F492324

General Info

Members Datasets Scaffolds Average Seq Length
1262 376 2524 129

Family's Representative Sequence

Representative Sequence 3300025912|Ga0207707_10669007|Ga0207707_106690072
Length 146
Sequence LQNADSAPISAAAPGCQIGQLPSSTRLSTWSVSLRSVQLSDVGIYTIGLALAVIFTATSFWVANTSLLWALGVPIGLVVLAIAQMGVHLVFFLHITTAPDNTNNVLALAFGLFIVILVIAGSLWIMTNLNENMMLSPQGMSLKMQH

Samples

Sample ID Description Type Environment
1 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
11 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
12 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
57 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
80 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
86 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
87 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
88 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
89 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
90 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
91 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
92 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
93 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
96 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
97 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
98 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
99 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
100 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
101 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
104 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
106 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
107 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
108 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
109 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
111 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
112 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
115 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
116 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
117 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
118 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
119 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
120 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
121 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
122 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
123 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
124 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
125 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
126 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
127 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
128 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
129 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
130 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
131 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
132 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
133 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
134 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
135 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
136 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
137 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
138 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
139 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
143 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
144 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
145 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
209 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
213 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
215 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
216 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
217 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
218 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
219 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
220 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
221 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
222 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
223 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
224 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
225 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
226 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
227 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
228 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
229 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
230 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
231 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
232 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
233 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
234 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
235 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
236 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
237 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
238 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
239 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
240 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
241 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
242 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
243 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
244 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
245 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
246 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
247 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
248 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
249 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
250 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
251 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
252 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
253 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
254 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
255 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
256 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
257 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
258 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
259 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
260 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
261 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
262 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
263 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
264 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
265 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
266 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
267 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
268 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
269 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
270 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
271 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
272 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
273 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
274 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
275 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
276 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
277 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
278 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
279 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
280 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
281 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
282 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
283 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
284 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
285 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
286 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
287 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
288 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
289 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
290 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
291 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
292 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
293 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
294 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
295 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
296 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
297 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
298 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
299 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
300 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
301 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
302 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
303 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
304 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
305 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
306 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
307 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
308 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
309 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
310 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
311 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
312 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
313 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
314 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
315 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
316 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
317 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
318 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
319 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
320 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
321 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
322 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
323 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
324 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
325 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
326 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
327 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
328 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
329 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
330 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
331 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
332 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
333 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
334 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
335 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
336 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
337 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
338 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
339 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
340 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
341 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
342 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
343 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
344 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
345 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
346 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
347 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
348 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
349 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
350 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
351 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
352 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
353 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
354 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
355 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
356 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
357 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
358 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
359 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
360 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
361 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
362 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
363 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
364 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
365 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
366 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
367 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
368 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
369 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
370 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
371 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
372 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
373 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
374 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
375 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
376 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.05
Metatranscriptomes 0.32
