F492258
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1256 | 465 | 1248 | 103 |
Family's Representative Sequence
| Representative Sequence | 3300009553|Ga0105249_10304390|Ga0105249_103043902 |
| Length | 120 |
| Sequence | LRRLSLSQEIFGNKESNMADPMRIRAQAAGDKTIVRVLMAHEMETGQRKDAAGKVIPAWYIQQVQAKLNGKDVLSAQWGPAVAKNPFLQFMIKGAKAGDKVSVSWVDNRGDTRSDEAVVT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 3 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 4 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 5 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 6 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 7 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 8 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003347 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM | Metagenome | Rhizosphere |
| 11 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 15 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 76 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 82 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 83 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 84 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 85 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 86 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 87 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 88 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 89 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 90 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 91 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 92 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 94 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 95 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 96 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 97 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 98 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 99 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 100 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 101 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 102 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 104 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 126 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 131 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 203 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 204 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 205 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 206 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 207 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 208 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 209 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 210 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 211 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 212 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 213 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 214 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 215 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 216 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 217 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 218 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 219 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 220 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 221 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 222 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 223 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 224 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 225 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 226 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 227 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 228 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 229 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 230 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 231 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 232 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 233 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 234 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 235 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 237 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 238 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 239 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 240 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 241 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 242 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 243 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 244 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 245 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 246 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 247 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 249 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 250 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 251 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 252 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 253 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 254 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 255 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 256 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 257 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 258 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 259 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 260 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 261 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 262 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 263 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 264 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 265 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 266 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 267 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 268 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 269 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 270 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 271 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 272 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 273 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 274 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 275 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 276 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 277 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 278 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 279 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 280 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 281 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 282 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 283 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 284 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 285 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 286 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 287 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 288 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 289 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 290 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 291 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 292 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 293 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 294 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 295 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 296 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 297 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 368 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 369 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 370 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 371 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 372 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 373 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 374 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 375 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 376 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 377 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 378 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 379 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 380 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 381 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 382 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 383 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 384 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 385 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 401 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 408 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 409 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 410 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 411 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 412 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 413 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 414 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 417 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 419 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 420 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 421 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 422 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 423 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 424 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 426 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 427 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 428 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 429 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 430 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 431 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 432 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 433 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 434 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 435 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 436 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 437 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 438 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 439 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 443 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 444 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 445 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 446 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 447 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 448 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 449 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 450 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 451 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 452 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 453 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 454 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 455 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 456 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 457 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 458 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 459 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 460 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 461 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 462 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 463 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 464 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 465 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.36 |
