 3300037068 Bacteria 3025
575 Ga0373925_0075368 3300037068 Bacteria 2556
576 Ga0373925_0079530 3300037068 Bacteria 2491
577 Ga0395900_0006757 3300037418 Bacteria 11904
578 Ga0395898_0016369 3300037466 Bacteria 7589
579 Ga0395905_0001948 3300037471 Bacteria 23653
580 Ga0395905_0302388 3300037471 Bacteria 1487
581 Ga0395905_0408093 3300037471 Bacteria 1254
582 Ga0395905_0439600 3300037471 Bacteria 1202
583 Ga0395901_0079195 3300038443 Bacteria 3431
584 Ga0395901_0263302 3300038443 Bacteria 1794
585 Ga0395901_0572591 3300038443 Bacteria 1142
586 Ga0436365_0112616 3300039437 Bacteria 4886
587 Ga0436365_0572660 3300039437 Bacteria 2254
588 Ga0436360_0046295 3300039438 Bacteria 2933
589 Ga0436360_0435233 3300039438 Bacteria 1136
590 Ga0436361_0430718 3300039447 Bacteria 3841
591 Ga0436363_0702892 3300039450 Bacteria 2351
592 Ga0436363_0977790 3300039450 Bacteria 7072
593 Ga0436362_0237800 3300039453 Bacteria 2255
594 Ga0436362_1039149 3300039453 Bacteria 2513
595 Ga0451807_0848413 3300041486 Bacteria 893
596 Ga0451841_0221733 3300041498 Bacteria 854
597 Ga0466969_0016565 3300044656 Bacteria 3855
598 Ga0466969_0199813 3300044656 Bacteria 912
599 Ga0466972_0002927 3300044658 Bacteria 8463
600 Ga0466965_0142381 3300044683 Bacteria 1249
601 Ga0466966_0004373 3300044684 Bacteria 9318
602 Ga0466961_0000709 3300044693 Bacteria 20961
603 Ga0466963_0048779 3300044694 Bacteria 2799
604 Ga0466963_0100195 3300044694 Bacteria 1982
605 Ga0466963_0242140 3300044694 Bacteria 1265
606 Ga0466964_0274297 3300044706 Bacteria 840
607 Ga0466968_0122276 3300044735 Bacteria 1178
608 Ga0466970_0111188 3300044765 Bacteria 1496
609 Ga0466960_0166054 3300044901 Bacteria 1188
610 Ga0466960_0201586 3300044901 Bacteria 1087
611 Ga0466959_0003898 3300045049 Bacteria 9905
612 Ga0466959_0073096 3300045049 Bacteria 2481
613 Ga0466958_0054521 3300045836 Bacteria 2425
614 Ga0495617_029845 3300046452 Bacteria 1833
615 Ga0495592_0012829 3300046454 Bacteria 6371
616 Ga0495592_0117103 3300046454 Bacteria 1879
617 Ga0495592_0223526 3300046454 Bacteria 1257
618 Ga0495592_0237127 3300046454 Bacteria 1212
619 Ga0495603_0005523 3300046455 Bacteria 7543
620 Ga0495603_0022697 3300046455 Bacteria 3797
621 Ga0495603_0028072 3300046455 Bacteria 3394
622 Ga0495603_0047068 3300046455 Bacteria 2569
623 Ga0495603_0092711 3300046455 Bacteria 1765
624 Ga0495590_0104751 3300046457 Bacteria 1007
625 Ga0495629_0003619 3300046459 Bacteria 11680
626 Ga0495629_0014105 3300046459 Bacteria 5757
627 Ga0495629_0026528 3300046459 Bacteria 4115
628 Ga0495629_0083584 3300046459 Bacteria 2228
629 Ga0495638_0027840 3300046460 Bacteria 3655
630 Ga0495638_0041939 3300046460 Bacteria 2892
631 Ga0495641_0002985 3300046461 Bacteria 12986
632 Ga0495641_0105705 3300046461 Bacteria 1256
633 Ga0495651_0022801 3300046462 Bacteria 4867
634 Ga0495651_0029728 3300046462 Bacteria 4260
635 Ga0495651_0076698 3300046462 Bacteria 2531
636 Ga0495651_0332985 3300046462 Bacteria 1008
637 Ga0495653_0001635 3300046463 Bacteria 17593
638 Ga0495653_0019937 3300046463 Bacteria 5435
639 Ga0495580_0001546 3300046472 Bacteria 20242
640 Ga0495582_0000535 3300046473 Bacteria 20995
641 Ga0495582_0015124 3300046473 Bacteria 4244
642 Ga0495582_0035512 3300046473 Bacteria 2742
643 Ga0495582_0066499 3300046473 Bacteria 1992
644 Ga0495605_0110771 3300046474 Bacteria 1253
645 Ga0495639_0001501 3300046475 Bacteria 10399
646 Ga0495639_0022686 3300046475 Bacteria 2754
647 Ga0495639_0075670 3300046475 Bacteria 1561
648 Ga0495639_0076497 3300046475 Bacteria 1553
649 Ga0495639_0147813 3300046475 Bacteria 1132
650 Ga0495662_0000510 3300046476 Bacteria 17683
651 Ga0495664_0006101 3300046477 Bacteria 6651
652 Ga0495664_0016598 3300046477 Bacteria 4197
653 Ga0495664_0126000 3300046477 Bacteria 1549
654 Ga0495664_0143413 3300046477 Bacteria 1448
655 Ga0495584_0176996 3300046491 Bacteria 1084
656 Ga0495594_0000467 3300046499 Bacteria 20554
657 Ga0495594_0051805 3300046499 Bacteria 2259
658 Ga0495594_0185764 3300046499 Bacteria 1184
659 Ga0495594_0189732 3300046499 Bacteria 1171
660 Ga0495596_0063658 3300046500 Bacteria 1435
661 Ga0495596_0117617 3300046500 Bacteria 1032
662 Ga0495607_0062876 3300046501 Bacteria 2102
663 Ga0495607_0128050 3300046501 Bacteria 1325
664 Ga0495583_0052132 3300046506 Bacteria 1863
665 Ga0495583_0176440 3300046506 Bacteria 876
666 Ga0495606_0000831 3300046507 Bacteria 46699
667 Ga0495606_0038505 3300046507 Bacteria 3234
668 Ga0495608_0018999 3300046511 Bacteria 4736
669 Ga0495608_0044574 3300046511 Bacteria 2960
670 Ga0495608_0081839 3300046511 Bacteria 2097
671 Ga0495610_0016195 3300046512 Bacteria 4303
672 Ga0495610_0048587 3300046512 Bacteria 2082
673 Ga0495618_0047715 3300046514 Bacteria 2703
674 Ga0495620_0051841 3300046515 Bacteria 1745
675 Ga0495620_0117379 3300046515 Bacteria 1051
676 Ga0495628_0061000 3300046516 Bacteria 2958
677 Ga0495628_0105392 3300046516 Bacteria 2172
678 Ga0495628_0151294 3300046516 Bacteria 1768
679 Ga0495630_0009913 3300046517 Bacteria 6861
680 Ga0495630_0076688 3300046517 Bacteria 2519
681 Ga0495630_0278762 3300046517 Bacteria 1277
682 Ga0495630_0418479 3300046517 Bacteria 1027
683 Ga0495643_0020700 3300046522 Bacteria 3787
684 Ga0495644_0101563 3300046523 Bacteria 1088
685 Ga0495648_0002812 3300046524 Bacteria 15664
686 Ga0495648_0027211 3300046524 Bacteria 3833
687 Ga0495648_0053583 3300046524 Bacteria 2443
688 Ga0495648_0067554 3300046524 Bacteria 2090
689 Ga0495648_0082316 3300046524 Bacteria 1827
690 Ga0495648_0213126 3300046524 Bacteria 958
691 Ga0495666_0008155 3300046526 Bacteria 5252
692 Ga0495652_0020210 3300046529 Bacteria 5919
693 Ga0495652_0059935 3300046529 Bacteria 3218
694 Ga0495652_0073765 3300046529 Bacteria 2840
695 Ga0495652_0075106 3300046529 Bacteria 2809
696 Ga0495652_0110030 3300046529 Bacteria 2217
697 Ga0495652_0192054 3300046529 Bacteria 1557
698 Ga0495654_0015350 3300046530 Bacteria 4068
699 Ga0495665_0000128 3300046531 Bacteria 36043
700 Ga0495665_0046233 3300046531 Bacteria 2312
701 Ga0495640_0007295 3300046533 Bacteria 8711
702 Ga0495640_0007536 3300046533 Bacteria 8553
703 Ga0495640_0018011 3300046533 Bacteria 5251
704 Ga0495640_0034708 3300046533 Bacteria 3573
705 Ga0495640_0139408 3300046533 Bacteria 1564
706 Ga0495640_0146778 3300046533 Bacteria 1517
707 Ga0495586_0085311 3300046535 Bacteria 1740
708 Ga0495587_0005610 3300046536 Bacteria 8189
709 Ga0495587_0031355 3300046536 Bacteria 3219
710 Ga0495587_0137669 3300046536 Bacteria 1394
711 Ga0495621_0077626 3300046539 Bacteria 1233
712 Ga0495597_0108909 3300046542 Bacteria 1163
713 Ga0495597_0127204 3300046542 Bacteria 1059
714 Ga0495645_0064772 3300046543 Bacteria 2644
715 Ga0495645_0148321 3300046543 Bacteria 1632
716 Ga0495645_0164715 3300046543 Bacteria 1530
717 Ga0495645_0274347 3300046543 Bacteria 1112
718 Ga0495645_0304727 3300046543 Bacteria 1039
719 Ga0495622_0008565 3300046557 Bacteria 4740
720 Ga0495622_0026867 3300046557 Bacteria 2686
721 Ga0495622_0035907 3300046557 Bacteria 2311
722 Ga0495622_0053041 3300046557 Bacteria 1881
723 Ga0495667_0010575 3300046559 Bacteria 6244
724 Ga0495656_0023665 3300046615 Bacteria 2419
725 Ga0495656_0138886 3300046615 Bacteria 1163
726 Ga0495668_0045650 3300046616 Bacteria 2436
727 Ga0495634_0011829 3300046642 Bacteria 6346
728 Ga0495634_0020602 3300046642 Bacteria 4674
729 Ga0495634_0032241 3300046642 Bacteria 3604
730 Ga0495634_0060513 3300046642 Bacteria 2519
731 Ga0495634_0158476 3300046642 Bacteria 1428
732 Ga0495634_0264793 3300046642 Bacteria 1048
733 Ga0495611_0077935 3300046648 Bacteria 1520
734 Ga0495625_0059794 3300046660 Bacteria 2702
735 Ga0495625_0341590 3300046660 Bacteria 948
736 Ga0495635_0017402 3300046663 Bacteria 5021
737 Ga0495635_0037977 3300046663 Bacteria 3333
738 Ga0495635_0076564 3300046663 Bacteria 2292
739 Ga0495635_0208653 3300046663 Bacteria 1323
740 Ga0495659_0011312 3300046664 Bacteria 2875
