F492274

General Info

Members Datasets Scaffolds Average Seq Length
1258 338 2516 71

Family's Representative Sequence

Representative Sequence 3300025914|Ga0207671_10461921|Ga0207671_104619212
Length 86
Sequence LRQQGHARRPGGVLVMENRLRVLRAERNWSQGDLAERLEVSRQSVNAIETGKYDPSLPLAFRIAELFDLSIEQVFVSPSRDTSQTA

Samples

Sample ID Description Type Environment
1 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
89 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
120 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
123 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
192 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
193 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
194 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
195 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
196 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
197 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
198 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
199 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
200 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
201 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
202 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
203 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
204 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
205 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
206 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
207 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
208 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
209 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
210 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
211 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
212 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
213 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
214 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
215 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
216 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
217 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
218 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
219 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
220 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
221 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
222 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
223 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
224 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
225 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
226 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
227 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
228 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
229 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
230 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
231 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
232 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
233 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
234 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
235 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
236 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
237 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
238 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
239 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
240 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
241 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
242 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
243 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
244 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
245 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
246 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
247 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
248 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
249 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
250 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
251 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
252 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
253 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
254 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
255 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
256 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
257 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
258 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
259 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
260 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
261 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
262 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
263 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
264 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
265 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
266 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
267 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
268 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
269 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
270 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
271 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
272 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
273 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
274 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
275 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
276 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
277 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
278 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
279 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
280 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
281 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
282 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
283 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
284 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
285 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
286 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
287 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
288 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
289 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
290 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
291 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
292 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
293 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
294 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
295 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
297 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
298 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
299 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
300 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
301 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
302 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
303 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
304 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
305 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
306 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
307 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
308 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
309 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
310 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
311 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
312 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
313 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
314 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
315 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
316 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
317 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
318 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
319 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
320 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
321 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
322 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
323 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
324 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
325 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
326 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
327 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
328 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
329 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
330 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
331 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
332 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
333 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
334 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
335 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
336 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
337 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
338 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.89
Metatranscriptomes 1.11
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 0
Rhizoplane 3.18
Rhizosphere 95.79
Stem 0
Stem Tuber 0
Unclassified 1.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207671_10461921 3300025914 Bacteria 1011
2 JGI24752J21851_1041341 3300001976 Bacteria 618
3 JGI24740J21852_10031784 3300001979 Bacteria 1697
4 JGI24739J22299_10004910 3300001989 Bacteria 5093
5 JGI24739J22299_10011675 3300001989 Bacteria 3239
6 JGI24737J22298_10002269 3300001990 Bacteria 6848
7 JGI24737J22298_10006441 3300001990 Bacteria 4010
8 JGI24737J22298_10061630 3300001990 Bacteria 1128
9 JGI24743J22301_10004677 3300001991 Bacteria 2243
10 JGI24743J22301_10020903 3300001991 Bacteria 1248
11 JGI24743J22301_10023416 3300001991 Bacteria 1189
12 JGI24735J21928_10138376 3300002067 Bacteria 702
13 JGI24735J21928_10180733 3300002067 Bacteria 611
14 JGI24738J21930_10056125 3300002075 Bacteria 806
15 JGI24738J21930_10091567 3300002075 Bacteria 643
16 JGI24744J21845_10000087 3300002077 Bacteria 12007
17 JGI24034J26672_10044209 3300002239 Bacteria 754
18 rootH2_10079461 3300003320 Bacteria 2126
19 Ga0058862_12767607 3300004803 Bacteria 854
20 Ga0065712_10077034 3300005290 Bacteria 3561
21 Ga0065712_10823327 3300005290 Bacteria 505
22 Ga0065712_10825305 3300005290 Bacteria 505
23 Ga0065715_10117758 3300005293 Bacteria 2324
24 Ga0065715_10322600 3300005293 Bacteria 999
25 Ga0065715_10469900 3300005293 Bacteria 807
26 Ga0065715_11091879 3300005293 Bacteria 507
27 Ga0070658_10006725 3300005327 Bacteria 9314
28 Ga0070658_10016331 3300005327 Bacteria 5941
29 Ga0070658_10086977 3300005327 Bacteria 2571
30 Ga0070658_10094600 3300005327 Bacteria 2465
31 Ga0070658_10140523 3300005327 Bacteria 2017
32 Ga0070658_10188570 3300005327 Bacteria 1737
33 Ga0070658_10202829 3300005327 Bacteria 1674
34 Ga0070658_10239086 3300005327 Bacteria 1539
35 Ga0070658_10250185 3300005327 Bacteria 1503
36 Ga0070658_10554731 3300005327 Bacteria 994
37 Ga0070658_10622607 3300005327 Bacteria 936
38 Ga0070658_10776017 3300005327 Bacteria 832
39 Ga0070676_10296333 3300005328 Bacteria 1095
40 Ga0070676_10408267 3300005328 Bacteria 946
41 Ga0070676_10487684 3300005328 Bacteria 873
42 Ga0070676_10755808 3300005328 Bacteria 714
43 Ga0070683_100421659 3300005329 Bacteria 1273
44 Ga0070683_100523245 3300005329 Bacteria 1133
45 Ga0070683_100560931 3300005329 Bacteria 1092
46 Ga0070683_101602869 3300005329 Bacteria 626
47 Ga0070683_101760148 3300005329 Bacteria 596
48 Ga0070690_100031729 3300005330 Bacteria 3294
49 Ga0070690_101530271 3300005330 Bacteria 539
50 Ga0070670_100010583 3300005331 Bacteria 7876
51 Ga0070670_100013288 3300005331 Bacteria 7053
52 Ga0070670_100059044 3300005331 Bacteria 3293
53 Ga0070670_100098904 3300005331 Bacteria 2510
54 Ga0070670_100372673 3300005331 Bacteria 1257
55 Ga0070670_100651589 3300005331 Bacteria 945
56 Ga0070670_100780385 3300005331 Bacteria 862
57 Ga0070670_101288067 3300005331 Bacteria 669
58 Ga0070670_101316083 3300005331 Bacteria 662
59 Ga0070670_101360573 3300005331 Bacteria 650
60 Ga0068869_100017638 3300005334 Bacteria 4843
61 Ga0070666_10007976 3300005335 Bacteria 6547
62 Ga0070666_10021968 3300005335 Bacteria 4140
63 Ga0070666_10074454 3300005335 Bacteria 2314
64 Ga0070666_10122691 3300005335 Bacteria 1802
65 Ga0070680_100002487 3300005336 Bacteria 13653
66 Ga0070680_100005700 3300005336 Bacteria 9442
67 Ga0070680_100015150 3300005336 Bacteria 6038
68 Ga0070680_100207521 3300005336 Bacteria 1652
69 Ga0070680_100511525 3300005336 Bacteria 1028
70 Ga0070680_100542631 3300005336 Bacteria 996
71 Ga0070680_100881351 3300005336 Bacteria 772
72 Ga0070682_100387045 3300005337 Bacteria 1054
73 Ga0070682_100426866 3300005337 Bacteria 1009
74 Ga0068868_100095117 3300005338 Bacteria 2404
75 Ga0068868_100542981 3300005338 Bacteria 1023
76 Ga0068868_100584740 3300005338 Bacteria 987
77 Ga0068868_100789992 3300005338 Bacteria 856
78 Ga0068868_101203605 3300005338 Bacteria 701
79 Ga0070660_100008889 3300005339 Bacteria 7044
80 Ga0070660_100019740 3300005339 Bacteria 4943
81 Ga0070660_100052961 3300005339 Bacteria 3130
82 Ga0070660_100080389 3300005339 Bacteria 2558
83 Ga0070660_100111059 3300005339 Bacteria 2181
84 Ga0070660_100114493 3300005339 Bacteria 2148
85 Ga0070660_100168710 3300005339 Unclassified 1767
86 Ga0070660_100179712 3300005339 Bacteria 1712
87 Ga0070660_100197132 3300005339 Bacteria 1633
88 Ga0070660_100232272 3300005339 Bacteria 1501
89 Ga0070660_100236701 3300005339 Bacteria 1486
90 Ga0070660_100322372 3300005339 Bacteria 1269
91 Ga0070660_100632308 3300005339 Bacteria 896
92 Ga0070660_100635338 3300005339 Bacteria 894
93 Ga0070660_100898069 3300005339 Bacteria 747
94 Ga0070689_101238570 3300005340 Bacteria 671
95 Ga0070691_10772704 3300005341 Bacteria 583
96 Ga0070687_100631028 3300005343 Bacteria 740
97 Ga0070687_100952599 3300005343 Bacteria 619
98 Ga0070661_100043226 3300005344 Bacteria 3291
99 Ga0070661_100053318 3300005344 Bacteria 2959
100 Ga0070661_100154741 3300005344 Bacteria 1734
101 Ga0070661_100363049 3300005344 Bacteria 1138
102 Ga0070661_100823986 3300005344 Bacteria 762
103 Ga0070661_101195276 3300005344 Bacteria 636
104 Ga0070692_10061213 3300005345 Bacteria 1983
105 Ga0070692_10121549 3300005345 Bacteria 1457