Isolates 0.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.98
Nodule 0.24
Rhizoplane 2.93
Rhizosphere 92.31
Stem 0
Stem Tuber 0
Unclassified 0.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207707_10669007 3300025912 Bacteria 874
2 JGI24741J21665_1069843 3300001915 Bacteria 521
3 JGI24746J21847_1029196 3300001977 Bacteria 761
4 JGI24740J21852_10002962 3300001979 Bacteria 7533
5 JGI24739J22299_10187226 3300001989 Bacteria 608
6 JGI24737J22298_10014671 3300001990 Bacteria 2542
7 JGI24737J22298_10053671 3300001990 Bacteria 1221
8 JGI24735J21928_10002439 3300002067 Bacteria 6457
9 JGI24735J21928_10017650 3300002067 Bacteria 2206
10 JGI24735J21928_10080438 3300002067 Bacteria 933
11 JGI24748J21848_1014998 3300002074 Bacteria 921
12 JGI24738J21930_10152532 3300002075 Bacteria 514
13 JGI24033J26618_1008325 3300002155 Bacteria 1192
14 JGI24751J29686_10097789 3300002459 Bacteria 612
15 JGI25406J46586_10067351 3300003203 Bacteria 1134
16 Ga0065712_10198026 3300005290 Bacteria 1120
17 Ga0065712_10310064 3300005290 Bacteria 845
18 Ga0065712_10399054 3300005290 Bacteria 712
19 Ga0065715_10089302 3300005293 Bacteria 11347
20 Ga0065715_10091297 3300005293 Bacteria 5910
21 Ga0065715_10453444 3300005293 Bacteria 814
22 Ga0065715_11128668 3300005293 Bacteria 502
23 Ga0065707_10381286 3300005295 Bacteria 877
24 Ga0065707_11063010 3300005295 Bacteria 524
25 Ga0070658_10000558 3300005327 Bacteria 32263
26 Ga0070658_10012036 3300005327 Bacteria 6948
27 Ga0070658_10015559 3300005327 Bacteria 6084
28 Ga0070658_10047251 3300005327 Bacteria 3483
29 Ga0070658_10069108 3300005327 Bacteria 2889
30 Ga0070658_10153780 3300005327 Bacteria 1927
31 Ga0070658_10762150 3300005327 Bacteria 840
32 Ga0070658_10772058 3300005327 Bacteria 835
33 Ga0070658_11219967 3300005327 Bacteria 654
34 Ga0070676_10014185 3300005328 Bacteria 4376
35 Ga0070676_10081323 3300005328 Bacteria 1966
36 Ga0070676_10309992 3300005328 Bacteria 1073
37 Ga0070676_10607072 3300005328 Bacteria 790
38 Ga0070683_100010769 3300005329 Bacteria 7869
39 Ga0070683_100050131 3300005329 Bacteria 3863
40 Ga0070683_100105926 3300005329 Bacteria 2651
41 Ga0070683_100203041 3300005329 Bacteria 1882
42 Ga0070683_101717485 3300005329 Bacteria 604
43 Ga0070670_100001315 3300005331 Bacteria 19824
44 Ga0070670_100010704 3300005331 Bacteria 7838
45 Ga0070670_100012634 3300005331 Bacteria 7230
46 Ga0070670_100209704 3300005331 Bacteria 1694
47 Ga0070670_100302341 3300005331 Bacteria 1400
48 Ga0070670_100480716 3300005331 Bacteria 1103
49 Ga0070670_100639812 3300005331 Bacteria 954
50 Ga0070677_10001059 3300005333 Bacteria 8871
51 Ga0070677_10043733 3300005333 Bacteria 1779
52 Ga0070677_10076676 3300005333 Bacteria 1420
53 Ga0070677_10195863 3300005333 Bacteria 972
54 Ga0068869_100060502 3300005334 Bacteria 2776
55 Ga0068869_101476142 3300005334 Bacteria 603
56 Ga0070666_10367165 3300005335 Bacteria 1032
57 Ga0070680_100000734 3300005336 Bacteria 22858
58 Ga0070680_100020070 3300005336 Bacteria 5299
59 Ga0070680_100027677 3300005336 Bacteria 4541
60 Ga0070680_100218220 3300005336 Bacteria 1609
61 Ga0070680_100539339 3300005336 Bacteria 999
62 Ga0070680_101150642 3300005336 Bacteria 671
63 Ga0070680_101892715 3300005336 Bacteria 517
64 Ga0070682_100125422 3300005337 Bacteria 1729
65 Ga0070682_100333597 3300005337 Bacteria 1125
66 Ga0070682_100827027 3300005337 Bacteria 755
67 Ga0068868_100291029 3300005338 Bacteria 1385
68 Ga0068868_102197305 3300005338 Bacteria 526
69 Ga0070660_100000627 3300005339 Bacteria 23539
70 Ga0070660_100004878 3300005339 Bacteria 9270
71 Ga0070660_100023266 3300005339 Bacteria 4590
72 Ga0070660_100094459 3300005339 Bacteria 2362
73 Ga0070660_100126230 3300005339 Bacteria 2044
74 Ga0070660_100203452 3300005339 Bacteria 1606
75 Ga0070660_100211528 3300005339 Bacteria 1575
76 Ga0070660_100270422 3300005339 Bacteria 1389
77 Ga0070660_100372131 3300005339 Bacteria 1179
78 Ga0070660_100501649 3300005339 Bacteria 1010
79 Ga0070660_101439433 3300005339 Bacteria 586
80 Ga0070660_101443618 3300005339 Bacteria 585
81 Ga0070689_100245486 3300005340 Bacteria 1476
82 Ga0070691_10003748 3300005341 Bacteria 6865
83 Ga0070687_100574405 3300005343 Bacteria 771
84 Ga0070687_100892952 3300005343 Bacteria 637
85 Ga0070687_101137757 3300005343 Bacteria 573
86 Ga0070661_100020482 3300005344 Bacteria 4717
87 Ga0070661_100047666 3300005344 Bacteria 3136
88 Ga0070661_100096532 3300005344 Bacteria 2193
89 Ga0070661_100111077 3300005344 Bacteria 2047
90 Ga0070661_100689520 3300005344 Bacteria 832
91 Ga0070661_101090538 3300005344 Bacteria 665
92 Ga0070692_10027099 3300005345 Bacteria 2838
93 Ga0070692_10028408 3300005345 Bacteria 2779
94 Ga0070692_10057903 3300005345 Bacteria 2034
95 Ga0070692_10068351 3300005345 Bacteria 1887
96 Ga0070668_100016145 3300005347 Bacteria 5588
97 Ga0070668_100062324 3300005347 Bacteria 2889
98 Ga0070668_100092225 3300005347 Bacteria 2389
99 Ga0070668_100110468 3300005347 Bacteria 2188
100 Ga0070668_100121789 3300005347 Bacteria 2086
101 Ga0070668_100320956 3300005347 Bacteria 1304
102 Ga0070668_101224908 3300005347 Bacteria 681
103 Ga0070669_100020274 3300005353 Bacteria 4749
104 Ga0070669_100040882 3300005353 Bacteria 3371
105 Ga0070669_100270791 3300005353 Bacteria 1358
106 Ga0070669_100417558 3300005353 Bacteria 1101
107 Ga0070669_100664419 3300005353 Bacteria 878
108 Ga0070675_100003732 3300005354 Bacteria 11581
109 Ga0070675_100644262 3300005354 Bacteria 963
110 Ga0070675_101144388 3300005354 Bacteria 716
111 Ga0070671_100007905 3300005355 Bacteria 8502
112 Ga0070671_100220016 3300005355 Bacteria 1611
113 Ga0070671_100825171 3300005355 Bacteria 808
114 Ga0070671_101132012 3300005355 Bacteria 688
115 Ga0070674_100001916 3300005356 Bacteria 11325
116 Ga0070674_100061697 3300005356 Bacteria 2617
117 Ga0070673_100034079 3300005364 Bacteria 3850
118 Ga0070673_100453510 3300005364 Bacteria 1154
119 Ga0070673_100611300 3300005364 Bacteria 995
120 Ga0070673_100727312 3300005364 Bacteria 913
121 Ga0070673_101290464 3300005364 Bacteria 685
122 Ga0070688_100169535 3300005365 Bacteria 1505
123 Ga0070688_100930824 3300005365 Bacteria 687
124 Ga0070659_100023326 3300005366 Bacteria 4734
125 Ga0070659_100061664 3300005366 Bacteria 2963
126 Ga0070659_100211680 3300005366 Bacteria 1598
127 Ga0070659_100267025 3300005366 Bacteria 1421
128 Ga0070659_100305740 3300005366 Bacteria 1327
129 Ga0070659_100524439 3300005366 Bacteria 1012
130 Ga0070659_100578188 3300005366 Bacteria 964
131 Ga0070659_100786954 3300005366 Bacteria 827
132 Ga0070659_100935937 3300005366 Bacteria 758
133 Ga0070659_101455772 3300005366 Bacteria 610
134 Ga0070659_101901896 3300005366 Bacteria 534
135 Ga0070667_100029764 3300005367 Bacteria 4552
136 Ga0070667_100104027 3300005367 Bacteria 2455
137 Ga0070709_10032804 3300005434 Bacteria 3134
138 Ga0070714_100090315 3300005435 Bacteria 2682
139 Ga0070714_100101230 3300005435 Bacteria 2538
140 Ga0070714_100179828 3300005435 Bacteria 1924
141 Ga0070714_100198613 3300005435 Bacteria 1834
142 Ga0070714_101535574 3300005435 Bacteria 650
143 Ga0070713_100031712 3300005436 Bacteria 4212
144 Ga0070713_100043185 3300005436 Bacteria 3684
145 Ga0070713_100389907 3300005436 Bacteria 1299
146 Ga0070713_100845357 3300005436 Bacteria 879
147 Ga0070710_10000608 3300005437 Bacteria 17022
148 Ga0070710_10104768 3300005437 Bacteria 1690
149 Ga0070710_10497810 3300005437 Bacteria 834
150 Ga0070701_10527956 3300005438 Bacteria 771
151 Ga0070711_100001017 3300005439 Bacteria 14917
152 Ga0070711_100172401 3300005439 Bacteria 1650
153 Ga0070711_100436488 3300005439 Bacteria 1070
154 Ga0070705_100456606 3300005440 Bacteria 960
155 Ga0070705_101469393 3300005440 Bacteria 570
156 Ga0070694_100006434 3300005444 Bacteria 7128
157 Ga0070694_100098590 3300005444 Bacteria 2064
158 Ga0070663_100023343 3300005455 Bacteria 4145
159 Ga0070663_100037080 3300005455 Bacteria 3391
160 Ga0070663_100105428 3300005455 Bacteria 2110
161 Ga0070663_100272556 3300005455 Bacteria 1346
162 Ga0070663_100296538 3300005455 Bacteria 1293
163 Ga0070663_100299474 3300005455 Bacteria 1287
164 Ga0070663_100396232 3300005455 Bacteria 1127
165 Ga0070663_100855397 3300005455 Bacteria 783
166 Ga0070663_101081305 3300005455 Bacteria 700
167 Ga0070678_100067757 3300005456 Bacteria 2658
168 Ga0070662_100003714 3300005457 Bacteria 9548
169 Ga0070662_100055091 3300005457 Bacteria 2884
170 Ga0070662_100101305 3300005457 Bacteria 2180
171 Ga0070662_100146285 3300005457 Bacteria 1836
172 Ga0070662_100171415 3300005457 Bacteria 1704
173 Ga0070662_100403223 3300005457 Bacteria 1129
174 Ga0070662_100682223 3300005457 Bacteria 868
175 Ga0070662_101993065 3300005457 Bacteria 502
176 Ga0070681_10022802 3300005458 Bacteria 6292
177 Ga0070681_10100623 3300005458 Bacteria 2836
178 Ga0070681_10144220 3300005458 Bacteria 2311
179 Ga0070681_10255437 3300005458 Bacteria 1665
180 Ga0068867_100972933 3300005459 Bacteria 768
181 Ga0070685_10875908 3300005466 Bacteria 667
182 Ga0070706_100047664 3300005467 Bacteria 3954
183 Ga0070698_100051608 3300005471 Bacteria 4188
184 Ga0070699_100743706 3300005518 Bacteria 897
185 Ga0070679_100028135 3300005530 Bacteria 5539
186 Ga0070679_100193097 3300005530 Bacteria 2004
187 Ga0070679_100304953 3300005530 Bacteria 1543
188 Ga0070679_100670436 3300005530 Bacteria 980
189 Ga0070679_101019587 3300005530 Bacteria 772
190 Ga0070679_101707672 3300005530 Bacteria 578
191 Ga0070684_100002286 3300005535 Bacteria 14120
192 Ga0070684_100056440 3300005535 Bacteria 3427
193 Ga0070684_100076347 3300005535 Bacteria 2957
194 Ga0070684_101502337 3300005535 Bacteria 635
195 Ga0070697_100183377 3300005536 Bacteria 1775
196 Ga0068853_100007913 3300005539 Bacteria 8524
197 Ga0068853_100147789 3300005539 Bacteria 2113
198 Ga0068853_100638659 3300005539 Bacteria 1013
199 Ga0068853_101269354 3300005539 Bacteria 712
200 Ga0068853_101529862 3300005539 Bacteria 646
201 Ga0068853_102356782 3300005539 Bacteria 516
202 Ga0070672_100048450 3300005543 Bacteria 3302
203 Ga0070672_100051180 3300005543 Bacteria 3220
204 Ga0070672_100638352 3300005543 Bacteria 929
205 Ga0070686_101174121 3300005544 Bacteria 637
206 Ga0070695_100120565 3300005545 Bacteria 1794
207 Ga0070695_100246126 3300005545 Bacteria 1299
208 Ga0070695_100676835 3300005545 Bacteria 817
209 Ga0070695_101842179 3300005545 Bacteria 508
210 Ga0070696_100048091 3300005546 Bacteria 2960
211 Ga0070696_100154641 3300005546 Bacteria 1686
212 Ga0070696_100175943 3300005546 Bacteria 1585
213 Ga0070696_100373796 3300005546 Bacteria 1109
214 Ga0070693_100045778 3300005547 Bacteria 2482
215 Ga0070665_100316185 3300005548 Bacteria 1565
216 Ga0070665_100444516 3300005548 Bacteria 1306
217 Ga0070704_100182244 3300005549 Bacteria 1681
218 Ga0070704_101099168 3300005549 Bacteria 722
219 Ga0068855_100001243 3300005563 Bacteria 31626
220 Ga0068855_100006911 3300005563 Bacteria 13762
221 Ga0068855_100009211 3300005563 Bacteria 11925
222 Ga0068855_100011781 3300005563 Bacteria 10575
223 Ga0068855_100049239 3300005563 Bacteria 4970
224 Ga0068855_100136881 3300005563 Bacteria 2793
225 Ga0068855_100764323 3300005563 Bacteria 1029
226 Ga0068855_101808719 3300005563 Bacteria 621
227 Ga0070664_100023180 3300005564 Bacteria 5126
228 Ga0070664_100024881 3300005564 Bacteria 4959
229 Ga0070664_100083296 3300005564 Bacteria 2759
230 Ga0070664_100125181 3300005564 Bacteria 2253
231 Ga0070664_100225225 3300005564 Bacteria 1679
232 Ga0070664_101577386 3300005564 Bacteria 622
233 Ga0070664_101708623 3300005564 Bacteria 597
234 Ga0068857_100037826 3300005577 Bacteria 4275
235 Ga0068857_100058943 3300005577 Bacteria 3410
236 Ga0068857_100075194 3300005577 Bacteria 3011
237 Ga0068857_100131070 3300005577 Bacteria 2261
238 Ga0068857_100486700 3300005577 Bacteria 1157
239 Ga0068854_100001998 3300005578 Bacteria 12488
240 Ga0068854_100040957 3300005578 Bacteria 3270
241 Ga0068854_100331634 3300005578 Bacteria 1240
242 Ga0068854_101203656 3300005578 Bacteria 679
243 Ga0068854_101471345 3300005578 Bacteria 618
244 Ga0068856_100005373 3300005614 Bacteria 12629
245 Ga0068856_100055681 3300005614 Bacteria 3903
246 Ga0068856_100069969 3300005614 Bacteria 3470
247 Ga0068856_100096178 3300005614 Bacteria 2950
248 Ga0068856_100122138 3300005614 Bacteria 2606
249 Ga0068856_100263549 3300005614 Bacteria 1739
250 Ga0068856_100687299 3300005614 Bacteria 1044
251 Ga0070702_100899130 3300005615 Bacteria 693
252 Ga0068852_100002078 3300005616 Bacteria 13676
253 Ga0068852_100013146 3300005616 Bacteria 6326
254 Ga0068852_100042800 3300005616 Bacteria 3836
255 Ga0068852_100100692 3300005616 Bacteria 2607
256 Ga0068852_100191467 3300005616 Bacteria 1930
257 Ga0068852_100289221 3300005616 Bacteria 1582
258 Ga0068852_100377194 3300005616 Bacteria 1390
259 Ga0068852_100845473 3300005616 Bacteria 931
260 Ga0068859_100073865 3300005617 Bacteria 3448
261 Ga0068859_100210538 3300005617 Bacteria 2030
262 Ga0068859_102854176 3300005617 Bacteria 530
263 Ga0068864_100105316 3300005618 Bacteria 2507
264 Ga0068864_100121864 3300005618 Bacteria 2333
265 Ga0068864_100192123 3300005618 Bacteria 1872
266 Ga0068864_100227598 3300005618 Bacteria 1723