741 Ga0495661_0096740 3300046665 Bacteria 1669
742 Ga0495661_0098835 3300046665 Bacteria 1646
743 Ga0495588_0002722 3300046674 Bacteria 7577
744 Ga0495588_0050332 3300046674 Bacteria 2143
745 Ga0495588_0059466 3300046674 Bacteria 1977
746 Ga0495588_0079867 3300046674 Bacteria 1707
747 Ga0495588_0085186 3300046674 Bacteria 1652
748 Ga0495657_0019410 3300046675 Bacteria 4904
749 Ga0495657_0029086 3300046675 Bacteria 3878
750 Ga0495657_0087691 3300046675 Bacteria 2002
751 Ga0495657_0142917 3300046675 Bacteria 1490
752 Ga0495599_0000562 3300046678 Bacteria 21198
753 Ga0495599_0034765 3300046678 Bacteria 3165
754 Ga0495599_0202726 3300046678 Bacteria 1218
755 Ga0495623_0021634 3300046679 Bacteria 4153
756 Ga0495623_0039103 3300046679 Bacteria 3032
757 Ga0495623_0106377 3300046679 Bacteria 1704
758 Ga0495646_0023262 3300046680 Bacteria 3902
759 Ga0495646_0030160 3300046680 Bacteria 3387
760 Ga0495646_0058421 3300046680 Bacteria 2306
761 Ga0495646_0071204 3300046680 Bacteria 2046
762 Ga0495646_0117774 3300046680 Bacteria 1506
763 Ga0495647_0000600 3300046681 Bacteria 10656
764 Ga0495658_0001083 3300046683 Bacteria 14340
765 Ga0495658_0086125 3300046683 Bacteria 1853
766 Ga0495658_0423370 3300046683 Bacteria 849
767 Ga0495669_0016067 3300046684 Bacteria 3205
768 Ga0495669_0068699 3300046684 Bacteria 1612
769 Ga0495669_0083607 3300046684 Bacteria 1467
770 Ga0495669_0092101 3300046684 Bacteria 1400
771 Ga0495613_0005438 3300046689 Bacteria 9568
772 Ga0495613_0043339 3300046689 Bacteria 3329
773 Ga0495613_0081991 3300046689 Bacteria 2343
774 Ga0495613_0256649 3300046689 Bacteria 1219
775 Ga0495624_0005136 3300046690 Bacteria 9454
776 Ga0495624_0157631 3300046690 Bacteria 1387
777 Ga0495624_0199746 3300046690 Bacteria 1215
778 Ga0495624_0254433 3300046690 Bacteria 1062
779 Ga0495624_0337989 3300046690 Bacteria 906
780 Ga0495670_0073193 3300046691 Bacteria 1736
781 Ga0495670_0100722 3300046691 Bacteria 1487
782 Ga0495649_0018602 3300046694 Bacteria 3906
783 Ga0495649_0255742 3300046694 Bacteria 899
784 Ga0495600_0016680 3300046809 Bacteria 4666
785 Ga0495600_0022095 3300046809 Bacteria 4082
786 Ga0495600_0038517 3300046809 Bacteria 3111
787 Ga0495600_0202794 3300046809 Bacteria 1273
788 Ga0495600_0220838 3300046809 Bacteria 1212
789 Ga0495581_0003213 3300047315 Bacteria 9361
790 Ga0495581_0139297 3300047315 Bacteria 1415
791 Ga0495604_0006935 3300047317 Bacteria 8979
792 Ga0495604_0021826 3300047317 Bacteria 5111
793 Ga0495604_0036266 3300047317 Bacteria 3887
794 Ga0495604_0082745 3300047317 Bacteria 2399
795 Ga0495604_0220791 3300047317 Bacteria 1305
796 Ga0495604_0329013 3300047317 Bacteria 1020
797 Ga0495604_0333719 3300047317 Bacteria 1011
798 Ga0495674_0010035 3300047319 Bacteria 8975
799 Ga0495674_0034718 3300047319 Bacteria 4557
800 Ga0495674_0036341 3300047319 Bacteria 4434
801 Ga0495674_0102980 3300047319 Bacteria 2427
802 Ga0495674_0206151 3300047319 Bacteria 1630
803 Ga0495674_0314206 3300047319 Bacteria 1278
804 Ga0495672_0047426 3300047320 Bacteria 2555
805 Ga0495672_0109929 3300047320 Bacteria 1481
806 Ga0495676_0007949 3300047321 Bacteria 9724
807 Ga0495676_0030366 3300047321 Bacteria 4588
808 Ga0495676_0032842 3300047321 Bacteria 4377
809 Ga0495680_0009468 3300047322 Bacteria 8758
810 Ga0495680_0064965 3300047322 Bacteria 2796
811 Ga0495683_0068905 3300047323 Bacteria 1739
812 Ga0495687_033438 3300047443 Bacteria 2332
813 Ga0495675_0003041 3300047444 Bacteria 10085
814 Ga0495675_0106695 3300047444 Bacteria 1750
815 Ga0495675_0130282 3300047444 Bacteria 1564
816 Ga0495675_0320784 3300047444 Bacteria 916
817 Ga0495673_0112638 3300047469 Bacteria 1086
818 Ga0495684_0005455 3300047471 Bacteria 9899
819 Ga0495684_0008298 3300047471 Bacteria 8046
820 Ga0495684_0030796 3300047471 Bacteria 4119
821 Ga0495684_0044813 3300047471 Bacteria 3385
822 Ga0495686_0128372 3300047472 Bacteria 1505
823 Ga0495593_0006937 3300047673 Bacteria 6634
824 Ga0495593_0037818 3300047673 Bacteria 2608
825 Ga0495593_0113872 3300047673 Bacteria 1380
826 Ga0495602_0014209 3300048088 Bacteria 8091
827 Ga0495602_0018054 3300048088 Bacteria 7057
828 Ga0495602_0114893 3300048088 Bacteria 2178
829 Ga0495602_0227954 3300048088 Bacteria 1402
830 Ga0495615_0013748 3300048090 Bacteria 1697
831 Ga0496100_0075974 3300048903 Bacteria 2254
832 Ga0496100_0191984 3300048903 Bacteria 1483
833 Ga0496100_0415744 3300048903 Bacteria 1026
834 Ga0496100_0417219 3300048903 Bacteria 1024
835 Ga0496101_0008819 3300048904 Bacteria 6598
836 Ga0496101_0061673 3300048904 Bacteria 2724
837 Ga0496101_0175729 3300048904 Bacteria 1647
838 Ga0496101_0218671 3300048904 Bacteria 1478
839 Ga0496101_0322261 3300048904 Bacteria 1212
840 Ga0496101_0453340 3300048904 Bacteria 1012
841 Ga0496102_0041671 3300048905 Bacteria 4159
842 Ga0496102_0047085 3300048905 Bacteria 3917
843 Ga0496102_0081377 3300048905 Bacteria 2986
844 Ga0496102_0085911 3300048905 Bacteria 2905
845 Ga0496102_0099110 3300048905 Bacteria 2704
846 Ga0496102_0155050 3300048905 Bacteria 2153
847 Ga0496102_0208937 3300048905 Bacteria 1840
848 Ga0496102_0511275 3300048905 Bacteria 1123
849 Ga0496103_0020714 3300048906 Bacteria 3953
850 Ga0496104_0035714 3300048907 Bacteria 4642
851 Ga0496104_0060516 3300048907 Bacteria 3587
852 Ga0496104_0217985 3300048907 Bacteria 1820
853 Ga0496104_0533738 3300048907 Bacteria 1084
854 Ga0496104_0669214 3300048907 Bacteria 946
855 Ga0496105_0005233 3300048908 Bacteria 9834
856 Ga0496105_0171778 3300048908 Bacteria 1777
857 Ga0496105_0187475 3300048908 Bacteria 1692
858 Ga0496105_0210354 3300048908 Bacteria 1585
859 Ga0496106_0001075 3300048909 Bacteria 20159
860 Ga0496106_0006134 3300048909 Bacteria 8889
861 Ga0496106_0033686 3300048909 Bacteria 3823
862 Ga0496106_0034614 3300048909 Bacteria 3774
863 Ga0496106_0057839 3300048909 Bacteria 2933
864 Ga0496106_0120607 3300048909 Bacteria 2049
865 Ga0496106_0337226 3300048909 Bacteria 1210
866 Ga0496107_0002790 3300048910 Bacteria 11524
867 Ga0496107_0017396 3300048910 Bacteria 5057
868 Ga0496107_0111336 3300048910 Bacteria 2012
869 Ga0496107_0275636 3300048910 Bacteria 1252
870 Ga0496107_0291473 3300048910 Bacteria 1215
871 Ga0496108_0000309 3300048911 Bacteria 41957
872 Ga0496108_0016858 3300048911 Bacteria 5971
873 Ga0496108_0028705 3300048911 Bacteria 4603
874 Ga0496108_0121021 3300048911 Bacteria 2245
875 Ga0496109_0000229 3300048912 Bacteria 54733
876 Ga0496109_0091231 3300048912 Bacteria 2817
877 Ga0496109_0106392 3300048912 Bacteria 2605
878 Ga0496109_0153961 3300048912 Bacteria 2153
879 Ga0496110_0011598 3300048913 Bacteria 7224
880 Ga0496110_0034064 3300048913 Bacteria 4409
881 Ga0496110_0038809 3300048913 Bacteria 4145
882 Ga0496110_0138627 3300048913 Bacteria 2199
883 Ga0496110_0275666 3300048913 Bacteria 1531
884 Ga0496110_0359658 3300048913 Bacteria 1326
885 Ga0496111_0011315 3300048914 Bacteria 6006
886 Ga0496111_0131148 3300048914 Bacteria 1854
887 Ga0496111_0265065 3300048914 Bacteria 1274
888 Ga0496112_0000018 3300048915 Bacteria 188820
889 Ga0496112_0053970 3300048915 Bacteria 3948
890 Ga0496112_0074725 3300048915 Bacteria 3351
891 Ga0496112_0143302 3300048915 Bacteria 2358
892 Ga0496112_0157177 3300048915 Bacteria 2240
893 Ga0496112_0455207 3300048915 Bacteria 1217
894 Ga0496112_0722640 3300048915 Bacteria 923
895 Ga0496113_0024174 3300048916 Bacteria 4315
896 Ga0496113_0033720 3300048916 Bacteria 3730
897 Ga0496113_0201756 3300048916 Bacteria 1581
898 Ga0496113_0212151 3300048916 Bacteria 1541
899 Ga0496114_0380658 3300048917 Bacteria 1249
900 Ga0496114_0468702 3300048917 Bacteria 1115
901 Ga0496115_0011619 3300048918 Bacteria 6606
902 Ga0496115_0036077 3300048918 Bacteria 3913
903 Ga0496115_0082294 3300048918 Bacteria 2622
904 Ga0496115_0106272 3300048918 Bacteria 2304
905 Ga0496115_0154204 3300048918 Bacteria 1897
906 Ga0496115_0302273 3300048918 Bacteria 1311