106 Ga0070668_100025208 3300005347 Bacteria 4508
107 Ga0070668_100543885 3300005347 Bacteria 1010
108 Ga0070668_100781314 3300005347 Bacteria 847
109 Ga0070668_101790926 3300005347 Bacteria 565
110 Ga0070669_100075622 3300005353 Bacteria 2498
111 Ga0070669_100234386 3300005353 Bacteria 1456
112 Ga0070669_100449787 3300005353 Bacteria 1061
113 Ga0070669_101646752 3300005353 Bacteria 559
114 Ga0070675_100032255 3300005354 Bacteria 4238
115 Ga0070675_100037831 3300005354 Bacteria 3933
116 Ga0070675_100038284 3300005354 Bacteria 3907
117 Ga0070675_100387128 3300005354 Bacteria 1245
118 Ga0070675_100393008 3300005354 Bacteria 1236
119 Ga0070675_101245918 3300005354 Bacteria 685
120 Ga0070675_101318839 3300005354 Unclassified 665
121 Ga0070671_100001153 3300005355 Bacteria 19660
122 Ga0070671_100042899 3300005355 Bacteria 3761
123 Ga0070671_100179642 3300005355 Bacteria 1791
124 Ga0070671_100274703 3300005355 Bacteria 1432
125 Ga0070671_100951039 3300005355 Bacteria 752
126 Ga0070671_101014010 3300005355 Bacteria 728
127 Ga0070674_100093447 3300005356 Bacteria 2176
128 Ga0070674_100152339 3300005356 Bacteria 1746
129 Ga0070674_100642910 3300005356 Bacteria 901
130 Ga0070674_100959579 3300005356 Bacteria 748
131 Ga0070673_100066358 3300005364 Bacteria 2882
132 Ga0070673_100262580 3300005364 Bacteria 1509
133 Ga0070673_100287322 3300005364 Bacteria 1444
134 Ga0070673_100316579 3300005364 Bacteria 1377
135 Ga0070673_100391619 3300005364 Bacteria 1241
136 Ga0070673_100452240 3300005364 Bacteria 1155
137 Ga0070673_100458048 3300005364 Bacteria 1148
138 Ga0070673_100839998 3300005364 Bacteria 849
139 Ga0070659_100004455 3300005366 Bacteria 10005
140 Ga0070659_100004654 3300005366 Bacteria 9801
141 Ga0070659_100005251 3300005366 Bacteria 9293
142 Ga0070659_100014684 3300005366 Bacteria 5856
143 Ga0070659_100020613 3300005366 Bacteria 5011
144 Ga0070659_100021887 3300005366 Bacteria 4876
145 Ga0070659_100029848 3300005366 Bacteria 4216
146 Ga0070659_100034052 3300005366 Bacteria 3961
147 Ga0070659_100048977 3300005366 Bacteria 3321
148 Ga0070659_100064921 3300005366 Bacteria 2890
149 Ga0070659_100070020 3300005366 Bacteria 2786
150 Ga0070659_100070098 3300005366 Bacteria 2784
151 Ga0070659_100156877 3300005366 Bacteria 1859
152 Ga0070659_100164806 3300005366 Bacteria 1813
153 Ga0070659_100278415 3300005366 Bacteria 1391
154 Ga0070659_100419144 3300005366 Bacteria 1132
155 Ga0070659_100430464 3300005366 Bacteria 1117
156 Ga0070659_100696018 3300005366 Bacteria 878
157 Ga0070659_100750306 3300005366 Bacteria 846
158 Ga0070659_100980522 3300005366 Bacteria 741
159 Ga0070659_101513882 3300005366 Bacteria 598
160 Ga0070659_101574052 3300005366 Bacteria 586
161 Ga0070659_101631542 3300005366 Bacteria 576
162 Ga0070659_101826584 3300005366 Bacteria 544
163 Ga0070667_100007684 3300005367 Bacteria 8942
164 Ga0070667_100041106 3300005367 Bacteria 3879
165 Ga0070667_100350823 3300005367 Bacteria 1336
166 Ga0070667_100512222 3300005367 Bacteria 1100
167 Ga0070667_100548412 3300005367 Bacteria 1062
168 Ga0070667_101455760 3300005367 Bacteria 643
169 Ga0070709_10460787 3300005434 Bacteria 959
170 Ga0070714_100068611 3300005435 Bacteria 3060
171 Ga0070714_101091631 3300005435 Bacteria 777
172 Ga0070713_100079243 3300005436 Bacteria 2798
173 Ga0070701_10172915 3300005438 Bacteria 1259
174 Ga0070694_100038036 3300005444 Bacteria 3195
175 Ga0070663_100008628 3300005455 Bacteria 6282
176 Ga0070663_100073842 3300005455 Bacteria 2489
177 Ga0070663_100101372 3300005455 Bacteria 2148
178 Ga0070663_100135816 3300005455 Bacteria 1872
179 Ga0070663_100313197 3300005455 Bacteria 1260
180 Ga0070663_100337999 3300005455 Bacteria 1216
181 Ga0070663_100394814 3300005455 Bacteria 1129
182 Ga0070663_100667727 3300005455 Bacteria 881
183 Ga0070663_101167232 3300005455 Bacteria 675
184 Ga0070678_100112791 3300005456 Bacteria 2130
185 Ga0070678_100240079 3300005456 Bacteria 1515
186 Ga0070678_100968566 3300005456 Bacteria 781
187 Ga0070678_101193939 3300005456 Bacteria 705
188 Ga0070662_100006323 3300005457 Bacteria 7629
189 Ga0070662_100019424 3300005457 Bacteria 4613
190 Ga0070662_100056943 3300005457 Bacteria 2839
191 Ga0070662_100070374 3300005457 Bacteria 2578
192 Ga0070662_100091889 3300005457 Bacteria 2280
193 Ga0070662_100113338 3300005457 Bacteria 2069
194 Ga0070662_100115618 3300005457 Bacteria 2049
195 Ga0070662_100118385 3300005457 Bacteria 2027
196 Ga0070662_100148358 3300005457 Bacteria 1823
197 Ga0070662_100233401 3300005457 Bacteria 1473
198 Ga0070662_100578726 3300005457 Bacteria 943
199 Ga0070662_100761220 3300005457 Bacteria 822
200 Ga0070662_101300169 3300005457 Bacteria 626
201 Ga0070681_10010659 3300005458 Bacteria 9085
202 Ga0070681_10316716 3300005458 Bacteria 1469
203 Ga0070681_10919283 3300005458 Bacteria 794
204 Ga0070681_11421456 3300005458 Bacteria 617
205 Ga0068867_100012499 3300005459 Bacteria 6009
206 Ga0068867_100367189 3300005459 Bacteria 1205
207 Ga0068867_102014150 3300005459 Bacteria 546
208 Ga0070679_100008460 3300005530 Bacteria 9687
209 Ga0070679_100030956 3300005530 Bacteria 5285
210 Ga0070679_100263683 3300005530 Bacteria 1678
211 Ga0070679_100294356 3300005530 Bacteria 1574
212 Ga0070679_100417730 3300005530 Bacteria 1287
213 Ga0070679_101032138 3300005530 Bacteria 766
214 Ga0068853_100020764 3300005539 Bacteria 5463
215 Ga0068853_100035886 3300005539 Bacteria 4213
216 Ga0068853_100110530 3300005539 Bacteria 2441
217 Ga0068853_100206660 3300005539 Bacteria 1788
218 Ga0068853_100300250 3300005539 Bacteria 1484
219 Ga0068853_100387693 3300005539 Bacteria 1306
220 Ga0070672_100061095 3300005543 Bacteria 2969
221 Ga0070672_100128122 3300005543 Bacteria 2084
222 Ga0070672_100287947 3300005543 Bacteria 1390
223 Ga0070672_100311534 3300005543 Bacteria 1336
224 Ga0070672_100447343 3300005543 Bacteria 1112
225 Ga0070672_101044707 3300005543 Bacteria 725
226 Ga0070672_101138225 3300005543 Bacteria 694
227 Ga0070672_101262491 3300005543 Bacteria 659
228 Ga0070672_101269775 3300005543 Bacteria 657
229 Ga0070686_101458122 3300005544 Bacteria 576
230 Ga0070695_100181507 3300005545 Bacteria 1491
231 Ga0070695_100476950 3300005545 Bacteria 961
232 Ga0070696_100260569 3300005546 Bacteria 1314
233 Ga0070696_100350470 3300005546 Bacteria 1143
234 Ga0070693_100232002 3300005547 Bacteria 1215
235 Ga0070693_100541852 3300005547 Bacteria 832
236 Ga0070665_100018073 3300005548 Bacteria 7077
237 Ga0070665_100020398 3300005548 Bacteria 6657
238 Ga0070665_100213924 3300005548 Bacteria 1928
239 Ga0070665_100285026 3300005548 Bacteria 1654
240 Ga0070665_100337484 3300005548 Bacteria 1512
241 Ga0070665_102317838 3300005548 Bacteria 540
242 Ga0070704_100174703 3300005549 Bacteria 1712
243 Ga0070704_100753309 3300005549 Bacteria 867
244 Ga0068855_100053841 3300005563 Bacteria 4733
245 Ga0068855_100164277 3300005563 Bacteria 2518
246 Ga0068855_100186507 3300005563 Bacteria 2342
247 Ga0068855_100281782 3300005563 Bacteria 1845
248 Ga0068855_100284017 3300005563 Bacteria 1837
249 Ga0068855_100587348 3300005563 Bacteria 1202
250 Ga0068855_100826559 3300005563 Bacteria 983
251 Ga0070664_100019497 3300005564 Bacteria 5581
252 Ga0070664_100051422 3300005564 Bacteria 3489
253 Ga0070664_100414823 3300005564 Bacteria 1232
254 Ga0070664_100773561 3300005564 Bacteria 897
255 Ga0070664_101569364 3300005564 Bacteria 623
256 Ga0068857_100006686 3300005577 Bacteria 9911
257 Ga0068857_100123307 3300005577 Bacteria 2334
258 Ga0068857_101131626 3300005577 Bacteria 757
259 Ga0068854_100063884 3300005578 Bacteria 2673
260 Ga0068854_100199678 3300005578 Bacteria 1571
261 Ga0068854_100251725 3300005578 Bacteria 1411
262 Ga0068854_100390765 3300005578 Bacteria 1149
263 Ga0068854_100629572 3300005578 Bacteria 919
264 Ga0068854_100959723 3300005578 Bacteria 755
265 Ga0068854_102202230 3300005578 Bacteria 510
266 Ga0068856_100062897 3300005614 Bacteria 3666
267 Ga0068856_100081122 3300005614 Bacteria 3218
268 Ga0068856_100173068 3300005614 Bacteria 2171
269 Ga0068856_100420872 3300005614 Bacteria 1356
270 Ga0068856_100520659 3300005614 Bacteria 1210
271 Ga0068856_100576942 3300005614 Bacteria 1146
272 Ga0068852_100001683 3300005616 Bacteria 15057
273 Ga0068852_100003961 3300005616 Bacteria 10406
274 Ga0068852_100048353 3300005616 Bacteria 3633
275 Ga0068852_100112412 3300005616 Bacteria 2478
276 Ga0068852_100118212 3300005616 Bacteria 2422
277 Ga0068852_100157103 3300005616 Bacteria 2120
278 Ga0068852_100434607 3300005616 Bacteria 1297
279 Ga0068852_100450433 3300005616 Bacteria 1274
280 Ga0068852_100552651 3300005616 Bacteria 1152
281 Ga0068852_100759856 3300005616 Bacteria 982
282 Ga0068852_100861452 3300005616 Bacteria 922
283 Ga0068852_101150429 3300005616 Bacteria 797
284 Ga0068852_101325103 3300005616 Bacteria 742
285 Ga0068852_101507521 3300005616 Bacteria 695
286 Ga0068852_102369577 3300005616 Bacteria 552
287 Ga0068852_102424199 3300005616 Bacteria 545
288 Ga0068859_100103540 3300005617 Bacteria 2904
289 Ga0068859_100302971 3300005617 Bacteria 1691
290 Ga0068859_101224022 3300005617 Bacteria 827
291 Ga0068859_102356268 3300005617 Bacteria 587
292 Ga0068864_100003892 3300005618 Bacteria 12290
293 Ga0068864_100006964 3300005618 Bacteria 9272
294 Ga0068864_100104628 3300005618 Bacteria 2515
295 Ga0068864_100147512 3300005618 Bacteria 2128
296 Ga0068864_100253493 3300005618 Bacteria 1635
297 Ga0068864_100472777 3300005618 Bacteria 1202
298 Ga0068864_102631126 3300005618 Bacteria 509
299 Ga0068866_10032784 3300005718 Bacteria 2514
300 Ga0068866_10396745 3300005718 Bacteria 889
301 Ga0068866_10436822 3300005718 Bacteria 853
302 Ga0068861_100241524 3300005719 Bacteria 1536
303 Ga0068861_100602915 3300005719 Bacteria 1008
304 Ga0068861_102363751 3300005719 Bacteria 534
305 Ga0068851_10041206 3300005834 Bacteria 2321
306 Ga0068851_10252513 3300005834 Bacteria 1001
307 Ga0068870_10020264 3300005840 Bacteria 3235
308 Ga0068863_100017219 3300005841 Bacteria 6930
309 Ga0068863_100019578 3300005841 Bacteria 6473
310 Ga0068863_100068479 3300005841 Bacteria 3357
311 Ga0068863_101731580 3300005841 Bacteria 635
312 Ga0068863_102499302 3300005841 Bacteria 526
313 Ga0068858_100057665 3300005842 Bacteria 3589
314 Ga0068858_100123919 3300005842 Bacteria 2418
315 Ga0068858_100285624 3300005842 Bacteria 1572
316 Ga0068858_100425630 3300005842 Bacteria 1277
317 Ga0068858_100602248 3300005842 Bacteria 1066
318 Ga0068860_100004855 3300005843 Bacteria 13707
319 Ga0068860_100204706 3300005843 Bacteria 1913
320 Ga0068860_100809219 3300005843 Bacteria 950
321 Ga0068860_101420615 3300005843 Bacteria 715
322 Ga0068862_100085609 3300005844 Bacteria 2739
323 Ga0068862_100282557 3300005844 Bacteria 1521
324 Ga0068862_100308013 3300005844 Bacteria 1459
325 Ga0068862_101780324 3300005844 Bacteria 625
326 Ga0068862_101893393 3300005844 Bacteria 606
327 Ga0068862_102686477 3300005844 Bacteria 509
328 Ga0081539_10009840 3300005985 Bacteria 7895
329 Ga0070717_10008955 3300006028 Bacteria 7503
330 Ga0070717_10382590 3300006028 Bacteria 1262
331 Ga0070716_100267273 3300006173 Bacteria 1173
332 Ga0075366_10269456 3300006195 Bacteria 1040
333 Ga0075366_10447774 3300006195 Bacteria 797
334 Ga0097621_100099081 3300006237 Bacteria 2449
335 Ga0068871_100143112 3300006358 Bacteria 2034
336 Ga0068871_100281119 3300006358 Bacteria 1456
337 Ga0068871_100580778 3300006358 Bacteria 1017
338 Ga0068871_101604575 3300006358 Bacteria 616
339 Ga0075428_100703050 3300006844 Bacteria 1077
340 Ga0075428_101036055 3300006844 Bacteria 868
341 Ga0075431_101447251 3300006847 Bacteria 646
342 Ga0075433_10401208 3300006852 Bacteria 1210
343 Ga0075433_10662056 3300006852 Bacteria 915
344 Ga0075434_101005592 3300006871 Bacteria 848
345 Ga0068865_100039406 3300006881 Bacteria 3205
346 Ga0068865_100643074 3300006881 Bacteria 901
347 Ga0075436_100360608 3300006914 Bacteria 1049
348 Ga0097620_100103537 3300006931 Bacteria 2904
349 Ga0097620_100302994 3300006931 Bacteria 1691
350 Ga0097620_101224140 3300006931 Bacteria 827
351 Ga0097620_102355511 3300006931 Bacteria 587
352 Ga0075435_100215952 3300007076 Bacteria 1628
353 Ga0105244_10152633 3300009036 Bacteria 1106
354 Ga0105250_10293854 3300009092 Bacteria 701
355 Ga0105240_10090604 3300009093 Bacteria 3737
356 Ga0105240_10104097 3300009093 Bacteria 3447
357 Ga0105240_11127909 3300009093 Bacteria 833
358 Ga0105240_11192091 3300009093 Bacteria 807
359 Ga0111539_10010849 3300009094 Bacteria 11468
360 Ga0105245_10073088 3300009098 Bacteria 3117
361 Ga0105245_10106799 3300009098 Bacteria 2598
362 Ga0105245_10143507 3300009098 Bacteria 2251
363 Ga0105245_10203025 3300009098 Bacteria 1904
364 Ga0105247_10105862 3300009101 Bacteria 1804
365 Ga0114129_11113278 3300009147 Bacteria 988
366 Ga0105243_10971779 3300009148 Bacteria 850
367 Ga0105243_11242770 3300009148 Bacteria 760
368 Ga0105241_10157434 3300009174 Bacteria 1864
369 Ga0105241_10385695 3300009174 Bacteria 1225
370 Ga0105242_10158501 3300009176 Bacteria 1979
371 Ga0105242_10283484 3300009176 Bacteria 1506
372 Ga0105242_10349630 3300009176 Bacteria 1365
373 Ga0105248_10000660 3300009177 Bacteria 39185
374 Ga0105248_10025331 3300009177 Bacteria 6595
375 Ga0105248_10045390 3300009177 Bacteria 4928
376 Ga0105248_10086790 3300009177 Bacteria 3521
377 Ga0105248_10711001 3300009177 Bacteria 1134
378 Ga0105248_10912102 3300009177 Bacteria 992
379 Ga0105248_10947027 3300009177 Bacteria 972
380 Ga0105248_11985644 3300009177 Bacteria 661
381 Ga0105248_13049804 3300009177 Bacteria 533
382 Ga0105237_10838629 3300009545 Bacteria 926
383 Ga0105238_10066506 3300009551 Bacteria 3606
384 Ga0105238_10156150 3300009551 Bacteria 2257
385 Ga0105238_11316653 3300009551 Bacteria 749
386 Ga0105249_10126929 3300009553 Bacteria 2430
387 Ga0105249_11205544 3300009553 Bacteria 828
388 Ga0105249_11967939 3300009553 Bacteria 657
389 Ga0105239_10122079 3300010375 Bacteria 2894
390 Ga0105239_10533321 3300010375 Bacteria 1336
391 Ga0105239_11678206 3300010375 Bacteria 735
392 Ga0105239_11891652 3300010375 Bacteria 692
393 Ga0105246_10038843 3300011119 Bacteria 3203
394 Ga0105246_11056400 3300011119 Bacteria 739
395 Ga0157373_10016504 3300013100 Bacteria 5385
396 Ga0157373_10019454 3300013100 Bacteria 4940
397 Ga0157373_10053919 3300013100 Bacteria 2858
398 Ga0157373_10117797 3300013100 Bacteria 1867
399 Ga0157373_10124874 3300013100 Bacteria 1810