267 Ga0068864_100289375 3300005618 Bacteria 1531
268 Ga0068861_100130818 3300005719 Bacteria 2037
269 Ga0068851_10260276 3300005834 Bacteria 987
270 Ga0068870_10306611 3300005840 Bacteria 1004
271 Ga0068863_100083443 3300005841 Bacteria 3028
272 Ga0068863_100111763 3300005841 Bacteria 2602
273 Ga0068863_100183955 3300005841 Bacteria 2006
274 Ga0068863_100458244 3300005841 Bacteria 1252
275 Ga0068863_101287939 3300005841 Bacteria 738
276 Ga0068858_100051723 3300005842 Bacteria 3801
277 Ga0068858_100356440 3300005842 Bacteria 1402
278 Ga0068858_100784657 3300005842 Bacteria 929
279 Ga0068858_102205991 3300005842 Bacteria 544
280 Ga0068860_100020127 3300005843 Bacteria 6465
281 Ga0068860_100078054 3300005843 Bacteria 3149
282 Ga0068860_100388422 3300005843 Bacteria 1379
283 Ga0068860_100476377 3300005843 Bacteria 1244
284 Ga0068860_101152310 3300005843 Bacteria 795
285 Ga0068860_101709086 3300005843 Bacteria 651
286 Ga0068860_102296930 3300005843 Bacteria 560
287 Ga0068862_100005184 3300005844 Bacteria 10951
288 Ga0068862_100117772 3300005844 Bacteria 2338
289 Ga0068862_100122130 3300005844 Bacteria 2297
290 Ga0068862_100153856 3300005844 Bacteria 2049
291 Ga0068862_101009083 3300005844 Bacteria 823
292 Ga0081455_10117466 3300005937 Bacteria 2102
293 Ga0081540_1021771 3300005983 Bacteria 3805
294 Ga0081540_1066978 3300005983 Bacteria 1680
295 Ga0081539_10004520 3300005985 Bacteria 15282
296 Ga0081539_10048404 3300005985 Bacteria 2418
297 Ga0070717_10004265 3300006028 Bacteria 10306
298 Ga0070717_10022641 3300006028 Bacteria 4968
299 Ga0070717_10058966 3300006028 Bacteria 3175
300 Ga0070717_10287360 3300006028 Bacteria 1459
301 Ga0070717_10346746 3300006028 Bacteria 1327
302 Ga0075365_10165885 3300006038 Bacteria 1541
303 Ga0075432_10013699 3300006058 Bacteria 2757
304 Ga0075432_10066629 3300006058 Bacteria 1289
305 Ga0075432_10175408 3300006058 Bacteria 836
306 Ga0070715_10227751 3300006163 Bacteria 962
307 Ga0075427_10011754 3300006194 Bacteria 1322
308 Ga0075366_10058017 3300006195 Bacteria 2300
309 Ga0075366_10903596 3300006195 Bacteria 550
310 Ga0097621_102423499 3300006237 Bacteria 502
311 Ga0097621_102444899 3300006237 Bacteria 500
312 Ga0075370_10240123 3300006353 Bacteria 1073
313 Ga0075428_100165834 3300006844 Bacteria 2396
314 Ga0075428_100195445 3300006844 Bacteria 2188
315 Ga0075428_100829214 3300006844 Bacteria 982
316 Ga0075430_100031610 3300006846 Bacteria 4492
317 Ga0075431_100070769 3300006847 Bacteria 3599
318 Ga0075431_100122224 3300006847 Bacteria 2686
319 Ga0075433_10003532 3300006852 Bacteria 12068
320 Ga0075433_10020295 3300006852 Bacteria 5553
321 Ga0075433_10045829 3300006852 Bacteria 3802
322 Ga0075433_10156324 3300006852 Bacteria 2029
323 Ga0075433_11604950 3300006852 Unclassified 561
324 Ga0075434_100006302 3300006871 Bacteria 10871
325 Ga0075434_100025091 3300006871 Bacteria 5831
326 Ga0075434_100112448 3300006871 Bacteria 2735
327 Ga0075434_100147008 3300006871 Bacteria 2377
328 Ga0075434_100151984 3300006871 Bacteria 2335
329 Ga0075434_100267620 3300006871 Bacteria 1728
330 Ga0075434_100306407 3300006871 Bacteria 1608
331 Ga0075434_100415220 3300006871 Bacteria 1367
332 Ga0075434_101061140 3300006871 Bacteria 824
333 Ga0075429_100003161 3300006880 Bacteria 13997
334 Ga0075429_100153746 3300006880 Bacteria 2015
335 Ga0068865_100237362 3300006881 Bacteria 1433
336 Ga0068865_101145208 3300006881 Bacteria 687
337 Ga0075436_100040318 3300006914 Bacteria 3223
338 Ga0075436_100153831 3300006914 Bacteria 1619
339 Ga0075436_101005009 3300006914 Bacteria 626
340 Ga0097620_100073868 3300006931 Bacteria 3448
341 Ga0097620_100210524 3300006931 Bacteria 2030
342 Ga0097620_102854539 3300006931 Bacteria 530
343 Ga0075435_100034522 3300007076 Bacteria 4008
344 Ga0075435_100051530 3300007076 Bacteria 3316
345 Ga0075435_100254383 3300007076 Bacteria 1496
346 Ga0075435_100356753 3300007076 Bacteria 1254
347 Ga0075435_101435429 3300007076 Bacteria 605
348 Ga0099794_10546797 3300007265 Bacteria 611
349 Ga0099795_10131882 3300007788 Bacteria 1009
350 Ga0099795_10428558 3300007788 Bacteria 605
351 Ga0105240_10019683 3300009093 Bacteria 9016
352 Ga0105240_10082483 3300009093 Bacteria 3948
353 Ga0105240_10647229 3300009093 Bacteria 1159
354 Ga0105240_11169033 3300009093 Bacteria 816
355 Ga0111539_10011004 3300009094 Bacteria 11388
356 Ga0111539_10012498 3300009094 Bacteria 10640
357 Ga0111539_10044219 3300009094 Bacteria 5336
358 Ga0111539_10061417 3300009094 Bacteria 4452
359 Ga0111539_10118838 3300009094 Bacteria 3098
360 Ga0111539_10154429 3300009094 Bacteria 2686
361 Ga0111539_10332609 3300009094 Bacteria 1768
362 Ga0111539_10629809 3300009094 Bacteria 1249
363 Ga0111539_10783142 3300009094 Bacteria 1110
364 Ga0111539_11047246 3300009094 Bacteria 948
365 Ga0105245_10144738 3300009098 Bacteria 2242
366 Ga0105247_10101454 3300009101 Bacteria 1840
367 Ga0114129_10243225 3300009147 Bacteria 2418
368 Ga0114129_10276672 3300009147 Bacteria 2244
369 Ga0114129_10743324 3300009147 Bacteria 1256
370 Ga0114129_11086138 3300009147 Bacteria 1003
371 Ga0114129_11175314 3300009147 Bacteria 957
372 Ga0114129_12454465 3300009147 Bacteria 624
373 Ga0105243_10208913 3300009148 Bacteria 1717
374 Ga0105243_10232907 3300009148 Bacteria 1635
375 Ga0105241_10772547 3300009174 Bacteria 883
376 Ga0105242_10286636 3300009176 Bacteria 1498
377 Ga0105242_10691114 3300009176 Bacteria 997
378 Ga0105248_10132608 3300009177 Bacteria 2811
379 Ga0105248_11220969 3300009177 Bacteria 850
380 Ga0105237_10013830 3300009545 Bacteria 8449
381 Ga0105237_10026608 3300009545 Bacteria 5913
382 Ga0105237_10830728 3300009545 Bacteria 931
383 Ga0105238_10007506 3300009551 Bacteria 10924
384 Ga0105238_11207640 3300009551 Bacteria 781
385 Ga0105238_11293150 3300009551 Bacteria 755
386 Ga0105238_11958843 3300009551 Bacteria 619
387 Ga0105249_10002721 3300009553 Bacteria 15283
388 Ga0105249_10161794 3300009553 Bacteria 2164
389 Ga0105249_10308690 3300009553 Bacteria 1589
390 Ga0105249_10393437 3300009553 Bacteria 1414
391 Ga0105249_10868349 3300009553 Bacteria 968
392 Ga0105249_11631935 3300009553 Bacteria 717
393 Ga0105249_12722307 3300009553 Bacteria 566
394 Ga0099796_10142609 3300010159 Bacteria 937
395 Ga0099796_10214091 3300010159 Bacteria 787
396 Ga0105239_10054013 3300010375 Bacteria 4405
397 Ga0105239_10097416 3300010375 Bacteria 3250
398 Ga0105239_10380155 3300010375 Bacteria 1596
399 Ga0105239_10382533 3300010375 Bacteria 1591
400 Ga0105239_10426669 3300010375 Bacteria 1502
401 Ga0105239_10538792 3300010375 Bacteria 1329
402 Ga0105239_10642588 3300010375 Bacteria 1212
403 Ga0105246_10016096 3300011119 Bacteria 4733
404 Ga0105246_10404535 3300011119 Bacteria 1134
405 Ga0105246_11001353 3300011119 Bacteria 757
406 Ga0105246_11252293 3300011119 Bacteria 685
407 Ga0157373_10004427 3300013100 Bacteria 10579
408 Ga0157373_10035644 3300013100 Bacteria 3572
409 Ga0157373_10057018 3300013100 Bacteria 2771
410 Ga0157373_10075595 3300013100 Bacteria 2376
411 Ga0157373_10086683 3300013100 Bacteria 2206
412 Ga0157373_10234872 3300013100 Bacteria 1295
413 Ga0157373_10482219 3300013100 Bacteria 895
414 Ga0157373_11152781 3300013100 Bacteria 583
415 Ga0157371_10001929 3300013102 Bacteria 20701
416 Ga0157371_10004654 3300013102 Bacteria 11880
417 Ga0157371_10055281 3300013102 Bacteria 2817
418 Ga0157371_10080028 3300013102 Bacteria 2314
419 Ga0157371_10088293 3300013102 Bacteria 2195
420 Ga0157371_10121744 3300013102 Bacteria 1855
421 Ga0157371_10225181 3300013102 Bacteria 1347
422 Ga0157371_10231218 3300013102 Bacteria 1329
423 Ga0157371_10423320 3300013102 Bacteria 976
424 Ga0157371_10440167 3300013102 Bacteria 957
425 Ga0157371_11090669 3300013102 Bacteria 612
426 Ga0157370_10024178 3300013104 Bacteria 6020
427 Ga0157370_10030190 3300013104 Bacteria 5313
428 Ga0157370_10054156 3300013104 Bacteria 3824
429 Ga0157370_10107736 3300013104 Bacteria 2606
430 Ga0157370_10146151 3300013104 Bacteria 2202
431 Ga0157370_10191384 3300013104 Bacteria 1899
432 Ga0157370_10276000 3300013104 Bacteria 1553
433 Ga0157370_10384981 3300013104 Bacteria 1292
434 Ga0157369_10004032 3300013105 Bacteria 17407
435 Ga0157369_10021495 3300013105 Bacteria 7218
436 Ga0157369_10246463 3300013105 Bacteria 1865
437 Ga0157369_10254207 3300013105 Bacteria 1833
438 Ga0157369_10407366 3300013105 Bacteria 1410
439 Ga0157369_10969770 3300013105 Bacteria 871
440 Ga0157369_11139206 3300013105 Bacteria 797
441 Ga0157369_11935147 3300013105 Bacteria 598
442 Ga0157374_10002969 3300013296 Bacteria 14202
443 Ga0157374_10074019 3300013296 Bacteria 3215
444 Ga0157374_10083588 3300013296 Bacteria 3033
445 Ga0157374_10383206 3300013296 Bacteria 1401
446 Ga0157374_11069977 3300013296 Bacteria 827
447 Ga0157378_10135235 3300013297 Bacteria 2285
448 Ga0157378_11174394 3300013297 Bacteria 806
449 Ga0163162_10102756 3300013306 Bacteria 2952
450 Ga0163162_10235513 3300013306 Bacteria 1961
451 Ga0163162_10254592 3300013306 Bacteria 1888
452 Ga0163162_10579793 3300013306 Bacteria 1249
453 Ga0163162_10870114 3300013306 Bacteria 1016
454 Ga0157372_10059949 3300013307 Bacteria 4258
455 Ga0157372_10089815 3300013307 Bacteria 3491
456 Ga0157372_10111866 3300013307 Bacteria 3128
457 Ga0157372_10369843 3300013307 Bacteria 1670
458 Ga0157372_13481305 3300013307 Bacteria 500
459 Ga0157375_10092375 3300013308 Bacteria 3090
460 Ga0157375_10505827 3300013308 Bacteria 1372
461 Ga0157375_10615441 3300013308 Bacteria 1244
462 Ga0157375_11015124 3300013308 Bacteria 969
463 Ga0163163_10006717 3300014325 Bacteria 10083
464 Ga0163163_10137837 3300014325 Bacteria 2481
465 Ga0157380_10005329 3300014326 Bacteria 8985
466 Ga0157380_10049733 3300014326 Bacteria 3308
467 Ga0157380_10392698 3300014326 Bacteria 1313
468 Ga0157380_10625018 3300014326 Bacteria 1070
469 Ga0157380_11592711 3300014326 Bacteria 708
470 Ga0157380_11962228 3300014326 Bacteria 647
471 Ga0157380_12076567 3300014326 Bacteria 631
472 Ga0157380_12703971 3300014326 Bacteria 563
473 Ga0182008_10184502 3300014497 Bacteria 1057
474 Ga0157377_10776954 3300014745 Bacteria 704
475 Ga0157379_10285666 3300014968 Bacteria 1502
476 Ga0157379_10443496 3300014968 Bacteria 1197
477 Ga0157379_10507179 3300014968 Bacteria 1119
478 Ga0157379_11946612 3300014968 Bacteria 580
479 Ga0157376_10040795 3300014969 Bacteria 3796
480 Ga0163161_10098424 3300017792 Bacteria 2174
481 Ga0163161_11380829 3300017792 Bacteria 615
482 Ga0206356_10696604 3300020070 Bacteria 1642
483 Ga0206352_10456701 3300020078 Bacteria 870
484 Ga0206353_11902530 3300020082 Bacteria 1153
485 Ga0213873_10089950 3300021358 Bacteria 871
486 Ga0213874_10023696 3300021377 Bacteria 1715
487 Ga0213875_10000009 3300021388 Bacteria 451129
488 Ga0213875_10174775 3300021388 Bacteria 1009
489 Ga0213875_10373080 3300021388 Bacteria 679
490 Ga0207666_1071876 3300025271 Bacteria 557
491 Ga0207697_10000125 3300025315 Bacteria 36703
492 Ga0207697_10184298 3300025315 Bacteria 916
493 Ga0207656_10073676 3300025321 Bacteria 1522
494 Ga0207656_10424216 3300025321 Bacteria 670
495 Ga0207682_10002090 3300025893 Bacteria 9045
496 Ga0207682_10051220 3300025893 Bacteria 1710
497 Ga0207692_10038604 3300025898 Bacteria 2343
498 Ga0207692_10588013 3300025898 Unclassified 714
499 Ga0207692_10833259 3300025898 Bacteria 604
500 Ga0207688_10096319 3300025901 Bacteria 1704
501 Ga0207688_10131332 3300025901 Bacteria 1468
502 Ga0207688_10241563 3300025901 Bacteria 1092
503 Ga0207680_10111358 3300025903 Bacteria 1776
504 Ga0207680_10399749 3300025903 Bacteria 971
505 Ga0207647_10000181 3300025904 Bacteria 50570
506 Ga0207647_10006349 3300025904 Bacteria 8594
507 Ga0207647_10031071 3300025904 Bacteria 3440
508 Ga0207647_10038556 3300025904 Bacteria 3020
509 Ga0207647_10045461 3300025904 Bacteria 2739
510 Ga0207647_10048684 3300025904 Bacteria 2632
511 Ga0207647_10480976 3300025904 Bacteria 694
512 Ga0207647_10801922 3300025904 Bacteria 506
513 Ga0207685_10126131 3300025905 Bacteria 1130
514 Ga0207699_10096316 3300025906 Bacteria 1868
515 Ga0207699_10157033 3300025906 Bacteria 1511
516 Ga0207645_10011200 3300025907 Bacteria 6134
517 Ga0207645_10137266 3300025907 Bacteria 1593
518 Ga0207645_10406718 3300025907 Bacteria 916
519 Ga0207643_10273052 3300025908 Bacteria 1047
520 Ga0207705_10000091 3300025909 Bacteria 110768
521 Ga0207705_10000320 3300025909 Bacteria 43763
522 Ga0207705_10005098 3300025909 Bacteria 9848
523 Ga0207705_10009747 3300025909 Bacteria 6988
524 Ga0207705_10016608 3300025909 Bacteria 5271
525 Ga0207705_10028205 3300025909 Bacteria 4002
526 Ga0207705_10067494 3300025909 Bacteria 2588
527 Ga0207705_10118362 3300025909 Bacteria 1963
528 Ga0207705_10141130 3300025909 Bacteria 1799
529 Ga0207705_10159280 3300025909 Bacteria 1695
530 Ga0207705_10286694 3300025909 Bacteria 1261
531 Ga0207705_10472195 3300025909 Bacteria 973
532 Ga0207705_10624085 3300025909 Bacteria 838
533 Ga0207705_10690970 3300025909 Bacteria 793
534 Ga0207705_10723909 3300025909 Bacteria 773
535 Ga0207705_10755948 3300025909 Bacteria 755
536 Ga0207705_10866271 3300025909 Bacteria 700
537 Ga0207684_10059931 3300025910 Bacteria 3232
538 Ga0207707_10028496 3300025912 Bacteria 4881