907 Ga0496115_0400346 3300048918 Bacteria 1114
908 Ga0496116_0007008 3300048919 Bacteria 10091
909 Ga0496116_0064921 3300048919 Bacteria 2344
910 Ga0496116_0118276 3300048919 Bacteria 1540
911 Ga0496117_0121490 3300048920 Bacteria 1603
912 Ga0496118_0001623 3300048921 Bacteria 33200
913 Ga0496118_0046366 3300048921 Bacteria 3382
914 Ga0496119_0185423 3300048922 Bacteria 1088
915 Ga0496120_0034831 3300048923 Bacteria 3012
916 Ga0496120_0219111 3300048923 Bacteria 910
917 Ga0496120_0246496 3300048923 Bacteria 841
918 Ga0496121_0000278 3300048924 Bacteria 106838
919 Ga0496121_0001257 3300048924 Bacteria 43906
920 Ga0496121_0071161 3300048924 Bacteria 2798
921 Ga0496121_0093161 3300048924 Bacteria 2346
922 Ga0496121_0142647 3300048924 Bacteria 1774
923 Ga0496121_0259554 3300048924 Bacteria 1200
924 Ga0496121_0292090 3300048924 Bacteria 1110
925 Ga0496122_0011998 3300048925 Bacteria 8690
926 Ga0496122_0039152 3300048925 Bacteria 3784
927 Ga0496123_0030316 3300048926 Bacteria 3961
928 Ga0496124_0003799 3300048927 Bacteria 18136
929 Ga0496124_0155417 3300048927 Bacteria 1789
930 Ga0496124_0301611 3300048927 Bacteria 1157
931 Ga0496124_0343759 3300048927 Bacteria 1058
932 Ga0496125_0054026 3300048928 Bacteria 3287
933 Ga0496125_0082443 3300048928 Bacteria 2451
934 Ga0496125_0107960 3300048928 Bacteria 2026
935 Ga0496125_0140980 3300048928 Bacteria 1676
936 Ga0496126_0003267 3300048929 Bacteria 20694
937 Ga0496126_0003347 3300048929 Bacteria 20346
938 Ga0496126_0009942 3300048929 Bacteria 10046
939 Ga0496126_0013009 3300048929 Bacteria 8491
940 Ga0496126_0194593 3300048929 Bacteria 1715
941 Ga0496126_0199109 3300048929 Bacteria 1692
942 Ga0496126_0360942 3300048929 Bacteria 1186
943 Ga0501046_0522547 3300049580 Bacteria 848
944 Ga0501047_0006910 3300049581 Bacteria 10662
945 Ga0501067_0026967 3300049583 Bacteria 3182
946 Ga0501067_0076036 3300049583 Bacteria 1860
947 Ga0501070_0004413 3300049586 Bacteria 12077
948 Ga0501073_0128745 3300049589 Bacteria 1755
949 Ga0501074_0041688 3300049590 Bacteria 3323
950 Ga0501080_0044907 3300049742 Bacteria 4112
951 nmdc:mga03n38_13142_c1 3300050490 Bacteria 3136
952 nmdc:mga03n38_167578_c1 3300050490 Bacteria 1116
953 nmdc:mga03n38_47675_c1 3300050490 Bacteria 1897
954 nmdc:mga00v17_200478_c1 3300050491 Bacteria 1290
955 nmdc:mga0yw44_115572_c1 3300050492 Bacteria 1724
956 nmdc:mga0yw44_167396_c1 3300050492 Bacteria 1442
957 nmdc:mga0yw44_176725_c1 3300050492 Bacteria 1404
958 nmdc:mga0yw44_210893_c1 3300050492 Bacteria 1285
959 nmdc:mga06z11_228314_c1 3300050494 Bacteria 1090
960 nmdc:mga06z11_39634_c1 3300050494 Bacteria 2346
961 nmdc:mga06z11_72147_c1 3300050494 Bacteria 1830
962 nmdc:mga04h51_48171_c1 3300050495 Bacteria 1419
963 nmdc:mga07m45_76209_c1 3300050496 Bacteria 1912
964 nmdc:mga0qj67_388766_c1 3300050509 Bacteria 1126
965 nmdc:mga08y16_172453_c1 3300050511 Bacteria 2247
966 nmdc:mga0n895_380753_c1 3300050512 Bacteria 1428
967 nmdc:mga0n895_87550_c1 3300050512 Bacteria 3112
968 nmdc:mga0rr50_373787_c1 3300050513 Bacteria 1201
969 nmdc:mga08x19_228219_c1 3300050514 Bacteria 1281
970 Ga0495601_0039160 3300053077 Bacteria 2968
971 Ga0495601_0072161 3300053077 Bacteria 2205
972 Ga0495601_0135490 3300053077 Bacteria 1605
973 Ga0495612_0023765 3300053078 Bacteria 2460
974 Ga0495612_0036891 3300053078 Bacteria 1984
975 Ga0495655_0039782 3300053083 Bacteria 1194
976 Ga0495655_0058366 3300053083 Bacteria 1045
977 Ga0495595_0068269 3300053084 Bacteria 1676
978 Ga0495595_0167678 3300053084 Bacteria 1086
979 Ga0495619_0014255 3300053085 Bacteria 5021
980 Ga0495619_0014580 3300053085 Bacteria 4965
981 Ga0495619_0253404 3300053085 Bacteria 1220
982 Ga0500578_0126053 3300053086 Bacteria 1608
983 Ga0500578_0360674 3300053086 Bacteria 847
984 Ga0500643_000076 3300053087 Bacteria 106911
985 Ga0500646_0024650 3300053090 Bacteria 1620
986 Ga0500647_0155035 3300053091 Bacteria 1066
987 Ga0500583_0195420 3300053092 Bacteria 1006
988 Ga0500651_0117439 3300053093 Bacteria 1618
989 Ga0500566_0000107 3300053094 Bacteria 42130
990 Ga0500566_0000277 3300053094 Bacteria 27736
991 Ga0500566_0027098 3300053094 Bacteria 3354
992 Ga0500566_0141784 3300053094 Bacteria 1274
993 Ga0500641_0008698 3300053096 Bacteria 3631
994 Ga0500641_0025456 3300053096 Bacteria 2289
995 Ga0500641_0037408 3300053096 Bacteria 1946
996 Ga0500641_0092760 3300053096 Bacteria 1290
997 Ga0500650_0000600 3300053098 Bacteria 9375
998 Ga0500554_001768 3300053102 Bacteria 4170
999 Ga0500555_023671 3300053103 Bacteria 1761
1000 Ga0500556_0000081 3300053104 Bacteria 90508
1001 Ga0500556_0017598 3300053104 Bacteria 2243
1002 Ga0500557_000102 3300053105 Bacteria 26497
1003 Ga0500562_004092 3300053108 Bacteria 3676
1004 Ga0500572_000551 3300053111 Bacteria 12753
1005 Ga0500592_005464 3300053116 Bacteria 2024
1006 Ga0500593_120445 3300053117 Bacteria 1064
1007 Ga0500594_0053185 3300053118 Bacteria 1146
1008 Ga0500595_001181 3300053119 Bacteria 14424
1009 Ga0500595_005078 3300053119 Bacteria 5783
1010 Ga0500595_007372 3300053119 Bacteria 4567
1011 Ga0500595_008629 3300053119 Bacteria 4158
1012 Ga0500595_028755 3300053119 Bacteria 1893
1013 Ga0500595_052637 3300053119 Bacteria 1256
1014 Ga0500608_004273 3300053122 Bacteria 5499
1015 Ga0500608_018401 3300053122 Bacteria 3187
1016 Ga0500614_073082 3300053123 Bacteria 946
1017 Ga0500618_009731 3300053125 Bacteria 2613
1018 Ga0500618_029191 3300053125 Bacteria 1302
1019 Ga0500642_0000042 3300053130 Bacteria 86476
1020 Ga0500642_0000225 3300053130 Bacteria 22158
1021 Ga0500642_0013084 3300053130 Bacteria 3036
1022 Ga0500658_0086267 3300053134 Bacteria 1350
1023 Ga0500658_0104976 3300053134 Bacteria 1237
1024 Ga0500658_0130753 3300053134 Bacteria 1119
1025 Ga0500559_0000857 3300053136 Bacteria 19581
1026 Ga0500559_0001081 3300053136 Bacteria 16536
1027 Ga0500559_0028198 3300053136 Bacteria 2398
1028 Ga0500559_0066362 3300053136 Bacteria 1618
1029 Ga0500568_0002631 3300053139 Bacteria 10435
1030 Ga0500568_0078038 3300053139 Bacteria 1259
1031 Ga0500573_0133350 3300053140 Bacteria 1373
1032 Ga0500589_167996 3300053147 Bacteria 875
1033 Ga0500590_110886 3300053148 Bacteria 1302
1034 Ga0500590_141658 3300053148 Bacteria 1098
1035 Ga0500603_005971 3300053150 Bacteria 2637
1036 Ga0500603_037087 3300053150 Bacteria 1285
1037 Ga0500603_040616 3300053150 Bacteria 1239
1038 Ga0500604_0008728 3300053151 Bacteria 2692
1039 Ga0500604_0016789 3300053151 Bacteria 2019
1040 Ga0500622_0002743 3300053156 Bacteria 12429
1041 Ga0500622_0004916 3300053156 Bacteria 8165
1042 Ga0500627_0087881 3300053158 Bacteria 1390
1043 Ga0500634_0088886 3300053161 Bacteria 1573
1044 Ga0500638_000149 3300053162 Bacteria 13453
1045 Ga0500638_075005 3300053162 Bacteria 1612
1046 Ga0500638_078416 3300053162 Bacteria 1571
1047 Ga0500639_087494 3300053163 Bacteria 1558
1048 Ga0500636_0001169 3300053177 Bacteria 14139
1049 Ga0500636_0003600 3300053177 Bacteria 8736
1050 Ga0500636_0047546 3300053177 Bacteria 2526
1051 Ga0500636_0050962 3300053177 Bacteria 2433
1052 Ga0500637_0001223 3300053178 Bacteria 10739
1053 Ga0500637_0002162 3300053178 Bacteria 8644
1054 Ga0500637_0035867 3300053178 Bacteria 2782
1055 Ga0500576_100726 3300053725 Bacteria 1180
1056 Ga0500625_138188 3300053729 Bacteria 942
1057 Ga0500645_011424 3300053730 Bacteria 2900
1058 Ga0500645_026733 3300053730 Bacteria 1754
1059 Ga0500609_004978 3300053731 Bacteria 1820
1060 Ga0500552_005939 3300053733 Bacteria 1350
1061 Ga0500596_000611 3300053735 Bacteria 6864
1062 Ga0500596_014148 3300053735 Bacteria 1202
1063 Ga0500601_002393 3300053737 Bacteria 2015
1064 Ga0500601_010689 3300053737 Bacteria 1029
1065 Ga0500661_005251 3300055283 Bacteria 2424
1066 2507505410 2507262055 Bacteria 8048963
1067 2508539296 2508501009 Bacteria 7784016
1068 2508695623 2508501042 Bacteria 8719808
1069 2509152137 2508501128 Bacteria 8613869
1070 2511394501 2511231028 Bacteria 8046582