400 Ga0157373_10149016 3300013100 Bacteria 1646
401 Ga0157373_10162230 3300013100 Bacteria 1573
402 Ga0157373_10386032 3300013100 Bacteria 1002
403 Ga0157373_10435616 3300013100 Unclassified 942
404 Ga0157373_10798530 3300013100 Bacteria 696
405 Ga0157373_10871722 3300013100 Bacteria 667
406 Ga0157373_11118314 3300013100 Bacteria 591
407 Ga0157373_11225380 3300013100 Bacteria 566
408 Ga0157373_11316979 3300013100 Bacteria 547
409 Ga0157371_10034998 3300013102 Bacteria 3600
410 Ga0157371_10045480 3300013102 Bacteria 3123
411 Ga0157371_10079143 3300013102 Bacteria 2328
412 Ga0157371_10080544 3300013102 Bacteria 2306
413 Ga0157371_10086284 3300013102 Bacteria 2223
414 Ga0157371_10096033 3300013102 Bacteria 2100
415 Ga0157371_10099998 3300013102 Bacteria 2057
416 Ga0157371_10127697 3300013102 Bacteria 1808
417 Ga0157371_10179782 3300013102 Bacteria 1513
418 Ga0157371_10183631 3300013102 Bacteria 1496
419 Ga0157371_10231519 3300013102 Bacteria 1328
420 Ga0157371_10384545 3300013102 Bacteria 1025
421 Ga0157371_10642570 3300013102 Bacteria 791
422 Ga0157371_10670711 3300013102 Bacteria 775
423 Ga0157371_10766178 3300013102 Bacteria 725
424 Ga0157370_10033272 3300013104 Bacteria 5026
425 Ga0157370_10037156 3300013104 Bacteria 4722
426 Ga0157370_10356065 3300013104 Bacteria 1349
427 Ga0157370_10387559 3300013104 Bacteria 1287
428 Ga0157370_10684941 3300013104 Bacteria 936
429 Ga0157370_10743535 3300013104 Bacteria 894
430 Ga0157370_10988149 3300013104 Bacteria 762
431 Ga0157369_10005909 3300013105 Bacteria 14216
432 Ga0157369_10082841 3300013105 Bacteria 3432
433 Ga0157369_10434869 3300013105 Bacteria 1359
434 Ga0157369_10678398 3300013105 Bacteria 1062
435 Ga0157369_11171087 3300013105 Bacteria 785
436 Ga0157369_12481470 3300013105 Bacteria 525
437 Ga0157374_10003253 3300013296 Bacteria 13645
438 Ga0157374_10210622 3300013296 Bacteria 1906
439 Ga0157374_10886619 3300013296 Bacteria 909
440 Ga0157374_11320735 3300013296 Bacteria 743
441 Ga0157374_11863627 3300013296 Bacteria 627
442 Ga0157374_12045918 3300013296 Bacteria 599
443 Ga0157374_12486981 3300013296 Bacteria 545
444 Ga0157374_12857405 3300013296 Bacteria 510
445 Ga0157378_10072817 3300013297 Bacteria 3088
446 Ga0157378_10226881 3300013297 Bacteria 1778
447 Ga0157378_10351594 3300013297 Bacteria 1440
448 Ga0157378_10648454 3300013297 Bacteria 1071
449 Ga0157378_10748863 3300013297 Bacteria 1000
450 Ga0157378_11400184 3300013297 Bacteria 742
451 Ga0157378_12147829 3300013297 Bacteria 609
452 Ga0163162_10010838 3300013306 Bacteria 8870
453 Ga0163162_10034039 3300013306 Bacteria 5068
454 Ga0163162_10180332 3300013306 Bacteria 2238
455 Ga0163162_10577786 3300013306 Bacteria 1251
456 Ga0163162_11264950 3300013306 Bacteria 838
457 Ga0163162_11776614 3300013306 Bacteria 705
458 Ga0163162_12892209 3300013306 Bacteria 552
459 Ga0157372_10041199 3300013307 Bacteria 5105
460 Ga0157372_10105309 3300013307 Bacteria 3226
461 Ga0157372_10169113 3300013307 Bacteria 2529
462 Ga0157372_10208959 3300013307 Bacteria 2262
463 Ga0157372_10294174 3300013307 Bacteria 1888
464 Ga0157372_10370395 3300013307 Bacteria 1669
465 Ga0157372_10675155 3300013307 Bacteria 1203
466 Ga0157372_10959711 3300013307 Bacteria 991
467 Ga0157372_11029943 3300013307 Bacteria 953
468 Ga0157375_10166856 3300013308 Bacteria 2347
469 Ga0157375_10337121 3300013308 Bacteria 1673
470 Ga0157375_10430163 3300013308 Bacteria 1486
471 Ga0163163_10033987 3300014325 Bacteria 4935
472 Ga0163163_10188909 3300014325 Bacteria 2108
473 Ga0163163_10517654 3300014325 Bacteria 1255
474 Ga0157380_10780533 3300014326 Bacteria 970
475 Ga0182008_10939305 3300014497 Bacteria 512
476 Ga0157377_10014489 3300014745 Bacteria 4013
477 Ga0157377_10109292 3300014745 Bacteria 1660
478 Ga0157377_10208064 3300014745 Bacteria 1246
479 Ga0157377_10720386 3300014745 Bacteria 727
480 Ga0157379_10281987 3300014968 Bacteria 1512
481 Ga0157379_10321885 3300014968 Bacteria 1412
482 Ga0157379_11350338 3300014968 Bacteria 690
483 Ga0157379_11403357 3300014968 Bacteria 677
484 Ga0157376_10108918 3300014969 Bacteria 2434
485 Ga0157376_10328453 3300014969 Bacteria 1456
486 Ga0182007_10323846 3300015262 Bacteria 572
487 Ga0197907_11287558 3300020069 Bacteria 2754
488 Ga0206349_1411556 3300020075 Bacteria 1131
489 Ga0206355_1106287 3300020076 Bacteria 1614
490 Ga0206351_10733585 3300020077 Bacteria 674
491 Ga0206350_10334419 3300020080 Bacteria 1128
492 Ga0206354_10801876 3300020081 Bacteria 1046
493 Ga0206354_10855847 3300020081 Bacteria 744
494 Ga0206353_11371573 3300020082 Bacteria 1113
495 Ga0206353_11530823 3300020082 Bacteria 1878
496 Ga0206353_11964301 3300020082 Bacteria 1438
497 Ga0206353_12041288 3300020082 Bacteria 660
498 Ga0154015_1141618 3300020610 Bacteria 563
499 Ga0224712_10301845 3300022467 Bacteria 749
500 Ga0207697_10002198 3300025315 Bacteria 10202
501 Ga0207697_10019446 3300025315 Bacteria 2782
502 Ga0207697_10058146 3300025315 Bacteria 1605
503 Ga0207697_10293835 3300025315 Bacteria 720
504 Ga0207697_10416741 3300025315 Unclassified 596
505 Ga0207656_10104433 3300025321 Bacteria 1302
506 Ga0207656_10161383 3300025321 Bacteria 1067
507 Ga0207655_1165709 3300025728 Bacteria 687
508 Ga0207682_10011777 3300025893 Bacteria 3416
509 Ga0207682_10600774 3300025893 Bacteria 519
510 Ga0207642_10016251 3300025899 Bacteria 2798
511 Ga0207642_10050630 3300025899 Bacteria 1874
512 Ga0207710_10078831 3300025900 Bacteria 1524
513 Ga0207710_10155287 3300025900 Bacteria 1112
514 Ga0207688_10009422 3300025901 Bacteria 5316
515 Ga0207688_10030882 3300025901 Bacteria 2956
516 Ga0207688_10337055 3300025901 Bacteria 927
517 Ga0207688_10345340 3300025901 Bacteria 916
518 Ga0207680_10163350 3300025903 Bacteria 1495
519 Ga0207680_10167100 3300025903 Bacteria 1479
520 Ga0207647_10002633 3300025904 Bacteria 13570
521 Ga0207647_10024599 3300025904 Bacteria 3970
522 Ga0207647_10029015 3300025904 Bacteria 3585
523 Ga0207647_10142593 3300025904 Bacteria 1404
524 Ga0207647_10290513 3300025904 Bacteria 932
525 Ga0207645_10061899 3300025907 Bacteria 2391
526 Ga0207645_10336630 3300025907 Bacteria 1008
527 Ga0207645_10347716 3300025907 Bacteria 992
528 Ga0207645_10550085 3300025907 Bacteria 783
529 Ga0207645_10578605 3300025907 Bacteria 762
530 Ga0207645_10597177 3300025907 Bacteria 749
531 Ga0207643_10038094 3300025908 Bacteria 2700
532 Ga0207705_10018659 3300025909 Bacteria 4961
533 Ga0207705_10031804 3300025909 Bacteria 3769
534 Ga0207705_10062623 3300025909 Bacteria 2687
535 Ga0207705_10063179 3300025909 Bacteria 2675
536 Ga0207705_10294781 3300025909 Bacteria 1243
537 Ga0207705_10312429 3300025909 Bacteria 1206
538 Ga0207705_10312826 3300025909 Bacteria 1206
539 Ga0207705_10411730 3300025909 Bacteria 1046
540 Ga0207705_10974060 3300025909 Bacteria 656
541 Ga0207705_10975464 3300025909 Bacteria 655
542 Ga0207705_11289101 3300025909 Bacteria 558
543 Ga0207705_11516354 3300025909 Bacteria 507
544 Ga0207654_10204310 3300025911 Bacteria 1303
545 Ga0207654_11322473 3300025911 Bacteria 525
546 Ga0207707_10042825 3300025912 Bacteria 3951
547 Ga0207707_10497305 3300025912 Bacteria 1040
548 Ga0207707_10821861 3300025912 Bacteria 773
549 Ga0207707_10859485 3300025912 Bacteria 752
550 Ga0207695_10078395 3300025913 Bacteria 3352
551 Ga0207695_11687208 3300025913 Bacteria 514
552 Ga0207660_10005019 3300025917 Bacteria 8627
553 Ga0207660_10011295 3300025917 Bacteria 5807
554 Ga0207660_10330147 3300025917 Bacteria 1219
555 Ga0207660_10374232 3300025917 Bacteria 1144
556 Ga0207660_10376975 3300025917 Bacteria 1140
557 Ga0207660_10430534 3300025917 Bacteria 1065
558 Ga0207662_10371778 3300025918 Bacteria 964
559 Ga0207662_10409074 3300025918 Bacteria 921
560 Ga0207662_10500832 3300025918 Bacteria 836
561 Ga0207657_10002179 3300025919 Bacteria 21219
562 Ga0207657_10014760 3300025919 Bacteria 7606
563 Ga0207657_10015699 3300025919 Bacteria 7324
564 Ga0207657_10020632 3300025919 Bacteria 6222
565 Ga0207657_10031438 3300025919 Bacteria 4808
566 Ga0207657_10045664 3300025919 Bacteria 3842
567 Ga0207657_10062053 3300025919 Bacteria 3202
568 Ga0207657_10068468 3300025919 Bacteria 3015
569 Ga0207657_10083246 3300025919 Bacteria 2684
570 Ga0207657_10124685 3300025919 Bacteria 2116
571 Ga0207657_10137070 3300025919 Bacteria 2002
572 Ga0207657_10149735 3300025919 Bacteria 1901
573 Ga0207657_10166084 3300025919 Unclassified 1790
574 Ga0207649_10019441 3300025920 Bacteria 3882
575 Ga0207649_10038455 3300025920 Bacteria 2897
576 Ga0207649_10043321 3300025920 Bacteria 2751
577 Ga0207649_10094685 3300025920 Bacteria 1963
578 Ga0207649_10127974 3300025920 Bacteria 1721
579 Ga0207649_10262459 3300025920 Bacteria 1248
580 Ga0207649_10287775 3300025920 Bacteria 1197
581 Ga0207649_10311193 3300025920 Bacteria 1154
582 Ga0207649_10715660 3300025920 Bacteria 777
583 Ga0207649_10992930 3300025920 Bacteria 660
584 Ga0207652_10011538 3300025921 Bacteria 7123
585 Ga0207652_10017787 3300025921 Bacteria 5823
586 Ga0207652_10080707 3300025921 Bacteria 2844
587 Ga0207652_10106943 3300025921 Bacteria 2477
588 Ga0207652_10218264 3300025921 Bacteria 1718
589 Ga0207652_10268927 3300025921 Bacteria 1537
590 Ga0207652_10378562 3300025921 Bacteria 1277
591 Ga0207652_10480076 3300025921 Bacteria 1120
592 Ga0207681_10106940 3300025923 Bacteria 2028
593 Ga0207681_10199184 3300025923 Bacteria 1536
594 Ga0207681_10477972 3300025923 Bacteria 1017
595 Ga0207681_10548209 3300025923 Bacteria 951
596 Ga0207681_11368667 3300025923 Bacteria 594
597 Ga0207694_10124178 3300025924 Bacteria 2063
598 Ga0207694_10782639 3300025924 Bacteria 806
599 Ga0207694_11375407 3300025924 Bacteria 597
600 Ga0207650_10052989 3300025925 Bacteria 3006
601 Ga0207650_10066817 3300025925 Bacteria 2697
602 Ga0207650_10082758 3300025925 Bacteria 2437
603 Ga0207650_10101595 3300025925 Bacteria 2214
604 Ga0207650_10345032 3300025925 Bacteria 1224
605 Ga0207650_10509238 3300025925 Bacteria 1006
606 Ga0207650_10630437 3300025925 Bacteria 903
607 Ga0207650_10703187 3300025925 Bacteria 854
608 Ga0207650_11072842 3300025925 Bacteria 685
609 Ga0207650_11077280 3300025925 Bacteria 684
610 Ga0207650_11266642 3300025925 Bacteria 628
611 Ga0207659_10023658 3300025926 Bacteria 4104
612 Ga0207659_10100473 3300025926 Bacteria 2180
613 Ga0207659_10126379 3300025926 Bacteria 1967
614 Ga0207659_10161321 3300025926 Bacteria 1760
615 Ga0207659_10619891 3300025926 Bacteria 923
616 Ga0207687_10069593 3300025927 Bacteria 2510
617 Ga0207687_10220615 3300025927 Bacteria 1493
618 Ga0207687_10261879 3300025927 Bacteria 1379
619 Ga0207687_11661713 3300025927 Bacteria 548
620 Ga0207700_10590375 3300025928 Bacteria 988
621 Ga0207664_10139058 3300025929 Bacteria 2052
622 Ga0207664_10382532 3300025929 Bacteria 1249
623 Ga0207664_10407777 3300025929 Bacteria 1209
624 Ga0207664_11676426 3300025929 Unclassified 558
625 Ga0207644_10000358 3300025931 Bacteria 29705
626 Ga0207644_10000415 3300025931 Bacteria 27794
627 Ga0207644_10003915 3300025931 Bacteria 9657
628 Ga0207644_10048669 3300025931 Bacteria 3032
629 Ga0207644_10184752 3300025931 Bacteria 1636
630 Ga0207644_10468000 3300025931 Bacteria 1037
631 Ga0207644_11088780 3300025931 Bacteria 671
632 Ga0207644_11472711 3300025931 Bacteria 572
633 Ga0207644_11791932 3300025931 Bacteria 514
634 Ga0207690_10005597 3300025932 Bacteria 7424
635 Ga0207690_10009277 3300025932 Bacteria 5846
636 Ga0207690_10016900 3300025932 Bacteria 4448
637 Ga0207690_10022602 3300025932 Bacteria 3914
638 Ga0207690_10038521 3300025932 Bacteria 3112
639 Ga0207690_10044284 3300025932 Bacteria 2933
640 Ga0207690_10086626 3300025932 Bacteria 2202
641 Ga0207690_10128251 3300025932 Bacteria 1853
642 Ga0207690_10225206 3300025932 Bacteria 1437
643 Ga0207690_10255300 3300025932 Bacteria 1356
644 Ga0207690_10356323 3300025932 Bacteria 1158
645 Ga0207690_10363873 3300025932 Bacteria 1146
646 Ga0207690_10545244 3300025932 Bacteria 942
647 Ga0207690_10578370 3300025932 Bacteria 915
648 Ga0207690_10681369 3300025932 Bacteria 844
649 Ga0207690_10730690 3300025932 Bacteria 815
650 Ga0207690_11335492 3300025932 Bacteria 599
651 Ga0207706_10003298 3300025933 Bacteria 15456
652 Ga0207706_10011160 3300025933 Bacteria 8190
653 Ga0207706_10032025 3300025933 Bacteria 4684
654 Ga0207706_10034511 3300025933 Bacteria 4500
655 Ga0207706_10062759 3300025933 Bacteria 3272
656 Ga0207706_10075560 3300025933 Bacteria 2963
657 Ga0207706_10104621 3300025933 Bacteria 2490
658 Ga0207706_10165875 3300025933 Bacteria 1941
659 Ga0207706_10563052 3300025933 Bacteria 980
660 Ga0207706_10844342 3300025933 Bacteria 776
661 Ga0207706_11671535 3300025933 Bacteria 514
662 Ga0207686_10157965 3300025934 Bacteria 1586
663 Ga0207686_10703627 3300025934 Bacteria 803
664 Ga0207709_11771843 3300025935 Bacteria 514
665 Ga0207669_10048374 3300025937 Bacteria 2526
666 Ga0207669_10082622 3300025937 Bacteria 2063
667 Ga0207669_10149834 3300025937 Bacteria 1632
668 Ga0207669_10502897 3300025937 Bacteria 970
669 Ga0207704_10039312 3300025938 Bacteria 2753
670 Ga0207704_10226361 3300025938 Bacteria 1387
671 Ga0207665_10030997 3300025939 Bacteria 3537
672 Ga0207691_10002039 3300025940 Bacteria 19763
673 Ga0207691_10008814 3300025940 Bacteria 9676
674 Ga0207691_10028711 3300025940 Bacteria 5206
675 Ga0207691_10040667 3300025940 Bacteria 4295
676 Ga0207691_11530883 3300025940 Bacteria 544
677 Ga0207711_10002381 3300025941 Bacteria 16823
678 Ga0207711_10004092 3300025941 Bacteria 12505
679 Ga0207711_10012307 3300025941 Bacteria 7112
680 Ga0207711_10025986 3300025941 Bacteria 4911
681 Ga0207711_10085965 3300025941 Bacteria 2756
682 Ga0207711_10192872 3300025941 Bacteria 1857
683 Ga0207711_10305382 3300025941 Bacteria 1468
684 Ga0207711_10415523 3300025941 Bacteria 1251
685 Ga0207711_10847379 3300025941 Bacteria 851
686 Ga0207689_10073008 3300025942 Bacteria 2819
687 Ga0207689_10073615 3300025942 Bacteria 2806
688 Ga0207661_10074011 3300025944 Bacteria 2792
689 Ga0207661_10305159 3300025944 Bacteria 1428
690 Ga0207661_11249016 3300025944 Bacteria 683
691 Ga0207679_10053217 3300025945 Bacteria 2973
692 Ga0207679_10076401 3300025945 Bacteria 2544
693 Ga0207679_10185494 3300025945 Bacteria 1724
694 Ga0207679_10360790 3300025945 Bacteria 1269
695 Ga0207679_10375991 3300025945 Bacteria 1244
696 Ga0207679_10540745 3300025945 Bacteria 1044
697 Ga0207679_10785935 3300025945 Bacteria 867