| Metatranscriptomes | 0.08 |
| Isolates | 0.56 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.41 |
| Nodule | 0.08 |
| Rhizoplane | 2.07 |
| Rhizosphere | 77.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_627485 | 2162886007 | Bacteria | 996 |
| 2 | rootH2_10234102 | 3300003320 | Bacteria | 1237 |
| 3 | JGI26128J50194_1000784 | 3300003347 | Bacteria | 1887 |
| 4 | Ga0055540_1005689 | 3300003792 | Bacteria | 5154 |
| 5 | Ga0055531_10000158 | 3300003794 | Bacteria | 77918 |
| 6 | Ga0065704_10144971 | 3300005289 | Bacteria | 1481 |
| 7 | Ga0065712_10429716 | 3300005290 | Bacteria | 704 |
| 8 | Ga0065715_10201477 | 3300005293 | Bacteria | 1359 |
| 9 | Ga0065715_10284025 | 3300005293 | Bacteria | 1079 |
| 10 | Ga0065707_10082401 | 3300005295 | Bacteria | 15662 |
| 11 | Ga0065707_10083629 | 3300005295 | Bacteria | 8593 |
| 12 | Ga0070658_11484581 | 3300005327 | Bacteria | 588 |
| 13 | Ga0070676_10006509 | 3300005328 | Bacteria | 6240 |
| 14 | Ga0070676_10020357 | 3300005328 | Bacteria | 3702 |
| 15 | Ga0070676_10290984 | 3300005328 | Bacteria | 1104 |
| 16 | Ga0070676_10413730 | 3300005328 | Bacteria | 941 |
| 17 | Ga0070676_10430190 | 3300005328 | Bacteria | 924 |
| 18 | Ga0070683_101531728 | 3300005329 | Bacteria | 641 |
| 19 | Ga0070690_100006390 | 3300005330 | Bacteria | 6679 |
| 20 | Ga0070690_100404218 | 3300005330 | Bacteria | 1003 |
| 21 | Ga0070670_100014643 | 3300005331 | Bacteria | 6733 |
| 22 | Ga0070670_100050018 | 3300005331 | Bacteria | 3592 |
| 23 | Ga0070670_100052480 | 3300005331 | Bacteria | 3502 |
| 24 | Ga0070670_100111871 | 3300005331 | Bacteria | 2353 |
| 25 | Ga0070670_100203248 | 3300005331 | Bacteria | 1721 |
| 26 | Ga0070670_101158358 | 3300005331 | Unclassified | 706 |
| 27 | Ga0070677_10083552 | 3300005333 | Bacteria | 1372 |
| 28 | Ga0070677_10089150 | 3300005333 | Bacteria | 1338 |
| 29 | Ga0070677_10716834 | 3300005333 | Bacteria | 565 |
| 30 | Ga0068869_100004832 | 3300005334 | Bacteria | 8413 |
| 31 | Ga0068869_100009279 | 3300005334 | Bacteria | 6380 |
| 32 | Ga0068869_100041362 | 3300005334 | Bacteria | 3300 |
| 33 | Ga0068869_100092159 | 3300005334 | Bacteria | 2281 |
| 34 | Ga0068869_100719537 | 3300005334 | Bacteria | 853 |
| 35 | Ga0068869_100850959 | 3300005334 | Bacteria | 787 |
| 36 | Ga0070666_10001214 | 3300005335 | Bacteria | 15546 |
| 37 | Ga0070666_10398960 | 3300005335 | Bacteria | 989 |
| 38 | Ga0070666_11085131 | 3300005335 | Bacteria | 595 |
| 39 | Ga0070666_11151990 | 3300005335 | Bacteria | 577 |
| 40 | Ga0070666_11377231 | 3300005335 | Bacteria | 527 |
| 41 | Ga0070680_101058687 | 3300005336 | Bacteria | 701 |
| 42 | Ga0070682_100397786 | 3300005337 | Bacteria | 1041 |
| 43 | Ga0068868_100000312 | 3300005338 | Bacteria | 32587 |
| 44 | Ga0068868_100014536 | 3300005338 | Bacteria | 5804 |
| 45 | Ga0068868_100187978 | 3300005338 | Bacteria | 1717 |
| 46 | Ga0068868_100194590 | 3300005338 | Bacteria | 1687 |
| 47 | Ga0068868_100204590 | 3300005338 | Bacteria | 1647 |
| 48 | Ga0068868_100277281 | 3300005338 | Bacteria | 1418 |
| 49 | Ga0068868_101341118 | 3300005338 | Bacteria | 666 |
| 50 | Ga0070660_100019235 | 3300005339 | Bacteria | 5000 |
| 51 | Ga0070660_100436627 | 3300005339 | Bacteria | 1085 |
| 52 | Ga0070660_100716819 | 3300005339 | Bacteria | 839 |
| 53 | Ga0070689_100016511 | 3300005340 | Bacteria | 5403 |
| 54 | Ga0070689_102026215 | 3300005340 | Bacteria | 527 |
| 55 | Ga0070689_102039895 | 3300005340 | Bacteria | 525 |
| 56 | Ga0070687_100047002 | 3300005343 | Bacteria | 2212 |
| 57 | Ga0070687_101004405 | 3300005343 | Bacteria | 605 |
| 58 | Ga0070661_100015946 | 3300005344 | Bacteria | 5303 |
| 59 | Ga0070661_100764206 | 3300005344 | Bacteria | 791 |
| 60 | Ga0070661_101481533 | 3300005344 | Bacteria | 572 |
| 61 | Ga0070668_100481101 | 3300005347 | Bacteria | 1072 |
| 62 | Ga0070669_100009785 | 3300005353 | Bacteria | 6828 |
| 63 | Ga0070669_100152181 | 3300005353 | Bacteria | 1792 |
| 64 | Ga0070669_100401730 | 3300005353 | Bacteria | 1121 |
| 65 | Ga0070675_100001196 | 3300005354 | Bacteria | 18872 |
| 66 | Ga0070675_100015225 | 3300005354 | Bacteria | 6074 |
| 67 | Ga0070675_100023005 | 3300005354 | Bacteria | 4980 |
| 68 | Ga0070675_101591984 | 3300005354 | Bacteria | 603 |
| 69 | Ga0070671_100009402 | 3300005355 | Bacteria | 7849 |
| 70 | Ga0070671_100010291 | 3300005355 | Bacteria | 7504 |
| 71 | Ga0070671_100037504 | 3300005355 | Bacteria | 4020 |
| 72 | Ga0070671_100063496 | 3300005355 | Bacteria | 3075 |
| 73 | Ga0070671_100263723 | 3300005355 | Bacteria | 1464 |
| 74 | Ga0070674_100020884 | 3300005356 | Bacteria | 4193 |
| 75 | Ga0070674_100063719 | 3300005356 | Bacteria | 2581 |
| 76 | Ga0070674_100234002 | 3300005356 | Bacteria | 1435 |
| 77 | Ga0070674_101019640 | 3300005356 | Bacteria | 727 |
| 78 | Ga0070674_101341015 | 3300005356 | Bacteria | 639 |
| 79 | Ga0070673_100001001 | 3300005364 | Bacteria | 16018 |
| 80 | Ga0070673_100005595 | 3300005364 | Bacteria | 8057 |
| 81 | Ga0070673_100055134 | 3300005364 | Bacteria | 3131 |
| 82 | Ga0070673_100135105 | 3300005364 | Bacteria | 2075 |
| 83 | Ga0070673_100210093 | 3300005364 | Bacteria | 1680 |
| 84 | Ga0070673_100308651 | 3300005364 | Bacteria | 1395 |
| 85 | Ga0070673_101293888 | 3300005364 | Bacteria | 685 |
| 86 | Ga0070688_100758398 | 3300005365 | Bacteria | 756 |
| 87 | Ga0070688_100817512 | 3300005365 | Bacteria | 730 |
| 88 | Ga0070659_100445191 | 3300005366 | Bacteria | 1098 |
| 89 | Ga0070659_100868814 | 3300005366 | Bacteria | 787 |
| 90 | Ga0070667_100008639 | 3300005367 | Bacteria | 8442 |
| 91 | Ga0070667_100035464 | 3300005367 | Bacteria | 4178 |
| 92 | Ga0070667_100118934 | 3300005367 | Bacteria | 2297 |
| 93 | Ga0070667_100141474 | 3300005367 | Bacteria | 2107 |
| 94 | Ga0070667_100195929 | 3300005367 | Bacteria | 1791 |
| 95 | Ga0070667_100221111 | 3300005367 | Bacteria | 1686 |
| 96 | Ga0070667_100252861 | 3300005367 | Bacteria | 1576 |
| 97 | Ga0070667_101010622 | 3300005367 | Bacteria | 776 |
| 98 | Ga0070703_10550155 | 3300005406 | Bacteria | 526 |
| 99 | Ga0070710_11064678 | 3300005437 | Bacteria | 592 |
| 100 | Ga0070701_10687047 | 3300005438 | Bacteria | 687 |
| 101 | Ga0070700_100302544 | 3300005441 | Bacteria | 1168 |
| 102 | Ga0070700_100418445 | 3300005441 | Bacteria | 1012 |
| 103 | Ga0070708_100000359 | 3300005445 | Bacteria | 34452 |
| 104 | Ga0070663_100001329 | 3300005455 | Bacteria | 13522 |
| 105 | Ga0070663_100170768 | 3300005455 | Bacteria | 1681 |
| 106 | Ga0070663_100509013 | 3300005455 | Bacteria | 1001 |
| 107 | Ga0070663_101018089 | 3300005455 | Bacteria | 721 |
| 108 | Ga0070678_100001350 | 3300005456 | Bacteria | 13053 |
| 109 | Ga0070678_100019530 | 3300005456 | Bacteria | 4421 |
| 110 | Ga0070678_100124088 | 3300005456 | Bacteria | 2041 |
| 111 | Ga0070678_100234909 | 3300005456 | Bacteria | 1530 |
| 112 | Ga0070678_100249689 | 3300005456 | Bacteria | 1487 |
| 113 | Ga0070678_100380141 | 3300005456 | Bacteria | 1222 |
| 114 | Ga0070678_100675272 | 3300005456 | Bacteria | 929 |
| 115 | Ga0070678_101198741 | 3300005456 | Bacteria | 704 |
| 116 | Ga0070662_100061191 | 3300005457 | Bacteria | 2748 |
| 117 | Ga0070662_100211907 | 3300005457 | Bacteria | 1542 |
| 118 | Ga0070662_100543556 | 3300005457 | Bacteria | 973 |
| 119 | Ga0070662_101106604 | 3300005457 | Bacteria | 680 |
| 120 | Ga0070681_10030700 | 3300005458 | Bacteria | 5392 |
| 121 | Ga0070681_10194030 | 3300005458 | Bacteria | 1950 |
| 122 | Ga0068867_100006369 | 3300005459 | Bacteria | 8345 |
| 123 | Ga0068867_100035602 | 3300005459 | Bacteria | 3612 |
| 124 | Ga0068867_100042192 | 3300005459 | Bacteria | 3336 |
| 125 | Ga0068867_100087456 | 3300005459 | Bacteria | 2360 |
| 126 | Ga0068867_100134339 | 3300005459 | Bacteria | 1926 |
| 127 | Ga0068867_100144313 | 3300005459 | Bacteria | 1864 |
| 128 | Ga0068867_100163249 | 3300005459 | Bacteria | 1758 |
| 129 | Ga0068867_100192902 | 3300005459 | Bacteria | 1626 |
| 130 | Ga0070685_10041723 | 3300005466 | Bacteria | 2616 |
| 131 | Ga0070685_10348170 | 3300005466 | Bacteria | 1012 |
| 132 | Ga0070685_10353220 | 3300005466 | Bacteria | 1006 |
| 133 | Ga0070685_11394215 | 3300005466 | Bacteria | 538 |
| 134 | Ga0070706_100038628 | 3300005467 | Bacteria | 4406 |
| 135 | Ga0070706_100094756 | 3300005467 | Bacteria | 2770 |
| 136 | Ga0070707_100121495 | 3300005468 | Bacteria | 2536 |
| 137 | Ga0070707_102345970 | 3300005468 | Bacteria | 501 |
| 138 | Ga0070698_100247243 | 3300005471 | Bacteria | 1716 |
| 139 | Ga0070698_100346944 | 3300005471 | Bacteria | 1416 |
| 140 | Ga0070699_100183198 | 3300005518 | Bacteria | 1859 |
| 141 | Ga0070699_100432562 | 3300005518 | Bacteria | 1192 |
| 142 | Ga0070699_100560060 | 3300005518 | Bacteria | 1041 |
| 143 | Ga0070679_100028003 | 3300005530 | Bacteria | 5552 |
| 144 | Ga0070679_100070126 | 3300005530 | Bacteria | 3497 |
| 145 | Ga0070679_100180884 | 3300005530 | Bacteria | 2081 |
| 146 | Ga0070697_100016402 | 3300005536 | Bacteria | 5824 |
| 147 | Ga0068853_100003043 | 3300005539 | Bacteria | 12805 |
| 148 | Ga0068853_100103028 | 3300005539 | Bacteria | 2526 |
| 149 | Ga0068853_100326263 | 3300005539 | Bacteria | 1424 |
| 150 | Ga0068853_100448241 | 3300005539 | Bacteria | 1214 |
| 151 | Ga0068853_100449348 | 3300005539 | Bacteria | 1212 |