1071 2513623967 2513237092 Bacteria 8341956
1072 2513642149 2513237094 Bacteria 8789602
1073 2513659466 2513237096 Bacteria 8722461
1074 2513675003 2513237098 Bacteria 9902361
1075 2513695247 2513237101 Bacteria 7952346
1076 2513704800 2513237102 Bacteria 7703324
1077 2513859428 2513237137 Bacteria 9558895
1078 2513873391 2513237139 Bacteria 8737671
1079 2513888618 2513237141 Bacteria 8496279
1080 2513921601 2513237145 Bacteria 8979722
1081 2514014721 2513237161 Bacteria 8871253
1082 2515627605 2515154112 Bacteria 8294334
1083 2517106324 2517093001 Bacteria 9002274
1084 2517889006 2517572143 Bacteria 9484767
1085 2524441396 2524023205 Bacteria 8918781
1086 2524467025 2524023210 Bacteria 9029266
1087 2524537432 2524023228 Bacteria 10118060
1088 2528855058 2528768022 Bacteria 10457665
1089 2603858334 2602042107 Bacteria 6226103
1090 2617352101 2617270735 Bacteria 9163226
1091 2617373570 2617270741 Bacteria 8201522
1092 2671122601 2667528175 Bacteria 7532676
1093 2728748475 2728368998 Bacteria 8720350
1094 2745077528 2744054633 Bacteria 8678936
1095 2793062188 2791355196 Bacteria 7323613
1096 2793073688 2791355197 Bacteria 8420563
1097 2793078351
1098 2805920739 2802429603 Bacteria 8777136
1099 2818237811 2816332527 Bacteria 8933356
1100 2824607323 2824600985 Bacteria 8488197
1101 2824616887 2824609381 Bacteria 8672835
1102 2824624404 2824617872 Bacteria 8814715
1103 2824632773 2824626560 Bacteria 8813858
1104 2824642055 2824635225 Bacteria 8785348
1105 2824649489 2824644064 Bacteria 8743947
1106 2824659691 2824653114 Bacteria 8493680
1107 2824669411 2824661429 Bacteria 9877870
1108 2824686305 2824679649 Bacteria 8248951
1109 2824702723 2824696289 Bacteria 8335049
1110 2824711444 2824704595 Bacteria 9667483
1111 2824719374 2824714736 Bacteria 8717648
1112 2824729879 2824723954 Bacteria 8758240
1113 2824738928 2824732956 Bacteria 7810675
1114 2824751656 2824746037 Bacteria 7911610
1115 2824762550 2824753945 Bacteria 9787441
1116 2824771884 2824763712 Bacteria 9792355
1117 2824780793 2824773399 Bacteria 8360218
1118 2838124653 2838122688 Bacteria 8803140
1119 2841945344 2841941048 Bacteria 8688029
1120 2841952129 2841949485 Bacteria 8680857
1121 2841965457 2841957949 Bacteria 8652217
1122 2841970483 2841966195 Bacteria 8673214
1123 2841981731 2841974524 Bacteria 8931498
1124 2841985012 2841983080 Bacteria 8395090
1125 2842043368 2842038055 Bacteria 8002051
1126 2842052642 2842045827 Bacteria 8006841
1127 2844315500 2844315083 Bacteria 8138177
1128 2847931206 2847930680 Bacteria 9342022
1129 2847942296 2847939898 Bacteria 8606328
1130 2849083170 2849076700 Bacteria 7039503
1131 2857516397 2857509624 Bacteria 7472071
1132 2874591673 2874590934 Bacteria 8299676
1133 2874607930 2874604998 Bacteria 7834745
1134 2874619101 2874612657 Bacteria 8252029
1135 2874621246 2874620515 Bacteria 8290088
1136 2874628645 2874628541 Bacteria 8630250
1137 2874646158 2874645413 Bacteria 8214782
1138 2876769596 2876761206 Bacteria 10111113
1139 2876771774 2876771140 Bacteria 8287509
1140 2876812457 2876808645 Bacteria 8824342
1141 2876819118 2876818435 Bacteria 8274608
1142 2879075635 2879074833 Bacteria 8279565
1143 2879085545 2879083081 Bacteria 8587928
1144 2879105883 2879099564 Bacteria 10442239
1145 2879113357 2879110137 Bacteria 8907982
1146 2879128444 2879127579 Bacteria 8294491
1147 2879143578 2879142872 Bacteria 8267021
1148 2881369268 2881364244 Bacteria 7710352
1149 2881669951 2881665667 Bacteria 8175609
1150 2885369377 2885366525 Bacteria 8326213
1151 2885382794 2885374607 Bacteria 8927485
1152 2885388542 2885383462 Bacteria 9473874
1153 2885411836 2885409591 Bacteria 9235467
1154 2888379448 2888378607 Bacteria 9652610
1155 2888390543 2888388044 Bacteria 7304136
1156 2888420166 2888419890 Bacteria 7857137
1157 2889035346 2889033259 Bacteria 9099371
1158 2903733453 2903727486 Bacteria 8281579
1159 2903758966 2903748898 Bacteria 9972761
1160 2903775479 2903768456 Bacteria 9749579
1161 2904667791 2904666416 Bacteria 8226587
1162 2904691051 2904690495 Bacteria 9412302
1163 2904708456
1164 2904716372 2904711408 Bacteria 9771557
1165 2906608589 2906602504 Bacteria 8295279
1166 2906613624
1167 2906628549 2906626472 Bacteria 8826946
1168 2906651401 2906643746 Bacteria 8722424
1169 2908747604 2908739725 Bacteria 8628932
1170 2908757109 2908756301 Bacteria 8864324
1171 2908776043 2908775508 Bacteria 8092255
1172 2922369433
1173 2922388532 2922386360 Bacteria 7017218
1174 2922398132 2922393267 Bacteria 8285685
1175 2922434059
1176 2929618738 2929615660 Bacteria 9193770
1177 2929628577 2929624759 Bacteria 9339455
1178 2932790919 2932784394 Bacteria 9704911
1179 2932794185 2932794094 Bacteria 7915132
1180 2932809259 2932801729 Bacteria 7987968
1181 2932812028 2932809354 Bacteria 9135765
1182 2932825521 2932818245 Bacteria 9955613
1183 2932833635 2932828146 Bacteria 9745859
1184 2933580552 2933577622 Bacteria 9116884
1185 2935615562 2935608549 Bacteria 8203142
1186 2935623161 2935616580 Bacteria 9032984
1187 2935636090 2935630451 Bacteria 8169952
1188 2935644236 2935638405 Bacteria 10015038
1189 2935654492 2935648319 Bacteria 8801166
1190 2935663372 2935656913 Bacteria 8965014
1191 2935672182 2935665750 Bacteria 9571747
1192 2935679297 2935675223 Bacteria 9928132
1193 2935686538 2935684952 Bacteria 9590419
1194 2935700321 2935694250 Bacteria 9291695
1195 2935710269 2935703347 Bacteria 10242284
1196 2935716226 2935713505 Bacteria 9608509
1197 2935723650 2935722832 Bacteria 9608746
1198 2935735205 2935732158 Bacteria 9706831
1199 2935744004 2935741537 Bacteria 9707219
1200 2935752504 2935750917 Bacteria 9590372
1201 2935763362 2935760218 Bacteria 9817913
1202 2935808260 2935801545 Bacteria 9301974
1203 2935816127 2935810662 Bacteria 9401221
1204 2935825637 2935819856 Bacteria 8261050
1205 2935833520 2935827899 Bacteria 10038562
1206 2935844473 2935837841 Bacteria 9454360
1207 2935853401 2935847175 Bacteria 8228321
1208 2935861409 2935855204 Bacteria 9035059
1209 2935869528 2935864058 Bacteria 9784707
1210 2935879857 2935873716 Bacteria 9632195
1211 2935889210 2935883170 Bacteria 7964738
1212 2935915003 2935908558 Bacteria 8568796
1213 2935918851 2935916978 Bacteria 9113783
1214 2935931432 2935926038 Bacteria 8601059
1215 2935940029 2935934488 Bacteria 8602579
1216 2935947624 2935942939 Bacteria 8599779
1217 2935956395 2935951376 Bacteria 8602333
1218 2935966765 2935959822 Bacteria 7869783
1219 2935973189 2935967501 Bacteria 8603075
1220 2935980567 2935975950 Bacteria 8347125
1221 2935990081 2935984226 Bacteria 8302647
1222 2935997920 2935992306 Bacteria 9802711
1223 2936008815 2936002035 Bacteria 9362176
1224 2936017469 2936011229 Bacteria 8801034
1225 2936026030 2936019824 Bacteria 8804134
1226 2936034872 2936028420 Bacteria 8965941
1227 2936041132 2936037263 Bacteria 9446081
1228 2936052870 2936046547 Bacteria 8903709
1229 2936060273 2936055302 Bacteria 8785755
1230 2940558417 2940556831 Bacteria 9590747
1231 2941512606 2941507105 Bacteria 8166816
1232 2941520556 2941515067 Bacteria 8166720
1233 2941528570 2941523033 Bacteria 8169134
1234 2941535384 2941531003 Bacteria 7653939
1235 2941543354 2941538514 Bacteria 9402094
1236 3005475226 3005474847 Bacteria 9259049
1237 3005486719 3005483717 Bacteria 7877331
1238 3005509024 3005506211 Bacteria 6943378
1239 3005594089 3005587118 Bacteria 7794411
1240 3005595188 3005594810 Bacteria 8716512
1241 3005711134 3005710791 Bacteria 7622528
1242 3005718432 3005718088 Bacteria 8283608
1243 8006936053 8006933436 Bacteria 10410654
1244 8006967593 8006964411 Bacteria 8966052
1245 8006975823 8006973647 Bacteria 10679141
1246 8006991062 8006984368 Bacteria 9651211
1247 8007000392 8006994254 Bacteria 8309700
1248 8016518042 8016511872 Bacteria 9921665
1249 8016526285 8016522445 Bacteria 8156687
1250 8016531344 8016530956 Bacteria 8155261