698 Ga0207679_11343538 3300025945 Bacteria 656
699 Ga0207679_11401616 3300025945 Bacteria 641
700 Ga0207679_11712322 3300025945 Bacteria 575
701 Ga0207667_10002612 3300025949 Bacteria 22331
702 Ga0207667_10005995 3300025949 Bacteria 14785
703 Ga0207667_10019409 3300025949 Bacteria 7590
704 Ga0207667_10019667 3300025949 Bacteria 7528
705 Ga0207667_10180615 3300025949 Bacteria 2167
706 Ga0207667_10670058 3300025949 Bacteria 1042
707 Ga0207667_10696421 3300025949 Bacteria 1019
708 Ga0207667_11102500 3300025949 Bacteria 777
709 Ga0207667_11715540 3300025949 Bacteria 594
710 Ga0207651_10055211 3300025960 Bacteria 2727
711 Ga0207651_10098848 3300025960 Bacteria 2159
712 Ga0207651_10145031 3300025960 Bacteria 1839
713 Ga0207651_10145930 3300025960 Bacteria 1835
714 Ga0207651_10269846 3300025960 Bacteria 1401
715 Ga0207651_10484649 3300025960 Bacteria 1066
716 Ga0207651_10687455 3300025960 Bacteria 900
717 Ga0207651_10760739 3300025960 Bacteria 857
718 Ga0207651_11350066 3300025960 Bacteria 641
719 Ga0207712_10013315 3300025961 Bacteria 5274
720 Ga0207712_11095604 3300025961 Bacteria 709
721 Ga0207712_11310183 3300025961 Bacteria 647
722 Ga0207668_10025749 3300025972 Bacteria 3811
723 Ga0207668_10085046 3300025972 Bacteria 2307
724 Ga0207668_11404270 3300025972 Bacteria 629
725 Ga0207640_10086017 3300025981 Bacteria 2163
726 Ga0207640_10098720 3300025981 Bacteria 2042
727 Ga0207640_10118614 3300025981 Bacteria 1891
728 Ga0207640_10121884 3300025981 Bacteria 1870
729 Ga0207640_10554053 3300025981 Bacteria 966
730 Ga0207640_11550491 3300025981 Bacteria 596
731 Ga0207640_11857299 3300025981 Archaea 545
732 Ga0207658_10047181 3300025986 Bacteria 3151
733 Ga0207658_10089985 3300025986 Bacteria 2377
734 Ga0207658_10539832 3300025986 Bacteria 1042
735 Ga0207658_10881206 3300025986 Bacteria 814
736 Ga0207658_11445001 3300025986 Bacteria 629
737 Ga0207658_11501247 3300025986 Bacteria 616
738 Ga0207677_10111420 3300026023 Bacteria 2039
739 Ga0207677_10209566 3300026023 Bacteria 1555
740 Ga0207677_10405454 3300026023 Bacteria 1157
741 Ga0207677_10667523 3300026023 Bacteria 919
742 Ga0207677_10708699 3300026023 Bacteria 894
743 Ga0207677_10997508 3300026023 Bacteria 759
744 Ga0207703_10000593 3300026035 Bacteria 36861
745 Ga0207703_10106781 3300026035 Bacteria 2382
746 Ga0207703_10269579 3300026035 Bacteria 1542
747 Ga0207703_10282020 3300026035 Bacteria 1509
748 Ga0207703_10776805 3300026035 Bacteria 914
749 Ga0207639_10047241 3300026041 Bacteria 3252
750 Ga0207639_10093915 3300026041 Bacteria 2407
751 Ga0207639_10341120 3300026041 Bacteria 1336
752 Ga0207639_10403711 3300026041 Bacteria 1231
753 Ga0207639_10936784 3300026041 Bacteria 810
754 Ga0207678_10009013 3300026067 Bacteria 8782
755 Ga0207678_10015421 3300026067 Bacteria 6719
756 Ga0207678_10021391 3300026067 Bacteria 5672
757 Ga0207678_10023390 3300026067 Bacteria 5404
758 Ga0207678_10280135 3300026067 Bacteria 1431
759 Ga0207678_10413599 3300026067 Bacteria 1169
760 Ga0207678_10541212 3300026067 Bacteria 1018
761 Ga0207678_10812438 3300026067 Bacteria 826
762 Ga0207702_10025805 3300026078 Bacteria 4878
763 Ga0207702_11223340 3300026078 Bacteria 745
764 Ga0207702_11231392 3300026078 Bacteria 743
765 Ga0207702_11269948 3300026078 Bacteria 730
766 Ga0207702_11836677 3300026078 Bacteria 598
767 Ga0207641_10014381 3300026088 Bacteria 6485
768 Ga0207641_10107436 3300026088 Bacteria 2468
769 Ga0207641_10134341 3300026088 Bacteria 2225
770 Ga0207648_10018551 3300026089 Bacteria 6297
771 Ga0207648_10144548 3300026089 Bacteria 2098
772 Ga0207676_10000253 3300026095 Bacteria 46261
773 Ga0207676_10002138 3300026095 Bacteria 14289
774 Ga0207676_10013212 3300026095 Bacteria 5930
775 Ga0207676_10372243 3300026095 Bacteria 1327
776 Ga0207676_10434331 3300026095 Bacteria 1234
777 Ga0207676_11031946 3300026095 Bacteria 811
778 Ga0207676_12059379 3300026095 Bacteria 569
779 Ga0207674_10000086 3300026116 Bacteria 100722
780 Ga0207674_10056635 3300026116 Bacteria 3979
781 Ga0207674_10170758 3300026116 Bacteria 2128
782 Ga0207674_10352142 3300026116 Bacteria 1423
783 Ga0207674_12286999 3300026116 Bacteria 503
784 Ga0207675_100176499 3300026118 Bacteria 2044
785 Ga0207675_102532408 3300026118 Bacteria 523
786 Ga0207675_102720569 3300026118 Bacteria 503
787 Ga0207683_10023087 3300026121 Bacteria 5346
788 Ga0207683_10062138 3300026121 Bacteria 3289
789 Ga0207683_10215180 3300026121 Bacteria 1750
790 Ga0207698_10004003 3300026142 Bacteria 8937
791 Ga0207698_10015624 3300026142 Bacteria 5090
792 Ga0207698_10066765 3300026142 Bacteria 2833
793 Ga0207698_10093885 3300026142 Bacteria 2465
794 Ga0207698_10186138 3300026142 Bacteria 1845
795 Ga0207698_10272391 3300026142 Bacteria 1561
796 Ga0207698_10385650 3300026142 Bacteria 1334
797 Ga0207698_10425964 3300026142 Bacteria 1275
798 Ga0207698_10428235 3300026142 Bacteria 1271
799 Ga0207698_11040457 3300026142 Bacteria 830
800 Ga0207698_11189151 3300026142 Bacteria 776
801 Ga0207698_11199699 3300026142 Bacteria 773
802 Ga0207698_11207895 3300026142 Bacteria 770
803 Ga0207698_11796903 3300026142 Bacteria 628
804 Ga0207698_12084935 3300026142 Bacteria 581
805 Ga0207698_12195405 3300026142 Bacteria 565
806 Ga0209974_10014706 3300027876 Bacteria 2601
807 Ga0209974_10060947 3300027876 Bacteria 1277
808 Ga0268266_10006627 3300028379 Bacteria 10571
809 Ga0268266_10097239 3300028379 Bacteria 2589
810 Ga0268266_10158893 3300028379 Bacteria 2043
811 Ga0268266_10348028 3300028379 Bacteria 1392
812 Ga0268266_10914496 3300028379 Bacteria 848
813 Ga0268266_11674690 3300028379 Bacteria 611
814 Ga0268266_11975434 3300028379 Bacteria 557
815 Ga0268265_10068082 3300028380 Bacteria 2759
816 Ga0268265_10156078 3300028380 Bacteria 1931
817 Ga0268265_10250856 3300028380 Bacteria 1567
818 Ga0268265_11216133 3300028380 Bacteria 751
819 Ga0268265_12458134 3300028380 Bacteria 527
820 Ga0268264_10003670 3300028381 Bacteria 13190
821 Ga0268264_10699908 3300028381 Bacteria 1006
822 Ga0268264_11723001 3300028381 Bacteria 637
823 Ga0307515_10276095 3300028794 Bacteria 1394
824 Ga0307512_10379751 3300030522 Bacteria 605
825 Ga0316178_1146043 3300030735 Bacteria 911
826 Ga0316183_1175925 3300030742 Bacteria 1257
827 Ga0316182_1007628 3300030745 Bacteria 1076
828 Ga0316182_1158440 3300030745 Bacteria 784
829 Ga0307513_10335593 3300031456 Bacteria 1264
830 Ga0307408_100003350 3300031548 Bacteria 11002
831 Ga0307408_100022223 3300031548 Bacteria 4307
832 Ga0307408_100098065 3300031548 Bacteria 2227
833 Ga0307408_100313957 3300031548 Bacteria 1318
834 Ga0307408_100492278 3300031548 Unclassified 1072
835 Ga0307408_100504885 3300031548 Bacteria 1059
836 Ga0307408_100510975 3300031548 Bacteria 1053
837 Ga0307408_100775106 3300031548 Bacteria 868
838 Ga0307405_10002088 3300031731 Bacteria 8710
839 Ga0307405_10003714 3300031731 Bacteria 7084
840 Ga0307405_10125688 3300031731 Bacteria 1763
841 Ga0307405_10224308 3300031731 Bacteria 1381
842 Ga0307405_10538742 3300031731 Bacteria 942
843 Ga0307405_10841415 3300031731 Bacteria 772
844 Ga0307405_11116431 3300031731 Bacteria 678
845 Ga0307413_10000292 3300031824 Bacteria 15426
846 Ga0307413_10007028 3300031824 Bacteria 5189
847 Ga0307413_10023501 3300031824 Bacteria 3341
848 Ga0307413_10443662 3300031824 Bacteria 1028
849 Ga0307413_11925158 3300031824 Bacteria 531
850 Ga0307410_10000652 3300031852 Bacteria 14303
851 Ga0307410_10002064 3300031852 Bacteria 9499
852 Ga0307410_10004898 3300031852 Bacteria 7008
853 Ga0307410_10009431 3300031852 Bacteria 5473
854 Ga0307410_10149451 3300031852 Bacteria 1737
855 Ga0307410_10334473 3300031852 Bacteria 1205
856 Ga0307410_10711956 3300031852 Bacteria 847
857 Ga0307410_11122974 3300031852 Bacteria 682
858 Ga0307406_10013035 3300031901 Bacteria 4752
859 Ga0307406_10021311 3300031901 Bacteria 3831
860 Ga0307406_10260752 3300031901 Bacteria 1311
861 Ga0307406_11465758 3300031901 Bacteria 600
862 Ga0307406_11537438 3300031901 Bacteria 586
863 Ga0307407_10001061 3300031903 Bacteria 9518
864 Ga0307407_10054848 3300031903 Bacteria 2300
865 Ga0307407_10478454 3300031903 Bacteria 909
866 Ga0307407_10619267 3300031903 Bacteria 808
867 Ga0307407_10899838 3300031903 Bacteria 679
868 Ga0307407_10918381 3300031903 Bacteria 672
869 Ga0307412_10000248 3300031911 Bacteria 35008
870 Ga0307412_10015741 3300031911 Bacteria 4489
871 Ga0307412_10024386 3300031911 Bacteria 3733
872 Ga0307412_10076520 3300031911 Bacteria 2299
873 Ga0307412_10277426 3300031911 Bacteria 1314
874 Ga0307409_100001918 3300031995 Bacteria 10617
875 Ga0307409_100008269 3300031995 Bacteria 6303
876 Ga0307409_100016302 3300031995 Bacteria 4911
877 Ga0307409_100033607 3300031995 Bacteria 3734
878 Ga0307409_100353438 3300031995 Bacteria 1388
879 Ga0307409_100386207 3300031995 Bacteria 1333
880 Ga0307409_100972384 3300031995 Bacteria 866
881 Ga0307409_101159634 3300031995 Bacteria 795
882 Ga0307409_101428688 3300031995 Bacteria 718
883 Ga0307409_101468712 3300031995 Bacteria 709
884 Ga0307409_101858789 3300031995 Bacteria 631
885 Ga0307409_102254000 3300031995 Bacteria 574
886 Ga0307416_100000366 3300032002 Bacteria 23527
887 Ga0307416_100004414 3300032002 Bacteria 8476
888 Ga0307416_100031319 3300032002 Bacteria 4002
889 Ga0307416_100059570 3300032002 Bacteria 3103
890 Ga0307416_101334855 3300032002 Bacteria 823
891 Ga0307416_101643088 3300032002 Bacteria 747
892 Ga0307416_101684733 3300032002 Bacteria 739
893 Ga0307416_101863556 3300032002 Bacteria 705
894 Ga0307416_102301647 3300032002 Bacteria 639
895 Ga0307416_102905091 3300032002 Bacteria 573
896 Ga0307416_103191715 3300032002 Bacteria 548
897 Ga0307416_103677914 3300032002 Bacteria 513
898 Ga0307414_10001973 3300032004 Bacteria 10628
899 Ga0307414_10031755 3300032004 Bacteria 3468
900 Ga0307414_10035399 3300032004 Bacteria 3322
901 Ga0307414_10040212 3300032004 Bacteria 3156
902 Ga0307414_10349806 3300032004 Bacteria 1268
903 Ga0307414_10375350 3300032004 Bacteria 1228
904 Ga0307414_10408860 3300032004 Bacteria 1181
905 Ga0307414_10506226 3300032004 Bacteria 1069
906 Ga0307414_11920635 3300032004 Bacteria 552
907 Ga0307414_12195756 3300032004 Bacteria 515
908 Ga0307414_12248660 3300032004 Bacteria 509
909 Ga0307411_10005103 3300032005 Bacteria 6404
910 Ga0307411_10017878 3300032005 Bacteria 4054
911 Ga0307411_10027320 3300032005 Bacteria 3451
912 Ga0307411_10253104 3300032005 Bacteria 1386
913 Ga0307411_10283559 3300032005 Bacteria 1319
914 Ga0307411_10370297 3300032005 Bacteria 1175
915 Ga0307411_10447155 3300032005 Bacteria 1080
916 Ga0307411_10719351 3300032005 Bacteria 871
917 Ga0307411_11166504 3300032005 Bacteria 697
918 Ga0307411_11225315 3300032005 Bacteria 681
919 Ga0307411_11467211 3300032005 Bacteria 626
920 Ga0307411_11709456 3300032005 Bacteria 582
921 Ga0307415_100000909 3300032126 Bacteria 13563
922 Ga0307415_100003550 3300032126 Bacteria 7957
923 Ga0307415_100006114 3300032126 Bacteria 6458
924 Ga0307415_100025925 3300032126 Bacteria 3689
925 Ga0307415_100026424 3300032126 Bacteria 3661
926 Ga0307415_100614844 3300032126 Bacteria 969
927 Ga0307415_100709070 3300032126 Bacteria 909
928 Ga0307415_100862737 3300032126 Bacteria 831
929 Ga0307415_101593134 3300032126 Bacteria 627
930 Ga0307415_102141504 3300032126 Bacteria 546
931 Ga0307510_10037783 3300033180 Bacteria 5352
932 Ga0373929_0268380 3300035085 Bacteria 500
933 Ga0373936_0323372 3300035113 Bacteria 699
934 Ga0373939_0298294 3300035114 Bacteria 642
935 Ga0373943_0036995 3300035170 Bacteria 2341
936 Ga0373946_0147448 3300035171 Bacteria 1095
937 Ga0373955_0698063 3300035172 Bacteria 623
938 Ga0373962_0132219 3300035242 Bacteria 804
939 Ga0373931_0871600 3300035691 Bacteria 604
940 Ga0373931_1146033 3300035691 Bacteria 531
941 Ga0373927_0062157 3300035695 Bacteria 2415
942 Ga0373947_0128573 3300035725 Bacteria 1615
943 Ga0373947_1028497 3300035725 Bacteria 562
944 Ga0373925_0003304 3300037068 Bacteria 12536
945 Ga0395899_0035436 3300037312 Bacteria 3746
946 Ga0395899_0088857 3300037312 Bacteria 2241
947 Ga0395899_0093762 3300037312 Bacteria 2173
948 Ga0395899_0093985 3300037312 Bacteria 2170
949 Ga0395899_0111186 3300037312 Bacteria 1969
950 Ga0395899_0122242 3300037312 Bacteria 1863
951 Ga0395899_0146922 3300037312 Bacteria 1673
952 Ga0395899_0177583 3300037312 Bacteria 1496
953 Ga0395899_0209374 3300037312 Bacteria 1356
954 Ga0395899_0264116 3300037312 Bacteria 1176
955 Ga0395899_0328894 3300037312 Bacteria 1027
956 Ga0395899_0334855 3300037312 Unclassified 1016
957 Ga0395899_0373184 3300037312 Bacteria 949
958 Ga0395899_0379768 3300037312 Bacteria 939
959 Ga0395899_0421723 3300037312 Bacteria 879
960 Ga0395900_0002700 3300037418 Bacteria 19400
961 Ga0395900_0003041 3300037418 Bacteria 18271
962 Ga0395900_0006151 3300037418 Bacteria 12530
963 Ga0395900_0006393 3300037418 Bacteria 12283
964 Ga0395900_0014124 3300037418 Bacteria 8155
965 Ga0395900_0015350 3300037418 Bacteria 7808
966 Ga0395900_0016814 3300037418 Bacteria 7461
967 Ga0395900_0053670 3300037418 Bacteria 4148
968 Ga0395900_0055842 3300037418 Bacteria 4066
969 Ga0395900_0082848 3300037418 Bacteria 3295
970 Ga0395900_0099913 3300037418 Bacteria 2980
971 Ga0395900_0104002 3300037418 Bacteria 2917
972 Ga0395900_0125132 3300037418 Bacteria 2636
973 Ga0395900_0132914 3300037418 Bacteria 2549
974 Ga0395900_0205192 3300037418 Bacteria 1992
975 Ga0395900_0257841 3300037418 Bacteria 1742
976 Ga0395900_0269161 3300037418 Bacteria 1699
977 Ga0395900_0371165 3300037418 Bacteria 1400
978 Ga0395900_0384959 3300037418 Bacteria 1370
979 Ga0395900_0386731 3300037418 Bacteria 1366
980 Ga0395900_0463214 3300037418 Bacteria 1222
981 Ga0395900_0526276 3300037418 Bacteria 1129
982 Ga0395900_0604491 3300037418 Bacteria 1037
983 Ga0395900_0628252 3300037418 Bacteria 1012
984 Ga0395900_1342416 3300037418 Bacteria 628
985 Ga0395898_0023412 3300037466 Bacteria 6242
986 Ga0395898_0028233 3300037466 Bacteria 5626
987 Ga0395898_0045064 3300037466 Bacteria 4336
988 Ga0395898_0050245 3300037466 Bacteria 4082
989 Ga0395898_0108329 3300037466 Bacteria 2664
990 Ga0395898_0154684 3300037466 Bacteria 2194
991 Ga0395898_0157120 3300037466 Bacteria 2175
992 Ga0395898_0308096 3300037466 Bacteria 1510
993 Ga0395898_0427465 3300037466 Bacteria 1262
994 Ga0395898_0479648 3300037466 Bacteria 1183
995 Ga0395898_0497490 3300037466 Bacteria 1159
996 Ga0395898_0560802 3300037466 Bacteria 1084
997 Ga0395898_0881407 3300037466 Bacteria 833