| 152 | Ga0068853_101472901 | 3300005539 | Bacteria | 659 |
| 153 | Ga0068853_102408234 | 3300005539 | Bacteria | 510 |
| 154 | Ga0070672_100011526 | 3300005543 | Bacteria | 6168 |
| 155 | Ga0070672_100020972 | 3300005543 | Bacteria | 4775 |
| 156 | Ga0070672_100093042 | 3300005543 | Bacteria | 2435 |
| 157 | Ga0070672_100151153 | 3300005543 | Bacteria | 1921 |
| 158 | Ga0070686_100237573 | 3300005544 | Bacteria | 1325 |
| 159 | Ga0070695_101216149 | 3300005545 | Bacteria | 620 |
| 160 | Ga0070665_100010823 | 3300005548 | Bacteria | 9227 |
| 161 | Ga0070665_100262938 | 3300005548 | Bacteria | 1726 |
| 162 | Ga0070665_100674723 | 3300005548 | Bacteria | 1046 |
| 163 | Ga0070665_101595576 | 3300005548 | Bacteria | 660 |
| 164 | Ga0070704_102181534 | 3300005549 | Bacteria | 515 |
| 165 | Ga0068855_100763025 | 3300005563 | Bacteria | 1030 |
| 166 | Ga0070664_100077686 | 3300005564 | Bacteria | 2855 |
| 167 | Ga0070664_100211134 | 3300005564 | Bacteria | 1735 |
| 168 | Ga0070664_100531988 | 3300005564 | Bacteria | 1086 |
| 169 | Ga0070664_100689385 | 3300005564 | Bacteria | 951 |
| 170 | Ga0068857_100005109 | 3300005577 | Bacteria | 11159 |
| 171 | Ga0068857_100028848 | 3300005577 | Bacteria | 4897 |
| 172 | Ga0068857_100312974 | 3300005577 | Bacteria | 1449 |
| 173 | Ga0068857_100320407 | 3300005577 | Bacteria | 1432 |
| 174 | Ga0068857_100375393 | 3300005577 | Bacteria | 1319 |
| 175 | Ga0068857_100608718 | 3300005577 | Bacteria | 1033 |
| 176 | Ga0068857_101658579 | 3300005577 | Bacteria | 625 |
| 177 | Ga0068857_101663630 | 3300005577 | Bacteria | 624 |
| 178 | Ga0068857_102010875 | 3300005577 | Bacteria | 567 |
| 179 | Ga0068854_100178843 | 3300005578 | Bacteria | 1656 |
| 180 | Ga0068854_100195310 | 3300005578 | Bacteria | 1588 |
| 181 | Ga0068856_100002604 | 3300005614 | Bacteria | 18562 |
| 182 | Ga0070702_101359607 | 3300005615 | Bacteria | 579 |
| 183 | Ga0068852_100137407 | 3300005616 | Bacteria | 2258 |
| 184 | Ga0068852_100171248 | 3300005616 | Bacteria | 2035 |
| 185 | Ga0068852_100358482 | 3300005616 | Bacteria | 1426 |
| 186 | Ga0068852_100422081 | 3300005616 | Bacteria | 1316 |
| 187 | Ga0068852_100508890 | 3300005616 | Bacteria | 1200 |
| 188 | Ga0068852_101400936 | 3300005616 | Bacteria | 721 |
| 189 | Ga0068852_102464367 | 3300005616 | Bacteria | 541 |
| 190 | Ga0068859_100022763 | 3300005617 | Bacteria | 6283 |
| 191 | Ga0068859_100074871 | 3300005617 | Bacteria | 3425 |
| 192 | Ga0068859_100176798 | 3300005617 | Bacteria | 2216 |
| 193 | Ga0068859_100770445 | 3300005617 | Bacteria | 1051 |
| 194 | Ga0068859_101505113 | 3300005617 | Bacteria | 743 |
| 195 | Ga0068859_103023221 | 3300005617 | Bacteria | 514 |
| 196 | Ga0068864_100000335 | 3300005618 | Bacteria | 41329 |
| 197 | Ga0068864_100008404 | 3300005618 | Bacteria | 8515 |
| 198 | Ga0068864_100254048 | 3300005618 | Bacteria | 1633 |
| 199 | Ga0068864_100284544 | 3300005618 | Bacteria | 1544 |
| 200 | Ga0068864_101851902 | 3300005618 | Bacteria | 609 |
| 201 | Ga0068866_10062011 | 3300005718 | Bacteria | 1944 |
| 202 | Ga0068866_10529042 | 3300005718 | Bacteria | 785 |
| 203 | Ga0068866_10911611 | 3300005718 | Bacteria | 619 |
| 204 | Ga0068861_100006418 | 3300005719 | Bacteria | 8009 |
| 205 | Ga0068861_100356978 | 3300005719 | Bacteria | 1284 |
| 206 | Ga0068861_102431694 | 3300005719 | Bacteria | 527 |
| 207 | Ga0068851_10414327 | 3300005834 | Bacteria | 795 |
| 208 | Ga0068870_10110312 | 3300005840 | Bacteria | 1570 |
| 209 | Ga0068870_10491782 | 3300005840 | Bacteria | 816 |
| 210 | Ga0068863_100029875 | 3300005841 | Bacteria | 5205 |
| 211 | Ga0068863_101598753 | 3300005841 | Bacteria | 661 |
| 212 | Ga0068858_100168978 | 3300005842 | Bacteria | 2061 |
| 213 | Ga0068858_100249884 | 3300005842 | Bacteria | 1684 |
| 214 | Ga0068860_100001975 | 3300005843 | Bacteria | 21676 |
| 215 | Ga0068860_100010220 | 3300005843 | Bacteria | 9288 |
| 216 | Ga0068860_100019680 | 3300005843 | Bacteria | 6544 |
| 217 | Ga0068860_100918470 | 3300005843 | Bacteria | 892 |
| 218 | Ga0068862_100017460 | 3300005844 | Bacteria | 5977 |
| 219 | Ga0068862_100024404 | 3300005844 | Bacteria | 5073 |
| 220 | Ga0068862_100038482 | 3300005844 | Bacteria | 4056 |
| 221 | Ga0068862_100616314 | 3300005844 | Bacteria | 1044 |
| 222 | Ga0068862_101225019 | 3300005844 | Bacteria | 750 |
| 223 | Ga0068862_101502996 | 3300005844 | Bacteria | 679 |
| 224 | Ga0068862_101833773 | 3300005844 | Bacteria | 616 |
| 225 | Ga0081455_10193472 | 3300005937 | Bacteria | 1529 |
| 226 | Ga0081455_10510270 | 3300005937 | Bacteria | 805 |
| 227 | Ga0075365_10050103 | 3300006038 | Bacteria | 2754 |
| 228 | Ga0075365_10848173 | 3300006038 | Bacteria | 644 |
| 229 | Ga0075368_10002000 | 3300006042 | Bacteria | 6580 |
| 230 | Ga0075368_10019410 | 3300006042 | Bacteria | 2566 |
| 231 | Ga0075368_10045969 | 3300006042 | Bacteria | 1726 |
| 232 | Ga0075368_10156877 | 3300006042 | Bacteria | 952 |
| 233 | Ga0075363_100006111 | 3300006048 | Bacteria | 5435 |
| 234 | Ga0075363_100033418 | 3300006048 | Bacteria | 2678 |
| 235 | Ga0075363_100159388 | 3300006048 | Bacteria | 1277 |
| 236 | Ga0075363_100161113 | 3300006048 | Bacteria | 1270 |
| 237 | Ga0075363_100402647 | 3300006048 | Bacteria | 804 |
| 238 | Ga0075363_100426427 | 3300006048 | Bacteria | 781 |
| 239 | Ga0075363_100491883 | 3300006048 | Bacteria | 728 |
| 240 | Ga0075363_100643064 | 3300006048 | Bacteria | 638 |
| 241 | Ga0075364_10103332 | 3300006051 | Bacteria | 1898 |
| 242 | Ga0075364_10117486 | 3300006051 | Bacteria | 1778 |
| 243 | Ga0075364_10160790 | 3300006051 | Bacteria | 1516 |
| 244 | Ga0075364_10196524 | 3300006051 | Bacteria | 1367 |
| 245 | Ga0075432_10056399 | 3300006058 | Bacteria | 1393 |
| 246 | Ga0075432_10374718 | 3300006058 | Bacteria | 609 |
| 247 | Ga0075362_10004294 | 3300006177 | Bacteria | 5097 |
| 248 | Ga0075362_10028978 | 3300006177 | Bacteria | 2382 |
| 249 | Ga0075362_10029956 | 3300006177 | Bacteria | 2348 |
| 250 | Ga0075362_10037845 | 3300006177 | Bacteria | 2117 |
| 251 | Ga0075362_10062083 | 3300006177 | Bacteria | 1692 |
| 252 | Ga0075362_10085501 | 3300006177 | Bacteria | 1458 |
| 253 | Ga0075362_10090136 | 3300006177 | Bacteria | 1422 |
| 254 | Ga0075362_10091744 | 3300006177 | Bacteria | 1411 |
| 255 | Ga0075362_10245705 | 3300006177 | Bacteria | 879 |
| 256 | Ga0075362_10574662 | 3300006177 | Bacteria | 581 |
| 257 | Ga0075367_10008658 | 3300006178 | Bacteria | 5278 |
| 258 | Ga0075367_10010639 | 3300006178 | Bacteria | 4839 |
| 259 | Ga0075367_10091437 | 3300006178 | Bacteria | 1851 |
| 260 | Ga0075367_10121315 | 3300006178 | Bacteria | 1611 |
| 261 | Ga0075367_10338695 | 3300006178 | Bacteria | 949 |
| 262 | Ga0075367_10744875 | 3300006178 | Bacteria | 623 |
| 263 | Ga0075367_10770292 | 3300006178 | Bacteria | 613 |
| 264 | Ga0075367_10958923 | 3300006178 | Bacteria | 546 |
| 265 | Ga0075369_10012606 | 3300006186 | Bacteria | 3339 |
| 266 | Ga0075369_10043585 | 3300006186 | Bacteria | 1926 |
| 267 | Ga0075369_10069452 | 3300006186 | Bacteria | 1549 |
| 268 | Ga0075369_10132473 | 3300006186 | Bacteria | 1133 |
| 269 | Ga0075369_10202469 | 3300006186 | Bacteria | 916 |
| 270 | Ga0075369_10229785 | 3300006186 | Bacteria | 859 |
| 271 | Ga0075427_10021345 | 3300006194 | Bacteria | 1030 |
| 272 | Ga0075366_10003945 | 3300006195 | Bacteria | 7914 |
| 273 | Ga0075366_10031291 | 3300006195 | Bacteria | 3131 |
| 274 | Ga0075366_10036971 | 3300006195 | Bacteria | 2880 |
| 275 | Ga0075366_10038103 | 3300006195 | Bacteria | 2839 |
| 276 | Ga0075366_10047038 | 3300006195 | Bacteria | 2557 |
| 277 | Ga0075366_10062814 | 3300006195 | Bacteria | 2207 |
| 278 | Ga0075366_10068300 | 3300006195 | Bacteria | 2115 |
| 279 | Ga0075366_10190153 | 3300006195 | Bacteria | 1248 |
| 280 | Ga0075366_10224751 | 3300006195 | Bacteria | 1144 |
| 281 | Ga0075366_10237496 | 3300006195 | Bacteria | 1111 |
| 282 | Ga0075366_10271963 | 3300006195 | Bacteria | 1035 |
| 283 | Ga0075366_10401545 | 3300006195 | Bacteria | 843 |
| 284 | Ga0075366_10621857 | 3300006195 | Bacteria | 670 |
| 285 | Ga0075366_10674752 | 3300006195 | Bacteria | 641 |
| 286 | Ga0075366_11008283 | 3300006195 | Bacteria | 519 |
| 287 | Ga0097621_100003156 | 3300006237 | Bacteria | 11316 |
| 288 | Ga0097621_100408273 | 3300006237 | Bacteria | 1217 |
| 289 | Ga0097621_100659557 | 3300006237 | Bacteria | 961 |
| 290 | Ga0097621_101163078 | 3300006237 | Bacteria | 726 |
| 291 | Ga0097621_101512126 | 3300006237 | Bacteria | 637 |
| 292 | Ga0075370_10000069 | 3300006353 | Bacteria | 31335 |
| 293 | Ga0075370_10002857 | 3300006353 | Bacteria | 8108 |
| 294 | Ga0075370_10003577 | 3300006353 | Bacteria | 7430 |
| 295 | Ga0075370_10003910 | 3300006353 | Bacteria | 7150 |
| 296 | Ga0075370_10007647 | 3300006353 | Bacteria | 5515 |
| 297 | Ga0075370_10013361 | 3300006353 | Bacteria | 4361 |
| 298 | Ga0075370_10028001 | 3300006353 | Bacteria | 3130 |
| 299 | Ga0075370_10049373 | 3300006353 | Bacteria | 2385 |
| 300 | Ga0075370_10061038 | 3300006353 | Bacteria | 2148 |
| 301 | Ga0075370_10087718 | 3300006353 | Bacteria | 1793 |
| 302 | Ga0075370_10405090 | 3300006353 | Bacteria | 818 |
| 303 | Ga0075370_10640439 | 3300006353 | Bacteria | 645 |
| 304 | Ga0075370_10698862 | 3300006353 | Bacteria | 616 |
| 305 | Ga0075370_10873815 | 3300006353 | Bacteria | 549 |
| 306 | Ga0075370_10920221 | 3300006353 | Bacteria | 535 |
| 307 | Ga0068871_100031944 | 3300006358 | Bacteria | 4154 |
| 308 | Ga0068871_100120663 | 3300006358 | Bacteria | 2214 |
| 309 | Ga0075428_100664390 | 3300006844 | Bacteria | 1111 |
| 310 | Ga0075428_101185429 | 3300006844 | Bacteria | 805 |
| 311 | Ga0075430_100800733 | 3300006846 | Bacteria | 777 |
| 312 | Ga0075430_100814356 | 3300006846 | Bacteria | 769 |
| 313 | Ga0075430_101013743 | 3300006846 | Bacteria | 684 |
| 314 | Ga0075431_100026171 | 3300006847 | Bacteria | 5984 |
| 315 | Ga0075434_100160470 | 3300006871 | Bacteria | 2268 |
| 316 | Ga0075429_100207907 | 3300006880 | Bacteria | 1715 |
| 317 | Ga0075429_101442670 | 3300006880 | Bacteria | 599 |
| 318 | Ga0068865_100001690 | 3300006881 | Bacteria | 12923 |
| 319 | Ga0068865_100067591 | 3300006881 | Bacteria | 2525 |
| 320 | Ga0068865_100087499 | 3300006881 | Bacteria | 2252 |
| 321 | Ga0068865_100487010 | 3300006881 | Bacteria | 1026 |
| 322 | Ga0075436_100224033 | 3300006914 | Bacteria | 1335 |
| 323 | Ga0097620_100022763 | 3300006931 | Bacteria | 6283 |
| 324 | Ga0097620_100074872 | 3300006931 | Bacteria | 3425 |
| 325 | Ga0097620_100176802 | 3300006931 | Bacteria | 2216 |