1251 8016544562 8016539877 Bacteria 8155419
1252 8016557515 8016548790 Bacteria 8155074
1253 8016565871 8016557553 Bacteria 8154380
1254 8016603470 8016595262 Bacteria 8149947
1255 8016606412 8016603502 Bacteria 8731218
1256 8016635469 8016630954 Bacteria 9217207
1257 8017058603 8017057580 Bacteria 10023680
1258 8019531179 8019530166 Bacteria 8155624
1259 8019562604 8019555841 Bacteria 9642137
1260 8019572682 8019565922 Bacteria 9639779
1261 8019577056 8019576017 Bacteria 10049540
1262 8019595125 8019586578 Bacteria 10212056
1263 8019606618 8019597564 Bacteria 10041141
1264 8019611895 8019608314 Bacteria 10042931
1265 8019623121 8019619141 Bacteria 9218857
1266 8019629979 8019629233 Bacteria 8687553
1267 8019640628 8019638758 Bacteria 9062356
1268 8019666819 8019659431 Bacteria 8577854
1269 8019676576 8019668869 Bacteria 8791617
1270 8019679414 8019678201 Bacteria 8863603
1271 8055742587 8055742211 Bacteria 9226248
1272 8056676097 8056673599 Bacteria 7871253
1273 8056682898 8056681323 Bacteria 8472857
1274 8056691101 8056689827 Bacteria 6712655
1275 8056971444 8056967851 Bacteria 9038162
1276 Ga0207708_10168070
1277 JGI24740J21852_10005020
1278 JGI24737J22298_10008460
1279 JGI25406J46586_10000915
1280 JGI25406J46586_10007375
1281 JGI25165J46597_1014680
1282 JGI25153J46596_10009437
1283 JGI25153J46596_10015245
1284 JGI25160J50197_1005997
1285 JGI25160J50197_1019333
1286 Ga0055539_1004550
1287 Ga0055531_10006765
1288 Ga0065165_1005936
1289 Ga0070658_10546748
1290 Ga0070676_10182125
1291 Ga0070683_100019475
1292 Ga0070690_100085911
1293 Ga0070670_100043583
1294 Ga0070670_100119653
1295 Ga0070670_100519945
1296 Ga0068869_100051564
1297 Ga0068869_100271958
1298 Ga0068869_100370751
1299 Ga0068869_100606099
1300 Ga0068869_100683718
1301 Ga0070680_100055433
1302 Ga0070680_100222463
1303 Ga0070660_100001075
1304 Ga0070660_100180794
1305 Ga0070660_100231833
1306 Ga0070689_100248673
1307 Ga0070691_10105060
1308 Ga0070687_100057024
1309 Ga0070661_100035628
1310 Ga0070661_100517174
1311 Ga0070668_100188166
1312 Ga0070668_100228150
1313 Ga0070668_100313191
1314 Ga0070668_100550132
1315 Ga0070669_100071036
1316 Ga0070671_100165443
1317 Ga0070671_100514123
1318 Ga0070674_100188614
1319 Ga0070674_100350990
1320 Ga0070673_100243980
1321 Ga0070673_100332377
1322 Ga0070688_100238895
1323 Ga0070688_100362765
1324 Ga0070667_100261908
1325 Ga0070709_10007973
1326 Ga0070709_10025469
1327 Ga0070713_100016372
1328 Ga0070713_100040826
1329 Ga0070713_100046950
1330 Ga0070710_10002189
1331 Ga0070710_10017653
1332 Ga0070710_10053633
1333 Ga0070701_10271717
1334 Ga0070711_100001652
1335 Ga0070711_100020415
1336 Ga0070700_100127250
1337 Ga0070663_100044119
1338 Ga0070663_100046917
1339 Ga0070663_100072148
1340 Ga0070663_100168690
1341 Ga0070678_100120701
1342 Ga0070678_100123023
1343 Ga0070678_100134879
1344 Ga0070662_100094105
1345 Ga0070662_100328695
1346 Ga0070681_10009671
1347 Ga0070681_10025343
1348 Ga0068867_100195740
1349 Ga0068867_100509236
1350 Ga0070706_100167339
1351 Ga0070706_100430541
1352 Ga0070698_100041947
1353 Ga0070698_100555351
1354 Ga0070699_100142347
1355 Ga0070679_100019056
1356 Ga0070679_100045610
1357 Ga0070679_100048159
1358 Ga0070679_100108238
1359 Ga0070679_100481550
1360 Ga0070684_100007076
1361 Ga0070684_100011685
1362 Ga0070697_100013361
1363 Ga0068853_100052993
1364 Ga0068853_100210435
1365 Ga0068853_100302979
1366 Ga0070672_100109953
1367 Ga0070672_100153248
1368 Ga0070672_100217010
1369 Ga0070672_100376622
1370 Ga0070686_100197296
1371 Ga0070686_100269415
1372 Ga0070695_100286477
1373 Ga0070696_100485359
1374 Ga0070665_100026811
1375 Ga0070665_100042207
1376 Ga0070665_100071603
1377 Ga0070665_100166368
1378 Ga0070665_100378656
1379 Ga0070665_100418995
1380 Ga0070665_100580881
1381 Ga0068855_100044373
1382 Ga0068855_100044540
1383 Ga0068855_100050100
1384 Ga0068855_100301187
1385 Ga0068855_100630919
1386 Ga0068855_100962064
1387 Ga0070664_100158287
1388 Ga0070664_100325492
1389 Ga0070664_100463991
1390 Ga0068857_100008930
1391 Ga0068857_100013150
1392 Ga0068857_100022226
1393 Ga0068854_100018010
1394 Ga0068854_100028179
1395 Ga0068854_100352176
1396 Ga0068854_100437100
1397 Ga0068856_100013958
1398 Ga0068856_100037942
1399 Ga0068856_100042359
1400 Ga0068856_100261073
1401 Ga0068852_100076112
1402 Ga0068852_100082459
1403 Ga0068852_100092974
1404 Ga0068852_100118263
1405 Ga0068852_100934871
1406 Ga0068859_100166910
1407 Ga0068859_100615841
1408 Ga0068859_100778995
1409 Ga0068864_100063118
1410 Ga0068864_100273938
1411 Ga0068866_10091135
1412 Ga0068861_100052851
1413 Ga0068861_100204526
1414 Ga0068851_10015565
1415 Ga0068851_10256226
1416 Ga0068863_100170331
1417 Ga0068863_100214768
1418 Ga0068858_100064112
1419 Ga0068858_100110112
1420 Ga0068858_100127257
1421 Ga0068858_100317348
1422 Ga0068858_100412372
1423 Ga0068858_100534950
1424 Ga0068860_100000477
1425 Ga0068860_100148278
1426 Ga0068860_100428295
1427 Ga0068860_100586364
1428 Ga0068862_100233210
1429 Ga0068862_100402066
1430 Ga0081455_10017064
1431 Ga0081455_10019554
1432 Ga0081455_10079472
1433 Ga0081455_10365700
1434 Ga0081540_1001247
1435 Ga0081540_1006252
1436 Ga0081540_1007349
1437 Ga0081540_1009140
1438 Ga0081540_1011012
1439 Ga0081540_1014005
1440 Ga0081540_1023509
1441 Ga0081540_1029355
1442 Ga0081540_1036844
1443 Ga0081540_1042418
1444 Ga0081539_10000371
1445 Ga0081539_10003753
1446 Ga0081539_10027474
1447 Ga0081539_10033413
1448 Ga0070717_10007759
1449 Ga0070717_10010181
1450 Ga0070717_10217047
1451 Ga0070717_10676887
1452 Ga0075365_10093004
1453 Ga0075365_10180396
1454 Ga0075365_10229685
1455 Ga0075365_10349106
1456 Ga0075368_10028196
1457 Ga0075363_100085594
1458 Ga0070715_10120031
1459 Ga0070716_100042649
1460 Ga0070716_100071251
1461 Ga0070716_100196355
1462 Ga0070712_100016641
1463 Ga0070712_100042188
1464 Ga0070712_100509458
1465 Ga0075362_10105188
1466 Ga0075367_10120046
1467 Ga0075369_10048814
1468 Ga0075369_10153452
1469 Ga0075366_10139489
1470 Ga0097621_100510710
1471 Ga0075370_10029972
1472 Ga0075370_10064727
1473 Ga0075370_10117821
1474 Ga0068871_100114354
1475 Ga0068871_100320516
1476 Ga0075430_100406551
1477 Ga0075436_100209016
1478 Ga0097620_100166923
1479 Ga0097620_100615817
1480 Ga0097620_100778902
1481 Ga0099824_1009377
1482 Ga0099822_1000918
1483 Ga0075435_100155550
1484 Ga0099794_10006185
1485 Ga0099795_10028449
1486 Ga0099795_10083578
1487 Ga0105240_10002459
1488 Ga0105240_10014175
1489 Ga0105240_10018930
1490 Ga0105240_10067208
1491 Ga0105240_10146885
1492 Ga0105240_10226877
1493 Ga0111539_10588126
1494 Ga0105245_10070499
1495 Ga0105245_10157149
1496 Ga0105245_10729078
1497 Ga0105247_10035861
1498 Ga0105247_10257752
1499 Ga0105243_10214772
1500 Ga0105243_10275979
1501 Ga0105243_10481613
1502 Ga0105241_10000249
1503 Ga0105241_10056480
1504 Ga0105241_10124868
1505 Ga0105241_10252866
1506 Ga0105241_10297611
1507 Ga0105241_10456533
1508 Ga0105242_10077591
1509 Ga0105242_10202597
1510 Ga0105242_10302464
1511 Ga0105242_10378730
1512 Ga0105248_10179660
1513 Ga0105248_10347956
1514 Ga0105248_10622950
1515 Ga0105237_10010653
1516 Ga0105237_10014068
1517 Ga0105237_10031484
1518 Ga0105237_10539836
1519 Ga0105237_10585533
1520 Ga0105238_10005612
1521 Ga0105238_10013147
1522 Ga0105238_10192759
1523 Ga0105238_10199327
1524 Ga0105238_10726259
1525 Ga0105249_10354188
1526 Ga0105249_10480084
1527 Ga0099796_10008025
1528 Ga0099796_10030133
1529 Ga0105239_10012784
1530 Ga0105239_10014648
1531 Ga0105239_10043484
1532 Ga0105239_10150620
1533 Ga0105239_10151693
1534 Ga0105239_10653470
1535 Ga0105239_10711510
1536 Ga0105246_10062059
1537 Ga0105246_10526915
1538 Ga0157373_10192907
1539 Ga0157370_10042620
1540 Ga0157370_10070601
1541 Ga0157369_10303761
1542 Ga0157369_10640652
1543 Ga0157374_10248139
1544 Ga0157378_10112031
1545 Ga0157378_10705296
1546 Ga0163162_10134527
1547 Ga0163162_10495698
1548 Ga0163162_10509196
1549 Ga0157372_10164183