998 Ga0395898_0960307 3300037466 Bacteria 791
999 Ga0395898_1096862 3300037466 Bacteria 729
1000 Ga0395898_1242055 3300037466 Bacteria 675
1001 Ga0395898_1331178 3300037466 Unclassified 647
1002 Ga0395905_0000226 3300037471 Bacteria 85938
1003 Ga0395905_0002055 3300037471 Bacteria 22979
1004 Ga0395905_0002081 3300037471 Bacteria 22761
1005 Ga0395905_0003223 3300037471 Bacteria 17551
1006 Ga0395905_0004472 3300037471 Bacteria 14505
1007 Ga0395905_0008041 3300037471 Bacteria 10420
1008 Ga0395905_0010915 3300037471 Bacteria 8793
1009 Ga0395905_0012965 3300037471 Bacteria 8010
1010 Ga0395905_0022794 3300037471 Bacteria 5920
1011 Ga0395905_0028444 3300037471 Bacteria 5270
1012 Ga0395905_0033598 3300037471 Bacteria 4817
1013 Ga0395905_0040985 3300037471 Bacteria 4344
1014 Ga0395905_0046615 3300037471 Bacteria 4064
1015 Ga0395905_0060052 3300037471 Bacteria 3555
1016 Ga0395905_0066467 3300037471 Bacteria 3376
1017 Ga0395905_0067275 3300037471 Bacteria 3355
1018 Ga0395905_0079251 3300037471 Bacteria 3078
1019 Ga0395905_0109977 3300037471 Bacteria 2588
1020 Ga0395905_0177684 3300037471 Bacteria 1998
1021 Ga0395905_0185695 3300037471 Bacteria 1951
1022 Ga0395905_0265267 3300037471 Bacteria 1603
1023 Ga0395905_0345920 3300037471 Bacteria 1378
1024 Ga0395905_0442242 3300037471 Bacteria 1197
1025 Ga0395905_0550308 3300037471 Bacteria 1055
1026 Ga0395905_0644168 3300037471 Bacteria 961
1027 Ga0395905_0666138 3300037471 Bacteria 943
1028 Ga0395905_0961706 3300037471 Unclassified 757
1029 Ga0395905_0971405 3300037471 Bacteria 752
1030 Ga0395905_1031932 3300037471 Bacteria 725
1031 Ga0395905_1340390 3300037471 Bacteria 619
1032 Ga0395905_1741497 3300037471 Bacteria 528
1033 Ga0395901_0002307 3300038443 Bacteria 19441
1034 Ga0395901_0005438 3300038443 Bacteria 12892
1035 Ga0395901_0027243 3300038443 Bacteria 5871
1036 Ga0395901_0029844 3300038443 Bacteria 5616
1037 Ga0395901_0034041 3300038443 Bacteria 5260
1038 Ga0395901_0071588 3300038443 Bacteria 3613
1039 Ga0395901_0078833 3300038443 Bacteria 3439
1040 Ga0395901_0101121 3300038443 Bacteria 3025
1041 Ga0395901_0190558 3300038443 Bacteria 2150
1042 Ga0395901_0259230 3300038443 Bacteria 1810
1043 Ga0395901_0272672 3300038443 Bacteria 1759
1044 Ga0395901_0335088 3300038443 Bacteria 1563
1045 Ga0395901_0347938 3300038443 Bacteria 1530
1046 Ga0395901_0441822 3300038443 Bacteria 1331
1047 Ga0395901_0489935 3300038443 Bacteria 1253
1048 Ga0395901_0573362 3300038443 Bacteria 1141
1049 Ga0395901_0591328 3300038443 Bacteria 1120
1050 Ga0395901_0617276 3300038443 Bacteria 1091
1051 Ga0395901_0639986 3300038443 Bacteria 1068
1052 Ga0395901_0730601 3300038443 Bacteria 985
1053 Ga0395901_0817557 3300038443 Bacteria 919
1054 Ga0395901_0846330 3300038443 Bacteria 900
1055 Ga0395901_0905693 3300038443 Bacteria 863
1056 Ga0395901_1107519 3300038443 Bacteria 762
1057 Ga0395901_1272783 3300038443 Bacteria 698
1058 Ga0395901_2019702 3300038443 Bacteria 522
1059 Ga0395901_2038699 3300038443 Bacteria 519
1060 Ga0439439_0052616 3300041406 Bacteria 1070
1061 Ga0439465_0055202 3300041413 Bacteria 1308
1062 Ga0451804_0612306 3300041463 Bacteria 543
1063 Ga0451849_0741623 3300041505 Bacteria 1283
1064 Ga0439432_140621 3300042006 Bacteria 710
1065 Ga0439449_0016067 3300042007 Bacteria 2815
1066 Ga0439462_0104184 3300042015 Bacteria 783
1067 Ga0450890_016729 3300042127 Bacteria 973
1068 Ga0450892_026128 3300042130 Bacteria 595
1069 Ga0450898_052658 3300042134 Bacteria 789
1070 Ga0450889_000363 3300042144 Bacteria 5033
1071 Ga0439458_0000109 3300042157 Bacteria 16485
1072 Ga0439458_0117731 3300042157 Bacteria 698
1073 Ga0466972_0113240 3300044658 Bacteria 1281
1074 Ga0466972_0278629 3300044658 Bacteria 781
1075 Ga0466972_0285294 3300044658 Bacteria 771
1076 Ga0466966_0031546 3300044684 Bacteria 3436
1077 Ga0466966_0038794 3300044684 Bacteria 3067
1078 Ga0466966_0088771 3300044684 Bacteria 1921
1079 Ga0466966_0255351 3300044684 Bacteria 1056
1080 Ga0466966_0457666 3300044684 Bacteria 767
1081 Ga0466966_0801459 3300044684 Unclassified 568
1082 Ga0466966_0854787 3300044684 Bacteria 548
1083 Ga0466961_0029959 3300044693 Bacteria 3496
1084 Ga0466961_0036378 3300044693 Bacteria 3160
1085 Ga0466961_0090190 3300044693 Bacteria 1936
1086 Ga0466961_0129893 3300044693 Unclassified 1579
1087 Ga0466961_0823796 3300044693 Bacteria 554
1088 Ga0466963_0052851 3300044694 Bacteria 2696
1089 Ga0466963_0116631 3300044694 Bacteria 1835
1090 Ga0466963_1231389 3300044694 Bacteria 526
1091 Ga0466964_0008959 3300044706 Unclassified 3765
1092 Ga0466964_0040750 3300044706 Bacteria 1876
1093 Ga0453684_0769278 3300044712 Bacteria 1041
1094 Ga0466971_0011770 3300044719 Bacteria 3832
1095 Ga0466971_0047748 3300044719 Bacteria 1925
1096 Ga0466968_0003696 3300044735 Bacteria 5678
1097 Ga0466970_0010711 3300044765 Bacteria 4660
1098 Ga0466970_0020923 3300044765 Bacteria 3405
1099 Ga0466970_0559146 3300044765 Bacteria 661
1100 Ga0466957_0074344 3300044842 Bacteria 2107
1101 Ga0466957_0152063 3300044842 Bacteria 1497
1102 Ga0466957_0266612 3300044842 Unclassified 1142
1103 Ga0466957_0684695 3300044842 Bacteria 723
1104 Ga0466957_1113998 3300044842 Bacteria 569
1105 Ga0466960_0006242 3300044901 Bacteria 4773
1106 Ga0466959_0014316 3300045049 Bacteria 5758
1107 Ga0466959_0032757 3300045049 Bacteria 3847
1108 Ga0466959_0076076 3300045049 Bacteria 2424
1109 Ga0466959_0267104 3300045049 Bacteria 1177
1110 Ga0466958_0030281 3300045836 Bacteria 3213
1111 Ga0466958_0043033 3300045836 Bacteria 2719
1112 Ga0466958_0132253 3300045836 Bacteria 1567
1113 Ga0466958_0234579 3300045836 Bacteria 1172
1114 Ga0466967_0094534 3300045976 Bacteria 2722
1115 Ga0466967_0107074 3300045976 Bacteria 2564
1116 Ga0466967_0841788 3300045976 Bacteria 911
1117 Ga0466967_1106686 3300045976 Bacteria 789
1118 Ga0495629_0793220 3300046459 Bacteria 625
1119 Ga0495638_0000414 3300046460 Bacteria 51945
1120 Ga0495638_0640814 3300046460 Bacteria 517
1121 Ga0495584_0306754 3300046491 Bacteria 806
1122 Ga0495585_0068810 3300046492 Bacteria 1933
1123 Ga0495583_0039381 3300046506 Bacteria 2227
1124 Ga0495606_0275530 3300046507 Bacteria 922
1125 Ga0495616_0125890 3300046513 Bacteria 1178
1126 Ga0495631_0208071 3300046518 Bacteria 836
1127 Ga0495632_0185176 3300046519 Bacteria 953
1128 Ga0495643_0394341 3300046522 Bacteria 612
1129 Ga0495644_0163645 3300046523 Bacteria 853
1130 Ga0495663_0014797 3300046525 Bacteria 2191
1131 Ga0495663_0017558 3300046525 Bacteria 2032
1132 Ga0495663_0208793 3300046525 Bacteria 683
1133 Ga0495663_0271318 3300046525 Bacteria 606
1134 Ga0495642_0027521 3300046528 Bacteria 2263
1135 Ga0495642_0245749 3300046528 Bacteria 782
1136 Ga0495654_0287451 3300046530 Bacteria 675
1137 Ga0495621_0000572 3300046539 Bacteria 9176
1138 Ga0495621_0027614 3300046539 Bacteria 1923
1139 Ga0495621_0216800 3300046539 Bacteria 774
1140 Ga0495597_0224296 3300046542 Bacteria 745
1141 Ga0495633_0003479 3300046558 Bacteria 10471
1142 Ga0495633_0134415 3300046558 Bacteria 1144
1143 Ga0495668_0036250 3300046616 Bacteria 2763
1144 Ga0495668_0189735 3300046616 Bacteria 1126
1145 Ga0495668_0416051 3300046616 Bacteria 739
1146 Ga0495668_0654013 3300046616 Bacteria 581
1147 Ga0495625_0000492 3300046660 Bacteria 59211
1148 Ga0495625_0033466 3300046660 Bacteria 3801
1149 Ga0495625_0422342 3300046660 Bacteria 829
1150 Ga0495659_0192372 3300046664 Bacteria 834
1151 Ga0495661_0179032 3300046665 Bacteria 1125
1152 Ga0495669_0000089 3300046684 Bacteria 60373
1153 Ga0495669_0000774 3300046684 Bacteria 13678
1154 Ga0495669_0009907 3300046684 Bacteria 4028
1155 Ga0495669_0032669 3300046684 Bacteria 2288
1156 Ga0495669_0543205 3300046684 Bacteria 565
1157 Ga0495670_0697577 3300046691 Bacteria 554
1158 Ga0495600_0893008 3300046809 Bacteria 525
1159 Ga0495683_0263568 3300047323 Bacteria 752
1160 Ga0495683_0304414 3300047323 Bacteria 684
1161 Ga0495677_0008344 3300047445 Bacteria 3851
1162 Ga0495677_0010499 3300047445 Bacteria 3399
1163 Ga0495677_0442256 3300047445 Bacteria 515
1164 Ga0495685_031991 3300047447 Bacteria 1808
1165 Ga0496100_0008265 3300048903 Bacteria 5798
1166 Ga0496100_0036550 3300048903 Bacteria 3099
1167 Ga0496101_0012014 3300048904 Bacteria 5771
1168 Ga0496101_0114186 3300048904 Bacteria 2036
1169 Ga0496101_0259583 3300048904 Bacteria 1355
1170 Ga0496102_0189683 3300048905 Bacteria 1937
1171 Ga0496103_0152524 3300048906 Bacteria 1480
1172 Ga0496103_0374618 3300048906 Bacteria 915
1173 Ga0496104_0102305 3300048907 Bacteria 2744
1174 Ga0496104_0235499 3300048907 Bacteria 1743
1175 Ga0496105_0465532 3300048908 Bacteria 996
1176 Ga0496105_0854876 3300048908 Bacteria 688
1177 Ga0496106_0033725 3300048909 Bacteria 3821
1178 Ga0496106_0210288 3300048909 Bacteria 1550
1179 Ga0496106_0942115 3300048909 Bacteria 681
1180 Ga0496106_1095845 3300048909 Bacteria 624
1181 Ga0496107_0012597 3300048910 Bacteria 5904
1182 Ga0496107_0028631 3300048910 Bacteria 3960
1183 Ga0496107_0216666 3300048910 Bacteria 1424
1184 Ga0496107_0703464 3300048910 Bacteria 743
1185 Ga0496108_0000297 3300048911 Bacteria 42741
1186 Ga0496108_0019987 3300048911 Bacteria 5502
1187 Ga0496108_0020041 3300048911 Bacteria 5496
1188 Ga0496108_0084419 3300048911 Bacteria 2695
1189 Ga0496109_0090892 3300048912 Bacteria 2823
1190 Ga0496109_0699248 3300048912 Bacteria 951
1191 Ga0496109_0894493 3300048912 Bacteria 826
1192 Ga0496110_0001178 3300048913 Bacteria 18586
1193 Ga0496110_0010023 3300048913 Bacteria 7688
1194 Ga0496111_0000420 3300048914 Bacteria 21379
1195 Ga0496111_0013922 3300048914 Bacteria 5484
1196 Ga0496112_0000950 3300048915 Bacteria 21045
1197 Ga0496112_0003824 3300048915 Bacteria 12577
1198 Ga0496112_0016452 3300048915 Bacteria 6929
1199 Ga0496112_0383577 3300048915 Bacteria 1346
1200 Ga0496113_0000977 3300048916 Bacteria 15240
1201 Ga0496113_0008494 3300048916 Bacteria 6695
1202 Ga0496113_0644144 3300048916 Bacteria 847
1203 Ga0496114_0539718 3300048917 Bacteria 1031
1204 Ga0501292_069994 3300049515 Bacteria 651
1205 Ga0501034_0287763 3300049571 Bacteria 1582
1206 Ga0501067_0176356 3300049583 Bacteria 1190
1207 Ga0501069_0284271 3300049585 Bacteria 968
1208 Ga0501069_0517108 3300049585 Bacteria 713
1209 Ga0501071_1112016 3300049587 Bacteria 610
1210 Ga0501072_0391957 3300049588 Bacteria 1102
1211 Ga0501074_1051458 3300049590 Bacteria 572
1212 Ga0501075_0345485 3300049591 Bacteria 1134
1213 Ga0501076_0058509 3300049592 Bacteria 3064
1214 Ga0501199_007709 3300049650 Unclassified 1116
1215 Ga0501201_044894 3300049651 Bacteria 539
1216 Ga0501202_073618 3300049652 Bacteria 792
1217 Ga0501207_060351 3300049654 Bacteria 694
1218 Ga0501207_116395 3300049654 Bacteria 551
1219 Ga0501216_186229 3300049660 Bacteria 508
1220 Ga0501217_271747 3300049661 Bacteria 552
1221 Ga0501233_022419 3300049668 Bacteria 1364
1222 Ga0501242_047442 3300049674 Bacteria 622
1223 Ga0501247_014714 3300049677 Bacteria 972
1224 Ga0501249_053692 3300049679 Bacteria 927
1225 Ga0501257_042440 3300049686 Bacteria 1119
1226 Ga0501257_081862 3300049686 Bacteria 833
1227 Ga0501225_0109004 3300049705 Bacteria 815
1228 Ga0501234_009354 3300049707 Bacteria 1528
1229 Ga0501079_0133294 3300049741 Bacteria 1934
1230 Ga0501080_0339563 3300049742 Bacteria 1357
1231 Ga0501263_007011 3300049760 Bacteria 1316
1232 Ga0501267_032112 3300049764 Bacteria 623
1233 Ga0501268_007619 3300049765 Bacteria 1618
1234 Ga0501268_013292 3300049765 Bacteria 1328
1235 Ga0501268_161148 3300049765 Bacteria 523
1236 Ga0501270_002423 3300049767 Bacteria 1910
1237 Ga0501270_120911 3300049767 Bacteria 570
1238 nmdc:mga05p37_1398406_c1 3300050507 Bacteria 705
1239 nmdc:mga08y16_351005_c1 3300050511 Bacteria 1515
1240 nmdc:mga0n895_279679_c1 3300050512 Bacteria 1692
1241 nmdc:mga0n895_918533_c1 3300050512 Bacteria 860
1242 nmdc:mga0rr50_182010_c1 3300050513 Bacteria 1718
1243 nmdc:mga0rr50_392164_c1 3300050513 Bacteria 1172
1244 nmdc:mga0a205_537128_c1 3300050515 Bacteria 1025
1245 nmdc:mga0a205_7550_c1 3300050515 Bacteria 9853
1246 Ga0495655_0127137 3300053083 Bacteria 781
1247 Ga0500643_003526 3300053087 Bacteria 7474
1248 Ga0500594_0033803 3300053118 Bacteria 1362
1249 Ga0500652_187055 3300053131 Bacteria 846
1250 Ga0500559_0022946 3300053136 Bacteria 2648
1251 Ga0500645_070666 3300053730 Bacteria 1002
1252 Ga0590071_050640 3300059421 Bacteria 1007
1253 Ga0590075_041990 3300059424 Bacteria 1169
1254 Ga0590077_174751 3300059426 Bacteria 517
1255 Ga0501082_0998559 3300060353 Bacteria 732
1256 Ga0466962_0024850 3300061719 Unclassified 2876
1257 Ga0466962_0223015 3300061719 Bacteria 923
1258 Ga0530510_0872073 3300061734 Bacteria 688
1259 Ga0207671_10461921
1260 JGI24752J21851_1041341
1261 JGI24740J21852_10031784
1262 JGI24739J22299_10004910
1263 JGI24739J22299_10011675
1264 JGI24737J22298_10002269
1265 JGI24737J22298_10006441
1266 JGI24737J22298_10061630
1267 JGI24743J22301_10004677
1268 JGI24743J22301_10020903
1269 JGI24743J22301_10023416
1270 JGI24735J21928_10138376
1271 JGI24735J21928_10180733
1272 JGI24738J21930_10056125
1273 JGI24738J21930_10091567
1274 JGI24744J21845_10000087
1275 JGI24034J26672_10044209
1276 rootH2_10079461
1277 Ga0058862_12767607
1278 Ga0065712_10077034
1279 Ga0065712_10823327
1280 Ga0065712_10825305
1281 Ga0065715_10117758
1282 Ga0065715_10322600
1283 Ga0065715_10469900
1284 Ga0065715_11091879
1285 Ga0070658_10006725
1286 Ga0070658_10016331
1287 Ga0070658_10086977
1288 Ga0070658_10094600
1289 Ga0070658_10140523
1290 Ga0070658_10188570
1291 Ga0070658_10202829
1292 Ga0070658_10239086
1293 Ga0070658_10250185
1294 Ga0070658_10554731
1295 Ga0070658_10622607
1296 Ga0070658_10776017
1297 Ga0070676_10296333
1298 Ga0070676_10408267
1299 Ga0070676_10487684
1300 Ga0070676_10755808
1301 Ga0070683_100421659
1302 Ga0070683_100523245
1303 Ga0070683_100560931
1304 Ga0070683_101602869
1305 Ga0070683_101760148
1306 Ga0070690_100031729
1307 Ga0070690_101530271
1308 Ga0070670_100010583
1309 Ga0070670_100013288
1310 Ga0070670_100059044
1311 Ga0070670_100098904
1312 Ga0070670_100372673
1313 Ga0070670_100651589
1314 Ga0070670_100780385
1315 Ga0070670_101288067
1316 Ga0070670_101316083
1317 Ga0070670_101360573
1318 Ga0068869_100017638
1319 Ga0070666_10007976
1320 Ga0070666_10021968
1321 Ga0070666_10074454
1322 Ga0070666_10122691
1323 Ga0070680_100002487
1324 Ga0070680_100005700
1325 Ga0070680_100015150
1326 Ga0070680_100207521
1327 Ga0070680_100511525