| 326 | Ga0097620_100770446 | 3300006931 | Bacteria | 1051 |
| 327 | Ga0097620_101505081 | 3300006931 | Bacteria | 743 |
| 328 | Ga0097620_103023307 | 3300006931 | Bacteria | 514 |
| 329 | Ga0075435_100393558 | 3300007076 | Bacteria | 1191 |
| 330 | Ga0075435_101431013 | 3300007076 | Bacteria | 606 |
| 331 | Ga0075435_101499860 | 3300007076 | Bacteria | 591 |
| 332 | Ga0105240_10137773 | 3300009093 | Bacteria | 2921 |
| 333 | Ga0105240_10202919 | 3300009093 | Bacteria | 2322 |
| 334 | Ga0105240_11208746 | 3300009093 | Bacteria | 800 |
| 335 | Ga0105240_11947268 | 3300009093 | Bacteria | 611 |
| 336 | Ga0105245_10054814 | 3300009098 | Bacteria | 3580 |
| 337 | Ga0105245_10099488 | 3300009098 | Bacteria | 2689 |
| 338 | Ga0105245_10129687 | 3300009098 | Bacteria | 2364 |
| 339 | Ga0105245_10144596 | 3300009098 | Bacteria | 2243 |
| 340 | Ga0105245_10156093 | 3300009098 | Bacteria | 2161 |
| 341 | Ga0105245_10560966 | 3300009098 | Bacteria | 1165 |
| 342 | Ga0105245_11356793 | 3300009098 | Bacteria | 761 |
| 343 | Ga0105245_11535534 | 3300009098 | Bacteria | 717 |
| 344 | Ga0105247_10262331 | 3300009101 | Bacteria | 1185 |
| 345 | Ga0105243_10006865 | 3300009148 | Bacteria | 8776 |
| 346 | Ga0105243_10018982 | 3300009148 | Bacteria | 5213 |
| 347 | Ga0105243_10029668 | 3300009148 | Bacteria | 4207 |
| 348 | Ga0105243_10969369 | 3300009148 | Bacteria | 851 |
| 349 | Ga0105243_11119629 | 3300009148 | Bacteria | 796 |
| 350 | Ga0105243_11273798 | 3300009148 | Bacteria | 751 |
| 351 | Ga0105243_11649857 | 3300009148 | Bacteria | 669 |
| 352 | Ga0105243_11777174 | 3300009148 | Bacteria | 647 |
| 353 | Ga0105241_10135019 | 3300009174 | Bacteria | 2002 |
| 354 | Ga0105241_10389013 | 3300009174 | Bacteria | 1220 |
| 355 | Ga0105241_10420449 | 3300009174 | Bacteria | 1176 |
| 356 | Ga0105241_10633629 | 3300009174 | Bacteria | 969 |
| 357 | Ga0105241_11010795 | 3300009174 | Bacteria | 778 |
| 358 | Ga0105242_10002941 | 3300009176 | Bacteria | 13318 |
| 359 | Ga0105242_10375600 | 3300009176 | Bacteria | 1320 |
| 360 | Ga0105242_10454749 | 3300009176 | Bacteria | 1208 |
| 361 | Ga0105242_10777703 | 3300009176 | Bacteria | 945 |
| 362 | Ga0105242_12629649 | 3300009176 | Bacteria | 552 |
| 363 | Ga0105248_10006504 | 3300009177 | Bacteria | 12816 |
| 364 | Ga0105248_10701648 | 3300009177 | Bacteria | 1142 |
| 365 | Ga0105248_13404229 | 3300009177 | Bacteria | 505 |
| 366 | Ga0105237_10022143 | 3300009545 | Bacteria | 6520 |
| 367 | Ga0105237_10022563 | 3300009545 | Bacteria | 6457 |
| 368 | Ga0105237_10044937 | 3300009545 | Bacteria | 4447 |
| 369 | Ga0105237_12600564 | 3300009545 | Bacteria | 517 |
| 370 | Ga0105238_10381104 | 3300009551 | Bacteria | 1402 |
| 371 | Ga0105238_12428565 | 3300009551 | Bacteria | 560 |
| 372 | Ga0105238_12684331 | 3300009551 | Bacteria | 534 |
| 373 | Ga0105249_10172034 | 3300009553 | Bacteria | 2101 |
| 374 | Ga0105249_10304390 | 3300009553 | Bacteria | 1600 |
| 375 | Ga0105249_10470445 | 3300009553 | Bacteria | 1298 |
| 376 | Ga0105249_10975419 | 3300009553 | Bacteria | 916 |
| 377 | Ga0105239_10034022 | 3300010375 | Bacteria | 5595 |
| 378 | Ga0105239_11575658 | 3300010375 | Bacteria | 759 |
| 379 | Ga0105239_12302028 | 3300010375 | Bacteria | 627 |
| 380 | Ga0105246_10172817 | 3300011119 | Bacteria | 1656 |
| 381 | Ga0105246_11127274 | 3300011119 | Bacteria | 718 |
| 382 | Ga0157373_10308491 | 3300013100 | Bacteria | 1124 |
| 383 | Ga0157373_10697372 | 3300013100 | Bacteria | 744 |
| 384 | Ga0157370_10071975 | 3300013104 | Bacteria | 3262 |
| 385 | Ga0157370_11367194 | 3300013104 | Bacteria | 637 |
| 386 | Ga0157374_10009908 | 3300013296 | Bacteria | 8180 |
| 387 | Ga0157374_10277170 | 3300013296 | Bacteria | 1655 |
| 388 | Ga0157374_10455283 | 3300013296 | Bacteria | 1281 |
| 389 | Ga0157374_10754036 | 3300013296 | Bacteria | 988 |
| 390 | Ga0157374_11041713 | 3300013296 | Bacteria | 838 |
| 391 | Ga0157374_11102222 | 3300013296 | Bacteria | 814 |
| 392 | Ga0157378_10008788 | 3300013297 | Bacteria | 8792 |
| 393 | Ga0157378_10012969 | 3300013297 | Bacteria | 7292 |
| 394 | Ga0157378_10081000 | 3300013297 | Bacteria | 2934 |
| 395 | Ga0157378_10146246 | 3300013297 | Bacteria | 2199 |
| 396 | Ga0157378_10728291 | 3300013297 | Bacteria | 1013 |
| 397 | Ga0157378_11161679 | 3300013297 | Bacteria | 811 |
| 398 | Ga0157378_11710601 | 3300013297 | Bacteria | 676 |
| 399 | Ga0157378_11949936 | 3300013297 | Bacteria | 637 |
| 400 | Ga0163162_10000168 | 3300013306 | Bacteria | 60425 |
| 401 | Ga0163162_10034511 | 3300013306 | Bacteria | 5035 |
| 402 | Ga0163162_10059547 | 3300013306 | Bacteria | 3851 |
| 403 | Ga0163162_10315677 | 3300013306 | Bacteria | 1695 |
| 404 | Ga0163162_12189907 | 3300013306 | Bacteria | 635 |
| 405 | Ga0157372_10105643 | 3300013307 | Bacteria | 3221 |
| 406 | Ga0157372_10160841 | 3300013307 | Bacteria | 2595 |
| 407 | Ga0157372_10331593 | 3300013307 | Bacteria | 1772 |
| 408 | Ga0157375_10001422 | 3300013308 | Bacteria | 20591 |
| 409 | Ga0157375_10003720 | 3300013308 | Bacteria | 13235 |
| 410 | Ga0157375_10041871 | 3300013308 | Bacteria | 4427 |
| 411 | Ga0157375_10135462 | 3300013308 | Bacteria | 2586 |
| 412 | Ga0157375_10795507 | 3300013308 | Bacteria | 1095 |
| 413 | Ga0157375_11531755 | 3300013308 | Bacteria | 787 |
| 414 | Ga0163163_10000817 | 3300014325 | Bacteria | 26523 |
| 415 | Ga0163163_10860999 | 3300014325 | Bacteria | 970 |
| 416 | Ga0157380_10007819 | 3300014326 | Bacteria | 7609 |
| 417 | Ga0157380_10024651 | 3300014326 | Bacteria | 4555 |
| 418 | Ga0157380_10109031 | 3300014326 | Bacteria | 2322 |
| 419 | Ga0157380_10614634 | 3300014326 | Bacteria | 1078 |
| 420 | Ga0157380_11286245 | 3300014326 | Bacteria | 778 |
| 421 | Ga0157380_12103911 | 3300014326 | Bacteria | 627 |
| 422 | Ga0182008_10112794 | 3300014497 | Bacteria | 1347 |
| 423 | Ga0157377_10239829 | 3300014745 | Bacteria | 1170 |
| 424 | Ga0157377_10490301 | 3300014745 | Bacteria | 857 |
| 425 | Ga0157379_10009570 | 3300014968 | Bacteria | 8440 |
| 426 | Ga0157379_10026294 | 3300014968 | Bacteria | 5181 |
| 427 | Ga0157379_10077463 | 3300014968 | Bacteria | 2977 |
| 428 | Ga0157379_10084183 | 3300014968 | Bacteria | 2850 |
| 429 | Ga0157379_10279827 | 3300014968 | Bacteria | 1518 |
| 430 | Ga0157379_10637925 | 3300014968 | Bacteria | 996 |
| 431 | Ga0157379_10794188 | 3300014968 | Bacteria | 893 |
| 432 | Ga0157376_10003750 | 3300014969 | Bacteria | 10507 |
| 433 | Ga0157376_10040924 | 3300014969 | Bacteria | 3791 |
| 434 | Ga0157376_11043831 | 3300014969 | Bacteria | 841 |
| 435 | Ga0157376_11142175 | 3300014969 | Bacteria | 806 |
| 436 | Ga0157376_11362583 | 3300014969 | Bacteria | 740 |
| 437 | Ga0163161_10046958 | 3300017792 | Bacteria | 3117 |
| 438 | Ga0163161_10091021 | 3300017792 | Bacteria | 2257 |
| 439 | Ga0163161_10184705 | 3300017792 | Bacteria | 1600 |
| 440 | Ga0163161_10226753 | 3300017792 | Bacteria | 1449 |
| 441 | Ga0213872_10000009 | 3300021361 | Bacteria | 221470 |
| 442 | Ga0213872_10001063 | 3300021361 | Bacteria | 19004 |
| 443 | Ga0213872_10004239 | 3300021361 | Bacteria | 7688 |
| 444 | Ga0207426_1158563 | 3300025302 | Bacteria | 520 |
| 445 | Ga0209051_1000315 | 3300025303 | Bacteria | 73579 |
| 446 | Ga0209257_1000309 | 3300025304 | Bacteria | 104166 |
| 447 | Ga0209257_1016516 | 3300025304 | Bacteria | 2980 |
| 448 | Ga0207697_10017545 | 3300025315 | Bacteria | 2941 |
| 449 | Ga0207697_10327890 | 3300025315 | Bacteria | 680 |
| 450 | Ga0207656_10042605 | 3300025321 | Bacteria | 1932 |
| 451 | Ga0207682_10002297 | 3300025893 | Bacteria | 8613 |
| 452 | Ga0207682_10069487 | 3300025893 | Bacteria | 1490 |
| 453 | Ga0207642_10379509 | 3300025899 | Bacteria | 841 |
| 454 | Ga0207642_10575550 | 3300025899 | Bacteria | 698 |
| 455 | Ga0207642_10942718 | 3300025899 | Bacteria | 554 |
| 456 | Ga0207688_10747001 | 3300025901 | Bacteria | 619 |
| 457 | Ga0207680_10003377 | 3300025903 | Bacteria | 7518 |
| 458 | Ga0207685_10213795 | 3300025905 | Bacteria | 913 |
| 459 | Ga0207685_10292505 | 3300025905 | Bacteria | 803 |
| 460 | Ga0207645_10002626 | 3300025907 | Bacteria | 14018 |
| 461 | Ga0207645_10003152 | 3300025907 | Bacteria | 12630 |
| 462 | Ga0207645_10013698 | 3300025907 | Bacteria | 5452 |
| 463 | Ga0207645_10084315 | 3300025907 | Bacteria | 2039 |
| 464 | Ga0207645_10150477 | 3300025907 | Bacteria | 1519 |
| 465 | Ga0207645_10433864 | 3300025907 | Bacteria | 886 |
| 466 | Ga0207643_10023892 | 3300025908 | Bacteria | 3372 |
| 467 | Ga0207643_10112150 | 3300025908 | Bacteria | 1607 |
| 468 | Ga0207705_10645419 | 3300025909 | Bacteria | 823 |
| 469 | Ga0207705_11339888 | 3300025909 | Bacteria | 546 |
| 470 | Ga0207684_10085345 | 3300025910 | Bacteria | 2689 |
| 471 | Ga0207684_10294104 | 3300025910 | Bacteria | 1400 |
| 472 | Ga0207654_10081214 | 3300025911 | Bacteria | 1951 |
| 473 | Ga0207654_10306856 | 3300025911 | Bacteria | 1081 |
| 474 | Ga0207707_10002045 | 3300025912 | Bacteria | 18314 |
| 475 | Ga0207707_10065229 | 3300025912 | Bacteria | 3171 |
| 476 | Ga0207707_10258442 | 3300025912 | Bacteria | 1512 |
| 477 | Ga0207695_10038445 | 3300025913 | Bacteria | 5152 |
| 478 | Ga0207695_10103170 | 3300025913 | Bacteria | 2844 |
| 479 | Ga0207695_10350675 | 3300025913 | Bacteria | 1363 |
| 480 | Ga0207671_10033573 | 3300025914 | Bacteria | 3816 |
| 481 | Ga0207671_10768690 | 3300025914 | Bacteria | 765 |
| 482 | Ga0207660_11391444 | 3300025917 | Bacteria | 568 |
| 483 | Ga0207662_10424604 | 3300025918 | Bacteria | 905 |
| 484 | Ga0207657_10073512 | 3300025919 | Bacteria | 2889 |
| 485 | Ga0207649_10006701 | 3300025920 | Bacteria | 6259 |
| 486 | Ga0207649_10451429 | 3300025920 | Bacteria | 970 |
| 487 | Ga0207649_10690849 | 3300025920 | Bacteria | 791 |
| 488 | Ga0207649_11212328 | 3300025920 | Bacteria | 596 |
| 489 | Ga0207652_10026703 | 3300025921 | Bacteria | 4811 |
| 490 | Ga0207652_10401156 | 3300025921 | Bacteria | 1237 |
| 491 | Ga0207646_10109381 | 3300025922 | Bacteria | 2480 |
| 492 | Ga0207646_10149848 | 3300025922 | Bacteria | 2103 |
| 493 | Ga0207681_10020212 | 3300025923 | Bacteria | 4216 |
| 494 | Ga0207681_10139744 | 3300025923 | Bacteria | 1802 |
| 495 | Ga0207681_10526049 | 3300025923 | Bacteria | 971 |
| 496 | Ga0207681_10533567 | 3300025923 | Bacteria | 964 |
| 497 | Ga0207694_10275730 | 3300025924 | Bacteria | 1380 |
| 498 | Ga0207650_10077148 | 3300025925 | Bacteria | 2518 |
| 499 | Ga0207650_10100023 | 3300025925 | Bacteria | 2230 |
| 500 | Ga0207650_10114624 | 3300025925 | Bacteria | 2091 |
| 501 | Ga0207650_10301729 | 3300025925 | Bacteria | 1308 |