1550 Ga0157375_10055933
1551 Ga0157375_10655909
1552 Ga0157375_10834080
1553 Ga0163163_10333035
1554 Ga0163163_10399415
1555 Ga0163163_10529979
1556 Ga0163163_10740892
1557 Ga0157380_10075144
1558 Ga0157380_10393906
1559 Ga0157377_10108853
1560 Ga0157379_10060438
1561 Ga0157379_10088121
1562 Ga0157379_10106961
1563 Ga0157379_10532480
1564 Ga0157376_10090409
1565 Ga0157376_10180325
1566 Ga0157376_10862356
1567 Ga0163161_10210421
1568 Ga0214544_1000056
1569 Ga0214542_1000071
1570 Ga0214545_1000033
1571 Ga0214543_1000105
1572 Ga0213876_10142204
1573 Ga0207425_1019783
1574 Ga0209677_100170
1575 Ga0209677_111529
1576 Ga0209148_1000295
1577 Ga0209233_1001518
1578 Ga0209233_1008835
1579 Ga0209455_1001656
1580 Ga0209564_1006432
1581 Ga0209564_1014608
1582 Ga0209564_1015692
1583 Ga0209758_1000069
1584 Ga0209758_1000253
1585 Ga0209758_1000397
1586 Ga0209758_1007518
1587 Ga0209758_1011392
1588 Ga0209758_1050116
1589 Ga0209758_1061866
1590 Ga0209758_1084644
1591 Ga0209256_1007295
1592 Ga0209256_1025105
1593 Ga0209256_1034456
1594 Ga0207426_1001927
1595 Ga0207426_1002760
1596 Ga0207426_1005115
1597 Ga0207426_1005770
1598 Ga0207426_1028628
1599 Ga0209257_1005744
1600 Ga0207697_10040431
1601 Ga0207656_10016880
1602 Ga0207682_10116352
1603 Ga0207692_10004175
1604 Ga0207692_10103730
1605 Ga0207710_10146216
1606 Ga0207688_10104785
1607 Ga0207688_10211785
1608 Ga0207647_10016684
1609 Ga0207699_10005583
1610 Ga0207699_10096190
1611 Ga0207699_10178181
1612 Ga0207645_10161208
1613 Ga0207705_10088303
1614 Ga0207684_10238619
1615 Ga0207684_10309523
1616 Ga0207684_10401479
1617 Ga0207654_10000083
1618 Ga0207654_10178892
1619 Ga0207654_10242604
1620 Ga0207707_10000445
1621 Ga0207707_10001947
1622 Ga0207707_10004159
1623 Ga0207707_10243457
1624 Ga0207695_10000148
1625 Ga0207695_10000387
1626 Ga0207695_10106551
1627 Ga0207695_10205773
1628 Ga0207695_10304020
1629 Ga0207671_10095512
1630 Ga0207671_10119710
1631 Ga0207671_10176774
1632 Ga0207671_10210814
1633 Ga0207671_10273577
1634 Ga0207693_10020364
1635 Ga0207693_10026947
1636 Ga0207663_10005695
1637 Ga0207663_10006822
1638 Ga0207663_10015460
1639 Ga0207663_10371474
1640 Ga0207660_10074471
1641 Ga0207657_10003784
1642 Ga0207657_10062344
1643 Ga0207657_10238087
1644 Ga0207649_10092828
1645 Ga0207649_10159508
1646 Ga0207652_10076415
1647 Ga0207652_10095479
1648 Ga0207652_10405291
1649 Ga0207694_10000121
1650 Ga0207694_10160471
1651 Ga0207694_10304916
1652 Ga0207694_10389554
1653 Ga0207650_10286628
1654 Ga0207659_10123545
1655 Ga0207687_10049484
1656 Ga0207687_10151184
1657 Ga0207700_10019025
1658 Ga0207700_10100327
1659 Ga0207700_10371070
1660 Ga0207664_10114185
1661 Ga0207644_10284042
1662 Ga0207644_10440591
1663 Ga0207644_10615744
1664 Ga0207706_10210582
1665 Ga0207706_10351551
1666 Ga0207706_10371531
1667 Ga0207706_10383472
1668 Ga0207686_10303706
1669 Ga0207686_10345265
1670 Ga0207686_10346993
1671 Ga0207709_10073054
1672 Ga0207709_10250846
1673 Ga0207709_10579158
1674 Ga0207669_10022383
1675 Ga0207665_10012221
1676 Ga0207665_10092979
1677 Ga0207665_10147019
1678 Ga0207665_10201037
1679 Ga0207691_10121306
1680 Ga0207691_10270284
1681 Ga0207711_10310718
1682 Ga0207711_10315009
1683 Ga0207711_10800516
1684 Ga0207689_10069376
1685 Ga0207689_10093451
1686 Ga0207689_10130195
1687 Ga0207661_10011706
1688 Ga0207661_10141606
1689 Ga0207679_10101728
1690 Ga0207679_10235615
1691 Ga0207679_10278286
1692 Ga0207667_10059290
1693 Ga0207667_10095652
1694 Ga0207667_10107566
1695 Ga0207667_10724014
1696 Ga0207651_10392804
1697 Ga0207712_10281001
1698 Ga0207668_10077201
1699 Ga0207640_10116432
1700 Ga0207640_10410167
1701 Ga0207658_10150570
1702 Ga0207677_10044527
1703 Ga0207677_10298398
1704 Ga0207703_10104482
1705 Ga0207703_10201723
1706 Ga0207639_10066593
1707 Ga0207639_10109567
1708 Ga0207639_10240029
1709 Ga0207639_10338609
1710 Ga0207678_10017660
1711 Ga0207678_10102578
1712 Ga0207678_10235186
1713 Ga0207678_10331728
1714 Ga0207678_10435100
1715 Ga0207708_10197943
1716 Ga0207702_10000004
1717 Ga0207702_10010411
1718 Ga0207702_10164524
1719 Ga0207702_10402873
1720 Ga0207641_10368481
1721 Ga0207648_10043666
1722 Ga0207648_10348684
1723 Ga0207676_10118366
1724 Ga0207674_10005754
1725 Ga0207674_10051030
1726 Ga0207674_10060831
1727 Ga0207675_100066332
1728 Ga0207675_100227027
1729 Ga0207675_100581960
1730 Ga0207683_10120243
1731 Ga0207683_10152798
1732 Ga0207683_10245760
1733 Ga0207683_10268193
1734 Ga0207683_10452079
1735 Ga0207683_10475670
1736 Ga0207698_10055584
1737 Ga0207698_10062251
1738 Ga0207698_10092809
1739 Ga0209389_1000157
1740 Ga0209589_1000035
1741 Ga0209489_100079
1742 Ga0209489_101111
1743 Ga0209489_108314
1744 Ga0209700_100011
1745 Ga0209700_100077
1746 Ga0209813_10103818
1747 Ga0268266_10001236
1748 Ga0268266_10017196
1749 Ga0268266_10024061
1750 Ga0268266_10115835
1751 Ga0268266_10207072
1752 Ga0268266_10295642
1753 Ga0268266_10370197
1754 Ga0268265_10235020
1755 Ga0268265_10284298
1756 Ga0268265_10314928
1757 Ga0268264_10000062
1758 Ga0265326_10032836
1759 Ga0265334_10057274
1760 Ga0265323_10002052
1761 Ga0265336_10001641
1762 Ga0307517_10000175
1763 Ga0307515_10042883
1764 Ga0265338_10001066
1765 Ga0307511_10090017
1766 Ga0265330_10029710
1767 Ga0265330_10058641
1768 Ga0265332_10012261
1769 Ga0265328_10080363
1770 Ga0265325_10076700
1771 Ga0265340_10030670
1772 Ga0265339_10000738
1773 Ga0265339_10031597
1774 Ga0265331_10019666
1775 Ga0265316_10100380
1776 Ga0307513_10094234
1777 Ga0307509_10038191
1778 Ga0307508_10040818
1779 Ga0307508_10062296
1780 Ga0307508_10175097
1781 Ga0265314_10010574
1782 Ga0265314_10011119
1783 Ga0265314_10150027
1784 Ga0265314_10212342
1785 Ga0265342_10008380
1786 Ga0265342_10129631
1787 Ga0307516_10065364
1788 Ga0307516_10110468
1789 Ga0307405_10081471
1790 Ga0307405_10101218
1791 Ga0307410_10108325
1792 Ga0307412_10397853
1793 Ga0307414_10053559
1794 Ga0307411_10144646
1795 Ga0307415_100277040
1796 Ga0307415_100341699
1797 Ga0307507_10057529
1798 Ga0307510_10013138
1799 Ga0307510_10014518
1800 Ga0307510_10188060
1801 Ga0307510_10281329
1802 Ga0315911_1000008
1803 Ga0373926_0040287
1804 Ga0373929_0020069
1805 Ga0373934_0000780
1806 Ga0373934_0080894
1807 Ga0373923_0014616
1808 Ga0373936_0021542
1809 Ga0373945_0006256
1810 Ga0373953_0004338
1811 Ga0373953_0010472
1812 Ga0373953_0074161
1813 Ga0373954_0002052
1814 Ga0373954_0045857
1815 Ga0373954_0076967
1816 Ga0373956_0001732
1817 Ga0373956_0042301
1818 Ga0373957_0024130
1819 Ga0373943_0004587
1820 Ga0373943_0030231
1821 Ga0373943_0046469
1822 Ga0373946_0001716
1823 Ga0373955_0022637
1824 Ga0373955_0045630
1825 Ga0373961_0030269
1826 Ga0373935_0030701
1827 Ga0373935_0031532
1828 Ga0373935_0109190
1829 Ga0373935_0304249
1830 Ga0373927_0001064
1831 Ga0373927_0001972
1832 Ga0373927_0010111
1833 Ga0373927_0010444
1834 Ga0373927_0134807
1835 Ga0373927_0240830
1836 Ga0373933_0000068
1837 Ga0373933_0001999
1838 Ga0373933_0063756
1839 Ga0373933_0083825
1840 Ga0373933_0087959
1841 Ga0373947_0002167
1842 Ga0373947_0011961
1843 Ga0373947_0019455
1844 Ga0373947_0048102
1845 Ga0373937_0043074
1846 Ga0373937_0283010
1847 Ga0373937_0357620
1848 Ga0373925_0022749
1849 Ga0373925_0053231
1850 Ga0373925_0075368
1851 Ga0373925_0079530
1852 Ga0395900_0006757
1853 Ga0395898_0016369
1854 Ga0395905_0001948
1855 Ga0395905_0302388
1856 Ga0395905_0408093
1857 Ga0395905_0439600
1858 Ga0395901_0079195
1859 Ga0395901_0263302
1860 Ga0395901_0572591
1861 Ga0436365_0112616
1862 Ga0436365_0572660
1863 Ga0436360_0046295
1864 Ga0436360_0435233
1865 Ga0436361_0430718
1866 Ga0436363_0702892
1867 Ga0436363_0977790
1868 Ga0436362_0237800
1869 Ga0436362_1039149
1870 Ga0451807_0848413
1871 Ga0451841_0221733
1872 Ga0466969_0016565
1873 Ga0466969_0199813
1874 Ga0466972_0002927
1875 Ga0466965_0142381
1876 Ga0466966_0004373
1877 Ga0466961_0000709
1878 Ga0466963_0048779
1879 Ga0466963_0100195