539 Ga0207707_10128255 3300025912 Bacteria 2218
540 Ga0207695_10338495 3300025913 Bacteria 1393
541 Ga0207695_11124753 3300025913 Bacteria 665
542 Ga0207671_10010300 3300025914 Bacteria 7727
543 Ga0207693_10007423 3300025915 Bacteria 9015
544 Ga0207693_10018850 3300025915 Bacteria 5493
545 Ga0207693_10261043 3300025915 Bacteria 1358
546 Ga0207663_10000782 3300025916 Bacteria 14252
547 Ga0207663_10360076 3300025916 Bacteria 1103
548 Ga0207660_10000750 3300025917 Bacteria 21593
549 Ga0207660_10029473 3300025917 Bacteria 3765
550 Ga0207660_10054020 3300025917 Bacteria 2865
551 Ga0207660_10102044 3300025917 Bacteria 2144
552 Ga0207660_11162784 3300025917 Bacteria 628
553 Ga0207662_11026704 3300025918 Bacteria 586
554 Ga0207657_10001561 3300025919 Bacteria 24588
555 Ga0207657_10004813 3300025919 Bacteria 14228
556 Ga0207657_10006293 3300025919 Bacteria 12337
557 Ga0207657_10008694 3300025919 Bacteria 10280
558 Ga0207657_10039763 3300025919 Bacteria 4175
559 Ga0207657_10040259 3300025919 Bacteria 4143
560 Ga0207657_10188367 3300025919 Bacteria 1666
561 Ga0207657_10220817 3300025919 Bacteria 1518
562 Ga0207657_10265181 3300025919 Bacteria 1366
563 Ga0207657_10483355 3300025919 Bacteria 971
564 Ga0207657_10483781 3300025919 Bacteria 970
565 Ga0207657_10691052 3300025919 Bacteria 793
566 Ga0207657_10692431 3300025919 Bacteria 792
567 Ga0207657_10861473 3300025919 Bacteria 699
568 Ga0207649_10009066 3300025920 Bacteria 5438
569 Ga0207649_10028725 3300025920 Bacteria 3277
570 Ga0207649_10139033 3300025920 Bacteria 1659
571 Ga0207649_10218380 3300025920 Bacteria 1356
572 Ga0207649_10702248 3300025920 Bacteria 784
573 Ga0207652_10003128 3300025921 Bacteria 13802
574 Ga0207652_10423996 3300025921 Bacteria 1200
575 Ga0207652_10515769 3300025921 Bacteria 1076
576 Ga0207652_10941608 3300025921 Bacteria 761
577 Ga0207652_11438403 3300025921 Bacteria 593
578 Ga0207681_10032887 3300025923 Bacteria 3398
579 Ga0207681_10047544 3300025923 Bacteria 2892
580 Ga0207681_10058030 3300025923 Bacteria 2648
581 Ga0207681_10471312 3300025923 Bacteria 1024
582 Ga0207681_10737726 3300025923 Bacteria 820
583 Ga0207681_10762342 3300025923 Bacteria 807
584 Ga0207681_10791069 3300025923 Bacteria 792
585 Ga0207681_11424902 3300025923 Bacteria 581
586 Ga0207694_10101829 3300025924 Bacteria 2276
587 Ga0207694_10542495 3300025924 Bacteria 976
588 Ga0207650_10002017 3300025925 Bacteria 14217
589 Ga0207650_10143421 3300025925 Bacteria 1879
590 Ga0207650_10175921 3300025925 Bacteria 1703
591 Ga0207650_10305809 3300025925 Bacteria 1300
592 Ga0207659_10014865 3300025926 Bacteria 5030
593 Ga0207659_10446830 3300025926 Bacteria 1088
594 Ga0207687_11314492 3300025927 Bacteria 621
595 Ga0207700_10158102 3300025928 Bacteria 1880
596 Ga0207700_10723982 3300025928 Bacteria 889
597 Ga0207700_10983984 3300025928 Bacteria 755
598 Ga0207664_10031282 3300025929 Bacteria 4070
599 Ga0207664_10184086 3300025929 Bacteria 1795
600 Ga0207664_10197028 3300025929 Bacteria 1737
601 Ga0207664_10757629 3300025929 Bacteria 873
602 Ga0207664_11655141 3300025929 Bacteria 562
603 Ga0207644_10083498 3300025931 Bacteria 2366
604 Ga0207644_10108181 3300025931 Bacteria 2099
605 Ga0207644_10121683 3300025931 Bacteria 1987
606 Ga0207644_10316018 3300025931 Bacteria 1262
607 Ga0207644_11091650 3300025931 Bacteria 670
608 Ga0207690_10004031 3300025932 Bacteria 8673
609 Ga0207690_10034443 3300025932 Bacteria 3263
610 Ga0207690_10116983 3300025932 Bacteria 1929
611 Ga0207690_10406195 3300025932 Bacteria 1087
612 Ga0207690_10426458 3300025932 Bacteria 1062
613 Ga0207690_10908695 3300025932 Bacteria 730
614 Ga0207690_10938639 3300025932 Bacteria 718
615 Ga0207706_10001553 3300025933 Bacteria 22757
616 Ga0207706_10002832 3300025933 Bacteria 16825
617 Ga0207706_10010496 3300025933 Bacteria 8465
618 Ga0207706_10038332 3300025933 Bacteria 4252
619 Ga0207706_10102047 3300025933 Bacteria 2524
620 Ga0207706_10102922 3300025933 Bacteria 2512
621 Ga0207706_10157793 3300025933 Bacteria 1995
622 Ga0207706_10177901 3300025933 Bacteria 1869
623 Ga0207706_10225863 3300025933 Bacteria 1639
624 Ga0207706_10256741 3300025933 Bacteria 1526
625 Ga0207706_10274794 3300025933 Bacteria 1470
626 Ga0207706_10599906 3300025933 Bacteria 946
627 Ga0207706_11032530 3300025933 Bacteria 689
628 Ga0207686_10398044 3300025934 Bacteria 1048
629 Ga0207686_10959413 3300025934 Bacteria 692
630 Ga0207709_11834725 3300025935 Bacteria 505
631 Ga0207669_10033847 3300025937 Bacteria 2889
632 Ga0207669_10071365 3300025937 Bacteria 2181
633 Ga0207669_10788603 3300025937 Bacteria 787
634 Ga0207665_10000154 3300025939 Bacteria 46682
635 Ga0207665_10205027 3300025939 Bacteria 1438
636 Ga0207691_10027956 3300025940 Bacteria 5284
637 Ga0207691_10050036 3300025940 Bacteria 3827
638 Ga0207691_10090419 3300025940 Bacteria 2744
639 Ga0207691_10625390 3300025940 Bacteria 911
640 Ga0207711_10100127 3300025941 Bacteria 2563
641 Ga0207711_11105239 3300025941 Bacteria 734
642 Ga0207689_10284544 3300025942 Bacteria 1369
643 Ga0207689_10401397 3300025942 Bacteria 1143
644 Ga0207661_10036040 3300025944 Bacteria 3859
645 Ga0207661_10068782 3300025944 Bacteria 2885
646 Ga0207661_10096586 3300025944 Bacteria 2472
647 Ga0207661_10096945 3300025944 Bacteria 2468
648 Ga0207661_10216782 3300025944 Bacteria 1690
649 Ga0207661_10910590 3300025944 Bacteria 810
650 Ga0207661_10938749 3300025944 Bacteria 797
651 Ga0207679_10178867 3300025945 Bacteria 1753
652 Ga0207679_10407984 3300025945 Bacteria 1196
653 Ga0207679_10747842 3300025945 Bacteria 889
654 Ga0207679_10777876 3300025945 Bacteria 872
655 Ga0207679_11868464 3300025945 Bacteria 548
656 Ga0207667_10000122 3300025949 Bacteria 121588
657 Ga0207667_10008746 3300025949 Bacteria 12003
658 Ga0207667_10008838 3300025949 Bacteria 11922
659 Ga0207667_10019585 3300025949 Bacteria 7548
660 Ga0207667_10044469 3300025949 Bacteria 4705
661 Ga0207667_10134626 3300025949 Bacteria 2545
662 Ga0207667_10140653 3300025949 Bacteria 2485
663 Ga0207667_10195057 3300025949 Bacteria 2078
664 Ga0207667_10239674 3300025949 Bacteria 1856
665 Ga0207667_10287430 3300025949 Bacteria 1680
666 Ga0207667_10375420 3300025949 Bacteria 1449
667 Ga0207667_10825300 3300025949 Bacteria 923
668 Ga0207651_10328996 3300025960 Bacteria 1280
669 Ga0207651_10417204 3300025960 Bacteria 1145
670 Ga0207651_10521202 3300025960 Bacteria 1030
671 Ga0207712_10004801 3300025961 Bacteria 8540
672 Ga0207712_10166014 3300025961 Bacteria 1721
673 Ga0207712_10336138 3300025961 Bacteria 1251
674 Ga0207712_10962578 3300025961 Bacteria 756
675 Ga0207668_10001859 3300025972 Bacteria 12319
676 Ga0207668_10014137 3300025972 Bacteria 4937
677 Ga0207668_10112182 3300025972 Bacteria 2048
678 Ga0207668_10128486 3300025972 Bacteria 1931
679 Ga0207668_10455084 3300025972 Bacteria 1093
680 Ga0207668_10479566 3300025972 Bacteria 1066
681 Ga0207668_10494296 3300025972 Bacteria 1051
682 Ga0207668_10511569 3300025972 Bacteria 1034
683 Ga0207668_11458034 3300025972 Bacteria 617
684 Ga0207640_10099971 3300025981 Bacteria 2031
685 Ga0207640_10111576 3300025981 Bacteria 1940
686 Ga0207640_10148940 3300025981 Bacteria 1717
687 Ga0207640_10298391 3300025981 Bacteria 1273
688 Ga0207640_10510794 3300025981 Bacteria 1002
689 Ga0207640_11050188 3300025981 Bacteria 719
690 Ga0207640_11376682 3300025981 Bacteria 632
691 Ga0207640_11438514 3300025981 Bacteria 618
692 Ga0207640_11864167 3300025981 Bacteria 544
693 Ga0207640_11881117 3300025981 Bacteria 541
694 Ga0207658_10003983 3300025986 Bacteria 10349
695 Ga0207658_10021490 3300025986 Bacteria 4481
696 Ga0207658_10492867 3300025986 Bacteria 1090
697 Ga0207658_11291232 3300025986 Bacteria 667
698 Ga0207677_10303832 3300026023 Bacteria 1319
699 Ga0207703_10240607 3300026035 Bacteria 1627
700 Ga0207703_10921108 3300026035 Bacteria 837
701 Ga0207703_12076575 3300026035 Bacteria 544
702 Ga0207639_10043710 3300026041 Bacteria 3365
703 Ga0207639_10061305 3300026041 Bacteria 2904
704 Ga0207639_10148343 3300026041 Bacteria 1962
705 Ga0207639_10191598 3300026041 Bacteria 1747
706 Ga0207639_10293190 3300026041 Bacteria 1435
707 Ga0207639_10677677 3300026041 Bacteria 955
708 Ga0207639_11054636 3300026041 Bacteria 762
709 Ga0207639_11430487 3300026041 Bacteria 649
710 Ga0207639_11493070 3300026041 Bacteria 634
711 Ga0207639_11788976 3300026041 Bacteria 575
712 Ga0207678_10005696 3300026067 Bacteria 11123
713 Ga0207678_10037676 3300026067 Bacteria 4205
714 Ga0207678_10046770 3300026067 Bacteria 3742
715 Ga0207678_10083224 3300026067 Bacteria 2737
716 Ga0207678_10178394 3300026067 Bacteria 1814
717 Ga0207678_10184911 3300026067 Bacteria 1780
718 Ga0207678_10191073 3300026067 Bacteria 1750
719 Ga0207678_10444523 3300026067 Bacteria 1126
720 Ga0207678_10654649 3300026067 Bacteria 923
721 Ga0207708_10259984 3300026075 Bacteria 1401
722 Ga0207708_10842337 3300026075 Bacteria 791
723 Ga0207702_10006356 3300026078 Bacteria 10200
724 Ga0207702_10025873 3300026078 Bacteria 4871
725 Ga0207702_10051593 3300026078 Bacteria 3477
726 Ga0207702_10200930 3300026078 Bacteria 1847
727 Ga0207702_10572367 3300026078 Bacteria 1107
728 Ga0207702_11673667 3300026078 Bacteria 629
729 Ga0207641_10009035 3300026088 Bacteria 8233
730 Ga0207641_10033172 3300026088 Bacteria 4291
731 Ga0207641_10122965 3300026088 Bacteria 2319
732 Ga0207641_10207729 3300026088 Bacteria 1809
733 Ga0207641_10360908 3300026088 Bacteria 1387
734 Ga0207641_11729980 3300026088 Bacteria 627
735 Ga0207648_10221821 3300026089 Bacteria 1680
736 Ga0207648_10752759 3300026089 Bacteria 905
737 Ga0207676_10188754 3300026095 Bacteria 1812
738 Ga0207676_10197416 3300026095 Bacteria 1775
739 Ga0207676_10255108 3300026095 Bacteria 1580
740 Ga0207676_10304071 3300026095 Bacteria 1457
741 Ga0207674_10000580 3300026116 Bacteria 48154
742 Ga0207674_10007588 3300026116 Bacteria 12639
743 Ga0207674_10070108 3300026116 Bacteria 3524
744 Ga0207674_10601873 3300026116 Bacteria 1062
745 Ga0207674_10691752 3300026116 Bacteria 984
746 Ga0207674_10847008 3300026116 Bacteria 882
747 Ga0207675_100076644 3300026118 Bacteria 3131
748 Ga0207675_100241610 3300026118 Bacteria 1745
749 Ga0207683_10003970 3300026121 Bacteria 12833
750 Ga0207698_10000703 3300026142 Bacteria 19442
751 Ga0207698_10001709 3300026142 Bacteria 12798
752 Ga0207698_10006559 3300026142 Bacteria 7272
753 Ga0207698_10049490 3300026142 Bacteria 3199
754 Ga0207698_10172623 3300026142 Bacteria 1906
755 Ga0207698_10193882 3300026142 Bacteria 1813
756 Ga0207698_10194785 3300026142 Bacteria 1809
757 Ga0207698_10342228 3300026142 Bacteria 1409
758 Ga0207698_10798836 3300026142 Bacteria 946
759 Ga0207698_11668360 3300026142 Bacteria 653
760 Ga0209179_1051170 3300027512 Bacteria 886
761 Ga0209179_1058218 3300027512 Bacteria 836
762 Ga0209974_10018635 3300027876 Bacteria 2302
763 Ga0207428_10000733 3300027907 Bacteria 37786
764 Ga0207428_10029808 3300027907 Bacteria 4515
765 Ga0207428_10699962 3300027907 Bacteria 725
766 Ga0268266_10179697 3300028379 Bacteria 1926
767 Ga0268266_10474152 3300028379 Bacteria 1192
768 Ga0268265_10017459 3300028380 Bacteria 4953
769 Ga0268265_10018144 3300028380 Bacteria 4872
770 Ga0268265_10020400 3300028380 Bacteria 4625
771 Ga0268265_10124832 3300028380 Bacteria 2128
772 Ga0268265_12550571 3300028380 Bacteria 517
773 Ga0268264_10001404 3300028381 Bacteria 22509
774 Ga0268264_10047676 3300028381 Bacteria 3562
775 Ga0268264_10290259 3300028381 Bacteria 1536
776 Ga0268264_10331720 3300028381 Bacteria 1442
777 Ga0268264_10840986 3300028381 Bacteria 919
778 Ga0268264_11845012 3300028381 Bacteria 614
779 Ga0316182_1071532 3300030745 Bacteria 628
780 Ga0265760_10219614 3300031090 Bacteria 648
781 Ga0265316_10518582 3300031344 Bacteria 850
782 Ga0307513_10855485 3300031456 Bacteria 616
783 Ga0307509_10185870 3300031507 Bacteria 1936
784 Ga0307408_100016465 3300031548 Bacteria 4935
785 Ga0307408_100053009 3300031548 Bacteria 2928
786 Ga0307408_100078978 3300031548 Bacteria 2454
787 Ga0307408_100293823 3300031548 Bacteria 1358
788 Ga0307508_10150881 3300031616 Bacteria 1928
789 Ga0307516_10119076 3300031730 Bacteria 2434
790 Ga0307516_10245777 3300031730 Bacteria 1486
791 Ga0307405_10613725 3300031731 Bacteria 889
792 Ga0307405_11467071 3300031731 Bacteria 598
793 Ga0307405_11520794 3300031731 Bacteria 588
794 Ga0307413_10000415 3300031824 Bacteria 13755
795 Ga0307413_10095072 3300031824 Bacteria 1952
796 Ga0307413_10107064 3300031824 Bacteria 1862
797 Ga0307410_10002306 3300031852 Bacteria 9167
798 Ga0307410_10015265 3300031852 Bacteria 4550
799 Ga0307410_10034767 3300031852 Bacteria 3268
800 Ga0307410_10047685 3300031852 Bacteria 2864
801 Ga0307410_10320300 3300031852 Bacteria 1230
802 Ga0307410_10683025 3300031852 Bacteria 864
803 Ga0307406_10042135 3300031901 Bacteria 2849
804 Ga0307406_10068209 3300031901 Bacteria 2321
805 Ga0307406_10169214 3300031901 Bacteria 1580
806 Ga0307406_10220942 3300031901 Bacteria 1408
807 Ga0307407_10005401 3300031903 Bacteria 5539
808 Ga0307407_10018047 3300031903 Bacteria 3557
809 Ga0307407_11357858 3300031903 Bacteria 559
810 Ga0307412_10040335 3300031911 Bacteria 3020
811 Ga0307412_10135475 3300031911 Bacteria 1796