1328 Ga0070680_100542631
1329 Ga0070680_100881351
1330 Ga0070682_100387045
1331 Ga0070682_100426866
1332 Ga0068868_100095117
1333 Ga0068868_100542981
1334 Ga0068868_100584740
1335 Ga0068868_100789992
1336 Ga0068868_101203605
1337 Ga0070660_100008889
1338 Ga0070660_100019740
1339 Ga0070660_100052961
1340 Ga0070660_100080389
1341 Ga0070660_100111059
1342 Ga0070660_100114493
1343 Ga0070660_100168710
1344 Ga0070660_100179712
1345 Ga0070660_100197132
1346 Ga0070660_100232272
1347 Ga0070660_100236701
1348 Ga0070660_100322372
1349 Ga0070660_100632308
1350 Ga0070660_100635338
1351 Ga0070660_100898069
1352 Ga0070689_101238570
1353 Ga0070691_10772704
1354 Ga0070687_100631028
1355 Ga0070687_100952599
1356 Ga0070661_100043226
1357 Ga0070661_100053318
1358 Ga0070661_100154741
1359 Ga0070661_100363049
1360 Ga0070661_100823986
1361 Ga0070661_101195276
1362 Ga0070692_10061213
1363 Ga0070692_10121549
1364 Ga0070668_100025208
1365 Ga0070668_100543885
1366 Ga0070668_100781314
1367 Ga0070668_101790926
1368 Ga0070669_100075622
1369 Ga0070669_100234386
1370 Ga0070669_100449787
1371 Ga0070669_101646752
1372 Ga0070675_100032255
1373 Ga0070675_100037831
1374 Ga0070675_100038284
1375 Ga0070675_100387128
1376 Ga0070675_100393008
1377 Ga0070675_101245918
1378 Ga0070675_101318839
1379 Ga0070671_100001153
1380 Ga0070671_100042899
1381 Ga0070671_100179642
1382 Ga0070671_100274703
1383 Ga0070671_100951039
1384 Ga0070671_101014010
1385 Ga0070674_100093447
1386 Ga0070674_100152339
1387 Ga0070674_100642910
1388 Ga0070674_100959579
1389 Ga0070673_100066358
1390 Ga0070673_100262580
1391 Ga0070673_100287322
1392 Ga0070673_100316579
1393 Ga0070673_100391619
1394 Ga0070673_100452240
1395 Ga0070673_100458048
1396 Ga0070673_100839998
1397 Ga0070659_100004455
1398 Ga0070659_100004654
1399 Ga0070659_100005251
1400 Ga0070659_100014684
1401 Ga0070659_100020613
1402 Ga0070659_100021887
1403 Ga0070659_100029848
1404 Ga0070659_100034052
1405 Ga0070659_100048977
1406 Ga0070659_100064921
1407 Ga0070659_100070020
1408 Ga0070659_100070098
1409 Ga0070659_100156877
1410 Ga0070659_100164806
1411 Ga0070659_100278415
1412 Ga0070659_100419144
1413 Ga0070659_100430464
1414 Ga0070659_100696018
1415 Ga0070659_100750306
1416 Ga0070659_100980522
1417 Ga0070659_101513882
1418 Ga0070659_101574052
1419 Ga0070659_101631542
1420 Ga0070659_101826584
1421 Ga0070667_100007684
1422 Ga0070667_100041106
1423 Ga0070667_100350823
1424 Ga0070667_100512222
1425 Ga0070667_100548412
1426 Ga0070667_101455760
1427 Ga0070709_10460787
1428 Ga0070714_100068611
1429 Ga0070714_101091631
1430 Ga0070713_100079243
1431 Ga0070701_10172915
1432 Ga0070694_100038036
1433 Ga0070663_100008628
1434 Ga0070663_100073842
1435 Ga0070663_100101372
1436 Ga0070663_100135816
1437 Ga0070663_100313197
1438 Ga0070663_100337999
1439 Ga0070663_100394814
1440 Ga0070663_100667727
1441 Ga0070663_101167232
1442 Ga0070678_100112791
1443 Ga0070678_100240079
1444 Ga0070678_100968566
1445 Ga0070678_101193939
1446 Ga0070662_100006323
1447 Ga0070662_100019424
1448 Ga0070662_100056943
1449 Ga0070662_100070374
1450 Ga0070662_100091889
1451 Ga0070662_100113338
1452 Ga0070662_100115618
1453 Ga0070662_100118385
1454 Ga0070662_100148358
1455 Ga0070662_100233401
1456 Ga0070662_100578726
1457 Ga0070662_100761220
1458 Ga0070662_101300169
1459 Ga0070681_10010659
1460 Ga0070681_10316716
1461 Ga0070681_10919283
1462 Ga0070681_11421456
1463 Ga0068867_100012499
1464 Ga0068867_100367189
1465 Ga0068867_102014150
1466 Ga0070679_100008460
1467 Ga0070679_100030956
1468 Ga0070679_100263683
1469 Ga0070679_100294356
1470 Ga0070679_100417730
1471 Ga0070679_101032138
1472 Ga0068853_100020764
1473 Ga0068853_100035886
1474 Ga0068853_100110530
1475 Ga0068853_100206660
1476 Ga0068853_100300250
1477 Ga0068853_100387693
1478 Ga0070672_100061095
1479 Ga0070672_100128122
1480 Ga0070672_100287947
1481 Ga0070672_100311534
1482 Ga0070672_100447343
1483 Ga0070672_101044707
1484 Ga0070672_101138225
1485 Ga0070672_101262491
1486 Ga0070672_101269775
1487 Ga0070686_101458122
1488 Ga0070695_100181507
1489 Ga0070695_100476950
1490 Ga0070696_100260569
1491 Ga0070696_100350470
1492 Ga0070693_100232002
1493 Ga0070693_100541852
1494 Ga0070665_100018073
1495 Ga0070665_100020398
1496 Ga0070665_100213924
1497 Ga0070665_100285026
1498 Ga0070665_100337484
1499 Ga0070665_102317838
1500 Ga0070704_100174703
1501 Ga0070704_100753309
1502 Ga0068855_100053841
1503 Ga0068855_100164277
1504 Ga0068855_100186507
1505 Ga0068855_100281782
1506 Ga0068855_100284017
1507 Ga0068855_100587348
1508 Ga0068855_100826559
1509 Ga0070664_100019497
1510 Ga0070664_100051422
1511 Ga0070664_100414823
1512 Ga0070664_100773561
1513 Ga0070664_101569364
1514 Ga0068857_100006686
1515 Ga0068857_100123307
1516 Ga0068857_101131626
1517 Ga0068854_100063884
1518 Ga0068854_100199678
1519 Ga0068854_100251725
1520 Ga0068854_100390765
1521 Ga0068854_100629572
1522 Ga0068854_100959723
1523 Ga0068854_102202230
1524 Ga0068856_100062897
1525 Ga0068856_100081122
1526 Ga0068856_100173068
1527 Ga0068856_100420872
1528 Ga0068856_100520659
1529 Ga0068856_100576942
1530 Ga0068852_100001683
1531 Ga0068852_100003961
1532 Ga0068852_100048353
1533 Ga0068852_100112412
1534 Ga0068852_100118212
1535 Ga0068852_100157103
1536 Ga0068852_100434607
1537 Ga0068852_100450433
1538 Ga0068852_100552651
1539 Ga0068852_100759856
1540 Ga0068852_100861452
1541 Ga0068852_101150429
1542 Ga0068852_101325103
1543 Ga0068852_101507521
1544 Ga0068852_102369577
1545 Ga0068852_102424199
1546 Ga0068859_100103540
1547 Ga0068859_100302971
1548 Ga0068859_101224022
1549 Ga0068859_102356268
1550 Ga0068864_100003892
1551 Ga0068864_100006964
1552 Ga0068864_100104628
1553 Ga0068864_100147512
1554 Ga0068864_100253493
1555 Ga0068864_100472777
1556 Ga0068864_102631126
1557 Ga0068866_10032784
1558 Ga0068866_10396745
1559 Ga0068866_10436822
1560 Ga0068861_100241524
1561 Ga0068861_100602915
1562 Ga0068861_102363751
1563 Ga0068851_10041206
1564 Ga0068851_10252513
1565 Ga0068870_10020264
1566 Ga0068863_100017219
1567 Ga0068863_100019578
1568 Ga0068863_100068479
1569 Ga0068863_101731580
1570 Ga0068863_102499302
1571 Ga0068858_100057665
1572 Ga0068858_100123919
1573 Ga0068858_100285624
1574 Ga0068858_100425630
1575 Ga0068858_100602248
1576 Ga0068860_100004855
1577 Ga0068860_100204706
1578 Ga0068860_100809219
1579 Ga0068860_101420615
1580 Ga0068862_100085609
1581 Ga0068862_100282557
1582 Ga0068862_100308013
1583 Ga0068862_101780324
1584 Ga0068862_101893393
1585 Ga0068862_102686477
1586 Ga0081539_10009840
1587 Ga0070717_10008955
1588 Ga0070717_10382590
1589 Ga0070716_100267273
1590 Ga0075366_10269456
1591 Ga0075366_10447774
1592 Ga0097621_100099081
1593 Ga0068871_100143112
1594 Ga0068871_100281119
1595 Ga0068871_100580778
1596 Ga0068871_101604575
1597 Ga0075428_100703050
1598 Ga0075428_101036055
1599 Ga0075431_101447251
1600 Ga0075433_10401208
1601 Ga0075433_10662056
1602 Ga0075434_101005592
1603 Ga0068865_100039406
1604 Ga0068865_100643074
1605 Ga0075436_100360608
1606 Ga0097620_100103537
1607 Ga0097620_100302994
1608 Ga0097620_101224140
1609 Ga0097620_102355511
1610 Ga0075435_100215952
1611 Ga0105244_10152633
1612 Ga0105250_10293854
1613 Ga0105240_10090604
1614 Ga0105240_10104097
1615 Ga0105240_11127909
1616 Ga0105240_11192091
1617 Ga0111539_10010849
1618 Ga0105245_10073088
1619 Ga0105245_10106799
1620 Ga0105245_10143507
1621 Ga0105245_10203025
1622 Ga0105247_10105862
1623 Ga0114129_11113278
1624 Ga0105243_10971779
1625 Ga0105243_11242770
1626 Ga0105241_10157434
1627 Ga0105241_10385695
1628 Ga0105242_10158501
1629 Ga0105242_10283484
1630 Ga0105242_10349630
1631 Ga0105248_10000660
1632 Ga0105248_10025331
1633 Ga0105248_10045390
1634 Ga0105248_10086790
1635 Ga0105248_10711001
1636 Ga0105248_10912102
1637 Ga0105248_10947027
1638 Ga0105248_11985644
1639 Ga0105248_13049804
1640 Ga0105237_10838629
1641 Ga0105238_10066506
1642 Ga0105238_10156150
1643 Ga0105238_11316653
1644 Ga0105249_10126929
1645 Ga0105249_11205544
1646 Ga0105249_11967939
1647 Ga0105239_10122079
1648 Ga0105239_10533321
1649 Ga0105239_11678206
1650 Ga0105239_11891652
1651 Ga0105246_10038843
1652 Ga0105246_11056400
1653 Ga0157373_10016504
1654 Ga0157373_10019454
1655 Ga0157373_10053919
1656 Ga0157373_10117797
1657 Ga0157373_10124874
1658 Ga0157373_10149016
1659 Ga0157373_10162230
1660 Ga0157373_10386032
1661 Ga0157373_10435616
1662 Ga0157373_10798530
1663 Ga0157373_10871722
1664 Ga0157373_11118314
1665 Ga0157373_11225380
1666 Ga0157373_11316979
1667 Ga0157371_10034998
1668 Ga0157371_10045480
1669 Ga0157371_10079143
1670 Ga0157371_10080544
1671 Ga0157371_10086284
1672 Ga0157371_10096033
1673 Ga0157371_10099998
1674 Ga0157371_10127697
1675 Ga0157371_10179782
1676 Ga0157371_10183631
1677 Ga0157371_10231519
1678 Ga0157371_10384545
1679 Ga0157371_10642570
1680 Ga0157371_10670711
1681 Ga0157371_10766178
1682 Ga0157370_10033272
1683 Ga0157370_10037156
1684 Ga0157370_10356065
1685 Ga0157370_10387559
1686 Ga0157370_10684941
1687 Ga0157370_10743535
1688 Ga0157370_10988149
1689 Ga0157369_10005909
1690 Ga0157369_10082841
1691 Ga0157369_10434869
1692 Ga0157369_10678398
1693 Ga0157369_11171087
1694 Ga0157369_12481470
1695 Ga0157374_10003253
1696 Ga0157374_10210622
1697 Ga0157374_10886619
1698 Ga0157374_11320735
1699 Ga0157374_11863627
1700 Ga0157374_12045918
1701 Ga0157374_12486981
1702 Ga0157374_12857405
1703 Ga0157378_10072817
1704 Ga0157378_10226881
1705 Ga0157378_10351594
1706 Ga0157378_10648454
1707 Ga0157378_10748863
1708 Ga0157378_11400184
1709 Ga0157378_12147829
1710 Ga0163162_10010838
1711 Ga0163162_10034039
1712 Ga0163162_10180332
1713 Ga0163162_10577786
1714 Ga0163162_11264950
1715 Ga0163162_11776614
1716 Ga0163162_12892209
1717 Ga0157372_10041199
1718 Ga0157372_10105309
1719 Ga0157372_10169113
1720 Ga0157372_10208959
1721 Ga0157372_10294174
1722 Ga0157372_10370395
1723 Ga0157372_10675155
1724 Ga0157372_10959711
1725 Ga0157372_11029943
1726 Ga0157375_10166856
1727 Ga0157375_10337121
1728 Ga0157375_10430163
1729 Ga0163163_10033987
1730 Ga0163163_10188909
1731 Ga0163163_10517654
1732 Ga0157380_10780533
1733 Ga0182008_10939305
1734 Ga0157377_10014489
1735 Ga0157377_10109292
1736 Ga0157377_10208064
1737 Ga0157377_10720386
1738 Ga0157379_10281987
1739 Ga0157379_10321885
1740 Ga0157379_11350338
1741 Ga0157379_11403357
1742 Ga0157376_10108918
1743 Ga0157376_10328453
1744 Ga0182007_10323846
1745 Ga0197907_11287558
1746 Ga0206349_1411556
1747 Ga0206355_1106287
1748 Ga0206351_10733585
1749 Ga0206350_10334419
1750 Ga0206354_10801876
1751 Ga0206354_10855847
1752 Ga0206353_11371573
1753 Ga0206353_11530823
1754 Ga0206353_11964301
1755 Ga0206353_12041288
1756 Ga0154015_1141618
1757 Ga0224712_10301845
1758 Ga0207697_10002198
1759 Ga0207697_10019446
1760 Ga0207697_10058146
1761 Ga0207697_10293835
1762 Ga0207697_10416741
1763 Ga0207656_10104433
1764 Ga0207656_10161383
1765 Ga0207655_1165709
1766 Ga0207682_10011777
1767 Ga0207682_10600774
1768 Ga0207642_10016251
1769 Ga0207642_10050630
1770 Ga0207710_10078831
1771 Ga0207710_10155287
1772 Ga0207688_10009422
1773 Ga0207688_10030882
1774 Ga0207688_10337055
1775 Ga0207688_10345340
1776 Ga0207680_10163350
1777 Ga0207680_10167100
1778 Ga0207647_10002633
1779 Ga0207647_10024599
1780 Ga0207647_10029015
1781 Ga0207647_10142593
1782 Ga0207647_10290513
1783 Ga0207645_10061899
1784 Ga0207645_10336630
1785 Ga0207645_10347716
1786 Ga0207645_10550085
1787 Ga0207645_10578605
1788 Ga0207645_10597177
1789 Ga0207643_10038094
1790 Ga0207705_10018659
1791 Ga0207705_10031804
1792 Ga0207705_10062623
1793 Ga0207705_10063179
1794 Ga0207705_10294781
1795 Ga0207705_10312429
1796 Ga0207705_10312826
1797 Ga0207705_10411730
1798 Ga0207705_10974060
1799 Ga0207705_10975464
1800 Ga0207705_11289101
1801 Ga0207705_11516354
1802 Ga0207654_10204310
1803 Ga0207654_11322473
1804 Ga0207707_10042825
1805 Ga0207707_10497305
1806 Ga0207707_10821861
1807 Ga0207707_10859485
1808 Ga0207695_10078395
1809 Ga0207695_11687208
1810 Ga0207660_10005019
1811 Ga0207660_10011295
1812 Ga0207660_10330147
1813 Ga0207660_10374232
1814 Ga0207660_10376975
1815 Ga0207660_10430534
1816 Ga0207662_10371778
1817 Ga0207662_10409074
1818 Ga0207662_10500832
1819 Ga0207657_10002179
1820 Ga0207657_10014760
1821 Ga0207657_10015699
1822 Ga0207657_10020632
1823 Ga0207657_10031438
1824 Ga0207657_10045664
1825 Ga0207657_10062053
1826 Ga0207657_10068468
1827 Ga0207657_10083246
1828 Ga0207657_10124685
1829 Ga0207657_10137070
1830 Ga0207657_10149735
1831 Ga0207657_10166084
1832 Ga0207649_10019441
1833 Ga0207649_10038455
1834 Ga0207649_10043321
1835 Ga0207649_10094685
1836 Ga0207649_10127974
1837 Ga0207649_10262459
1838 Ga0207649_10287775
1839 Ga0207649_10311193
1840 Ga0207649_10715660
1841 Ga0207649_10992930
1842 Ga0207652_10011538
1843 Ga0207652_10017787
1844 Ga0207652_10080707
1845 Ga0207652_10106943
1846 Ga0207652_10218264
1847 Ga0207652_10268927
1848 Ga0207652_10378562
1849 Ga0207652_10480076
1850 Ga0207681_10106940
1851 Ga0207681_10199184
1852 Ga0207681_10477972
1853 Ga0207681_10548209
1854 Ga0207681_11368667
1855 Ga0207694_10124178
1856 Ga0207694_10782639
1857 Ga0207694_11375407
1858 Ga0207650_10052989
1859 Ga0207650_10066817
1860 Ga0207650_10082758
1861 Ga0207650_10101595
1862 Ga0207650_10345032
1863 Ga0207650_10509238
1864 Ga0207650_10630437
1865 Ga0207650_10703187
1866 Ga0207650_11072842
1867 Ga0207650_11077280
1868 Ga0207650_11266642
1869 Ga0207659_10023658
1870 Ga0207659_10100473
1871 Ga0207659_10126379
1872 Ga0207659_10161321
1873 Ga0207659_10619891
1874 Ga0207687_10069593
1875 Ga0207687_10220615
1876 Ga0207687_10261879
1877 Ga0207687_11661713
1878 Ga0207700_10590375
1879 Ga0207664_10139058
1880 Ga0207664_10382532
1881 Ga0207664_10407777
1882 Ga0207664_11676426
1883 Ga0207644_10000358
1884 Ga0207644_10000415
1885 Ga0207644_10003915
1886 Ga0207644_10048669
1887 Ga0207644_10184752
1888 Ga0207644_10468000
1889 Ga0207644_11088780
1890 Ga0207644_11472711
1891 Ga0207644_11791932
1892 Ga0207690_10005597
1893 Ga0207690_10009277
1894 Ga0207690_10016900
1895 Ga0207690_10022602
1896 Ga0207690_10038521
1897 Ga0207690_10044284
1898 Ga0207690_10086626
1899 Ga0207690_10128251
1900 Ga0207690_10225206
1901 Ga0207690_10255300
1902 Ga0207690_10356323
1903 Ga0207690_10363873
1904 Ga0207690_10545244
1905 Ga0207690_10578370
1906 Ga0207690_10681369
1907 Ga0207690_10730690
1908 Ga0207690_11335492
1909 Ga0207706_10003298
1910 Ga0207706_10011160