| 502 | Ga0207650_10417710 | 3300025925 | Bacteria | 1112 |
| 503 | Ga0207659_10002305 | 3300025926 | Bacteria | 11377 |
| 504 | Ga0207659_10019172 | 3300025926 | Bacteria | 4496 |
| 505 | Ga0207659_10584626 | 3300025926 | Bacteria | 951 |
| 506 | Ga0207687_10036807 | 3300025927 | Bacteria | 3335 |
| 507 | Ga0207687_10059048 | 3300025927 | Bacteria | 2701 |
| 508 | Ga0207687_10089260 | 3300025927 | Bacteria | 2244 |
| 509 | Ga0207687_10155738 | 3300025927 | Bacteria | 1748 |
| 510 | Ga0207687_10325683 | 3300025927 | Bacteria | 1245 |
| 511 | Ga0207687_10385198 | 3300025927 | Bacteria | 1150 |
| 512 | Ga0207687_10491069 | 3300025927 | Bacteria | 1024 |
| 513 | Ga0207644_10010913 | 3300025931 | Bacteria | 6001 |
| 514 | Ga0207644_10113665 | 3300025931 | Bacteria | 2050 |
| 515 | Ga0207644_10153601 | 3300025931 | Bacteria | 1783 |
| 516 | Ga0207644_10157857 | 3300025931 | Bacteria | 1761 |
| 517 | Ga0207644_10753708 | 3300025931 | Bacteria | 813 |
| 518 | Ga0207644_10768630 | 3300025931 | Bacteria | 805 |
| 519 | Ga0207644_11553317 | 3300025931 | Bacteria | 555 |
| 520 | Ga0207690_11321674 | 3300025932 | Bacteria | 603 |
| 521 | Ga0207706_10073296 | 3300025933 | Bacteria | 3011 |
| 522 | Ga0207706_10213269 | 3300025933 | Bacteria | 1692 |
| 523 | Ga0207706_10370479 | 3300025933 | Bacteria | 1244 |
| 524 | Ga0207706_10467567 | 3300025933 | Bacteria | 1090 |
| 525 | Ga0207686_10019349 | 3300025934 | Bacteria | 3870 |
| 526 | Ga0207686_10423557 | 3300025934 | Bacteria | 1019 |
| 527 | Ga0207686_10484592 | 3300025934 | Bacteria | 957 |
| 528 | Ga0207686_10896066 | 3300025934 | Bacteria | 715 |
| 529 | Ga0207709_10113842 | 3300025935 | Bacteria | 1814 |
| 530 | Ga0207709_10369894 | 3300025935 | Bacteria | 1088 |
| 531 | Ga0207709_11060419 | 3300025935 | Bacteria | 664 |
| 532 | Ga0207709_11112533 | 3300025935 | Bacteria | 649 |
| 533 | Ga0207670_10010441 | 3300025936 | Bacteria | 5352 |
| 534 | Ga0207669_10158749 | 3300025937 | Bacteria | 1594 |
| 535 | Ga0207669_10406799 | 3300025937 | Bacteria | 1067 |
| 536 | Ga0207669_10523564 | 3300025937 | Bacteria | 952 |
| 537 | Ga0207704_10001176 | 3300025938 | Bacteria | 11669 |
| 538 | Ga0207704_10235341 | 3300025938 | Bacteria | 1365 |
| 539 | Ga0207704_10689440 | 3300025938 | Bacteria | 845 |
| 540 | Ga0207691_10007352 | 3300025940 | Bacteria | 10620 |
| 541 | Ga0207691_10020788 | 3300025940 | Bacteria | 6204 |
| 542 | Ga0207691_10031449 | 3300025940 | Bacteria | 4953 |
| 543 | Ga0207691_10134497 | 3300025940 | Bacteria | 2182 |
| 544 | Ga0207711_10010839 | 3300025941 | Bacteria | 7578 |
| 545 | Ga0207689_10002510 | 3300025942 | Bacteria | 17057 |
| 546 | Ga0207689_10015898 | 3300025942 | Bacteria | 6373 |
| 547 | Ga0207689_10041503 | 3300025942 | Bacteria | 3807 |
| 548 | Ga0207689_10073322 | 3300025942 | Bacteria | 2812 |
| 549 | Ga0207689_10120802 | 3300025942 | Bacteria | 2155 |
| 550 | Ga0207689_10438207 | 3300025942 | Bacteria | 1091 |
| 551 | Ga0207689_10672400 | 3300025942 | Bacteria | 873 |
| 552 | Ga0207679_10116092 | 3300025945 | Bacteria | 2122 |
| 553 | Ga0207679_10312096 | 3300025945 | Bacteria | 1359 |
| 554 | Ga0207679_10526984 | 3300025945 | Bacteria | 1057 |
| 555 | Ga0207679_11056570 | 3300025945 | Bacteria | 745 |
| 556 | Ga0207667_11018397 | 3300025949 | Bacteria | 815 |
| 557 | Ga0207651_10033946 | 3300025960 | Bacteria | 3297 |
| 558 | Ga0207651_10257684 | 3300025960 | Bacteria | 1430 |
| 559 | Ga0207651_10282632 | 3300025960 | Bacteria | 1372 |
| 560 | Ga0207651_10352824 | 3300025960 | Bacteria | 1239 |
| 561 | Ga0207651_10590025 | 3300025960 | Bacteria | 970 |
| 562 | Ga0207712_10046245 | 3300025961 | Bacteria | 3017 |
| 563 | Ga0207712_10144716 | 3300025961 | Bacteria | 1828 |
| 564 | Ga0207712_10662255 | 3300025961 | Bacteria | 908 |
| 565 | Ga0207668_10108132 | 3300025972 | Bacteria | 2081 |
| 566 | Ga0207668_10137024 | 3300025972 | Bacteria | 1877 |
| 567 | Ga0207668_10286686 | 3300025972 | Bacteria | 1353 |
| 568 | Ga0207668_10349595 | 3300025972 | Bacteria | 1236 |
| 569 | Ga0207668_10614770 | 3300025972 | Bacteria | 948 |
| 570 | Ga0207640_10114940 | 3300025981 | Bacteria | 1916 |
| 571 | Ga0207640_10814935 | 3300025981 | Bacteria | 810 |
| 572 | Ga0207658_10026401 | 3300025986 | Bacteria | 4072 |
| 573 | Ga0207658_10029661 | 3300025986 | Bacteria | 3866 |
| 574 | Ga0207658_10112238 | 3300025986 | Bacteria | 2157 |
| 575 | Ga0207658_10167862 | 3300025986 | Bacteria | 1805 |
| 576 | Ga0207658_10220516 | 3300025986 | Bacteria | 1595 |
| 577 | Ga0207658_10252980 | 3300025986 | Bacteria | 1498 |
| 578 | Ga0207658_10871330 | 3300025986 | Bacteria | 819 |
| 579 | Ga0207677_10009363 | 3300026023 | Bacteria | 5512 |
| 580 | Ga0207677_10070855 | 3300026023 | Bacteria | 2458 |
| 581 | Ga0207677_10074674 | 3300026023 | Bacteria | 2407 |
| 582 | Ga0207677_10208339 | 3300026023 | Bacteria | 1559 |
| 583 | Ga0207677_10852459 | 3300026023 | Bacteria | 819 |
| 584 | Ga0207703_10007195 | 3300026035 | Bacteria | 8851 |
| 585 | Ga0207703_10211073 | 3300026035 | Bacteria | 1731 |
| 586 | Ga0207703_11225502 | 3300026035 | Bacteria | 721 |
| 587 | Ga0207639_10022564 | 3300026041 | Bacteria | 4535 |
| 588 | Ga0207639_10170551 | 3300026041 | Bacteria | 1842 |
| 589 | Ga0207639_10328382 | 3300026041 | Bacteria | 1360 |
| 590 | Ga0207639_11466101 | 3300026041 | Bacteria | 640 |
| 591 | Ga0207639_11571748 | 3300026041 | Bacteria | 617 |
| 592 | Ga0207678_10005182 | 3300026067 | Bacteria | 11681 |
| 593 | Ga0207678_10058661 | 3300026067 | Bacteria | 3312 |
| 594 | Ga0207678_10061650 | 3300026067 | Bacteria | 3226 |
| 595 | Ga0207678_10384271 | 3300026067 | Bacteria | 1214 |
| 596 | Ga0207708_10323990 | 3300026075 | Bacteria | 1258 |
| 597 | Ga0207708_10721500 | 3300026075 | Bacteria | 853 |
| 598 | Ga0207702_10045543 | 3300026078 | Bacteria | 3690 |
| 599 | Ga0207702_10246158 | 3300026078 | Bacteria | 1677 |
| 600 | Ga0207641_10022203 | 3300026088 | Bacteria | 5223 |
| 601 | Ga0207641_10962569 | 3300026088 | Bacteria | 849 |
| 602 | Ga0207641_11101144 | 3300026088 | Bacteria | 793 |
| 603 | Ga0207648_10011444 | 3300026089 | Bacteria | 8355 |
| 604 | Ga0207648_10013452 | 3300026089 | Bacteria | 7612 |
| 605 | Ga0207648_10033988 | 3300026089 | Bacteria | 4496 |
| 606 | Ga0207648_10040460 | 3300026089 | Bacteria | 4096 |
| 607 | Ga0207648_10042464 | 3300026089 | Bacteria | 3991 |
| 608 | Ga0207648_10045067 | 3300026089 | Bacteria | 3870 |
| 609 | Ga0207648_10057182 | 3300026089 | Bacteria | 3403 |
| 610 | Ga0207648_10155649 | 3300026089 | Bacteria | 2018 |
| 611 | Ga0207648_10328646 | 3300026089 | Bacteria | 1375 |
| 612 | Ga0207676_10009527 | 3300026095 | Bacteria | 6914 |
| 613 | Ga0207676_10209491 | 3300026095 | Bacteria | 1728 |
| 614 | Ga0207676_10447020 | 3300026095 | Bacteria | 1218 |
| 615 | Ga0207676_10486819 | 3300026095 | Bacteria | 1169 |
| 616 | Ga0207676_11699929 | 3300026095 | Bacteria | 629 |
| 617 | Ga0207674_10004887 | 3300026116 | Bacteria | 16041 |
| 618 | Ga0207674_10044914 | 3300026116 | Bacteria | 4549 |
| 619 | Ga0207674_10088788 | 3300026116 | Bacteria | 3084 |
| 620 | Ga0207674_10097618 | 3300026116 | Bacteria | 2922 |
| 621 | Ga0207674_10173302 | 3300026116 | Bacteria | 2110 |
| 622 | Ga0207674_10308373 | 3300026116 | Bacteria | 1532 |
| 623 | Ga0207674_10383650 | 3300026116 | Bacteria | 1358 |
| 624 | Ga0207675_100003168 | 3300026118 | Bacteria | 16147 |
| 625 | Ga0207675_100345804 | 3300026118 | Bacteria | 1456 |
| 626 | Ga0207675_101333015 | 3300026118 | Bacteria | 738 |
| 627 | Ga0207683_10010616 | 3300026121 | Bacteria | 7854 |
| 628 | Ga0207683_10019634 | 3300026121 | Bacteria | 5775 |
| 629 | Ga0207683_10126527 | 3300026121 | Bacteria | 2297 |
| 630 | Ga0207683_10172158 | 3300026121 | Bacteria | 1961 |
| 631 | Ga0207683_10260942 | 3300026121 | Bacteria | 1582 |
| 632 | Ga0207683_10533116 | 3300026121 | Bacteria | 1085 |
| 633 | Ga0207698_10034283 | 3300026142 | Bacteria | 3698 |
| 634 | Ga0207698_10115110 | 3300026142 | Bacteria | 2263 |
| 635 | Ga0207698_10982938 | 3300026142 | Bacteria | 854 |
| 636 | Ga0207698_11258856 | 3300026142 | Bacteria | 754 |
| 637 | Ga0209995_1007125 | 3300027471 | Bacteria | 1802 |
| 638 | Ga0209968_1000252 | 3300027526 | Bacteria | 9117 |
| 639 | Ga0209999_1048232 | 3300027543 | Bacteria | 803 |
| 640 | Ga0209588_1123609 | 3300027671 | Bacteria | 827 |
| 641 | Ga0209966_1000027 | 3300027695 | Bacteria | 65242 |
| 642 | Ga0209998_10025166 | 3300027717 | Bacteria | 1295 |
| 643 | Ga0209813_10007685 | 3300027866 | Bacteria | 2693 |
| 644 | Ga0209813_10027904 | 3300027866 | Bacteria | 1642 |
| 645 | Ga0209813_10031206 | 3300027866 | Bacteria | 1572 |
| 646 | Ga0209813_10074624 | 3300027866 | Bacteria | 1109 |
| 647 | Ga0209813_10127363 | 3300027866 | Bacteria | 892 |
| 648 | Ga0209813_10285985 | 3300027866 | Bacteria | 636 |
| 649 | Ga0209974_10001546 | 3300027876 | Bacteria | 8358 |
| 650 | Ga0209974_10102760 | 3300027876 | Bacteria | 1000 |
| 651 | Ga0268266_10087570 | 3300028379 | Bacteria | 2725 |
| 652 | Ga0268266_10204639 | 3300028379 | Bacteria | 1808 |
| 653 | Ga0268266_10352863 | 3300028379 | Bacteria | 1382 |
| 654 | Ga0268266_11285310 | 3300028379 | Bacteria | 707 |
| 655 | Ga0268265_10053567 | 3300028380 | Bacteria | 3057 |
| 656 | Ga0268265_10108252 | 3300028380 | Bacteria | 2262 |
| 657 | Ga0268265_10170495 | 3300028380 | Bacteria | 1859 |
| 658 | Ga0268265_10592620 | 3300028380 | Bacteria | 1058 |
| 659 | Ga0268265_11827467 | 3300028380 | Bacteria | 614 |
| 660 | Ga0268265_12395214 | 3300028380 | Bacteria | 534 |
| 661 | Ga0268264_10015734 | 3300028381 | Bacteria | 6195 |
| 662 | Ga0268264_10022308 | 3300028381 | Bacteria | 5170 |
| 663 | Ga0268264_10089369 | 3300028381 | Bacteria | 2652 |
| 664 | Ga0268264_10296405 | 3300028381 | Bacteria | 1521 |
| 665 | Ga0268264_11473446 | 3300028381 | Bacteria | 691 |
| 666 | Ga0307517_10044859 | 3300028786 | Bacteria | 4662 |
| 667 | Ga0307517_10072094 | 3300028786 | Bacteria | 3084 |
| 668 | Ga0307517_10258910 | 3300028786 | Bacteria | 1012 |
| 669 | Ga0307517_10291403 | 3300028786 | Bacteria | 922 |
| 670 | Ga0307517_10339947 | 3300028786 | Bacteria | 820 |
| 671 | Ga0307517_10432990 | 3300028786 | Bacteria | 686 |
| 672 | Ga0307515_10000006 | 3300028794 | Bacteria | 725810 |
| 673 | Ga0307515_10000048 | 3300028794 | Bacteria | 288111 |
| 674 | Ga0307515_10000178 | 3300028794 | Bacteria | 157107 |
| 675 | Ga0307515_10028802 | 3300028794 | Bacteria | 9421 |
| 676 | Ga0307515_10108583 | 3300028794 | Bacteria | 3268 |
| 677 | Ga0307515_10112860 | 3300028794 | Bacteria | 3157 |