812 Ga0307412_10254274 3300031911 Bacteria 1366
813 Ga0307412_10393523 3300031911 Bacteria 1126
814 Ga0307412_11843396 3300031911 Bacteria 557
815 Ga0307409_100000526 3300031995 Bacteria 16577
816 Ga0307409_100020471 3300031995 Bacteria 4510
817 Ga0307409_100067399 3300031995 Bacteria 2826
818 Ga0307409_100072677 3300031995 Bacteria 2740
819 Ga0307409_100146529 3300031995 Bacteria 2042
820 Ga0307409_100235619 3300031995 Bacteria 1662
821 Ga0307409_100309197 3300031995 Bacteria 1474
822 Ga0307409_100406258 3300031995 Bacteria 1302
823 Ga0307409_100426825 3300031995 Bacteria 1273
824 Ga0307409_101522305 3300031995 Bacteria 696
825 Ga0307416_100163632 3300032002 Bacteria 2060
826 Ga0307416_100204479 3300032002 Bacteria 1877
827 Ga0307416_100344312 3300032002 Bacteria 1505
828 Ga0307416_100710375 3300032002 Bacteria 1095
829 Ga0307416_100780735 3300032002 Bacteria 1050
830 Ga0307416_101023547 3300032002 Bacteria 929
831 Ga0307414_10003784 3300032004 Bacteria 8131
832 Ga0307414_10046912 3300032004 Bacteria 2970
833 Ga0307414_10064164 3300032004 Bacteria 2613
834 Ga0307414_10068211 3300032004 Bacteria 2551
835 Ga0307414_10789717 3300032004 Bacteria 865
836 Ga0307414_11857929 3300032004 Bacteria 562
837 Ga0307411_10000377 3300032005 Bacteria 15180
838 Ga0307411_10016437 3300032005 Bacteria 4187
839 Ga0307411_10022261 3300032005 Bacteria 3727
840 Ga0307411_10063879 3300032005 Bacteria 2462
841 Ga0307411_10118341 3300032005 Bacteria 1911
842 Ga0307411_10216356 3300032005 Bacteria 1483
843 Ga0307411_10267513 3300032005 Bacteria 1353
844 Ga0307411_10671309 3300032005 Bacteria 899
845 Ga0307411_10729043 3300032005 Bacteria 866
846 Ga0307411_11592009 3300032005 Bacteria 602
847 Ga0307415_100001808 3300032126 Bacteria 10474
848 Ga0307415_100026565 3300032126 Bacteria 3654
849 Ga0307415_100034020 3300032126 Bacteria 3313
850 Ga0307415_100284518 3300032126 Bacteria 1361
851 Ga0307415_100302958 3300032126 Bacteria 1325
852 Ga0307415_100458335 3300032126 Bacteria 1104
853 Ga0307415_102459223 3300032126 Bacteria 512
854 Ga0307507_10012192 3300033179 Bacteria 10667
855 Ga0316215_1003807 3300033544 Bacteria 1445
856 Ga0373928_0052663 3300035084 Bacteria 965
857 Ga0373929_0123294 3300035085 Bacteria 673
858 Ga0373929_0150763 3300035085 Bacteria 623
859 Ga0373940_0017710 3300035088 Bacteria 1779
860 Ga0373940_0032844 3300035088 Bacteria 1393
861 Ga0373940_0200781 3300035088 Bacteria 655
862 Ga0373951_0154044 3300035091 Bacteria 646
863 Ga0373932_0120024 3300035112 Bacteria 876
864 Ga0373939_0002714 3300035114 Bacteria 4152
865 Ga0373939_0010507 3300035114 Bacteria 2317
866 Ga0373939_0035806 3300035114 Bacteria 1465
867 Ga0373941_0009356 3300035115 Bacteria 2466
868 Ga0373941_0107344 3300035115 Bacteria 980
869 Ga0373960_0003056 3300035121 Bacteria 3778
870 Ga0373960_0143900 3300035121 Bacteria 809
871 Ga0373943_0194932 3300035170 Bacteria 1119
872 Ga0373962_0016166 3300035242 Bacteria 1921
873 Ga0373962_0023487 3300035242 Bacteria 1643
874 Ga0373931_0001206 3300035691 Bacteria 11056
875 Ga0373931_0022019 3300035691 Bacteria 3203
876 Ga0373931_0028804 3300035691 Bacteria 2847
877 Ga0373931_0040604 3300035691 Bacteria 2442
878 Ga0373931_0237473 3300035691 Bacteria 1104
879 Ga0373927_0094432 3300035695 Bacteria 1943
880 Ga0373947_1237865 3300035725 Bacteria 508
881 Ga0395899_0015104 3300037312 Bacteria 5886
882 Ga0395899_0027700 3300037312 Bacteria 4270
883 Ga0395899_0056027 3300037312 Bacteria 2914
884 Ga0395899_0060927 3300037312 Bacteria 2779
885 Ga0395899_0063705 3300037312 Bacteria 2711
886 Ga0395899_0074088 3300037312 Bacteria 2488
887 Ga0395899_0114364 3300037312 Bacteria 1938
888 Ga0395899_0154212 3300037312 Bacteria 1626
889 Ga0395899_0247624 3300037312 Bacteria 1224
890 Ga0395899_0304537 3300037312 Bacteria 1077
891 Ga0395899_0331489 3300037312 Bacteria 1022
892 Ga0395899_0548283 3300037312 Bacteria 743
893 Ga0395899_0621654 3300037312 Bacteria 686
894 Ga0395900_0003720 3300037418 Bacteria 16389
895 Ga0395900_0003925 3300037418 Bacteria 15869
896 Ga0395900_0004596 3300037418 Bacteria 14565
897 Ga0395900_0005577 3300037418 Bacteria 13172
898 Ga0395900_0008623 3300037418 Bacteria 10477
899 Ga0395900_0010077 3300037418 Bacteria 9666
900 Ga0395900_0018188 3300037418 Bacteria 7169
901 Ga0395900_0032952 3300037418 Bacteria 5331
902 Ga0395900_0044151 3300037418 Bacteria 4593
903 Ga0395900_0089614 3300037418 Bacteria 3161
904 Ga0395900_0097744 3300037418 Bacteria 3016
905 Ga0395900_0113604 3300037418 Bacteria 2779
906 Ga0395900_0140791 3300037418 Bacteria 2470
907 Ga0395900_0146660 3300037418 Bacteria 2413
908 Ga0395900_0186093 3300037418 Bacteria 2108
909 Ga0395900_0205520 3300037418 Bacteria 1990
910 Ga0395900_0214165 3300037418 Bacteria 1944
911 Ga0395900_0234199 3300037418 Bacteria 1845
912 Ga0395900_0268586 3300037418 Bacteria 1701
913 Ga0395900_0283176 3300037418 Bacteria 1649
914 Ga0395900_0351509 3300037418 Bacteria 1447
915 Ga0395900_0366792 3300037418 Bacteria 1410
916 Ga0395900_0642623 3300037418 Bacteria 998
917 Ga0395900_0732575 3300037418 Bacteria 920
918 Ga0395900_0816719 3300037418 Bacteria 859
919 Ga0395900_0838319 3300037418 Bacteria 845
920 Ga0395900_1332296 3300037418 Bacteria 631
921 Ga0395900_1384634 3300037418 Bacteria 616
922 Ga0395900_1670533 3300037418 Bacteria 548
923 Ga0395900_1683525 3300037418 Bacteria 545
924 Ga0395900_1699798 3300037418 Bacteria 542
925 Ga0395900_1903095 3300037418 Bacteria 505
926 Ga0395898_0028989 3300037466 Bacteria 5547
927 Ga0395898_0053183 3300037466 Bacteria 3954
928 Ga0395898_0062916 3300037466 Bacteria 3602
929 Ga0395898_0125326 3300037466 Bacteria 2461
930 Ga0395898_0129662 3300037466 Bacteria 2416
931 Ga0395898_0158058 3300037466 Bacteria 2168
932 Ga0395898_0172131 3300037466 Bacteria 2070
933 Ga0395898_0172572 3300037466 Bacteria 2067
934 Ga0395898_0240106 3300037466 Bacteria 1728
935 Ga0395898_0302232 3300037466 Bacteria 1526
936 Ga0395898_0412782 3300037466 Bacteria 1287
937 Ga0395898_0487619 3300037466 Bacteria 1172
938 Ga0395898_0843967 3300037466 Bacteria 855
939 Ga0395898_1236583 3300037466 Bacteria 677
940 Ga0395898_1330846 3300037466 Bacteria 647
941 Ga0395905_0001141 3300037471 Bacteria 33234
942 Ga0395905_0001314 3300037471 Bacteria 30557
943 Ga0395905_0003401 3300037471 Bacteria 17036
944 Ga0395905_0004560 3300037471 Bacteria 14341
945 Ga0395905_0012554 3300037471 Bacteria 8149
946 Ga0395905_0036588 3300037471 Bacteria 4610
947 Ga0395905_0077269 3300037471 Bacteria 3119
948 Ga0395905_0100833 3300037471 Bacteria 2711
949 Ga0395905_0106004 3300037471 Bacteria 2639
950 Ga0395905_0132419 3300037471 Bacteria 2345
951 Ga0395905_0134423 3300037471 Bacteria 2326
952 Ga0395905_0144700 3300037471 Bacteria 2236
953 Ga0395905_0228724 3300037471 Bacteria 1739
954 Ga0395905_0282207 3300037471 Bacteria 1547
955 Ga0395905_0286829 3300037471 Bacteria 1533
956 Ga0395905_0364304 3300037471 Bacteria 1338
957 Ga0395905_0370842 3300037471 Bacteria 1325
958 Ga0395905_0371983 3300037471 Bacteria 1322
959 Ga0395905_0408986 3300037471 Bacteria 1252
960 Ga0395905_0434014 3300037471 Bacteria 1210
961 Ga0395905_0436288 3300037471 Bacteria 1207
962 Ga0395905_0520075 3300037471 Bacteria 1090
963 Ga0395905_0528248 3300037471 Bacteria 1080
964 Ga0395905_0599370 3300037471 Bacteria 1003
965 Ga0395905_0614608 3300037471 Bacteria 989
966 Ga0395905_0748392 3300037471 Bacteria 880
967 Ga0395905_0855598 3300037471 Bacteria 812
968 Ga0395905_1158790 3300037471 Bacteria 676
969 Ga0395905_1219770 3300037471 Bacteria 656
970 Ga0395905_1252535 3300037471 Bacteria 645
971 Ga0395905_1428122 3300037471 Bacteria 596
972 Ga0395905_1503692 3300037471 Bacteria 578
973 Ga0395905_1751984 3300037471 Bacteria 527
974 Ga0436364_0063485 3300037853 Bacteria 24575
975 Ga0436364_0108740 3300037853 Bacteria 2234
976 Ga0436364_0574406 3300037853 Bacteria 1177
977 Ga0395901_0000041 3300038443 Bacteria 202314
978 Ga0395901_0005013 3300038443 Bacteria 13366
979 Ga0395901_0006286 3300038443 Bacteria 12033
980 Ga0395901_0029966 3300038443 Bacteria 5605
981 Ga0395901_0090289 3300038443 Bacteria 3206
982 Ga0395901_0114687 3300038443 Bacteria 2830
983 Ga0395901_0127876 3300038443 Bacteria 2670
984 Ga0395901_0186749 3300038443 Bacteria 2174
985 Ga0395901_0197428 3300038443 Bacteria 2109
986 Ga0395901_0208565 3300038443 Bacteria 2046
987 Ga0395901_0257846 3300038443 Bacteria 1815
988 Ga0395901_0348040 3300038443 Bacteria 1530
989 Ga0395901_0349266 3300038443 Bacteria 1526
990 Ga0395901_0356275 3300038443 Bacteria 1509
991 Ga0395901_0356763 3300038443 Bacteria 1508
992 Ga0395901_0369655 3300038443 Bacteria 1477
993 Ga0395901_0422069 3300038443 Bacteria 1367
994 Ga0395901_0514494 3300038443 Bacteria 1217
995 Ga0395901_0616747 3300038443 Bacteria 1092
996 Ga0395901_0801847 3300038443 Bacteria 930
997 Ga0395901_1302710 3300038443 Bacteria 688
998 Ga0395901_1365260 3300038443 Bacteria 668
999 Ga0395901_1802535 3300038443 Bacteria 561
1000 Ga0436365_0254242 3300039437 Bacteria 1048
1001 Ga0436365_1422861 3300039437 Bacteria 2487
1002 Ga0436365_1512976 3300039437 Bacteria 792
1003 Ga0436360_0915969 3300039438 Bacteria 576
1004 Ga0436363_0180868 3300039450 Bacteria 945
1005 Ga0436363_0185641 3300039450 Bacteria 1043
1006 Ga0436363_0327156 3300039450 Bacteria 908
1007 Ga0436363_0428368 3300039450 Bacteria 1221
1008 Ga0436363_0928585 3300039450 Bacteria 547
1009 Ga0436363_1097112 3300039450 Bacteria 2361
1010 Ga0436363_1539960 3300039450 Bacteria 603
1011 Ga0436362_0891275 3300039453 Bacteria 717
1012 Ga0439455_0032217 3300042012 Bacteria 1309
1013 Ga0450905_006273 3300042142 Bacteria 1607
1014 Ga0450889_001512 3300042144 Bacteria 2388
1015 Ga0439458_0000155 3300042157 Bacteria 15100
1016 Ga0439458_0090233 3300042157 Bacteria 788
1017 Ga0439459_0144096 3300042438 Bacteria 618
1018 Ga0439464_0022532 3300042439 Bacteria 1735
1019 Ga0466969_0042549 3300044656 Bacteria 2267
1020 Ga0466972_0065099 3300044658 Bacteria 1744
1021 Ga0466972_0076945 3300044658 Bacteria 1589
1022 Ga0466966_0006002 3300044684 Bacteria 8018
1023 Ga0466966_0020522 3300044684 Bacteria 4343
1024 Ga0466966_0136095 3300044684 Bacteria 1502
1025 Ga0466966_0336062 3300044684 Bacteria 908
1026 Ga0466966_0502582 3300044684 Bacteria 729
1027 Ga0466961_0007983 3300044693 Bacteria 6746
1028 Ga0466961_0054687 3300044693 Bacteria 2546
1029 Ga0466961_0632859 3300044693 Bacteria 642
1030 Ga0466963_0021278 3300044694 Bacteria 4089
1031 Ga0466963_0027890 3300044694 Bacteria 3620
1032 Ga0466963_0033786 3300044694 Bacteria 3324
1033 Ga0466963_0037418 3300044694 Bacteria 3168
1034 Ga0466963_0048735 3300044694 Bacteria 2800
1035 Ga0466963_0080798 3300044694 Bacteria 2201
1036 Ga0466963_0150162 3300044694 Bacteria 1617
1037 Ga0466963_0195249 3300044694 Bacteria 1415
1038 Ga0466971_0004107 3300044719 Bacteria 6270
1039 Ga0466971_0112692 3300044719 Bacteria 1256
1040 Ga0466971_0126437 3300044719 Bacteria 1185
1041 Ga0466971_0346806 3300044719 Bacteria 718
1042 Ga0466971_0608835 3300044719 Bacteria 545
1043 Ga0466970_0375300 3300044765 Bacteria 809
1044 Ga0466970_0389522 3300044765 Bacteria 794
1045 Ga0466970_0392728 3300044765 Bacteria 791
1046 Ga0466957_0026422 3300044842 Bacteria 3444
1047 Ga0466957_0119751 3300044842 Bacteria 1677
1048 Ga0466957_0428581 3300044842 Bacteria 908
1049 Ga0466960_0128366 3300044901 Bacteria 1335
1050 Ga0466960_0233182 3300044901 Bacteria 1016
1051 Ga0466960_0252731 3300044901 Bacteria 980
1052 Ga0466959_0013254 3300045049 Bacteria 5970
1053 Ga0466959_0117707 3300045049 Bacteria 1891
1054 Ga0466959_0175786 3300045049 Bacteria 1500
1055 Ga0466959_0385308 3300045049 Bacteria 954
1056 Ga0466959_0584879 3300045049 Bacteria 751
1057 Ga0466958_0010000 3300045836 Bacteria 5299
1058 Ga0466958_0060299 3300045836 Bacteria 2309
1059 Ga0466958_0115718 3300045836 Bacteria 1676
1060 Ga0466958_0790250 3300045836 Bacteria 619
1061 Ga0466958_0802529 3300045836 Bacteria 614
1062 Ga0466967_0041444 3300045976 Bacteria 3970
1063 Ga0466967_0103734 3300045976 Bacteria 2602
1064 Ga0466967_0109437 3300045976 Bacteria 2537
1065 Ga0466967_0380452 3300045976 Bacteria 1370
1066 Ga0466967_0394871 3300045976 Bacteria 1345
1067 Ga0466967_0415616 3300045976 Bacteria 1310
1068 Ga0466967_0423119 3300045976 Bacteria 1298
1069 Ga0466967_0437618 3300045976 Bacteria 1276
1070 Ga0466967_0942462 3300045976 Bacteria 859
1071 Ga0466967_0984340 3300045976 Bacteria 840
1072 Ga0495629_0224914 3300046459 Bacteria 1294
1073 Ga0495605_0018292 3300046474 Bacteria 3758
1074 Ga0495605_0359824 3300046474 Bacteria 609
1075 Ga0495662_0271504 3300046476 Bacteria 835
1076 Ga0495584_0365416 3300046491 Bacteria 733
1077 Ga0495585_0066640 3300046492 Bacteria 1971
1078 Ga0495585_0175132 3300046492 Bacteria 1106
1079 Ga0495596_0080449 3300046500 Bacteria 1265
1080 Ga0495616_0005667 3300046513 Bacteria 7649
1081 Ga0495620_0028022 3300046515 Bacteria 2626
1082 Ga0495631_0002293 3300046518 Bacteria 10937
1083 Ga0495632_0034373 3300046519 Bacteria 2595
1084 Ga0495637_0061801 3300046520 Bacteria 1535
1085 Ga0495643_0383823 3300046522 Bacteria 623
1086 Ga0495648_0140629 3300046524 Bacteria 1271