1880 Ga0466963_0242140
1881 Ga0466964_0274297
1882 Ga0466968_0122276
1883 Ga0466970_0111188
1884 Ga0466960_0166054
1885 Ga0466960_0201586
1886 Ga0466959_0003898
1887 Ga0466959_0073096
1888 Ga0466958_0054521
1889 Ga0495617_029845
1890 Ga0495592_0012829
1891 Ga0495592_0117103
1892 Ga0495592_0223526
1893 Ga0495592_0237127
1894 Ga0495603_0005523
1895 Ga0495603_0022697
1896 Ga0495603_0028072
1897 Ga0495603_0047068
1898 Ga0495603_0092711
1899 Ga0495590_0104751
1900 Ga0495629_0003619
1901 Ga0495629_0014105
1902 Ga0495629_0026528
1903 Ga0495629_0083584
1904 Ga0495638_0027840
1905 Ga0495638_0041939
1906 Ga0495641_0002985
1907 Ga0495641_0105705
1908 Ga0495651_0022801
1909 Ga0495651_0029728
1910 Ga0495651_0076698
1911 Ga0495651_0332985
1912 Ga0495653_0001635
1913 Ga0495653_0019937
1914 Ga0495580_0001546
1915 Ga0495582_0000535
1916 Ga0495582_0015124
1917 Ga0495582_0035512
1918 Ga0495582_0066499
1919 Ga0495605_0110771
1920 Ga0495639_0001501
1921 Ga0495639_0022686
1922 Ga0495639_0075670
1923 Ga0495639_0076497
1924 Ga0495639_0147813
1925 Ga0495662_0000510
1926 Ga0495664_0006101
1927 Ga0495664_0016598
1928 Ga0495664_0126000
1929 Ga0495664_0143413
1930 Ga0495584_0176996
1931 Ga0495594_0000467
1932 Ga0495594_0051805
1933 Ga0495594_0185764
1934 Ga0495594_0189732
1935 Ga0495596_0063658
1936 Ga0495596_0117617
1937 Ga0495607_0062876
1938 Ga0495607_0128050
1939 Ga0495583_0052132
1940 Ga0495583_0176440
1941 Ga0495606_0000831
1942 Ga0495606_0038505
1943 Ga0495608_0018999
1944 Ga0495608_0044574
1945 Ga0495608_0081839
1946 Ga0495610_0016195
1947 Ga0495610_0048587
1948 Ga0495618_0047715
1949 Ga0495620_0051841
1950 Ga0495620_0117379
1951 Ga0495628_0061000
1952 Ga0495628_0105392
1953 Ga0495628_0151294
1954 Ga0495630_0009913
1955 Ga0495630_0076688
1956 Ga0495630_0278762
1957 Ga0495630_0418479
1958 Ga0495643_0020700
1959 Ga0495644_0101563
1960 Ga0495648_0002812
1961 Ga0495648_0027211
1962 Ga0495648_0053583
1963 Ga0495648_0067554
1964 Ga0495648_0082316
1965 Ga0495648_0213126
1966 Ga0495666_0008155
1967 Ga0495652_0020210
1968 Ga0495652_0059935
1969 Ga0495652_0073765
1970 Ga0495652_0075106
1971 Ga0495652_0110030
1972 Ga0495652_0192054
1973 Ga0495654_0015350
1974 Ga0495665_0000128
1975 Ga0495665_0046233
1976 Ga0495640_0007295
1977 Ga0495640_0007536
1978 Ga0495640_0018011
1979 Ga0495640_0034708
1980 Ga0495640_0139408
1981 Ga0495640_0146778
1982 Ga0495586_0085311
1983 Ga0495587_0005610
1984 Ga0495587_0031355
1985 Ga0495587_0137669
1986 Ga0495621_0077626
1987 Ga0495597_0108909
1988 Ga0495597_0127204
1989 Ga0495645_0064772
1990 Ga0495645_0148321
1991 Ga0495645_0164715
1992 Ga0495645_0274347
1993 Ga0495645_0304727
1994 Ga0495622_0008565
1995 Ga0495622_0026867
1996 Ga0495622_0035907
1997 Ga0495622_0053041
1998 Ga0495667_0010575
1999 Ga0495656_0023665
2000 Ga0495656_0138886
2001 Ga0495668_0045650
2002 Ga0495634_0011829
2003 Ga0495634_0020602
2004 Ga0495634_0032241
2005 Ga0495634_0060513
2006 Ga0495634_0158476
2007 Ga0495634_0264793
2008 Ga0495611_0077935
2009 Ga0495625_0059794
2010 Ga0495625_0341590
2011 Ga0495635_0017402
2012 Ga0495635_0037977
2013 Ga0495635_0076564
2014 Ga0495635_0208653
2015 Ga0495659_0011312
2016 Ga0495661_0096740
2017 Ga0495661_0098835
2018 Ga0495588_0002722
2019 Ga0495588_0050332
2020 Ga0495588_0059466
2021 Ga0495588_0079867
2022 Ga0495588_0085186
2023 Ga0495657_0019410
2024 Ga0495657_0029086
2025 Ga0495657_0087691
2026 Ga0495657_0142917
2027 Ga0495599_0000562
2028 Ga0495599_0034765
2029 Ga0495599_0202726
2030 Ga0495623_0021634
2031 Ga0495623_0039103
2032 Ga0495623_0106377
2033 Ga0495646_0023262
2034 Ga0495646_0030160
2035 Ga0495646_0058421
2036 Ga0495646_0071204
2037 Ga0495646_0117774
2038 Ga0495647_0000600
2039 Ga0495658_0001083
2040 Ga0495658_0086125
2041 Ga0495658_0423370
2042 Ga0495669_0016067
2043 Ga0495669_0068699
2044 Ga0495669_0083607
2045 Ga0495669_0092101
2046 Ga0495613_0005438
2047 Ga0495613_0043339
2048 Ga0495613_0081991
2049 Ga0495613_0256649
2050 Ga0495624_0005136
2051 Ga0495624_0157631
2052 Ga0495624_0199746
2053 Ga0495624_0254433
2054 Ga0495624_0337989
2055 Ga0495670_0073193
2056 Ga0495670_0100722
2057 Ga0495649_0018602
2058 Ga0495649_0255742
2059 Ga0495600_0016680
2060 Ga0495600_0022095
2061 Ga0495600_0038517
2062 Ga0495600_0202794
2063 Ga0495600_0220838
2064 Ga0495581_0003213
2065 Ga0495581_0139297
2066 Ga0495604_0006935
2067 Ga0495604_0021826
2068 Ga0495604_0036266
2069 Ga0495604_0082745
2070 Ga0495604_0220791
2071 Ga0495604_0329013
2072 Ga0495604_0333719
2073 Ga0495674_0010035
2074 Ga0495674_0034718
2075 Ga0495674_0036341
2076 Ga0495674_0102980
2077 Ga0495674_0206151
2078 Ga0495674_0314206
2079 Ga0495672_0047426
2080 Ga0495672_0109929
2081 Ga0495676_0007949
2082 Ga0495676_0030366
2083 Ga0495676_0032842
2084 Ga0495680_0009468
2085 Ga0495680_0064965
2086 Ga0495683_0068905
2087 Ga0495687_033438
2088 Ga0495675_0003041
2089 Ga0495675_0106695
2090 Ga0495675_0130282
2091 Ga0495675_0320784
2092 Ga0495673_0112638
2093 Ga0495684_0005455
2094 Ga0495684_0008298
2095 Ga0495684_0030796
2096 Ga0495684_0044813
2097 Ga0495686_0128372
2098 Ga0495593_0006937
2099 Ga0495593_0037818
2100 Ga0495593_0113872
2101 Ga0495602_0014209
2102 Ga0495602_0018054
2103 Ga0495602_0114893
2104 Ga0495602_0227954
2105 Ga0495615_0013748
2106 Ga0496100_0075974
2107 Ga0496100_0191984
2108 Ga0496100_0415744
2109 Ga0496100_0417219
2110 Ga0496101_0008819
2111 Ga0496101_0061673
2112 Ga0496101_0175729
2113 Ga0496101_0218671
2114 Ga0496101_0322261
2115 Ga0496101_0453340
2116 Ga0496102_0041671
2117 Ga0496102_0047085
2118 Ga0496102_0081377
2119 Ga0496102_0085911
2120 Ga0496102_0099110
2121 Ga0496102_0155050
2122 Ga0496102_0208937
2123 Ga0496102_0511275
2124 Ga0496103_0020714
2125 Ga0496104_0035714
2126 Ga0496104_0060516
2127 Ga0496104_0217985
2128 Ga0496104_0533738
2129 Ga0496104_0669214
2130 Ga0496105_0005233
2131 Ga0496105_0171778
2132 Ga0496105_0187475
2133 Ga0496105_0210354
2134 Ga0496106_0001075
2135 Ga0496106_0006134
2136 Ga0496106_0033686
2137 Ga0496106_0034614
2138 Ga0496106_0057839
2139 Ga0496106_0120607
2140 Ga0496106_0337226
2141 Ga0496107_0002790
2142 Ga0496107_0017396
2143 Ga0496107_0111336
2144 Ga0496107_0275636
2145 Ga0496107_0291473
2146 Ga0496108_0000309
2147 Ga0496108_0016858
2148 Ga0496108_0028705
2149 Ga0496108_0121021
2150 Ga0496109_0000229
2151 Ga0496109_0091231
2152 Ga0496109_0106392
2153 Ga0496109_0153961
2154 Ga0496110_0011598
2155 Ga0496110_0034064
2156 Ga0496110_0038809
2157 Ga0496110_0138627
2158 Ga0496110_0275666
2159 Ga0496110_0359658
2160 Ga0496111_0011315
2161 Ga0496111_0131148
2162 Ga0496111_0265065
2163 Ga0496112_0000018
2164 Ga0496112_0053970
2165 Ga0496112_0074725
2166 Ga0496112_0143302
2167 Ga0496112_0157177
2168 Ga0496112_0455207
2169 Ga0496112_0722640
2170 Ga0496113_0024174
2171 Ga0496113_0033720
2172 Ga0496113_0201756
2173 Ga0496113_0212151
2174 Ga0496114_0380658
2175 Ga0496114_0468702
2176 Ga0496115_0011619
2177 Ga0496115_0036077
2178 Ga0496115_0082294
2179 Ga0496115_0106272
2180 Ga0496115_0154204
2181 Ga0496115_0302273
2182 Ga0496115_0400346
2183 Ga0496116_0007008
2184 Ga0496116_0064921
2185 Ga0496116_0118276
2186 Ga0496117_0121490
2187 Ga0496118_0001623
2188 Ga0496118_0046366
2189 Ga0496119_0185423
2190 Ga0496120_0034831
2191 Ga0496120_0219111
2192 Ga0496120_0246496
2193 Ga0496121_0000278
2194 Ga0496121_0001257
2195 Ga0496121_0071161
2196 Ga0496121_0093161
2197 Ga0496121_0142647
2198 Ga0496121_0259554
2199 Ga0496121_0292090
2200 Ga0496122_0011998
2201 Ga0496122_0039152
2202 Ga0496123_0030316
2203 Ga0496124_0003799
2204 Ga0496124_0155417
2205 Ga0496124_0301611
2206 Ga0496124_0343759
2207 Ga0496125_0054026
2208 Ga0496125_0082443
2209 Ga0496125_0107960
2210 Ga0496125_0140980
2211 Ga0496126_0003267
2212 Ga0496126_0003347
2213 Ga0496126_0009942
2214 Ga0496126_0013009
2215 Ga0496126_0194593
2216 Ga0496126_0199109
2217 Ga0496126_0360942
2218 Ga0501046_0522547
2219 Ga0501047_0006910
2220 Ga0501067_0026967