1911 Ga0207706_10032025
1912 Ga0207706_10034511
1913 Ga0207706_10062759
1914 Ga0207706_10075560
1915 Ga0207706_10104621
1916 Ga0207706_10165875
1917 Ga0207706_10563052
1918 Ga0207706_10844342
1919 Ga0207706_11671535
1920 Ga0207686_10157965
1921 Ga0207686_10703627
1922 Ga0207709_11771843
1923 Ga0207669_10048374
1924 Ga0207669_10082622
1925 Ga0207669_10149834
1926 Ga0207669_10502897
1927 Ga0207704_10039312
1928 Ga0207704_10226361
1929 Ga0207665_10030997
1930 Ga0207691_10002039
1931 Ga0207691_10008814
1932 Ga0207691_10028711
1933 Ga0207691_10040667
1934 Ga0207691_11530883
1935 Ga0207711_10002381
1936 Ga0207711_10004092
1937 Ga0207711_10012307
1938 Ga0207711_10025986
1939 Ga0207711_10085965
1940 Ga0207711_10192872
1941 Ga0207711_10305382
1942 Ga0207711_10415523
1943 Ga0207711_10847379
1944 Ga0207689_10073008
1945 Ga0207689_10073615
1946 Ga0207661_10074011
1947 Ga0207661_10305159
1948 Ga0207661_11249016
1949 Ga0207679_10053217
1950 Ga0207679_10076401
1951 Ga0207679_10185494
1952 Ga0207679_10360790
1953 Ga0207679_10375991
1954 Ga0207679_10540745
1955 Ga0207679_10785935
1956 Ga0207679_11343538
1957 Ga0207679_11401616
1958 Ga0207679_11712322
1959 Ga0207667_10002612
1960 Ga0207667_10005995
1961 Ga0207667_10019409
1962 Ga0207667_10019667
1963 Ga0207667_10180615
1964 Ga0207667_10670058
1965 Ga0207667_10696421
1966 Ga0207667_11102500
1967 Ga0207667_11715540
1968 Ga0207651_10055211
1969 Ga0207651_10098848
1970 Ga0207651_10145031
1971 Ga0207651_10145930
1972 Ga0207651_10269846
1973 Ga0207651_10484649
1974 Ga0207651_10687455
1975 Ga0207651_10760739
1976 Ga0207651_11350066
1977 Ga0207712_10013315
1978 Ga0207712_11095604
1979 Ga0207712_11310183
1980 Ga0207668_10025749
1981 Ga0207668_10085046
1982 Ga0207668_11404270
1983 Ga0207640_10086017
1984 Ga0207640_10098720
1985 Ga0207640_10118614
1986 Ga0207640_10121884
1987 Ga0207640_10554053
1988 Ga0207640_11550491
1989 Ga0207640_11857299
1990 Ga0207658_10047181
1991 Ga0207658_10089985
1992 Ga0207658_10539832
1993 Ga0207658_10881206
1994 Ga0207658_11445001
1995 Ga0207658_11501247
1996 Ga0207677_10111420
1997 Ga0207677_10209566
1998 Ga0207677_10405454
1999 Ga0207677_10667523
2000 Ga0207677_10708699
2001 Ga0207677_10997508
2002 Ga0207703_10000593
2003 Ga0207703_10106781
2004 Ga0207703_10269579
2005 Ga0207703_10282020
2006 Ga0207703_10776805
2007 Ga0207639_10047241
2008 Ga0207639_10093915
2009 Ga0207639_10341120
2010 Ga0207639_10403711
2011 Ga0207639_10936784
2012 Ga0207678_10009013
2013 Ga0207678_10015421
2014 Ga0207678_10021391
2015 Ga0207678_10023390
2016 Ga0207678_10280135
2017 Ga0207678_10413599
2018 Ga0207678_10541212
2019 Ga0207678_10812438
2020 Ga0207702_10025805
2021 Ga0207702_11223340
2022 Ga0207702_11231392
2023 Ga0207702_11269948
2024 Ga0207702_11836677
2025 Ga0207641_10014381
2026 Ga0207641_10107436
2027 Ga0207641_10134341
2028 Ga0207648_10018551
2029 Ga0207648_10144548
2030 Ga0207676_10000253
2031 Ga0207676_10002138
2032 Ga0207676_10013212
2033 Ga0207676_10372243
2034 Ga0207676_10434331
2035 Ga0207676_11031946
2036 Ga0207676_12059379
2037 Ga0207674_10000086
2038 Ga0207674_10056635
2039 Ga0207674_10170758
2040 Ga0207674_10352142
2041 Ga0207674_12286999
2042 Ga0207675_100176499
2043 Ga0207675_102532408
2044 Ga0207675_102720569
2045 Ga0207683_10023087
2046 Ga0207683_10062138
2047 Ga0207683_10215180
2048 Ga0207698_10004003
2049 Ga0207698_10015624
2050 Ga0207698_10066765
2051 Ga0207698_10093885
2052 Ga0207698_10186138
2053 Ga0207698_10272391
2054 Ga0207698_10385650
2055 Ga0207698_10425964
2056 Ga0207698_10428235
2057 Ga0207698_11040457
2058 Ga0207698_11189151
2059 Ga0207698_11199699
2060 Ga0207698_11207895
2061 Ga0207698_11796903
2062 Ga0207698_12084935
2063 Ga0207698_12195405
2064 Ga0209974_10014706
2065 Ga0209974_10060947
2066 Ga0268266_10006627
2067 Ga0268266_10097239
2068 Ga0268266_10158893
2069 Ga0268266_10348028
2070 Ga0268266_10914496
2071 Ga0268266_11674690
2072 Ga0268266_11975434
2073 Ga0268265_10068082
2074 Ga0268265_10156078
2075 Ga0268265_10250856
2076 Ga0268265_11216133
2077 Ga0268265_12458134
2078 Ga0268264_10003670
2079 Ga0268264_10699908
2080 Ga0268264_11723001
2081 Ga0307515_10276095
2082 Ga0307512_10379751
2083 Ga0316178_1146043
2084 Ga0316183_1175925
2085 Ga0316182_1007628
2086 Ga0316182_1158440
2087 Ga0307513_10335593
2088 Ga0307408_100003350
2089 Ga0307408_100022223
2090 Ga0307408_100098065
2091 Ga0307408_100313957
2092 Ga0307408_100492278
2093 Ga0307408_100504885
2094 Ga0307408_100510975
2095 Ga0307408_100775106
2096 Ga0307405_10002088
2097 Ga0307405_10003714
2098 Ga0307405_10125688
2099 Ga0307405_10224308
2100 Ga0307405_10538742
2101 Ga0307405_10841415
2102 Ga0307405_11116431
2103 Ga0307413_10000292
2104 Ga0307413_10007028
2105 Ga0307413_10023501
2106 Ga0307413_10443662
2107 Ga0307413_11925158
2108 Ga0307410_10000652
2109 Ga0307410_10002064
2110 Ga0307410_10004898
2111 Ga0307410_10009431
2112 Ga0307410_10149451
2113 Ga0307410_10334473
2114 Ga0307410_10711956
2115 Ga0307410_11122974
2116 Ga0307406_10013035
2117 Ga0307406_10021311
2118 Ga0307406_10260752
2119 Ga0307406_11465758
2120 Ga0307406_11537438
2121 Ga0307407_10001061
2122 Ga0307407_10054848
2123 Ga0307407_10478454
2124 Ga0307407_10619267
2125 Ga0307407_10899838
2126 Ga0307407_10918381
2127 Ga0307412_10000248
2128 Ga0307412_10015741
2129 Ga0307412_10024386
2130 Ga0307412_10076520
2131 Ga0307412_10277426
2132 Ga0307409_100001918
2133 Ga0307409_100008269
2134 Ga0307409_100016302
2135 Ga0307409_100033607
2136 Ga0307409_100353438
2137 Ga0307409_100386207
2138 Ga0307409_100972384
2139 Ga0307409_101159634
2140 Ga0307409_101428688
2141 Ga0307409_101468712
2142 Ga0307409_101858789
2143 Ga0307409_102254000
2144 Ga0307416_100000366
2145 Ga0307416_100004414
2146 Ga0307416_100031319
2147 Ga0307416_100059570
2148 Ga0307416_101334855
2149 Ga0307416_101643088
2150 Ga0307416_101684733
2151 Ga0307416_101863556
2152 Ga0307416_102301647
2153 Ga0307416_102905091
2154 Ga0307416_103191715
2155 Ga0307416_103677914
2156 Ga0307414_10001973
2157 Ga0307414_10031755
2158 Ga0307414_10035399
2159 Ga0307414_10040212
2160 Ga0307414_10349806
2161 Ga0307414_10375350
2162 Ga0307414_10408860
2163 Ga0307414_10506226
2164 Ga0307414_11920635
2165 Ga0307414_12195756
2166 Ga0307414_12248660
2167 Ga0307411_10005103
2168 Ga0307411_10017878
2169 Ga0307411_10027320
2170 Ga0307411_10253104
2171 Ga0307411_10283559
2172 Ga0307411_10370297
2173 Ga0307411_10447155
2174 Ga0307411_10719351
2175 Ga0307411_11166504
2176 Ga0307411_11225315
2177 Ga0307411_11467211
2178 Ga0307411_11709456
2179 Ga0307415_100000909
2180 Ga0307415_100003550
2181 Ga0307415_100006114
2182 Ga0307415_100025925
2183 Ga0307415_100026424
2184 Ga0307415_100614844
2185 Ga0307415_100709070
2186 Ga0307415_100862737
2187 Ga0307415_101593134
2188 Ga0307415_102141504
2189 Ga0307510_10037783
2190 Ga0373929_0268380
2191 Ga0373936_0323372
2192 Ga0373939_0298294
2193 Ga0373943_0036995
2194 Ga0373946_0147448
2195 Ga0373955_0698063
2196 Ga0373962_0132219
2197 Ga0373931_0871600
2198 Ga0373931_1146033
2199 Ga0373927_0062157
2200 Ga0373947_0128573
2201 Ga0373947_1028497
2202 Ga0373925_0003304
2203 Ga0395899_0035436
2204 Ga0395899_0088857
2205 Ga0395899_0093762
2206 Ga0395899_0093985
2207 Ga0395899_0111186
2208 Ga0395899_0122242
2209 Ga0395899_0146922
2210 Ga0395899_0177583
2211 Ga0395899_0209374
2212 Ga0395899_0264116
2213 Ga0395899_0328894
2214 Ga0395899_0334855
2215 Ga0395899_0373184
2216 Ga0395899_0379768
2217 Ga0395899_0421723
2218 Ga0395900_0002700
2219 Ga0395900_0003041
2220 Ga0395900_0006151
2221 Ga0395900_0006393
2222 Ga0395900_0014124
2223 Ga0395900_0015350
2224 Ga0395900_0016814
2225 Ga0395900_0053670
2226 Ga0395900_0055842
2227 Ga0395900_0082848
2228 Ga0395900_0099913
2229 Ga0395900_0104002
2230 Ga0395900_0125132
2231 Ga0395900_0132914
2232 Ga0395900_0205192
2233 Ga0395900_0257841
2234 Ga0395900_0269161
2235 Ga0395900_0371165
2236 Ga0395900_0384959
2237 Ga0395900_0386731
2238 Ga0395900_0463214
2239 Ga0395900_0526276
2240 Ga0395900_0604491
2241 Ga0395900_0628252
2242 Ga0395900_1342416
2243 Ga0395898_0023412
2244 Ga0395898_0028233
2245 Ga0395898_0045064
2246 Ga0395898_0050245
2247 Ga0395898_0108329
2248 Ga0395898_0154684
2249 Ga0395898_0157120
2250 Ga0395898_0308096
2251 Ga0395898_0427465
2252 Ga0395898_0479648
2253 Ga0395898_0497490
2254 Ga0395898_0560802
2255 Ga0395898_0881407
2256 Ga0395898_0960307
2257 Ga0395898_1096862
2258 Ga0395898_1242055
2259 Ga0395898_1331178
2260 Ga0395905_0000226
2261 Ga0395905_0002055
2262 Ga0395905_0002081
2263 Ga0395905_0003223
2264 Ga0395905_0004472
2265 Ga0395905_0008041
2266 Ga0395905_0010915
2267 Ga0395905_0012965
2268 Ga0395905_0022794
2269 Ga0395905_0028444
2270 Ga0395905_0033598
2271 Ga0395905_0040985
2272 Ga0395905_0046615
2273 Ga0395905_0060052
2274 Ga0395905_0066467
2275 Ga0395905_0067275
2276 Ga0395905_0079251
2277 Ga0395905_0109977
2278 Ga0395905_0177684
2279 Ga0395905_0185695
2280 Ga0395905_0265267
2281 Ga0395905_0345920
2282 Ga0395905_0442242
2283 Ga0395905_0550308
2284 Ga0395905_0644168
2285 Ga0395905_0666138
2286 Ga0395905_0961706
2287 Ga0395905_0971405
2288 Ga0395905_1031932
2289 Ga0395905_1340390
2290 Ga0395905_1741497
2291 Ga0395901_0002307
2292 Ga0395901_0005438
2293 Ga0395901_0027243
2294 Ga0395901_0029844
2295 Ga0395901_0034041
2296 Ga0395901_0071588
2297 Ga0395901_0078833
2298 Ga0395901_0101121
2299 Ga0395901_0190558
2300 Ga0395901_0259230
2301 Ga0395901_0272672
2302 Ga0395901_0335088
2303 Ga0395901_0347938
2304 Ga0395901_0441822
2305 Ga0395901_0489935
2306 Ga0395901_0573362
2307 Ga0395901_0591328
2308 Ga0395901_0617276
2309 Ga0395901_0639986
2310 Ga0395901_0730601
2311 Ga0395901_0817557
2312 Ga0395901_0846330
2313 Ga0395901_0905693
2314 Ga0395901_1107519
2315 Ga0395901_1272783
2316 Ga0395901_2019702
2317 Ga0395901_2038699
2318 Ga0439439_0052616
2319 Ga0439465_0055202
2320 Ga0451804_0612306
2321 Ga0451849_0741623
2322 Ga0439432_140621
2323 Ga0439449_0016067
2324 Ga0439462_0104184
2325 Ga0450890_016729
2326 Ga0450892_026128
2327 Ga0450898_052658
2328 Ga0450889_000363
2329 Ga0439458_0000109
2330 Ga0439458_0117731
2331 Ga0466972_0113240
2332 Ga0466972_0278629
2333 Ga0466972_0285294
2334 Ga0466966_0031546
2335 Ga0466966_0038794
2336 Ga0466966_0088771
2337 Ga0466966_0255351
2338 Ga0466966_0457666
2339 Ga0466966_0801459
2340 Ga0466966_0854787
2341 Ga0466961_0029959
2342 Ga0466961_0036378
2343 Ga0466961_0090190
2344 Ga0466961_0129893
2345 Ga0466961_0823796
2346 Ga0466963_0052851
2347 Ga0466963_0116631
2348 Ga0466963_1231389
2349 Ga0466964_0008959
2350 Ga0466964_0040750
2351 Ga0453684_0769278
2352 Ga0466971_0011770
2353 Ga0466971_0047748
2354 Ga0466968_0003696
2355 Ga0466970_0010711
2356 Ga0466970_0020923
2357 Ga0466970_0559146
2358 Ga0466957_0074344
2359 Ga0466957_0152063
2360 Ga0466957_0266612
2361 Ga0466957_0684695
2362 Ga0466957_1113998
2363 Ga0466960_0006242
2364 Ga0466959_0014316
2365 Ga0466959_0032757
2366 Ga0466959_0076076
2367 Ga0466959_0267104
2368 Ga0466958_0030281
2369 Ga0466958_0043033
2370 Ga0466958_0132253
2371 Ga0466958_0234579
2372 Ga0466967_0094534
2373 Ga0466967_0107074
2374 Ga0466967_0841788
2375 Ga0466967_1106686
2376 Ga0495629_0793220
2377 Ga0495638_0000414
2378 Ga0495638_0640814
2379 Ga0495584_0306754
2380 Ga0495585_0068810
2381 Ga0495583_0039381
2382 Ga0495606_0275530
2383 Ga0495616_0125890
2384 Ga0495631_0208071
2385 Ga0495632_0185176
2386 Ga0495643_0394341
2387 Ga0495644_0163645
2388 Ga0495663_0014797
2389 Ga0495663_0017558
2390 Ga0495663_0208793
2391 Ga0495663_0271318
2392 Ga0495642_0027521
2393 Ga0495642_0245749
2394 Ga0495654_0287451
2395 Ga0495621_0000572
2396 Ga0495621_0027614
2397 Ga0495621_0216800
2398 Ga0495597_0224296
2399 Ga0495633_0003479
2400 Ga0495633_0134415
2401 Ga0495668_0036250
2402 Ga0495668_0189735
2403 Ga0495668_0416051
2404 Ga0495668_0654013
2405 Ga0495625_0000492
2406 Ga0495625_0033466
2407 Ga0495625_0422342
2408 Ga0495659_0192372
2409 Ga0495661_0179032
2410 Ga0495669_0000089
2411 Ga0495669_0000774
2412 Ga0495669_0009907
2413 Ga0495669_0032669
2414 Ga0495669_0543205
2415 Ga0495670_0697577
2416 Ga0495600_0893008
2417 Ga0495683_0263568
2418 Ga0495683_0304414
2419 Ga0495677_0008344
2420 Ga0495677_0010499
2421 Ga0495677_0442256
2422 Ga0495685_031991
2423 Ga0496100_0008265
2424 Ga0496100_0036550
2425 Ga0496101_0012014
2426 Ga0496101_0114186
2427 Ga0496101_0259583
2428 Ga0496102_0189683
2429 Ga0496103_0152524
2430 Ga0496103_0374618
2431 Ga0496104_0102305
2432 Ga0496104_0235499
2433 Ga0496105_0465532
2434 Ga0496105_0854876
2435 Ga0496106_0033725
2436 Ga0496106_0210288
2437 Ga0496106_0942115
2438 Ga0496106_1095845
2439 Ga0496107_0012597
2440 Ga0496107_0028631
2441 Ga0496107_0216666
2442 Ga0496107_0703464
2443 Ga0496108_0000297
2444 Ga0496108_0019987
2445 Ga0496108_0020041
2446 Ga0496108_0084419
2447 Ga0496109_0090892
2448 Ga0496109_0699248
2449 Ga0496109_0894493
2450 Ga0496110_0001178
2451 Ga0496110_0010023
2452 Ga0496111_0000420
2453 Ga0496111_0013922
2454 Ga0496112_0000950
2455 Ga0496112_0003824
2456 Ga0496112_0016452
2457 Ga0496112_0383577
2458 Ga0496113_0000977
2459 Ga0496113_0008494
2460 Ga0496113_0644144
2461 Ga0496114_0539718
2462 Ga0501292_069994
2463 Ga0501034_0287763
2464 Ga0501067_0176356
2465 Ga0501069_0284271
2466 Ga0501069_0517108
2467 Ga0501071_1112016
2468 Ga0501072_0391957
2469 Ga0501074_1051458
2470 Ga0501075_0345485
2471 Ga0501076_0058509
2472 Ga0501199_007709
2473 Ga0501201_044894
2474 Ga0501202_073618
2475 Ga0501207_060351
2476 Ga0501207_116395
2477 Ga0501216_186229
2478 Ga0501217_271747
2479 Ga0501233_022419
2480 Ga0501242_047442
2481 Ga0501247_014714
2482 Ga0501249_053692
2483 Ga0501257_042440
2484 Ga0501257_081862
2485 Ga0501225_0109004
2486 Ga0501234_009354
2487 Ga0501079_0133294
2488 Ga0501080_0339563
2489 Ga0501263_007011
2490 Ga0501267_032112
2491 Ga0501268_007619
2492 Ga0501268_013292
2493 Ga0501268_161148
2494 Ga0501270_002423
2495 Ga0501270_120911
2496 nmdc:mga05p37_1398406_c1
2497 nmdc:mga08y16_351005_c1
2498 nmdc:mga0n895_279679_c1
2499 nmdc:mga0n895_918533_c1
2500 nmdc:mga0rr50_182010_c1
2501 nmdc:mga0rr50_392164_c1
2502 nmdc:mga0a205_537128_c1
2503 nmdc:mga0a205_7550_c1
2504 Ga0495655_0127137
2505 Ga0500643_003526
2506 Ga0500594_0033803
2507 Ga0500652_187055
2508 Ga0500559_0022946
2509 Ga0500645_070666
2510 Ga0590071_050640
2511 Ga0590075_041990
2512 Ga0590077_174751
2513 Ga0501082_0998559
2514 Ga0466962_0024850
2515 Ga0466962_0223015
2516 Ga0530510_0872073