1087 Ga0495663_0004391 3300046525 Bacteria 3968
1088 Ga0495663_0015836 3300046525 Bacteria 2128
1089 Ga0495663_0365477 3300046525 Bacteria 527
1090 Ga0495666_0212233 3300046526 Bacteria 888
1091 Ga0495654_0176291 3300046530 Bacteria 928
1092 Ga0495640_0386267 3300046533 Bacteria 861
1093 Ga0495598_0000508 3300046537 Bacteria 7204
1094 Ga0495598_0007000 3300046537 Bacteria 2568
1095 Ga0495598_0174331 3300046537 Bacteria 764
1096 Ga0495609_0055262 3300046538 Bacteria 1762
1097 Ga0495621_0002483 3300046539 Bacteria 4974
1098 Ga0495621_0008887 3300046539 Bacteria 3028
1099 Ga0495621_0040727 3300046539 Bacteria 1629
1100 Ga0495621_0055843 3300046539 Bacteria 1422
1101 Ga0495621_0168461 3300046539 Bacteria 869
1102 Ga0495622_0039902 3300046557 Bacteria 2186
1103 Ga0495633_0003339 3300046558 Bacteria 10778
1104 Ga0495633_0064540 3300046558 Bacteria 1712
1105 Ga0495656_0092543 3300046615 Bacteria 1385
1106 Ga0495656_0376634 3300046615 Bacteria 739
1107 Ga0495668_0017416 3300046616 Bacteria 4167
1108 Ga0495668_0087666 3300046616 Bacteria 1706
1109 Ga0495611_0268798 3300046648 Bacteria 789
1110 Ga0495625_0034061 3300046660 Bacteria 3760
1111 Ga0495625_0151463 3300046660 Bacteria 1559
1112 Ga0495661_0176964 3300046665 Bacteria 1133
1113 Ga0495658_0594863 3300046683 Bacteria 709
1114 Ga0495669_0011169 3300046684 Bacteria 3808
1115 Ga0495669_0013096 3300046684 Bacteria 3532
1116 Ga0495669_0023409 3300046684 Bacteria 2688
1117 Ga0495669_0036262 3300046684 Bacteria 2179
1118 Ga0495669_0085890 3300046684 Bacteria 1448
1119 Ga0495669_0329825 3300046684 Bacteria 737
1120 Ga0495613_0163220 3300046689 Bacteria 1584
1121 Ga0495670_0014228 3300046691 Bacteria 3914
1122 Ga0495670_0015314 3300046691 Bacteria 3770
1123 Ga0495670_0089037 3300046691 Bacteria 1578
1124 Ga0495649_0232208 3300046694 Bacteria 952
1125 Ga0495589_0441669 3300046794 Bacteria 596
1126 Ga0495660_0022790 3300046810 Bacteria 3573
1127 Ga0495676_0154282 3300047321 Bacteria 1631
1128 Ga0495683_0468491 3300047323 Bacteria 515
1129 Ga0495687_177461 3300047443 Bacteria 699
1130 Ga0495677_0003155 3300047445 Bacteria 6428
1131 Ga0495677_0087903 3300047445 Bacteria 1169
1132 Ga0495677_0313334 3300047445 Bacteria 618
1133 Ga0495686_0168267 3300047472 Bacteria 1276
1134 Ga0495615_0113286 3300048090 Bacteria 778
1135 Ga0495615_0126663 3300048090 Bacteria 743
1136 Ga0496100_0276504 3300048903 Bacteria 1250
1137 Ga0496101_0153577 3300048904 Bacteria 1762
1138 Ga0496102_1053331 3300048905 Bacteria 733
1139 Ga0496103_0078961 3300048906 Bacteria 2067
1140 Ga0496104_0007369 3300048907 Bacteria 9720
1141 Ga0496104_0072990 3300048907 Bacteria 3264
1142 Ga0496105_0030434 3300048908 Bacteria 4423
1143 Ga0496105_0066282 3300048908 Bacteria 2980
1144 Ga0496105_1030734 3300048908 Bacteria 614
1145 Ga0496106_0029558 3300048909 Bacteria 4085
1146 Ga0496106_0182894 3300048909 Bacteria 1664
1147 Ga0496107_0153153 3300048910 Unclassified 1706
1148 Ga0496107_0180613 3300048910 Bacteria 1567
1149 Ga0496108_0030914 3300048911 Bacteria 4438
1150 Ga0496108_0317948 3300048911 Bacteria 1357
1151 Ga0496108_0334834 3300048911 Bacteria 1320
1152 Ga0496108_0555576 3300048911 Bacteria 1001
1153 Ga0496108_0887806 3300048911 Bacteria 766
1154 Ga0496109_0124050 3300048912 Bacteria 2407
1155 Ga0496109_0469516 3300048912 Bacteria 1188
1156 Ga0496109_1255459 3300048912 Bacteria 677
1157 Ga0496109_1310655 3300048912 Bacteria 660
1158 Ga0496110_0101246 3300048913 Bacteria 2582
1159 Ga0496110_0490829 3300048913 Bacteria 1119
1160 Ga0496110_0719030 3300048913 Bacteria 901
1161 Ga0496110_1068418 3300048913 Bacteria 715
1162 Ga0496111_0199876 3300048914 Bacteria 1486
1163 Ga0496111_0618538 3300048914 Bacteria 792
1164 Ga0496112_0000419 3300048915 Bacteria 28061
1165 Ga0496112_0088398 3300048915 Bacteria 3066
1166 Ga0496112_0677912 3300048915 Bacteria 959
1167 Ga0496112_0798710 3300048915 Bacteria 868
1168 Ga0496113_0394372 3300048916 Bacteria 1111
1169 Ga0496113_0452024 3300048916 Bacteria 1032
1170 Ga0496114_0105195 3300048917 Bacteria 2414
1171 Ga0496115_0035582 3300048918 Bacteria 3940
1172 Ga0496123_0087404 3300048926 Bacteria 1865
1173 Ga0496124_0003283 3300048927 Bacteria 19954
1174 Ga0496124_0010909 3300048927 Bacteria 9142
1175 Ga0496125_0317089 3300048928 Bacteria 947
1176 Ga0496126_0290281 3300048929 Bacteria 1353
1177 Ga0495678_094950 3300049459 Bacteria 1043
1178 Ga0495682_0047722 3300049460 Bacteria 1562
1179 Ga0501067_0510530 3300049583 Bacteria 672
1180 Ga0501216_063337 3300049660 Bacteria 750
1181 Ga0501079_0879202 3300049741 Bacteria 706
1182 Ga0501080_1656762 3300049742 Bacteria 540
1183 Ga0501083_0694550 3300049744 Bacteria 662
1184 nmdc:mga0k408_236664_c1 3300050493 Bacteria 1090
1185 nmdc:mga07m45_380799_c1 3300050496 Bacteria 819
1186 nmdc:mga05p37_39565_c1 3300050507 Bacteria 5790
1187 nmdc:mga05p37_8115_c1 3300050507 Bacteria 12409
1188 nmdc:mga09592_184192_c1 3300050508 Bacteria 1807
1189 nmdc:mga09592_829877_c1 3300050508 Bacteria 780
1190 nmdc:mga0qj67_26100_c1 3300050509 Bacteria 4522
1191 nmdc:mga06r32_5267_c1 3300050510 Bacteria 11635
1192 nmdc:mga06r32_99092_c1 3300050510 Bacteria 2858
1193 nmdc:mga08y16_11593_c1 3300050511 Bacteria 9263
1194 nmdc:mga08y16_153507_c1 3300050511 Bacteria 2393
1195 nmdc:mga08y16_161331_c1 3300050511 Bacteria 2329
1196 nmdc:mga08y16_223115_c1 3300050511 Bacteria 1950
1197 nmdc:mga08y16_342895_c1 3300050511 Bacteria 1536
1198 nmdc:mga08y16_343039_c1 3300050511 Bacteria 1535
1199 nmdc:mga08y16_35966_c1 3300050511 Bacteria 5201
1200 nmdc:mga08y16_833066_c1 3300050511 Bacteria 913
1201 nmdc:mga08y16_8471_c1 3300050511 Bacteria 10771
1202 nmdc:mga08y16_88074_c1 3300050511 Bacteria 3235
1203 nmdc:mga0n895_1250265_c1 3300050512 Bacteria 715
1204 nmdc:mga0n895_132444_c1 3300050512 Bacteria 2519
1205 nmdc:mga0n895_1440171_c1 3300050512 Bacteria 656
1206 nmdc:mga0n895_23049_c1 3300050512 Bacteria 5847
1207 nmdc:mga0n895_249903_c1 3300050512 Bacteria 1800
1208 nmdc:mga0n895_279193_c1 3300050512 Bacteria 1694
1209 nmdc:mga0n895_408605_c1 3300050512 Bacteria 1373
1210 nmdc:mga0n895_681822_c1 3300050512 Bacteria 1025
1211 nmdc:mga0n895_698_c1 3300050512 Bacteria 23566
1212 nmdc:mga0n895_75578_c1 3300050512 Bacteria 3349
1213 nmdc:mga0rr50_114174_c1 3300050513 Unclassified 2141
1214 nmdc:mga0rr50_1729192_c1 3300050513 Bacteria 527
1215 nmdc:mga0rr50_284102_c1 3300050513 Bacteria 1381
1216 nmdc:mga0rr50_33419_c1 3300050513 Bacteria 3674
1217 nmdc:mga0rr50_358227_c1 3300050513 Bacteria 1228
1218 nmdc:mga0rr50_36277_c1 3300050513 Bacteria 3549
1219 nmdc:mga0rr50_79549_c1 3300050513 Bacteria 2525
1220 nmdc:mga08x19_213046_c1 3300050514 Bacteria 1326
1221 nmdc:mga08x19_314390_c1 3300050514 Bacteria 1089
1222 nmdc:mga08x19_490486_c1 3300050514 Bacteria 867
1223 nmdc:mga08x19_80556_c1 3300050514 Bacteria 2137
1224 nmdc:mga0a205_169383_c1 3300050515 Bacteria 2080
1225 nmdc:mga0a205_2369_c1 3300050515 Bacteria 16612
1226 nmdc:mga0a205_29957_c1 3300050515 Bacteria 5209
1227 nmdc:mga0a205_648216_c1 3300050515 Unclassified 907
1228 nmdc:mga0a205_71484_c1 3300050515 Bacteria 3351
1229 nmdc:mga0a205_743046_c1 3300050515 Bacteria 830
1230 nmdc:mga0a205_790074_c1 3300050515 Bacteria 797
1231 nmdc:mga0a205_815_c1 3300050515 Bacteria 25363
1232 Ga0495612_0254039 3300053078 Bacteria 782
1233 Ga0500635_0037425 3300053080 Bacteria 1604
1234 Ga0500578_0072394 3300053086 Bacteria 2196
1235 Ga0500566_0115191 3300053094 Bacteria 1456
1236 Ga0500641_0084528 3300053096 Bacteria 1350
1237 Ga0500650_0124446 3300053098 Bacteria 1201
1238 Ga0500650_0165712 3300053098 Bacteria 1018
1239 Ga0500650_0255872 3300053098 Bacteria 784
1240 Ga0500557_040053 3300053105 Bacteria 1465
1241 Ga0500569_169916 3300053109 Bacteria 739
1242 Ga0500642_0350884 3300053130 Bacteria 655
1243 Ga0500568_0365384 3300053139 Bacteria 523
1244 Ga0500616_0017449 3300053153 Bacteria 4072
1245 Ga0500616_0064388 3300053153 Bacteria 1888
1246 Ga0500627_0143107 3300053158 Bacteria 1080
1247 Ga0500638_383427 3300053162 Bacteria 510
1248 Ga0500639_129512 3300053163 Bacteria 1198
1249 Ga0500637_0089329 3300053178 Bacteria 1783
1250 Ga0500611_098575 3300053727 Bacteria 754
1251 Ga0500552_077807 3300053733 Bacteria 605
1252 Ga0466962_0034545 3300061719 Bacteria 2420
1253 Ga0466962_0080598 3300061719 Bacteria 1556
1254 Ga0466962_0434701 3300061719 Bacteria 660
1255 2600227751 2599185359 Bacteria 4772316
1256 2819714182 2818991466 Bacteria 4748179
1257 2874174271 2874168670 Bacteria 8062617
1258 2874176495 2874168670 Bacteria 8062617
1259 2885341155 2885334103 Bacteria 7216818
1260 2928530397 2928526807 Bacteria 4760224
1261 2928968191 2928968154 Bacteria 4633371
1262 2958065403 2958064165 Bacteria 7158582
1263 Ga0207707_10669007
1264 JGI24741J21665_1069843
1265 JGI24746J21847_1029196
1266 JGI24740J21852_10002962
1267 JGI24739J22299_10187226
1268 JGI24737J22298_10014671
1269 JGI24737J22298_10053671
1270 JGI24735J21928_10002439
1271 JGI24735J21928_10017650
1272 JGI24735J21928_10080438
1273 JGI24748J21848_1014998
1274 JGI24738J21930_10152532
1275 JGI24033J26618_1008325
1276 JGI24751J29686_10097789
1277 JGI25406J46586_10067351
1278 Ga0065712_10198026
1279 Ga0065712_10310064
1280 Ga0065712_10399054
1281 Ga0065715_10089302
1282 Ga0065715_10091297
1283 Ga0065715_10453444
1284 Ga0065715_11128668
1285 Ga0065707_10381286
1286 Ga0065707_11063010
1287 Ga0070658_10000558
1288 Ga0070658_10012036
1289 Ga0070658_10015559
1290 Ga0070658_10047251
1291 Ga0070658_10069108
1292 Ga0070658_10153780
1293 Ga0070658_10762150
1294 Ga0070658_10772058
1295 Ga0070658_11219967
1296 Ga0070676_10014185
1297 Ga0070676_10081323
1298 Ga0070676_10309992
1299 Ga0070676_10607072
1300 Ga0070683_100010769
1301 Ga0070683_100050131
1302 Ga0070683_100105926
1303 Ga0070683_100203041
1304 Ga0070683_101717485
1305 Ga0070670_100001315
1306 Ga0070670_100010704
1307 Ga0070670_100012634
1308 Ga0070670_100209704
1309 Ga0070670_100302341
1310 Ga0070670_100480716
1311 Ga0070670_100639812
1312 Ga0070677_10001059
1313 Ga0070677_10043733
1314 Ga0070677_10076676
1315 Ga0070677_10195863
1316 Ga0068869_100060502
1317 Ga0068869_101476142
1318 Ga0070666_10367165
1319 Ga0070680_100000734
1320 Ga0070680_100020070
1321 Ga0070680_100027677
1322 Ga0070680_100218220
1323 Ga0070680_100539339
1324 Ga0070680_101150642
1325 Ga0070680_101892715
1326 Ga0070682_100125422
1327 Ga0070682_100333597
1328 Ga0070682_100827027
1329 Ga0068868_100291029
1330 Ga0068868_102197305
1331 Ga0070660_100000627
1332 Ga0070660_100004878
1333 Ga0070660_100023266
1334 Ga0070660_100094459
1335 Ga0070660_100126230
1336 Ga0070660_100203452
1337 Ga0070660_100211528
1338 Ga0070660_100270422
1339 Ga0070660_100372131
1340 Ga0070660_100501649
1341 Ga0070660_101439433
1342 Ga0070660_101443618
1343 Ga0070689_100245486
1344 Ga0070691_10003748
1345 Ga0070687_100574405
1346 Ga0070687_100892952
1347 Ga0070687_101137757
1348 Ga0070661_100020482
1349 Ga0070661_100047666
1350 Ga0070661_100096532
1351 Ga0070661_100111077
1352 Ga0070661_100689520
1353 Ga0070661_101090538
1354 Ga0070692_10027099
1355 Ga0070692_10028408
1356 Ga0070692_10057903
1357 Ga0070692_10068351
1358 Ga0070668_100016145
1359 Ga0070668_100062324
1360 Ga0070668_100092225
1361 Ga0070668_100110468
1362 Ga0070668_100121789
1363 Ga0070668_100320956
1364 Ga0070668_101224908
1365 Ga0070669_100020274
1366 Ga0070669_100040882
1367 Ga0070669_100270791
1368 Ga0070669_100417558
1369 Ga0070669_100664419
1370 Ga0070675_100003732
1371 Ga0070675_100644262
1372 Ga0070675_101144388
1373 Ga0070671_100007905
1374 Ga0070671_100220016
1375 Ga0070671_100825171
1376 Ga0070671_101132012
1377 Ga0070674_100001916
1378 Ga0070674_100061697
1379 Ga0070673_100034079
1380 Ga0070673_100453510
1381 Ga0070673_100611300
1382 Ga0070673_100727312
1383 Ga0070673_101290464
1384 Ga0070688_100169535
1385 Ga0070688_100930824
1386 Ga0070659_100023326
1387 Ga0070659_100061664
1388 Ga0070659_100211680
1389 Ga0070659_100267025
1390 Ga0070659_100305740
1391 Ga0070659_100524439
1392 Ga0070659_100578188
1393 Ga0070659_100786954
1394 Ga0070659_100935937
1395 Ga0070659_101455772
1396 Ga0070659_101901896
1397 Ga0070667_100029764
1398 Ga0070667_100104027
1399 Ga0070709_10032804
1400 Ga0070714_100090315
1401 Ga0070714_100101230
1402 Ga0070714_100179828
1403 Ga0070714_100198613
1404 Ga0070714_101535574
1405 Ga0070713_100031712
1406 Ga0070713_100043185
1407 Ga0070713_100389907
1408 Ga0070713_100845357
1409 Ga0070710_10000608
1410 Ga0070710_10104768
1411 Ga0070710_10497810
1412 Ga0070701_10527956
1413 Ga0070711_100001017
1414 Ga0070711_100172401
1415 Ga0070711_100436488
1416 Ga0070705_100456606
1417 Ga0070705_101469393
1418 Ga0070694_100006434
1419 Ga0070694_100098590
1420 Ga0070663_100023343
1421 Ga0070663_100037080
1422 Ga0070663_100105428
1423 Ga0070663_100272556
1424 Ga0070663_100296538
1425 Ga0070663_100299474
1426 Ga0070663_100396232
1427 Ga0070663_100855397
1428 Ga0070663_101081305
1429 Ga0070678_100067757
1430 Ga0070662_100003714
1431 Ga0070662_100055091
1432 Ga0070662_100101305
1433 Ga0070662_100146285
1434 Ga0070662_100171415
1435 Ga0070662_100403223
1436 Ga0070662_100682223
1437 Ga0070662_101993065
1438 Ga0070681_10022802
1439 Ga0070681_10100623