2221 Ga0501067_0076036
2222 Ga0501070_0004413
2223 Ga0501073_0128745
2224 Ga0501074_0041688
2225 Ga0501080_0044907
2226 nmdc:mga03n38_13142_c1
2227 nmdc:mga03n38_167578_c1
2228 nmdc:mga03n38_47675_c1
2229 nmdc:mga00v17_200478_c1
2230 nmdc:mga0yw44_115572_c1
2231 nmdc:mga0yw44_167396_c1
2232 nmdc:mga0yw44_176725_c1
2233 nmdc:mga0yw44_210893_c1
2234 nmdc:mga06z11_228314_c1
2235 nmdc:mga06z11_39634_c1
2236 nmdc:mga06z11_72147_c1
2237 nmdc:mga04h51_48171_c1
2238 nmdc:mga07m45_76209_c1
2239 nmdc:mga0qj67_388766_c1
2240 nmdc:mga08y16_172453_c1
2241 nmdc:mga0n895_380753_c1
2242 nmdc:mga0n895_87550_c1
2243 nmdc:mga0rr50_373787_c1
2244 nmdc:mga08x19_228219_c1
2245 Ga0495601_0039160
2246 Ga0495601_0072161
2247 Ga0495601_0135490
2248 Ga0495612_0023765
2249 Ga0495612_0036891
2250 Ga0495655_0039782
2251 Ga0495655_0058366
2252 Ga0495595_0068269
2253 Ga0495595_0167678
2254 Ga0495619_0014255
2255 Ga0495619_0014580
2256 Ga0495619_0253404
2257 Ga0500578_0126053
2258 Ga0500578_0360674
2259 Ga0500643_000076
2260 Ga0500646_0024650
2261 Ga0500647_0155035
2262 Ga0500583_0195420
2263 Ga0500651_0117439
2264 Ga0500566_0000107
2265 Ga0500566_0000277
2266 Ga0500566_0027098
2267 Ga0500566_0141784
2268 Ga0500641_0008698
2269 Ga0500641_0025456
2270 Ga0500641_0037408
2271 Ga0500641_0092760
2272 Ga0500650_0000600
2273 Ga0500554_001768
2274 Ga0500555_023671
2275 Ga0500556_0000081
2276 Ga0500556_0017598
2277 Ga0500557_000102
2278 Ga0500562_004092
2279 Ga0500572_000551
2280 Ga0500592_005464
2281 Ga0500593_120445
2282 Ga0500594_0053185
2283 Ga0500595_001181
2284 Ga0500595_005078
2285 Ga0500595_007372
2286 Ga0500595_008629
2287 Ga0500595_028755
2288 Ga0500595_052637
2289 Ga0500608_004273
2290 Ga0500608_018401
2291 Ga0500614_073082
2292 Ga0500618_009731
2293 Ga0500618_029191
2294 Ga0500642_0000042
2295 Ga0500642_0000225
2296 Ga0500642_0013084
2297 Ga0500658_0086267
2298 Ga0500658_0104976
2299 Ga0500658_0130753
2300 Ga0500559_0000857
2301 Ga0500559_0001081
2302 Ga0500559_0028198
2303 Ga0500559_0066362
2304 Ga0500568_0002631
2305 Ga0500568_0078038
2306 Ga0500573_0133350
2307 Ga0500589_167996
2308 Ga0500590_110886
2309 Ga0500590_141658
2310 Ga0500603_005971
2311 Ga0500603_037087
2312 Ga0500603_040616
2313 Ga0500604_0008728
2314 Ga0500604_0016789
2315 Ga0500622_0002743
2316 Ga0500622_0004916
2317 Ga0500627_0087881
2318 Ga0500634_0088886
2319 Ga0500638_000149
2320 Ga0500638_075005
2321 Ga0500638_078416
2322 Ga0500639_087494
2323 Ga0500636_0001169
2324 Ga0500636_0003600
2325 Ga0500636_0047546
2326 Ga0500636_0050962
2327 Ga0500637_0001223
2328 Ga0500637_0002162
2329 Ga0500637_0035867
2330 Ga0500576_100726
2331 Ga0500625_138188
2332 Ga0500645_011424
2333 Ga0500645_026733
2334 Ga0500609_004978
2335 Ga0500552_005939
2336 Ga0500596_000611
2337 Ga0500596_014148
2338 Ga0500601_002393
2339 Ga0500601_010689
2340 Ga0500661_005251
2341 2507505410
2342 2508539296
2343 2508695623
2344 2509152137
2345 2511394501
2346 2513623967
2347 2513642149
2348 2513659466
2349 2513675003
2350 2513695247
2351 2513704800
2352 2513859428
2353 2513873391
2354 2513888618
2355 2513921601
2356 2514014721
2357 2515627605
2358 2517106324
2359 2517889006
2360 2524441396
2361 2524467025
2362 2524537432
2363 2528855058
2364 2603858334
2365 2617352101
2366 2617373570
2367 2671122601
2368 2728748475
2369 2745077528
2370 2793062188
2371 2793073688
2372 2793078351
2373 2805920739
2374 2818237811
2375 2824607323
2376 2824616887
2377 2824624404
2378 2824632773
2379 2824642055
2380 2824649489
2381 2824659691
2382 2824669411
2383 2824686305
2384 2824702723
2385 2824711444
2386 2824719374
2387 2824729879
2388 2824738928
2389 2824751656
2390 2824762550
2391 2824771884
2392 2824780793
2393 2838124653
2394 2841945344
2395 2841952129
2396 2841965457
2397 2841970483
2398 2841981731
2399 2841985012
2400 2842043368
2401 2842052642
2402 2844315500
2403 2847931206
2404 2847942296
2405 2849083170
2406 2857516397
2407 2874591673
2408 2874607930
2409 2874619101
2410 2874621246
2411 2874628645
2412 2874646158
2413 2876769596
2414 2876771774
2415 2876812457
2416 2876819118
2417 2879075635
2418 2879085545
2419 2879105883
2420 2879113357
2421 2879128444
2422 2879143578
2423 2881369268
2424 2881669951
2425 2885369377
2426 2885382794
2427 2885388542
2428 2885411836
2429 2888379448
2430 2888390543
2431 2888420166
2432 2889035346
2433 2903733453
2434 2903758966
2435 2903775479
2436 2904667791
2437 2904691051
2438 2904708456
2439 2904716372
2440 2906608589
2441 2906613624
2442 2906628549
2443 2906651401
2444 2908747604
2445 2908757109
2446 2908776043
2447 2922369433
2448 2922388532
2449 2922398132
2450 2922434059
2451 2929618738
2452 2929628577
2453 2932790919
2454 2932794185
2455 2932809259
2456 2932812028
2457 2932825521
2458 2932833635
2459 2933580552
2460 2935615562
2461 2935623161
2462 2935636090
2463 2935644236
2464 2935654492
2465 2935663372
2466 2935672182
2467 2935679297
2468 2935686538
2469 2935700321
2470 2935710269
2471 2935716226
2472 2935723650
2473 2935735205
2474 2935744004
2475 2935752504
2476 2935763362
2477 2935808260
2478 2935816127
2479 2935825637
2480 2935833520
2481 2935844473
2482 2935853401
2483 2935861409
2484 2935869528
2485 2935879857
2486 2935889210
2487 2935915003
2488 2935918851
2489 2935931432
2490 2935940029
2491 2935947624
2492 2935956395
2493 2935966765
2494 2935973189
2495 2935980567
2496 2935990081
2497 2935997920
2498 2936008815
2499 2936017469
2500 2936026030
2501 2936034872
2502 2936041132
2503 2936052870
2504 2936060273
2505 2940558417
2506 2941512606
2507 2941520556
2508 2941528570
2509 2941535384
2510 2941543354
2511 3005475226
2512 3005486719
2513 3005509024
2514 3005594089
2515 3005595188
2516 3005711134
2517 3005718432
2518 8006936053
2519 8006967593
2520 8006975823
2521 8006991062
2522 8007000392
2523 8016518042
2524 8016526285
2525 8016531344
2526 8016544562
2527 8016557515
2528 8016565871
2529 8016603470
2530 8016606412
2531 8016635469
2532 8017058603
2533 8019531179
2534 8019562604
2535 8019572682
2536 8019577056
2537 8019595125
2538 8019606618
2539 8019611895
2540 8019623121
2541 8019629979
2542 8019640628
2543 8019666819
2544 8019676576
2545 8019679414
2546 8055742587
2547 8056676097
2548 8056682898
2549 8056691101
2550 8056971444

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kjj-assembly1.cif.gz_A crystal structure of glycniamide ribonucleotide transformylase in complex with mg-atp-gamma-s 0.6912 4 50
4hgr-assembly1.cif.gz_D crystal structure of e56a/k67a mutant of 2-keto-3-deoxy-d-glycero-d-galactonononate-9-phosphate phosphohydrolase from bacteroides thetaiotaomicron 0.6772 5 38
3aw8-assembly1.cif.gz_B crystal structure of n5-carboxyaminoimidazole ribonucleotide synthetase from thermus thermophilus hb8 0.6704 5 50
3n1u-assembly1.cif.gz_A structure of putative had superfamily (subfamily iii a) hydrolase from legionella pneumophila 0.6703 5 50
1ltx-assembly1.cif.gz_R structure of rab escort protein-1 in complex with rab geranylgeranyl transferase and isoprenoid 0.6668 3 35
ID Description Score Start End Superfamily
af_Q2G0L8_3_282_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.7776 5 38 3.40.50.1000
4ap9D01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.7199 2 37 3.40.50.1000
af_O07810_7_266_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.6962 5 38 3.40.50.2020
af_Q922P9_265_423_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.6901 1 49 3.40.50.720
af_K7LWV7_39_162_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.6864 1 49 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A520ZL80-F1-model_v4 Uncharacterized protein 0.9598 1 58
AF-A0A439QNM7-F1-model_v4 Glycosyltransferase family 1 protein 0.9528 3 58
AF-A0A163XJ97-F1-model_v4 Mannosyltransferase 0.9491 1 250
AF-A0A163XJ97-F1-model_v4 Mannosyltransferase 0.9418 1 250
AF-A0A067W3T2-F1-model_v4 BAH domain-containing protein 0.9377 4 69

Map