| 678 | Ga0307515_10113929 | 3300028794 | Bacteria | 3130 |
| 679 | Ga0307515_10143436 | 3300028794 | Bacteria | 2546 |
| 680 | Ga0307515_10210945 | 3300028794 | Bacteria | 1786 |
| 681 | Ga0307515_10239825 | 3300028794 | Bacteria | 1587 |
| 682 | Ga0307511_10000082 | 3300030521 | Bacteria | 80315 |
| 683 | Ga0307512_10008458 | 3300030522 | Bacteria | 10030 |
| 684 | Ga0307512_10073753 | 3300030522 | Bacteria | 2511 |
| 685 | Ga0265327_10047228 | 3300031251 | Bacteria | 2273 |
| 686 | Ga0265327_10198720 | 3300031251 | Bacteria | 909 |
| 687 | Ga0265316_10404004 | 3300031344 | Bacteria | 983 |
| 688 | Ga0307513_10015075 | 3300031456 | Bacteria | 9380 |
| 689 | Ga0307513_10016139 | 3300031456 | Bacteria | 9021 |
| 690 | Ga0307513_10110085 | 3300031456 | Bacteria | 2750 |
| 691 | Ga0307513_10256109 | 3300031456 | Bacteria | 1543 |
| 692 | Ga0307513_10432393 | 3300031456 | Bacteria | 1044 |
| 693 | Ga0307513_10897313 | 3300031456 | Bacteria | 594 |
| 694 | Ga0307509_10000135 | 3300031507 | Bacteria | 109066 |
| 695 | Ga0307509_10002023 | 3300031507 | Bacteria | 33484 |
| 696 | Ga0307509_10003789 | 3300031507 | Bacteria | 22447 |
| 697 | Ga0307509_10023592 | 3300031507 | Bacteria | 6902 |
| 698 | Ga0307509_10049870 | 3300031507 | Bacteria | 4485 |
| 699 | Ga0307509_10063411 | 3300031507 | Bacteria | 3891 |
| 700 | Ga0307509_10506372 | 3300031507 | Bacteria | 891 |
| 701 | Ga0307408_100037340 | 3300031548 | Bacteria | 3421 |
| 702 | Ga0307408_100366711 | 3300031548 | Bacteria | 1227 |
| 703 | Ga0307408_100555038 | 3300031548 | Bacteria | 1014 |
| 704 | Ga0307408_101342350 | 3300031548 | Bacteria | 671 |
| 705 | Ga0307408_102469856 | 3300031548 | Bacteria | 505 |
| 706 | Ga0307508_10002258 | 3300031616 | Bacteria | 20542 |
| 707 | Ga0307508_10003213 | 3300031616 | Bacteria | 16704 |
| 708 | Ga0307508_10068798 | 3300031616 | Bacteria | 3111 |
| 709 | Ga0307508_10364060 | 3300031616 | Bacteria | 1037 |
| 710 | Ga0307508_10583914 | 3300031616 | Bacteria | 717 |
| 711 | Ga0307514_10000567 | 3300031649 | Bacteria | 70155 |
| 712 | Ga0307514_10015044 | 3300031649 | Bacteria | 6391 |
| 713 | Ga0307514_10191360 | 3300031649 | Bacteria | 1302 |
| 714 | Ga0307514_10322951 | 3300031649 | Bacteria | 845 |
| 715 | Ga0307516_10000068 | 3300031730 | Bacteria | 111515 |
| 716 | Ga0307516_10000677 | 3300031730 | Bacteria | 46191 |
| 717 | Ga0307516_10001526 | 3300031730 | Bacteria | 31910 |
| 718 | Ga0307516_10083550 | 3300031730 | Bacteria | 3034 |
| 719 | Ga0307516_10088249 | 3300031730 | Bacteria | 2934 |
| 720 | Ga0307516_10139836 | 3300031730 | Bacteria | 2192 |
| 721 | Ga0307516_10531078 | 3300031730 | Bacteria | 830 |
| 722 | Ga0307516_10689599 | 3300031730 | Bacteria | 678 |
| 723 | Ga0307516_10815190 | 3300031730 | Bacteria | 595 |
| 724 | Ga0307405_10006161 | 3300031731 | Bacteria | 5875 |
| 725 | Ga0307405_11098881 | 3300031731 | Bacteria | 683 |
| 726 | Ga0307405_11426447 | 3300031731 | Bacteria | 606 |
| 727 | Ga0307405_11461925 | 3300031731 | Bacteria | 599 |
| 728 | Ga0307413_10005022 | 3300031824 | Bacteria | 5842 |
| 729 | Ga0307413_10513633 | 3300031824 | Bacteria | 965 |
| 730 | Ga0307413_11369641 | 3300031824 | Bacteria | 621 |
| 731 | Ga0307413_11462731 | 3300031824 | Bacteria | 603 |
| 732 | Ga0307413_12088653 | 3300031824 | Bacteria | 512 |
| 733 | Ga0307410_10052989 | 3300031852 | Bacteria | 2743 |
| 734 | Ga0307410_10118795 | 3300031852 | Bacteria | 1925 |
| 735 | Ga0307410_10147993 | 3300031852 | Bacteria | 1745 |
| 736 | Ga0307410_10208782 | 3300031852 | Unclassified | 1495 |
| 737 | Ga0307410_10385702 | 3300031852 | Bacteria | 1128 |
| 738 | Ga0307410_10616049 | 3300031852 | Bacteria | 907 |
| 739 | Ga0307410_11609936 | 3300031852 | Bacteria | 574 |
| 740 | Ga0307406_10248496 | 3300031901 | Bacteria | 1338 |
| 741 | Ga0307406_10371802 | 3300031901 | Bacteria | 1124 |
| 742 | Ga0307406_11580603 | 3300031901 | Bacteria | 579 |
| 743 | Ga0307406_11724484 | 3300031901 | Bacteria | 555 |
| 744 | Ga0307407_10144012 | 3300031903 | Bacteria | 1541 |
| 745 | Ga0307407_10149037 | 3300031903 | Bacteria | 1518 |
| 746 | Ga0307407_10311361 | 3300031903 | Bacteria | 1101 |
| 747 | Ga0307412_10028899 | 3300031911 | Bacteria | 3475 |
| 748 | Ga0307412_10141870 | 3300031911 | Bacteria | 1761 |
| 749 | Ga0307412_10169770 | 3300031911 | Bacteria | 1630 |
| 750 | Ga0307412_10186141 | 3300031911 | Bacteria | 1566 |
| 751 | Ga0307412_10217234 | 3300031911 | Bacteria | 1463 |
| 752 | Ga0307412_10225048 | 3300031911 | Bacteria | 1441 |
| 753 | Ga0307412_11188707 | 3300031911 | Bacteria | 682 |
| 754 | Ga0307412_11204519 | 3300031911 | Bacteria | 678 |
| 755 | Ga0307409_100009537 | 3300031995 | Bacteria | 5971 |
| 756 | Ga0307409_100501518 | 3300031995 | Bacteria | 1182 |
| 757 | Ga0307416_100025405 | 3300032002 | Bacteria | 4341 |
| 758 | Ga0307416_100176148 | 3300032002 | Bacteria | 1998 |
| 759 | Ga0307416_100183202 | 3300032002 | Bacteria | 1965 |
| 760 | Ga0307416_100237905 | 3300032002 | Bacteria | 1762 |
| 761 | Ga0307416_101087294 | 3300032002 | Bacteria | 904 |
| 762 | Ga0307416_101423190 | 3300032002 | Unclassified | 799 |
| 763 | Ga0307416_101933650 | 3300032002 | Bacteria | 693 |
| 764 | Ga0307416_102366955 | 3300032002 | Bacteria | 631 |
| 765 | Ga0307414_10056000 | 3300032004 | Bacteria | 2763 |
| 766 | Ga0307414_10208303 | 3300032004 | Bacteria | 1596 |
| 767 | Ga0307414_10246193 | 3300032004 | Bacteria | 1483 |
| 768 | Ga0307414_10595351 | 3300032004 | Bacteria | 991 |
| 769 | Ga0307414_10959937 | 3300032004 | Bacteria | 786 |
| 770 | Ga0307411_10006035 | 3300032005 | Bacteria | 6021 |
| 771 | Ga0307411_10142318 | 3300032005 | Bacteria | 1770 |
| 772 | Ga0307411_10245047 | 3300032005 | Bacteria | 1406 |
| 773 | Ga0307411_11158388 | 3300032005 | Bacteria | 699 |
| 774 | Ga0307415_100006492 | 3300032126 | Bacteria | 6318 |
| 775 | Ga0307415_101337455 | 3300032126 | Bacteria | 680 |
| 776 | Ga0307507_10048825 | 3300033179 | Bacteria | 4111 |
| 777 | Ga0307507_10106197 | 3300033179 | Bacteria | 2320 |
| 778 | Ga0307510_10000170 | 3300033180 | Bacteria | 55071 |
| 779 | Ga0307510_10009424 | 3300033180 | Bacteria | 11633 |
| 780 | Ga0307510_10403669 | 3300033180 | Bacteria | 809 |
| 781 | Ga0373959_0078851 | 3300034820 | Bacteria | 756 |
| 782 | Ga0373959_0196003 | 3300034820 | Bacteria | 531 |
| 783 | Ga0373926_0011423 | 3300035083 | Bacteria | 2987 |
| 784 | Ga0373928_0049414 | 3300035084 | Bacteria | 989 |
| 785 | Ga0373929_0229875 | 3300035085 | Bacteria | 531 |
| 786 | Ga0373934_0000092 | 3300035086 | Bacteria | 31400 |
| 787 | Ga0373934_0089259 | 3300035086 | Bacteria | 1241 |
| 788 | Ga0373934_0360412 | 3300035086 | Bacteria | 606 |
| 789 | Ga0373944_0224777 | 3300035089 | Bacteria | 686 |
| 790 | Ga0373952_0182677 | 3300035092 | Bacteria | 606 |
| 791 | Ga0373923_0001839 | 3300035111 | Bacteria | 6291 |
| 792 | Ga0373923_0207404 | 3300035111 | Bacteria | 907 |
| 793 | Ga0373932_0008780 | 3300035112 | Bacteria | 2419 |
| 794 | Ga0373936_0014253 | 3300035113 | Bacteria | 3038 |
| 795 | Ga0373936_0019494 | 3300035113 | Bacteria | 2628 |
| 796 | Ga0373936_0136094 | 3300035113 | Bacteria | 1058 |
| 797 | Ga0373936_0342077 | 3300035113 | Bacteria | 680 |
| 798 | Ga0373939_0230382 | 3300035114 | Bacteria | 713 |
| 799 | Ga0373945_0301848 | 3300035116 | Bacteria | 686 |
| 800 | Ga0373945_0558620 | 3300035116 | Unclassified | 514 |
| 801 | Ga0373953_0007328 | 3300035117 | Bacteria | 3690 |
| 802 | Ga0373954_0013776 | 3300035118 | Bacteria | 3603 |
| 803 | Ga0373954_0018723 | 3300035118 | Bacteria | 3119 |
| 804 | Ga0373956_0004332 | 3300035119 | Bacteria | 5697 |
| 805 | Ga0373956_0071476 | 3300035119 | Bacteria | 1583 |
| 806 | Ga0373957_0004771 | 3300035120 | Bacteria | 4152 |
| 807 | Ga0373957_0009012 | 3300035120 | Bacteria | 3253 |
| 808 | Ga0373960_0092695 | 3300035121 | Bacteria | 968 |
| 809 | Ga0373943_0019914 | 3300035170 | Bacteria | 3091 |
| 810 | Ga0373946_0015558 | 3300035171 | Bacteria | 2887 |
| 811 | Ga0373946_0329087 | 3300035171 | Bacteria | 760 |
| 812 | Ga0373955_0002722 | 3300035172 | Bacteria | 7739 |
| 813 | Ga0373955_0105591 | 3300035172 | Bacteria | 1622 |
| 814 | Ga0373955_0152970 | 3300035172 | Bacteria | 1358 |
| 815 | Ga0373955_0464919 | 3300035172 | Bacteria | 771 |
| 816 | Ga0373942_0371596 | 3300035207 | Bacteria | 509 |
| 817 | Ga0373924_0003563 | 3300035410 | Bacteria | 5365 |
| 818 | Ga0373931_0028054 | 3300035691 | Bacteria | 2879 |
| 819 | Ga0373931_0509810 | 3300035691 | Bacteria | 777 |
| 820 | Ga0373931_0633107 | 3300035691 | Bacteria | 701 |
| 821 | Ga0373931_0692833 | 3300035691 | Bacteria | 672 |
| 822 | Ga0373935_0042801 | 3300035692 | Bacteria | 2848 |
| 823 | Ga0373935_0050707 | 3300035692 | Bacteria | 2634 |
| 824 | Ga0373927_0019356 | 3300035695 | Bacteria | 4464 |
| 825 | Ga0373927_0027651 | 3300035695 | Bacteria | 3702 |
| 826 | Ga0373933_0011004 | 3300035724 | Bacteria | 4970 |
| 827 | Ga0373933_0024114 | 3300035724 | Bacteria | 3482 |
| 828 | Ga0373933_0541618 | 3300035724 | Bacteria | 763 |
| 829 | Ga0373947_0171798 | 3300035725 | Bacteria | 1407 |
| 830 | Ga0373947_0289565 | 3300035725 | Bacteria | 1090 |
| 831 | Ga0373937_0003933 | 3300036401 | Bacteria | 12555 |
| 832 | Ga0373937_0049598 | 3300036401 | Bacteria | 3844 |
| 833 | Ga0373937_0317900 | 3300036401 | Bacteria | 1473 |
| 834 | Ga0373937_0462106 | 3300036401 | Bacteria | 1205 |
| 835 | Ga0373937_0495843 | 3300036401 | Bacteria | 1160 |
| 836 | Ga0373937_0607935 | 3300036401 | Bacteria | 1038 |
| 837 | Ga0373937_0655170 | 3300036401 | Bacteria | 995 |
| 838 | Ga0373937_1021581 | 3300036401 | Bacteria | 775 |
| 839 | Ga0373937_1945048 | 3300036401 | Bacteria | 534 |
| 840 | Ga0373925_0021793 | 3300037068 | Bacteria | 4671 |
| 841 | Ga0373925_0038647 | 3300037068 | Bacteria | 3529 |
| 842 | Ga0373925_0073187 | 3300037068 | Bacteria | 2593 |
| 843 | Ga0373925_0102290 | 3300037068 | Bacteria | 2204 |
| 844 | Ga0373925_0438816 | 3300037068 | Bacteria | 1068 |
| 845 | Ga0373925_0475128 | 3300037068 | Bacteria | 1025 |
| 846 | Ga0373925_0740020 | 3300037068 | Bacteria | 811 |
| 847 | Ga0373925_1306608 | 3300037068 | Bacteria | 595 |
| 848 | Ga0373925_1664843 | 3300037068 | Bacteria | 521 |
| 849 | Ga0395905_0005986 | 3300037471 | Bacteria | 12317 |
| 850 | Ga0395905_0006586 | 3300037471 | Bacteria | 11665 |
| 851 | Ga0436364_0041268 | 3300037853 | Bacteria | 1203 |
| 852 | Ga0436364_0145601 | 3300037853 | Bacteria | 2099 |
| 853 | Ga0436361_0144002 | 3300039447 | Bacteria | 44507 |
| 854 | Ga0436361_0427460 | 3300039447 | Bacteria | 107545 |