1440 Ga0070681_10144220
1441 Ga0070681_10255437
1442 Ga0068867_100972933
1443 Ga0070685_10875908
1444 Ga0070706_100047664
1445 Ga0070698_100051608
1446 Ga0070699_100743706
1447 Ga0070679_100028135
1448 Ga0070679_100193097
1449 Ga0070679_100304953
1450 Ga0070679_100670436
1451 Ga0070679_101019587
1452 Ga0070679_101707672
1453 Ga0070684_100002286
1454 Ga0070684_100056440
1455 Ga0070684_100076347
1456 Ga0070684_101502337
1457 Ga0070697_100183377
1458 Ga0068853_100007913
1459 Ga0068853_100147789
1460 Ga0068853_100638659
1461 Ga0068853_101269354
1462 Ga0068853_101529862
1463 Ga0068853_102356782
1464 Ga0070672_100048450
1465 Ga0070672_100051180
1466 Ga0070672_100638352
1467 Ga0070686_101174121
1468 Ga0070695_100120565
1469 Ga0070695_100246126
1470 Ga0070695_100676835
1471 Ga0070695_101842179
1472 Ga0070696_100048091
1473 Ga0070696_100154641
1474 Ga0070696_100175943
1475 Ga0070696_100373796
1476 Ga0070693_100045778
1477 Ga0070665_100316185
1478 Ga0070665_100444516
1479 Ga0070704_100182244
1480 Ga0070704_101099168
1481 Ga0068855_100001243
1482 Ga0068855_100006911
1483 Ga0068855_100009211
1484 Ga0068855_100011781
1485 Ga0068855_100049239
1486 Ga0068855_100136881
1487 Ga0068855_100764323
1488 Ga0068855_101808719
1489 Ga0070664_100023180
1490 Ga0070664_100024881
1491 Ga0070664_100083296
1492 Ga0070664_100125181
1493 Ga0070664_100225225
1494 Ga0070664_101577386
1495 Ga0070664_101708623
1496 Ga0068857_100037826
1497 Ga0068857_100058943
1498 Ga0068857_100075194
1499 Ga0068857_100131070
1500 Ga0068857_100486700
1501 Ga0068854_100001998
1502 Ga0068854_100040957
1503 Ga0068854_100331634
1504 Ga0068854_101203656
1505 Ga0068854_101471345
1506 Ga0068856_100005373
1507 Ga0068856_100055681
1508 Ga0068856_100069969
1509 Ga0068856_100096178
1510 Ga0068856_100122138
1511 Ga0068856_100263549
1512 Ga0068856_100687299
1513 Ga0070702_100899130
1514 Ga0068852_100002078
1515 Ga0068852_100013146
1516 Ga0068852_100042800
1517 Ga0068852_100100692
1518 Ga0068852_100191467
1519 Ga0068852_100289221
1520 Ga0068852_100377194
1521 Ga0068852_100845473
1522 Ga0068859_100073865
1523 Ga0068859_100210538
1524 Ga0068859_102854176
1525 Ga0068864_100105316
1526 Ga0068864_100121864
1527 Ga0068864_100192123
1528 Ga0068864_100227598
1529 Ga0068864_100289375
1530 Ga0068861_100130818
1531 Ga0068851_10260276
1532 Ga0068870_10306611
1533 Ga0068863_100083443
1534 Ga0068863_100111763
1535 Ga0068863_100183955
1536 Ga0068863_100458244
1537 Ga0068863_101287939
1538 Ga0068858_100051723
1539 Ga0068858_100356440
1540 Ga0068858_100784657
1541 Ga0068858_102205991
1542 Ga0068860_100020127
1543 Ga0068860_100078054
1544 Ga0068860_100388422
1545 Ga0068860_100476377
1546 Ga0068860_101152310
1547 Ga0068860_101709086
1548 Ga0068860_102296930
1549 Ga0068862_100005184
1550 Ga0068862_100117772
1551 Ga0068862_100122130
1552 Ga0068862_100153856
1553 Ga0068862_101009083
1554 Ga0081455_10117466
1555 Ga0081540_1021771
1556 Ga0081540_1066978
1557 Ga0081539_10004520
1558 Ga0081539_10048404
1559 Ga0070717_10004265
1560 Ga0070717_10022641
1561 Ga0070717_10058966
1562 Ga0070717_10287360
1563 Ga0070717_10346746
1564 Ga0075365_10165885
1565 Ga0075432_10013699
1566 Ga0075432_10066629
1567 Ga0075432_10175408
1568 Ga0070715_10227751
1569 Ga0075427_10011754
1570 Ga0075366_10058017
1571 Ga0075366_10903596
1572 Ga0097621_102423499
1573 Ga0097621_102444899
1574 Ga0075370_10240123
1575 Ga0075428_100165834
1576 Ga0075428_100195445
1577 Ga0075428_100829214
1578 Ga0075430_100031610
1579 Ga0075431_100070769
1580 Ga0075431_100122224
1581 Ga0075433_10003532
1582 Ga0075433_10020295
1583 Ga0075433_10045829
1584 Ga0075433_10156324
1585 Ga0075433_11604950
1586 Ga0075434_100006302
1587 Ga0075434_100025091
1588 Ga0075434_100112448
1589 Ga0075434_100147008
1590 Ga0075434_100151984
1591 Ga0075434_100267620
1592 Ga0075434_100306407
1593 Ga0075434_100415220
1594 Ga0075434_101061140
1595 Ga0075429_100003161
1596 Ga0075429_100153746
1597 Ga0068865_100237362
1598 Ga0068865_101145208
1599 Ga0075436_100040318
1600 Ga0075436_100153831
1601 Ga0075436_101005009
1602 Ga0097620_100073868
1603 Ga0097620_100210524
1604 Ga0097620_102854539
1605 Ga0075435_100034522
1606 Ga0075435_100051530
1607 Ga0075435_100254383
1608 Ga0075435_100356753
1609 Ga0075435_101435429
1610 Ga0099794_10546797
1611 Ga0099795_10131882
1612 Ga0099795_10428558
1613 Ga0105240_10019683
1614 Ga0105240_10082483
1615 Ga0105240_10647229
1616 Ga0105240_11169033
1617 Ga0111539_10011004
1618 Ga0111539_10012498
1619 Ga0111539_10044219
1620 Ga0111539_10061417
1621 Ga0111539_10118838
1622 Ga0111539_10154429
1623 Ga0111539_10332609
1624 Ga0111539_10629809
1625 Ga0111539_10783142
1626 Ga0111539_11047246
1627 Ga0105245_10144738
1628 Ga0105247_10101454
1629 Ga0114129_10243225
1630 Ga0114129_10276672
1631 Ga0114129_10743324
1632 Ga0114129_11086138
1633 Ga0114129_11175314
1634 Ga0114129_12454465
1635 Ga0105243_10208913
1636 Ga0105243_10232907
1637 Ga0105241_10772547
1638 Ga0105242_10286636
1639 Ga0105242_10691114
1640 Ga0105248_10132608
1641 Ga0105248_11220969
1642 Ga0105237_10013830
1643 Ga0105237_10026608
1644 Ga0105237_10830728
1645 Ga0105238_10007506
1646 Ga0105238_11207640
1647 Ga0105238_11293150
1648 Ga0105238_11958843
1649 Ga0105249_10002721
1650 Ga0105249_10161794
1651 Ga0105249_10308690
1652 Ga0105249_10393437
1653 Ga0105249_10868349
1654 Ga0105249_11631935
1655 Ga0105249_12722307
1656 Ga0099796_10142609
1657 Ga0099796_10214091
1658 Ga0105239_10054013
1659 Ga0105239_10097416
1660 Ga0105239_10380155
1661 Ga0105239_10382533
1662 Ga0105239_10426669
1663 Ga0105239_10538792
1664 Ga0105239_10642588
1665 Ga0105246_10016096
1666 Ga0105246_10404535
1667 Ga0105246_11001353
1668 Ga0105246_11252293
1669 Ga0157373_10004427
1670 Ga0157373_10035644
1671 Ga0157373_10057018
1672 Ga0157373_10075595
1673 Ga0157373_10086683
1674 Ga0157373_10234872
1675 Ga0157373_10482219
1676 Ga0157373_11152781
1677 Ga0157371_10001929
1678 Ga0157371_10004654
1679 Ga0157371_10055281
1680 Ga0157371_10080028
1681 Ga0157371_10088293
1682 Ga0157371_10121744
1683 Ga0157371_10225181
1684 Ga0157371_10231218
1685 Ga0157371_10423320
1686 Ga0157371_10440167
1687 Ga0157371_11090669
1688 Ga0157370_10024178
1689 Ga0157370_10030190
1690 Ga0157370_10054156
1691 Ga0157370_10107736
1692 Ga0157370_10146151
1693 Ga0157370_10191384
1694 Ga0157370_10276000
1695 Ga0157370_10384981
1696 Ga0157369_10004032
1697 Ga0157369_10021495
1698 Ga0157369_10246463
1699 Ga0157369_10254207
1700 Ga0157369_10407366
1701 Ga0157369_10969770
1702 Ga0157369_11139206
1703 Ga0157369_11935147
1704 Ga0157374_10002969
1705 Ga0157374_10074019
1706 Ga0157374_10083588
1707 Ga0157374_10383206
1708 Ga0157374_11069977
1709 Ga0157378_10135235
1710 Ga0157378_11174394
1711 Ga0163162_10102756
1712 Ga0163162_10235513
1713 Ga0163162_10254592
1714 Ga0163162_10579793
1715 Ga0163162_10870114
1716 Ga0157372_10059949
1717 Ga0157372_10089815
1718 Ga0157372_10111866
1719 Ga0157372_10369843
1720 Ga0157372_13481305
1721 Ga0157375_10092375
1722 Ga0157375_10505827
1723 Ga0157375_10615441
1724 Ga0157375_11015124
1725 Ga0163163_10006717
1726 Ga0163163_10137837
1727 Ga0157380_10005329
1728 Ga0157380_10049733
1729 Ga0157380_10392698
1730 Ga0157380_10625018
1731 Ga0157380_11592711
1732 Ga0157380_11962228
1733 Ga0157380_12076567
1734 Ga0157380_12703971
1735 Ga0182008_10184502
1736 Ga0157377_10776954
1737 Ga0157379_10285666
1738 Ga0157379_10443496
1739 Ga0157379_10507179
1740 Ga0157379_11946612
1741 Ga0157376_10040795
1742 Ga0163161_10098424
1743 Ga0163161_11380829
1744 Ga0206356_10696604
1745 Ga0206352_10456701
1746 Ga0206353_11902530
1747 Ga0213873_10089950
1748 Ga0213874_10023696
1749 Ga0213875_10000009
1750 Ga0213875_10174775
1751 Ga0213875_10373080
1752 Ga0207666_1071876
1753 Ga0207697_10000125
1754 Ga0207697_10184298
1755 Ga0207656_10073676
1756 Ga0207656_10424216
1757 Ga0207682_10002090
1758 Ga0207682_10051220
1759 Ga0207692_10038604
1760 Ga0207692_10588013
1761 Ga0207692_10833259
1762 Ga0207688_10096319
1763 Ga0207688_10131332
1764 Ga0207688_10241563
1765 Ga0207680_10111358
1766 Ga0207680_10399749
1767 Ga0207647_10000181
1768 Ga0207647_10006349
1769 Ga0207647_10031071
1770 Ga0207647_10038556
1771 Ga0207647_10045461
1772 Ga0207647_10048684
1773 Ga0207647_10480976
1774 Ga0207647_10801922
1775 Ga0207685_10126131
1776 Ga0207699_10096316
1777 Ga0207699_10157033
1778 Ga0207645_10011200
1779 Ga0207645_10137266
1780 Ga0207645_10406718
1781 Ga0207643_10273052
1782 Ga0207705_10000091
1783 Ga0207705_10000320
1784 Ga0207705_10005098
1785 Ga0207705_10009747
1786 Ga0207705_10016608
1787 Ga0207705_10028205
1788 Ga0207705_10067494
1789 Ga0207705_10118362
1790 Ga0207705_10141130
1791 Ga0207705_10159280
1792 Ga0207705_10286694
1793 Ga0207705_10472195
1794 Ga0207705_10624085
1795 Ga0207705_10690970
1796 Ga0207705_10723909
1797 Ga0207705_10755948
1798 Ga0207705_10866271
1799 Ga0207684_10059931
1800 Ga0207707_10028496
1801 Ga0207707_10128255
1802 Ga0207695_10338495
1803 Ga0207695_11124753
1804 Ga0207671_10010300
1805 Ga0207693_10007423
1806 Ga0207693_10018850
1807 Ga0207693_10261043
1808 Ga0207663_10000782
1809 Ga0207663_10360076
1810 Ga0207660_10000750
1811 Ga0207660_10029473
1812 Ga0207660_10054020
1813 Ga0207660_10102044
1814 Ga0207660_11162784
1815 Ga0207662_11026704
1816 Ga0207657_10001561
1817 Ga0207657_10004813
1818 Ga0207657_10006293
1819 Ga0207657_10008694
1820 Ga0207657_10039763
1821 Ga0207657_10040259
1822 Ga0207657_10188367
1823 Ga0207657_10220817
1824 Ga0207657_10265181
1825 Ga0207657_10483355
1826 Ga0207657_10483781
1827 Ga0207657_10691052
1828 Ga0207657_10692431
1829 Ga0207657_10861473
1830 Ga0207649_10009066
1831 Ga0207649_10028725
1832 Ga0207649_10139033
1833 Ga0207649_10218380
1834 Ga0207649_10702248
1835 Ga0207652_10003128
1836 Ga0207652_10423996
1837 Ga0207652_10515769
1838 Ga0207652_10941608
1839 Ga0207652_11438403
1840 Ga0207681_10032887
1841 Ga0207681_10047544
1842 Ga0207681_10058030
1843 Ga0207681_10471312
1844 Ga0207681_10737726
1845 Ga0207681_10762342
1846 Ga0207681_10791069
1847 Ga0207681_11424902
1848 Ga0207694_10101829
1849 Ga0207694_10542495
1850 Ga0207650_10002017
1851 Ga0207650_10143421
1852 Ga0207650_10175921
1853 Ga0207650_10305809
1854 Ga0207659_10014865
1855 Ga0207659_10446830
1856 Ga0207687_11314492
1857 Ga0207700_10158102
1858 Ga0207700_10723982
1859 Ga0207700_10983984
1860 Ga0207664_10031282
1861 Ga0207664_10184086
1862 Ga0207664_10197028
1863 Ga0207664_10757629
1864 Ga0207664_11655141
1865 Ga0207644_10083498
1866 Ga0207644_10108181
1867 Ga0207644_10121683
1868 Ga0207644_10316018
1869 Ga0207644_11091650
1870 Ga0207690_10004031
1871 Ga0207690_10034443
1872 Ga0207690_10116983
1873 Ga0207690_10406195
1874 Ga0207690_10426458
1875 Ga0207690_10908695
1876 Ga0207690_10938639
1877 Ga0207706_10001553
1878 Ga0207706_10002832
1879 Ga0207706_10010496
1880 Ga0207706_10038332
1881 Ga0207706_10102047
1882 Ga0207706_10102922
1883 Ga0207706_10157793
1884 Ga0207706_10177901
1885 Ga0207706_10225863
1886 Ga0207706_10256741
1887 Ga0207706_10274794
1888 Ga0207706_10599906
1889 Ga0207706_11032530
1890 Ga0207686_10398044
1891 Ga0207686_10959413
1892 Ga0207709_11834725
1893 Ga0207669_10033847
1894 Ga0207669_10071365
1895 Ga0207669_10788603
1896 Ga0207665_10000154
1897 Ga0207665_10205027
1898 Ga0207691_10027956
1899 Ga0207691_10050036
1900 Ga0207691_10090419
1901 Ga0207691_10625390
1902 Ga0207711_10100127
1903 Ga0207711_11105239
1904 Ga0207689_10284544
1905 Ga0207689_10401397
1906 Ga0207661_10036040
1907 Ga0207661_10068782
1908 Ga0207661_10096586
1909 Ga0207661_10096945
1910 Ga0207661_10216782
1911 Ga0207661_10910590
1912 Ga0207661_10938749
1913 Ga0207679_10178867
1914 Ga0207679_10407984
1915 Ga0207679_10747842
1916 Ga0207679_10777876
1917 Ga0207679_11868464
1918 Ga0207667_10000122
1919 Ga0207667_10008746
1920 Ga0207667_10008838
1921 Ga0207667_10019585
1922 Ga0207667_10044469
1923 Ga0207667_10134626
1924 Ga0207667_10140653
1925 Ga0207667_10195057
1926 Ga0207667_10239674
1927 Ga0207667_10287430
1928 Ga0207667_10375420
1929 Ga0207667_10825300
1930 Ga0207651_10328996
1931 Ga0207651_10417204
1932 Ga0207651_10521202
1933 Ga0207712_10004801
1934 Ga0207712_10166014
1935 Ga0207712_10336138
1936 Ga0207712_10962578
1937 Ga0207668_10001859
1938 Ga0207668_10014137
1939 Ga0207668_10112182
1940 Ga0207668_10128486
1941 Ga0207668_10455084
1942 Ga0207668_10479566
1943 Ga0207668_10494296
1944 Ga0207668_10511569
1945 Ga0207668_11458034
1946 Ga0207640_10099971
1947 Ga0207640_10111576
1948 Ga0207640_10148940
1949 Ga0207640_10298391
1950 Ga0207640_10510794
1951 Ga0207640_11050188
1952 Ga0207640_11376682
1953 Ga0207640_11438514
1954 Ga0207640_11864167
1955 Ga0207640_11881117
1956 Ga0207658_10003983
1957 Ga0207658_10021490
1958 Ga0207658_10492867
1959 Ga0207658_11291232
1960 Ga0207677_10303832
1961 Ga0207703_10240607
1962 Ga0207703_10921108
1963 Ga0207703_12076575
1964 Ga0207639_10043710
1965 Ga0207639_10061305
1966 Ga0207639_10148343
1967 Ga0207639_10191598
1968 Ga0207639_10293190
1969 Ga0207639_10677677
1970 Ga0207639_11054636
1971 Ga0207639_11430487
1972 Ga0207639_11493070
1973 Ga0207639_11788976
1974 Ga0207678_10005696
1975 Ga0207678_10037676
1976 Ga0207678_10046770
1977 Ga0207678_10083224
1978 Ga0207678_10178394