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01381

HTH_3

Helix-turn-helix

20

74

0.96

PF13443

HTH_26

Cro/C1-type HTH DNA-binding domain

19

78

0.96

PF12844

HTH_19

Helix-turn-helix domain

18

76

0.95

PF13560

HTH_31

Helix-turn-helix domain

18

74

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xi8-assembly1.cif.gz_A high resolution structure of native cylr2 0.9548 3 62
2xj3-assembly1.cif.gz_A high resolution structure of the t55c mutant of cylr2. 0.9526 3 62
3jxc-assembly1.cif.gz_L crystal structure of the p22 c2 repressor protein in complex with synthetic operator 9t in the presence of tl+ 0.9438 4 57
7nrd-assembly1.cif.gz_Sh structure of the yeast gcn1 bound to a colliding stalled 80s ribosome with mbf1, a/p-trna and p/e-trna 0.9328 5 52
2icp-assembly1.cif.gz_A crystal structure of the bacterial antitoxin higa from escherichia coli at ph 4.0. northeast structural genomics consortium target er390. 0.9247 6 52
ID Description Score Start End Superfamily
af_Q57720_1_65_1.10.260.40 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9983 1 62 1.10.260.40
3jxbD00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9434 4 57 1.10.260.40
2r1jL00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9422 4 57 1.10.260.40
af_Q57720_1_65_1.10.260.40 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.938 1 62 1.10.260.40
2kpjA01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9315 5 58 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A1I2MHZ6-F1-model_v4 Transcriptional regulator, XRE family 1.013 2 61 GO:0003677
AF-A0A1H9H2C8-F1-model_v4 Transcriptional regulator, XRE family 1.013 2 61 GO:0003677
AF-A0A7Y9SW35-F1-model_v4 DNA-binding XRE family transcriptional regulator 1.011 2 60 GO:0003677
AF-A0A519HVH0-F1-model_v4 Transcriptional regulator 1.01 1 62 GO:0003677
AF-A0A0R0AZF8-F1-model_v4 Cro/Cl family transcriptional regulator 1.01 1 62 GO:0003677

Map