| 855 | Ga0436361_0677106 | 3300039447 | Bacteria | 4214 |
| 856 | Ga0436363_0908329 | 3300039450 | Bacteria | 517 |
| 857 | Ga0439461_0011063 | 3300041410 | Bacteria | 1669 |
| 858 | Ga0451787_108726 | 3300041441 | Bacteria | 786 |
| 859 | Ga0451791_0258275 | 3300041451 | Bacteria | 905 |
| 860 | Ga0451793_0385879 | 3300041452 | Bacteria | 540 |
| 861 | Ga0451795_0098800 | 3300041456 | Bacteria | 543 |
| 862 | Ga0451798_0690418 | 3300041458 | Bacteria | 782 |
| 863 | Ga0451802_0097874 | 3300041460 | Bacteria | 701 |
| 864 | Ga0451804_0518901 | 3300041463 | Bacteria | 744 |
| 865 | Ga0451807_0660491 | 3300041486 | Bacteria | 788 |
| 866 | Ga0451807_1855817 | 3300041486 | Bacteria | 780 |
| 867 | Ga0451807_2535304 | 3300041486 | Bacteria | 645 |
| 868 | Ga0451833_0364967 | 3300041491 | Bacteria | 646 |
| 869 | Ga0451839_0985847 | 3300041496 | Bacteria | 658 |
| 870 | Ga0451845_0812550 | 3300041501 | Bacteria | 547 |
| 871 | Ga0451851_1327704 | 3300041507 | Bacteria | 1047 |
| 872 | Ga0451843_0719174 | 3300041509 | Bacteria | 568 |
| 873 | Ga0451843_1018189 | 3300041509 | Bacteria | 693 |
| 874 | Ga0451843_1143476 | 3300041509 | Bacteria | 546 |
| 875 | Ga0451855_0621740 | 3300041511 | Bacteria | 697 |
| 876 | Ga0451853_1855892 | 3300041512 | Bacteria | 547 |
| 877 | Ga0451853_2145180 | 3300041512 | Bacteria | 574 |
| 878 | Ga0451853_3592373 | 3300041512 | Bacteria | 1736 |
| 879 | Ga0439431_0003099 | 3300041997 | Bacteria | 3653 |
| 880 | Ga0439431_0022429 | 3300041997 | Bacteria | 1521 |
| 881 | Ga0439441_040866 | 3300042001 | Bacteria | 929 |
| 882 | Ga0439442_083723 | 3300042002 | Bacteria | 684 |
| 883 | Ga0439445_0069538 | 3300042004 | Bacteria | 972 |
| 884 | Ga0439445_0095564 | 3300042004 | Bacteria | 840 |
| 885 | Ga0439449_0176244 | 3300042007 | Bacteria | 799 |
| 886 | Ga0439449_0375104 | 3300042007 | Bacteria | 539 |
| 887 | Ga0450911_000064 | 3300042115 | Bacteria | 43716 |
| 888 | Ga0450917_012394 | 3300042120 | Bacteria | 694 |
| 889 | Ga0450888_013759 | 3300042126 | Bacteria | 973 |
| 890 | Ga0450890_037612 | 3300042127 | Bacteria | 707 |
| 891 | Ga0450896_062047 | 3300042133 | Bacteria | 610 |
| 892 | Ga0450898_115335 | 3300042134 | Bacteria | 571 |
| 893 | Ga0450899_011151 | 3300042135 | Bacteria | 1001 |
| 894 | Ga0450889_052289 | 3300042144 | Bacteria | 504 |
| 895 | Ga0450910_077718 | 3300042147 | Bacteria | 577 |
| 896 | Ga0439446_0162451 | 3300042156 | Bacteria | 739 |
| 897 | Ga0439434_0024180 | 3300042435 | Bacteria | 1832 |
| 898 | Ga0439459_0120093 | 3300042438 | Bacteria | 662 |
| 899 | Ga0451577_0000843 | 3300042876 | Bacteria | 45842 |
| 900 | Ga0451577_0019207 | 3300042876 | Bacteria | 6285 |
| 901 | Ga0451577_0031701 | 3300042876 | Bacteria | 4768 |
| 902 | Ga0451577_0105948 | 3300042876 | Bacteria | 2513 |
| 903 | Ga0451577_0128968 | 3300042876 | Bacteria | 2268 |
| 904 | Ga0451577_0172323 | 3300042876 | Bacteria | 1950 |
| 905 | Ga0451577_0261180 | 3300042876 | Bacteria | 1568 |
| 906 | Ga0451577_0305536 | 3300042876 | Bacteria | 1441 |
| 907 | Ga0451577_0637692 | 3300042876 | Bacteria | 966 |
| 908 | Ga0451577_0844880 | 3300042876 | Bacteria | 826 |
| 909 | Ga0453683_0242924 | 3300044673 | Bacteria | 1147 |
| 910 | Ga0453684_0043301 | 3300044712 | Bacteria | 6052 |
| 911 | Ga0453684_0167558 | 3300044712 | Bacteria | 2592 |
| 912 | Ga0453684_0222854 | 3300044712 | Bacteria | 2183 |
| 913 | Ga0453684_0326879 | 3300044712 | Bacteria | 1735 |
| 914 | Ga0453684_0355134 | 3300044712 | Bacteria | 1652 |
| 915 | Ga0453684_0414754 | 3300044712 | Bacteria | 1505 |
| 916 | Ga0453684_0497056 | 3300044712 | Bacteria | 1351 |
| 917 | Ga0453684_0545664 | 3300044712 | Bacteria | 1278 |
| 918 | Ga0453684_0632424 | 3300044712 | Bacteria | 1169 |
| 919 | Ga0453684_0846047 | 3300044712 | Bacteria | 983 |
| 920 | Ga0451576_0016269 | 3300045051 | Bacteria | 8216 |
| 921 | Ga0451576_0182140 | 3300045051 | Bacteria | 2193 |
| 922 | Ga0451576_0204453 | 3300045051 | Bacteria | 2062 |
| 923 | Ga0451576_0273763 | 3300045051 | Bacteria | 1765 |
| 924 | Ga0451576_0396581 | 3300045051 | Bacteria | 1447 |
| 925 | Ga0451576_0657900 | 3300045051 | Bacteria | 1101 |
| 926 | Ga0495592_0002300 | 3300046454 | Bacteria | 13481 |
| 927 | Ga0495592_0018151 | 3300046454 | Bacteria | 5346 |
| 928 | Ga0495592_0045062 | 3300046454 | Bacteria | 3292 |
| 929 | Ga0495592_0124858 | 3300046454 | Bacteria | 1807 |
| 930 | Ga0495603_0194372 | 3300046455 | Bacteria | 1173 |
| 931 | Ga0495590_0140922 | 3300046457 | Bacteria | 870 |
| 932 | Ga0495629_0478951 | 3300046459 | Bacteria | 841 |
| 933 | Ga0495638_0118898 | 3300046460 | Bacteria | 1563 |
| 934 | Ga0495638_0153200 | 3300046460 | Bacteria | 1336 |
| 935 | Ga0495638_0378659 | 3300046460 | Bacteria | 740 |
| 936 | Ga0495641_0007404 | 3300046461 | Bacteria | 6861 |
| 937 | Ga0495651_0001600 | 3300046462 | Bacteria | 17516 |
| 938 | Ga0495651_0002209 | 3300046462 | Bacteria | 15019 |
| 939 | Ga0495653_0242741 | 3300046463 | Bacteria | 1199 |
| 940 | Ga0495650_0085118 | 3300046471 | Bacteria | 1212 |
| 941 | Ga0495580_0017228 | 3300046472 | Bacteria | 5408 |
| 942 | Ga0495582_0023691 | 3300046473 | Bacteria | 3357 |
| 943 | Ga0495639_0005105 | 3300046475 | Bacteria | 5639 |
| 944 | Ga0495662_0012408 | 3300046476 | Bacteria | 4158 |
| 945 | Ga0495664_0035511 | 3300046477 | Bacteria | 2935 |
| 946 | Ga0495583_0086491 | 3300046506 | Bacteria | 1356 |
| 947 | Ga0495606_0146348 | 3300046507 | Bacteria | 1391 |
| 948 | Ga0495608_0003952 | 3300046511 | Bacteria | 10652 |
| 949 | Ga0495608_0293295 | 3300046511 | Bacteria | 1008 |
| 950 | Ga0495616_0234446 | 3300046513 | Bacteria | 794 |
| 951 | Ga0495618_0033008 | 3300046514 | Bacteria | 3244 |
| 952 | Ga0495620_0153980 | 3300046515 | Bacteria | 895 |
| 953 | Ga0495628_0004302 | 3300046516 | Bacteria | 12651 |
| 954 | Ga0495628_0008390 | 3300046516 | Bacteria | 8861 |
| 955 | Ga0495630_0186935 | 3300046517 | Bacteria | 1580 |
| 956 | Ga0495630_0218555 | 3300046517 | Bacteria | 1455 |
| 957 | Ga0495630_0438598 | 3300046517 | Bacteria | 1001 |
| 958 | Ga0495632_0026107 | 3300046519 | Bacteria | 3079 |
| 959 | Ga0495643_0200544 | 3300046522 | Bacteria | 958 |
| 960 | Ga0495648_0075809 | 3300046524 | Bacteria | 1933 |
| 961 | Ga0495648_0172759 | 3300046524 | Bacteria | 1106 |
| 962 | Ga0495648_0431841 | 3300046524 | Bacteria | 581 |
| 963 | Ga0495666_0003491 | 3300046526 | Bacteria | 7937 |
| 964 | Ga0495642_0222995 | 3300046528 | Bacteria | 823 |
| 965 | Ga0495652_0002967 | 3300046529 | Bacteria | 17081 |
| 966 | Ga0495652_0026875 | 3300046529 | Bacteria | 5077 |
| 967 | Ga0495654_0357509 | 3300046530 | Bacteria | 586 |
| 968 | Ga0495665_0039307 | 3300046531 | Bacteria | 2520 |
| 969 | Ga0495640_0805887 | 3300046533 | Bacteria | 559 |
| 970 | Ga0495586_0016380 | 3300046535 | Bacteria | 3942 |
| 971 | Ga0495586_0055189 | 3300046535 | Bacteria | 2153 |
| 972 | Ga0495587_0002613 | 3300046536 | Bacteria | 12037 |
| 973 | Ga0495598_0179321 | 3300046537 | Bacteria | 755 |
| 974 | Ga0495597_0000116 | 3300046542 | Bacteria | 72210 |
| 975 | Ga0495597_0047545 | 3300046542 | Bacteria | 1899 |
| 976 | Ga0495597_0080236 | 3300046542 | Bacteria | 1396 |
| 977 | Ga0495645_0017400 | 3300046543 | Bacteria | 5148 |
| 978 | Ga0495622_0013250 | 3300046557 | Bacteria | 3827 |
| 979 | Ga0495633_0506825 | 3300046558 | Bacteria | 544 |
| 980 | Ga0495667_0058327 | 3300046559 | Bacteria | 2536 |
| 981 | Ga0495667_0161254 | 3300046559 | Bacteria | 1442 |
| 982 | Ga0495667_0189183 | 3300046559 | Bacteria | 1319 |
| 983 | Ga0495668_0069990 | 3300046616 | Bacteria | 1929 |
| 984 | Ga0495668_0443489 | 3300046616 | Bacteria | 714 |
| 985 | Ga0495634_0060300 | 3300046642 | Bacteria | 2524 |
| 986 | Ga0495625_0481068 | 3300046660 | Bacteria | 762 |
| 987 | Ga0495625_0548161 | 3300046660 | Bacteria | 701 |
| 988 | Ga0495625_0875477 | 3300046660 | Bacteria | 517 |
| 989 | Ga0495635_0017152 | 3300046663 | Bacteria | 5057 |
| 990 | Ga0495657_0017464 | 3300046675 | Bacteria | 5207 |
| 991 | Ga0495657_0535412 | 3300046675 | Bacteria | 681 |
| 992 | Ga0495599_0011947 | 3300046678 | Bacteria | 5340 |
| 993 | Ga0495599_0015613 | 3300046678 | Bacteria | 4714 |
| 994 | Ga0495599_0038730 | 3300046678 | Bacteria | 2996 |
| 995 | Ga0495646_0018322 | 3300046680 | Bacteria | 4435 |
| 996 | Ga0495646_0132969 | 3300046680 | Bacteria | 1399 |
| 997 | Ga0495647_0014541 | 3300046681 | Bacteria | 2743 |
| 998 | Ga0495647_0163823 | 3300046681 | Bacteria | 959 |
| 999 | Ga0495658_0025108 | 3300046683 | Bacteria | 3183 |
| 1000 | Ga0495658_0026522 | 3300046683 | Bacteria | 3106 |
| 1001 | Ga0495658_0040043 | 3300046683 | Bacteria | 2604 |
| 1002 | Ga0495658_0110485 | 3300046683 | Bacteria | 1652 |
| 1003 | Ga0495658_0191753 | 3300046683 | Bacteria | 1271 |
| 1004 | Ga0495658_0554276 | 3300046683 | Bacteria | 736 |
| 1005 | Ga0495613_0083494 | 3300046689 | Bacteria | 2319 |
| 1006 | Ga0495624_0014311 | 3300046690 | Bacteria | 5387 |
| 1007 | Ga0495624_0083647 | 3300046690 | Bacteria | 1973 |
| 1008 | Ga0495670_0172367 | 3300046691 | Bacteria | 1140 |
| 1009 | Ga0495671_0166580 | 3300046692 | Bacteria | 1072 |
| 1010 | Ga0495671_0339833 | 3300046692 | Bacteria | 720 |
| 1011 | Ga0495649_0002438 | 3300046694 | Bacteria | 13091 |
| 1012 | Ga0495600_0019882 | 3300046809 | Bacteria | 4292 |
| 1013 | Ga0495581_0155377 | 3300047315 | Bacteria | 1337 |
| 1014 | Ga0495604_0025969 | 3300047317 | Bacteria | 4665 |
| 1015 | Ga0495674_0427473 | 3300047319 | Bacteria | 1066 |
| 1016 | Ga0495676_0255681 | 3300047321 | Bacteria | 1193 |
| 1017 | Ga0495680_0107777 | 3300047322 | Bacteria | 2068 |
| 1018 | Ga0495680_0651977 | 3300047322 | Bacteria | 699 |
| 1019 | Ga0495687_000328 | 3300047443 | Bacteria | 61170 |
| 1020 | Ga0495687_003100 | 3300047443 | Bacteria | 12441 |
| 1021 | Ga0495687_196581 | 3300047443 | Bacteria | 644 |
| 1022 | Ga0495675_0001531 | 3300047444 | Bacteria | 13954 |
| 1023 | Ga0495675_0094467 | 3300047444 | Bacteria | 1875 |
| 1024 | Ga0495677_0198732 | 3300047445 | Bacteria | 779 |
| 1025 | Ga0495679_049230 | 3300047446 | Bacteria | 1272 |
| 1026 | Ga0495673_0277409 | 3300047469 | Bacteria | 606 |
| 1027 | Ga0495681_0330156 | 3300047470 | Bacteria | 584 |
| 1028 | Ga0495684_0005095 | 3300047471 | Bacteria | 10247 |
| 1029 | Ga0495684_0304677 | 3300047471 | Bacteria | 1143 |
| 1030 | Ga0495686_0000992 | 3300047472 | Bacteria | 34617 |
| 1031 | Ga0495686_0167469 | 3300047472 | Bacteria | 1280 |
| 1032 | Ga0495686_0421970 | 3300047472 | Bacteria | 713 |