1979 Ga0207678_10184911
1980 Ga0207678_10191073
1981 Ga0207678_10444523
1982 Ga0207678_10654649
1983 Ga0207708_10259984
1984 Ga0207708_10842337
1985 Ga0207702_10006356
1986 Ga0207702_10025873
1987 Ga0207702_10051593
1988 Ga0207702_10200930
1989 Ga0207702_10572367
1990 Ga0207702_11673667
1991 Ga0207641_10009035
1992 Ga0207641_10033172
1993 Ga0207641_10122965
1994 Ga0207641_10207729
1995 Ga0207641_10360908
1996 Ga0207641_11729980
1997 Ga0207648_10221821
1998 Ga0207648_10752759
1999 Ga0207676_10188754
2000 Ga0207676_10197416
2001 Ga0207676_10255108
2002 Ga0207676_10304071
2003 Ga0207674_10000580
2004 Ga0207674_10007588
2005 Ga0207674_10070108
2006 Ga0207674_10601873
2007 Ga0207674_10691752
2008 Ga0207674_10847008
2009 Ga0207675_100076644
2010 Ga0207675_100241610
2011 Ga0207683_10003970
2012 Ga0207698_10000703
2013 Ga0207698_10001709
2014 Ga0207698_10006559
2015 Ga0207698_10049490
2016 Ga0207698_10172623
2017 Ga0207698_10193882
2018 Ga0207698_10194785
2019 Ga0207698_10342228
2020 Ga0207698_10798836
2021 Ga0207698_11668360
2022 Ga0209179_1051170
2023 Ga0209179_1058218
2024 Ga0209974_10018635
2025 Ga0207428_10000733
2026 Ga0207428_10029808
2027 Ga0207428_10699962
2028 Ga0268266_10179697
2029 Ga0268266_10474152
2030 Ga0268265_10017459
2031 Ga0268265_10018144
2032 Ga0268265_10020400
2033 Ga0268265_10124832
2034 Ga0268265_12550571
2035 Ga0268264_10001404
2036 Ga0268264_10047676
2037 Ga0268264_10290259
2038 Ga0268264_10331720
2039 Ga0268264_10840986
2040 Ga0268264_11845012
2041 Ga0316182_1071532
2042 Ga0265760_10219614
2043 Ga0265316_10518582
2044 Ga0307513_10855485
2045 Ga0307509_10185870
2046 Ga0307408_100016465
2047 Ga0307408_100053009
2048 Ga0307408_100078978
2049 Ga0307408_100293823
2050 Ga0307508_10150881
2051 Ga0307516_10119076
2052 Ga0307516_10245777
2053 Ga0307405_10613725
2054 Ga0307405_11467071
2055 Ga0307405_11520794
2056 Ga0307413_10000415
2057 Ga0307413_10095072
2058 Ga0307413_10107064
2059 Ga0307410_10002306
2060 Ga0307410_10015265
2061 Ga0307410_10034767
2062 Ga0307410_10047685
2063 Ga0307410_10320300
2064 Ga0307410_10683025
2065 Ga0307406_10042135
2066 Ga0307406_10068209
2067 Ga0307406_10169214
2068 Ga0307406_10220942
2069 Ga0307407_10005401
2070 Ga0307407_10018047
2071 Ga0307407_11357858
2072 Ga0307412_10040335
2073 Ga0307412_10135475
2074 Ga0307412_10254274
2075 Ga0307412_10393523
2076 Ga0307412_11843396
2077 Ga0307409_100000526
2078 Ga0307409_100020471
2079 Ga0307409_100067399
2080 Ga0307409_100072677
2081 Ga0307409_100146529
2082 Ga0307409_100235619
2083 Ga0307409_100309197
2084 Ga0307409_100406258
2085 Ga0307409_100426825
2086 Ga0307409_101522305
2087 Ga0307416_100163632
2088 Ga0307416_100204479
2089 Ga0307416_100344312
2090 Ga0307416_100710375
2091 Ga0307416_100780735
2092 Ga0307416_101023547
2093 Ga0307414_10003784
2094 Ga0307414_10046912
2095 Ga0307414_10064164
2096 Ga0307414_10068211
2097 Ga0307414_10789717
2098 Ga0307414_11857929
2099 Ga0307411_10000377
2100 Ga0307411_10016437
2101 Ga0307411_10022261
2102 Ga0307411_10063879
2103 Ga0307411_10118341
2104 Ga0307411_10216356
2105 Ga0307411_10267513
2106 Ga0307411_10671309
2107 Ga0307411_10729043
2108 Ga0307411_11592009
2109 Ga0307415_100001808
2110 Ga0307415_100026565
2111 Ga0307415_100034020
2112 Ga0307415_100284518
2113 Ga0307415_100302958
2114 Ga0307415_100458335
2115 Ga0307415_102459223
2116 Ga0307507_10012192
2117 Ga0316215_1003807
2118 Ga0373928_0052663
2119 Ga0373929_0123294
2120 Ga0373929_0150763
2121 Ga0373940_0017710
2122 Ga0373940_0032844
2123 Ga0373940_0200781
2124 Ga0373951_0154044
2125 Ga0373932_0120024
2126 Ga0373939_0002714
2127 Ga0373939_0010507
2128 Ga0373939_0035806
2129 Ga0373941_0009356
2130 Ga0373941_0107344
2131 Ga0373960_0003056
2132 Ga0373960_0143900
2133 Ga0373943_0194932
2134 Ga0373962_0016166
2135 Ga0373962_0023487
2136 Ga0373931_0001206
2137 Ga0373931_0022019
2138 Ga0373931_0028804
2139 Ga0373931_0040604
2140 Ga0373931_0237473
2141 Ga0373927_0094432
2142 Ga0373947_1237865
2143 Ga0395899_0015104
2144 Ga0395899_0027700
2145 Ga0395899_0056027
2146 Ga0395899_0060927
2147 Ga0395899_0063705
2148 Ga0395899_0074088
2149 Ga0395899_0114364
2150 Ga0395899_0154212
2151 Ga0395899_0247624
2152 Ga0395899_0304537
2153 Ga0395899_0331489
2154 Ga0395899_0548283
2155 Ga0395899_0621654
2156 Ga0395900_0003720
2157 Ga0395900_0003925
2158 Ga0395900_0004596
2159 Ga0395900_0005577
2160 Ga0395900_0008623
2161 Ga0395900_0010077
2162 Ga0395900_0018188
2163 Ga0395900_0032952
2164 Ga0395900_0044151
2165 Ga0395900_0089614
2166 Ga0395900_0097744
2167 Ga0395900_0113604
2168 Ga0395900_0140791
2169 Ga0395900_0146660
2170 Ga0395900_0186093
2171 Ga0395900_0205520
2172 Ga0395900_0214165
2173 Ga0395900_0234199
2174 Ga0395900_0268586
2175 Ga0395900_0283176
2176 Ga0395900_0351509
2177 Ga0395900_0366792
2178 Ga0395900_0642623
2179 Ga0395900_0732575
2180 Ga0395900_0816719
2181 Ga0395900_0838319
2182 Ga0395900_1332296
2183 Ga0395900_1384634
2184 Ga0395900_1670533
2185 Ga0395900_1683525
2186 Ga0395900_1699798
2187 Ga0395900_1903095
2188 Ga0395898_0028989
2189 Ga0395898_0053183
2190 Ga0395898_0062916
2191 Ga0395898_0125326
2192 Ga0395898_0129662
2193 Ga0395898_0158058
2194 Ga0395898_0172131
2195 Ga0395898_0172572
2196 Ga0395898_0240106
2197 Ga0395898_0302232
2198 Ga0395898_0412782
2199 Ga0395898_0487619
2200 Ga0395898_0843967
2201 Ga0395898_1236583
2202 Ga0395898_1330846
2203 Ga0395905_0001141
2204 Ga0395905_0001314
2205 Ga0395905_0003401
2206 Ga0395905_0004560
2207 Ga0395905_0012554
2208 Ga0395905_0036588
2209 Ga0395905_0077269
2210 Ga0395905_0100833
2211 Ga0395905_0106004
2212 Ga0395905_0132419
2213 Ga0395905_0134423
2214 Ga0395905_0144700
2215 Ga0395905_0228724
2216 Ga0395905_0282207
2217 Ga0395905_0286829
2218 Ga0395905_0364304
2219 Ga0395905_0370842
2220 Ga0395905_0371983
2221 Ga0395905_0408986
2222 Ga0395905_0434014
2223 Ga0395905_0436288
2224 Ga0395905_0520075
2225 Ga0395905_0528248
2226 Ga0395905_0599370
2227 Ga0395905_0614608
2228 Ga0395905_0748392
2229 Ga0395905_0855598
2230 Ga0395905_1158790
2231 Ga0395905_1219770
2232 Ga0395905_1252535
2233 Ga0395905_1428122
2234 Ga0395905_1503692
2235 Ga0395905_1751984
2236 Ga0436364_0063485
2237 Ga0436364_0108740
2238 Ga0436364_0574406
2239 Ga0395901_0000041
2240 Ga0395901_0005013
2241 Ga0395901_0006286
2242 Ga0395901_0029966
2243 Ga0395901_0090289
2244 Ga0395901_0114687
2245 Ga0395901_0127876
2246 Ga0395901_0186749
2247 Ga0395901_0197428
2248 Ga0395901_0208565
2249 Ga0395901_0257846
2250 Ga0395901_0348040
2251 Ga0395901_0349266
2252 Ga0395901_0356275
2253 Ga0395901_0356763
2254 Ga0395901_0369655
2255 Ga0395901_0422069
2256 Ga0395901_0514494
2257 Ga0395901_0616747
2258 Ga0395901_0801847
2259 Ga0395901_1302710
2260 Ga0395901_1365260
2261 Ga0395901_1802535
2262 Ga0436365_0254242
2263 Ga0436365_1422861
2264 Ga0436365_1512976
2265 Ga0436360_0915969
2266 Ga0436363_0180868
2267 Ga0436363_0185641
2268 Ga0436363_0327156
2269 Ga0436363_0428368
2270 Ga0436363_0928585
2271 Ga0436363_1097112
2272 Ga0436363_1539960
2273 Ga0436362_0891275
2274 Ga0439455_0032217
2275 Ga0450905_006273
2276 Ga0450889_001512
2277 Ga0439458_0000155
2278 Ga0439458_0090233
2279 Ga0439459_0144096
2280 Ga0439464_0022532
2281 Ga0466969_0042549
2282 Ga0466972_0065099
2283 Ga0466972_0076945
2284 Ga0466966_0006002
2285 Ga0466966_0020522
2286 Ga0466966_0136095
2287 Ga0466966_0336062
2288 Ga0466966_0502582
2289 Ga0466961_0007983
2290 Ga0466961_0054687
2291 Ga0466961_0632859
2292 Ga0466963_0021278
2293 Ga0466963_0027890
2294 Ga0466963_0033786
2295 Ga0466963_0037418
2296 Ga0466963_0048735
2297 Ga0466963_0080798
2298 Ga0466963_0150162
2299 Ga0466963_0195249
2300 Ga0466971_0004107
2301 Ga0466971_0112692
2302 Ga0466971_0126437
2303 Ga0466971_0346806
2304 Ga0466971_0608835
2305 Ga0466970_0375300
2306 Ga0466970_0389522
2307 Ga0466970_0392728
2308 Ga0466957_0026422
2309 Ga0466957_0119751
2310 Ga0466957_0428581
2311 Ga0466960_0128366
2312 Ga0466960_0233182
2313 Ga0466960_0252731
2314 Ga0466959_0013254
2315 Ga0466959_0117707
2316 Ga0466959_0175786
2317 Ga0466959_0385308
2318 Ga0466959_0584879
2319 Ga0466958_0010000
2320 Ga0466958_0060299
2321 Ga0466958_0115718
2322 Ga0466958_0790250
2323 Ga0466958_0802529
2324 Ga0466967_0041444
2325 Ga0466967_0103734
2326 Ga0466967_0109437
2327 Ga0466967_0380452
2328 Ga0466967_0394871
2329 Ga0466967_0415616
2330 Ga0466967_0423119
2331 Ga0466967_0437618
2332 Ga0466967_0942462
2333 Ga0466967_0984340
2334 Ga0495629_0224914
2335 Ga0495605_0018292
2336 Ga0495605_0359824
2337 Ga0495662_0271504
2338 Ga0495584_0365416
2339 Ga0495585_0066640
2340 Ga0495585_0175132
2341 Ga0495596_0080449
2342 Ga0495616_0005667
2343 Ga0495620_0028022
2344 Ga0495631_0002293
2345 Ga0495632_0034373
2346 Ga0495637_0061801
2347 Ga0495643_0383823
2348 Ga0495648_0140629
2349 Ga0495663_0004391
2350 Ga0495663_0015836
2351 Ga0495663_0365477
2352 Ga0495666_0212233
2353 Ga0495654_0176291
2354 Ga0495640_0386267
2355 Ga0495598_0000508
2356 Ga0495598_0007000
2357 Ga0495598_0174331
2358 Ga0495609_0055262
2359 Ga0495621_0002483
2360 Ga0495621_0008887
2361 Ga0495621_0040727
2362 Ga0495621_0055843
2363 Ga0495621_0168461
2364 Ga0495622_0039902
2365 Ga0495633_0003339
2366 Ga0495633_0064540
2367 Ga0495656_0092543
2368 Ga0495656_0376634
2369 Ga0495668_0017416
2370 Ga0495668_0087666
2371 Ga0495611_0268798
2372 Ga0495625_0034061
2373 Ga0495625_0151463
2374 Ga0495661_0176964
2375 Ga0495658_0594863
2376 Ga0495669_0011169
2377 Ga0495669_0013096
2378 Ga0495669_0023409
2379 Ga0495669_0036262
2380 Ga0495669_0085890
2381 Ga0495669_0329825
2382 Ga0495613_0163220
2383 Ga0495670_0014228
2384 Ga0495670_0015314
2385 Ga0495670_0089037
2386 Ga0495649_0232208
2387 Ga0495589_0441669
2388 Ga0495660_0022790
2389 Ga0495676_0154282
2390 Ga0495683_0468491
2391 Ga0495687_177461
2392 Ga0495677_0003155
2393 Ga0495677_0087903
2394 Ga0495677_0313334
2395 Ga0495686_0168267
2396 Ga0495615_0113286
2397 Ga0495615_0126663
2398 Ga0496100_0276504
2399 Ga0496101_0153577
2400 Ga0496102_1053331
2401 Ga0496103_0078961
2402 Ga0496104_0007369
2403 Ga0496104_0072990
2404 Ga0496105_0030434
2405 Ga0496105_0066282
2406 Ga0496105_1030734
2407 Ga0496106_0029558
2408 Ga0496106_0182894
2409 Ga0496107_0153153
2410 Ga0496107_0180613
2411 Ga0496108_0030914
2412 Ga0496108_0317948
2413 Ga0496108_0334834
2414 Ga0496108_0555576
2415 Ga0496108_0887806
2416 Ga0496109_0124050
2417 Ga0496109_0469516
2418 Ga0496109_1255459
2419 Ga0496109_1310655
2420 Ga0496110_0101246
2421 Ga0496110_0490829
2422 Ga0496110_0719030
2423 Ga0496110_1068418
2424 Ga0496111_0199876
2425 Ga0496111_0618538
2426 Ga0496112_0000419
2427 Ga0496112_0088398
2428 Ga0496112_0677912
2429 Ga0496112_0798710
2430 Ga0496113_0394372
2431 Ga0496113_0452024
2432 Ga0496114_0105195
2433 Ga0496115_0035582
2434 Ga0496123_0087404
2435 Ga0496124_0003283
2436 Ga0496124_0010909
2437 Ga0496125_0317089
2438 Ga0496126_0290281
2439 Ga0495678_094950
2440 Ga0495682_0047722
2441 Ga0501067_0510530
2442 Ga0501216_063337
2443 Ga0501079_0879202
2444 Ga0501080_1656762
2445 Ga0501083_0694550
2446 nmdc:mga0k408_236664_c1
2447 nmdc:mga07m45_380799_c1
2448 nmdc:mga05p37_39565_c1
2449 nmdc:mga05p37_8115_c1
2450 nmdc:mga09592_184192_c1
2451 nmdc:mga09592_829877_c1
2452 nmdc:mga0qj67_26100_c1
2453 nmdc:mga06r32_5267_c1
2454 nmdc:mga06r32_99092_c1
2455 nmdc:mga08y16_11593_c1
2456 nmdc:mga08y16_153507_c1
2457 nmdc:mga08y16_161331_c1
2458 nmdc:mga08y16_223115_c1
2459 nmdc:mga08y16_342895_c1
2460 nmdc:mga08y16_343039_c1
2461 nmdc:mga08y16_35966_c1
2462 nmdc:mga08y16_833066_c1
2463 nmdc:mga08y16_8471_c1
2464 nmdc:mga08y16_88074_c1
2465 nmdc:mga0n895_1250265_c1
2466 nmdc:mga0n895_132444_c1
2467 nmdc:mga0n895_1440171_c1
2468 nmdc:mga0n895_23049_c1
2469 nmdc:mga0n895_249903_c1
2470 nmdc:mga0n895_279193_c1
2471 nmdc:mga0n895_408605_c1
2472 nmdc:mga0n895_681822_c1
2473 nmdc:mga0n895_698_c1
2474 nmdc:mga0n895_75578_c1
2475 nmdc:mga0rr50_114174_c1
2476 nmdc:mga0rr50_1729192_c1
2477 nmdc:mga0rr50_284102_c1
2478 nmdc:mga0rr50_33419_c1
2479 nmdc:mga0rr50_358227_c1
2480 nmdc:mga0rr50_36277_c1
2481 nmdc:mga0rr50_79549_c1
2482 nmdc:mga08x19_213046_c1
2483 nmdc:mga08x19_314390_c1
2484 nmdc:mga08x19_490486_c1
2485 nmdc:mga08x19_80556_c1
2486 nmdc:mga0a205_169383_c1
2487 nmdc:mga0a205_2369_c1
2488 nmdc:mga0a205_29957_c1
2489 nmdc:mga0a205_648216_c1
2490 nmdc:mga0a205_71484_c1
2491 nmdc:mga0a205_743046_c1
2492 nmdc:mga0a205_790074_c1
2493 nmdc:mga0a205_815_c1
2494 Ga0495612_0254039
2495 Ga0500635_0037425
2496 Ga0500578_0072394
2497 Ga0500566_0115191
2498 Ga0500641_0084528
2499 Ga0500650_0124446
2500 Ga0500650_0165712
2501 Ga0500650_0255872
2502 Ga0500557_040053
2503 Ga0500569_169916
2504 Ga0500642_0350884
2505 Ga0500568_0365384
2506 Ga0500616_0017449
2507 Ga0500616_0064388
2508 Ga0500627_0143107
2509 Ga0500638_383427
2510 Ga0500639_129512
2511 Ga0500637_0089329
2512 Ga0500611_098575
2513 Ga0500552_077807
2514 Ga0466962_0034545
2515 Ga0466962_0080598
2516 Ga0466962_0434701
2517 2600227751
2518 2819714182
2519 2874174271
2520 2874176495
2521 2885341155
2522 2928530397
2523 2928968191
2524 2958065403

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03626

COX4_pro

Prokaryotic Cytochrome C oxidase subunit IV

46

119

0.95

Map