| 1033 | Ga0495593_0680229 | 3300047673 | Bacteria | 517 |
| 1034 | Ga0495602_0438485 | 3300048088 | Bacteria | 924 |
| 1035 | Ga0495602_0441654 | 3300048088 | Bacteria | 920 |
| 1036 | Ga0495602_0943119 | 3300048088 | Bacteria | 572 |
| 1037 | Ga0495626_0246832 | 3300048091 | Bacteria | 717 |
| 1038 | Ga0496101_0130117 | 3300048904 | Bacteria | 1911 |
| 1039 | Ga0496102_1779792 | 3300048905 | Bacteria | 533 |
| 1040 | Ga0496104_0524412 | 3300048907 | Bacteria | 1096 |
| 1041 | Ga0496104_0621853 | 3300048907 | Bacteria | 990 |
| 1042 | Ga0496106_0055989 | 3300048909 | Bacteria | 2981 |
| 1043 | Ga0496108_0058365 | 3300048911 | Bacteria | 3244 |
| 1044 | Ga0496108_0219302 | 3300048911 | Bacteria | 1653 |
| 1045 | Ga0496108_1757685 | 3300048911 | Bacteria | 509 |
| 1046 | Ga0496109_0188793 | 3300048912 | Bacteria | 1936 |
| 1047 | Ga0496110_0273726 | 3300048913 | Bacteria | 1537 |
| 1048 | Ga0496112_0551025 | 3300048915 | Bacteria | 1087 |
| 1049 | Ga0496113_0449754 | 3300048916 | Bacteria | 1035 |
| 1050 | Ga0496113_1603142 | 3300048916 | Bacteria | 501 |
| 1051 | Ga0496114_0032738 | 3300048917 | Bacteria | 4281 |
| 1052 | Ga0496114_0420814 | 3300048917 | Bacteria | 1183 |
| 1053 | Ga0496114_0706632 | 3300048917 | Bacteria | 884 |
| 1054 | Ga0496121_0034400 | 3300048924 | Bacteria | 4561 |
| 1055 | Ga0496121_0432796 | 3300048924 | Bacteria | 853 |
| 1056 | Ga0496124_0048814 | 3300048927 | Bacteria | 3614 |
| 1057 | Ga0496124_0155790 | 3300048927 | Bacteria | 1787 |
| 1058 | Ga0496125_0141311 | 3300048928 | Bacteria | 1673 |
| 1059 | Ga0496125_0182268 | 3300048928 | Bacteria | 1397 |
| 1060 | Ga0496125_0766763 | 3300048928 | Bacteria | 503 |
| 1061 | Ga0501297_030494 | 3300049520 | Bacteria | 716 |
| 1062 | Ga0501298_020738 | 3300049521 | Bacteria | 1227 |
| 1063 | Ga0501300_035560 | 3300049523 | Bacteria | 742 |
| 1064 | Ga0501301_001189 | 3300049524 | Bacteria | 1632 |
| 1065 | Ga0501303_001065 | 3300049526 | Bacteria | 2054 |
| 1066 | Ga0501031_0001187 | 3300049568 | Bacteria | 15843 |
| 1067 | Ga0501031_0118225 | 3300049568 | Bacteria | 1732 |
| 1068 | Ga0501033_0034547 | 3300049570 | Bacteria | 3792 |
| 1069 | Ga0501034_0223376 | 3300049571 | Bacteria | 1835 |
| 1070 | Ga0501036_0083136 | 3300049572 | Bacteria | 2706 |
| 1071 | Ga0501036_1043307 | 3300049572 | Bacteria | 669 |
| 1072 | Ga0501037_0903778 | 3300049573 | Bacteria | 579 |
| 1073 | Ga0501038_0540909 | 3300049574 | Bacteria | 887 |
| 1074 | Ga0501039_0344078 | 3300049575 | Bacteria | 1172 |
| 1075 | Ga0501039_0567692 | 3300049575 | Bacteria | 890 |
| 1076 | Ga0501041_0001914 | 3300049577 | Bacteria | 11673 |
| 1077 | Ga0501042_0096978 | 3300049578 | Bacteria | 2119 |
| 1078 | Ga0501042_0828742 | 3300049578 | Bacteria | 673 |
| 1079 | Ga0501043_0000059 | 3300049579 | Bacteria | 101444 |
| 1080 | Ga0501043_0534957 | 3300049579 | Bacteria | 872 |
| 1081 | Ga0501046_0000082 | 3300049580 | Bacteria | 101313 |
| 1082 | Ga0501047_0000050 | 3300049581 | Bacteria | 155628 |
| 1083 | Ga0501047_0018628 | 3300049581 | Bacteria | 6657 |
| 1084 | Ga0501048_0018113 | 3300049582 | Bacteria | 5181 |
| 1085 | Ga0501048_0836356 | 3300049582 | Bacteria | 662 |
| 1086 | Ga0501067_0155854 | 3300049583 | Bacteria | 1272 |
| 1087 | Ga0501067_0213865 | 3300049583 | Bacteria | 1074 |
| 1088 | Ga0501067_0385467 | 3300049583 | Bacteria | 781 |
| 1089 | Ga0501068_0010614 | 3300049584 | Bacteria | 5181 |
| 1090 | Ga0501068_0866314 | 3300049584 | Bacteria | 594 |
| 1091 | Ga0501069_0267212 | 3300049585 | Bacteria | 999 |
| 1092 | Ga0501070_0168367 | 3300049586 | Bacteria | 1805 |
| 1093 | Ga0501072_0064396 | 3300049588 | Bacteria | 2891 |
| 1094 | Ga0501072_0121924 | 3300049588 | Bacteria | 2077 |
| 1095 | Ga0501074_0070030 | 3300049590 | Bacteria | 2522 |
| 1096 | Ga0501075_0144169 | 3300049591 | Bacteria | 1815 |
| 1097 | Ga0501076_0040425 | 3300049592 | Bacteria | 3665 |
| 1098 | Ga0501076_0043317 | 3300049592 | Bacteria | 3546 |
| 1099 | Ga0501076_1297372 | 3300049592 | Bacteria | 599 |
| 1100 | Ga0501076_1311166 | 3300049592 | Bacteria | 595 |
| 1101 | Ga0501077_0004802 | 3300049593 | Bacteria | 8216 |
| 1102 | Ga0501077_0378880 | 3300049593 | Bacteria | 904 |
| 1103 | Ga0501198_084939 | 3300049649 | Bacteria | 619 |
| 1104 | Ga0501222_017605 | 3300049662 | Bacteria | 947 |
| 1105 | Ga0501223_028488 | 3300049663 | Bacteria | 1088 |
| 1106 | Ga0501233_137999 | 3300049668 | Bacteria | 671 |
| 1107 | Ga0501236_125398 | 3300049670 | Bacteria | 525 |
| 1108 | Ga0501257_203693 | 3300049686 | Bacteria | 570 |
| 1109 | Ga0501221_176672 | 3300049704 | Bacteria | 581 |
| 1110 | Ga0501079_0058608 | 3300049741 | Bacteria | 2971 |
| 1111 | Ga0501079_1107761 | 3300049741 | Bacteria | 624 |
| 1112 | Ga0501079_1283637 | 3300049741 | Bacteria | 576 |
| 1113 | Ga0501080_0003122 | 3300049742 | Bacteria | 14606 |
| 1114 | Ga0501080_0409118 | 3300049742 | Bacteria | 1220 |
| 1115 | Ga0501081_0274726 | 3300049743 | Bacteria | 1233 |
| 1116 | Ga0501081_0357849 | 3300049743 | Bacteria | 1076 |
| 1117 | Ga0501081_1554689 | 3300049743 | Bacteria | 503 |
| 1118 | Ga0501083_0114806 | 3300049744 | Bacteria | 1768 |
| 1119 | Ga0501262_002075 | 3300049759 | Bacteria | 2263 |
| 1120 | Ga0501263_016317 | 3300049760 | Bacteria | 966 |
| 1121 | Ga0501264_057141 | 3300049761 | Bacteria | 517 |
| 1122 | Ga0501265_000298 | 3300049762 | Bacteria | 5106 |
| 1123 | Ga0501275_069972 | 3300049772 | Bacteria | 551 |
| 1124 | Ga0501283_032095 | 3300049779 | Bacteria | 884 |
| 1125 | Ga0501035_0238803 | 3300049822 | Bacteria | 1546 |
| 1126 | Ga0501035_0270865 | 3300049822 | Bacteria | 1437 |
| 1127 | Ga0501044_1336083 | 3300049823 | Bacteria | 583 |
| 1128 | Ga0501045_0004217 | 3300049824 | Bacteria | 9919 |
| 1129 | Ga0501045_0387234 | 3300049824 | Bacteria | 1041 |
| 1130 | nmdc:mga03683_10542_c1 | 3300050489 | Bacteria | 2981 |
| 1131 | nmdc:mga03683_107762_c1 | 3300050489 | Bacteria | 1229 |
| 1132 | nmdc:mga03683_19613_c1 | 3300050489 | Bacteria | 2584 |
| 1133 | nmdc:mga03683_210524_c1 | 3300050489 | Bacteria | 894 |
| 1134 | nmdc:mga03683_242205_c1 | 3300050489 | Bacteria | 836 |
| 1135 | nmdc:mga03683_3074_c1 | 3300050489 | Bacteria | 5303 |
| 1136 | nmdc:mga03683_338682_c1 | 3300050489 | Bacteria | 710 |
| 1137 | nmdc:mga03683_59786_c2 | 3300050489 | Bacteria | 1235 |
| 1138 | nmdc:mga03683_6406_c1 | 3300050489 | Bacteria | 4028 |
| 1139 | nmdc:mga03683_654062_c1 | 3300050489 | Bacteria | 517 |
| 1140 | nmdc:mga03n38_251470_c1 | 3300050490 | Bacteria | 934 |
| 1141 | nmdc:mga03n38_43245_c1 | 3300050490 | Bacteria | 1974 |
| 1142 | nmdc:mga03n38_923878_c1 | 3300050490 | Bacteria | 514 |
| 1143 | nmdc:mga00v17_157864_c1 | 3300050491 | Bacteria | 1459 |
| 1144 | nmdc:mga00v17_411953_c1 | 3300050491 | Bacteria | 878 |
| 1145 | nmdc:mga00v17_463011_c1 | 3300050491 | Bacteria | 823 |
| 1146 | nmdc:mga00v17_47503_c1 | 3300050491 | Bacteria | 2600 |
| 1147 | nmdc:mga00v17_72040_c1 | 3300050491 | Bacteria | 2143 |
| 1148 | nmdc:mga00v17_82732_c1 | 3300050491 | Bacteria | 2007 |
| 1149 | nmdc:mga00v17_936622_c1 | 3300050491 | Bacteria | 547 |
| 1150 | nmdc:mga0yw44_1009388_c1 | 3300050492 | Bacteria | 563 |
| 1151 | nmdc:mga0yw44_124611_c1 | 3300050492 | Bacteria | 1663 |
| 1152 | nmdc:mga0yw44_85085_c1 | 3300050492 | Bacteria | 1989 |
| 1153 | nmdc:mga0k408_120481_c1 | 3300050493 | Bacteria | 1553 |
| 1154 | nmdc:mga0k408_12739_c1 | 3300050493 | Bacteria | 4600 |
| 1155 | nmdc:mga0k408_135363_c1 | 3300050493 | Bacteria | 1464 |
| 1156 | nmdc:mga0k408_156678_c1 | 3300050493 | Bacteria | 1356 |
| 1157 | nmdc:mga0k408_17491_c1 | 3300050493 | Bacteria | 3995 |
| 1158 | nmdc:mga0k408_256133_c1 | 3300050493 | Bacteria | 1045 |
| 1159 | nmdc:mga0k408_26087_c1 | 3300050493 | Bacteria | 3312 |
| 1160 | nmdc:mga0k408_285891_c1 | 3300050493 | Bacteria | 984 |
| 1161 | nmdc:mga0k408_34425_c1 | 3300050493 | Bacteria | 2900 |
| 1162 | nmdc:mga0k408_370086_c1 | 3300050493 | Bacteria | 854 |
| 1163 | nmdc:mga0k408_50096_c1 | 3300050493 | Bacteria | 2417 |
| 1164 | nmdc:mga0k408_551395_c1 | 3300050493 | Bacteria | 681 |
| 1165 | nmdc:mga0k408_590493_c1 | 3300050493 | Bacteria | 655 |
| 1166 | nmdc:mga0k408_72200_c1 | 3300050493 | Bacteria | 2015 |
| 1167 | nmdc:mga0k408_72324_c1 | 3300050493 | Bacteria | 2014 |
| 1168 | nmdc:mga0k408_74617_c1 | 3300050493 | Bacteria | 1982 |
| 1169 | nmdc:mga0k408_7990_c1 | 3300050493 | Bacteria | 5672 |
| 1170 | nmdc:mga0k408_9000_c1 | 3300050493 | Bacteria | 5372 |
| 1171 | nmdc:mga06z11_115523_c2 | 3300050494 | Bacteria | 1171 |
| 1172 | nmdc:mga06z11_131555_c1 | 3300050494 | Bacteria | 1406 |
| 1173 | nmdc:mga06z11_24408_c1 | 3300050494 | Bacteria | 2852 |
| 1174 | nmdc:mga06z11_32152_c1 | 3300050494 | Bacteria | 2556 |
| 1175 | nmdc:mga06z11_902261_c1 | 3300050494 | Bacteria | 539 |
| 1176 | nmdc:mga04h51_100039_c2 | 3300050495 | Bacteria | 742 |
| 1177 | nmdc:mga04h51_289046_c1 | 3300050495 | Bacteria | 665 |
| 1178 | nmdc:mga04h51_399297_c1 | 3300050495 | Bacteria | 575 |
| 1179 | nmdc:mga04h51_531353_c1 | 3300050495 | Bacteria | 505 |
| 1180 | nmdc:mga04h51_7897_c1 | 3300050495 | Bacteria | 2828 |
| 1181 | nmdc:mga07m45_139885_c1 | 3300050496 | Bacteria | 1402 |
| 1182 | nmdc:mga07m45_185510_c1 | 3300050496 | Bacteria | 1210 |
| 1183 | nmdc:mga07m45_19596_c1 | 3300050496 | Bacteria | 3667 |
| 1184 | nmdc:mga07m45_23940_c1 | 3300050496 | Bacteria | 3340 |
| 1185 | nmdc:mga07m45_26234_c1 | 3300050496 | Bacteria | 3202 |
| 1186 | nmdc:mga07m45_309423_c1 | 3300050496 | Bacteria | 918 |
| 1187 | nmdc:mga07m45_3313_c3 | 3300050496 | Bacteria | 2226 |
| 1188 | nmdc:mga07m45_337561_c1 | 3300050496 | Bacteria | 876 |
| 1189 | nmdc:mga07m45_34063_c1 | 3300050496 | Bacteria | 2830 |
| 1190 | nmdc:mga07m45_34942_c1 | 3300050496 | Bacteria | 2795 |
| 1191 | nmdc:mga07m45_36656_c1 | 3300050496 | Bacteria | 2733 |
| 1192 | nmdc:mga07m45_47499_c1 | 3300050496 | Bacteria | 2414 |
| 1193 | nmdc:mga07m45_492_c1 | 3300050496 | Bacteria | 16696 |
| 1194 | nmdc:mga07m45_50366_c1 | 3300050496 | Bacteria | 2347 |
| 1195 | nmdc:mga07m45_70818_c1 | 3300050496 | Bacteria | 1984 |
| 1196 | nmdc:mga07m45_780537_c1 | 3300050496 | Bacteria | 548 |
| 1197 | nmdc:mga07m45_79946_c1 | 3300050496 | Bacteria | 1866 |
| 1198 | nmdc:mga0qj67_1084791_c1 | 3300050509 | Bacteria | 626 |
| 1199 | nmdc:mga0rr50_645322_c1 | 3300050513 | Bacteria | 903 |
| 1200 | nmdc:mga0rr50_901194_c1 | 3300050513 | Bacteria | 754 |
| 1201 | nmdc:mga08x19_96782_c1 | 3300050514 | Bacteria | 1954 |
| 1202 | nmdc:mga0sz30_171936_c1 | 3300050516 | Bacteria | 961 |
| 1203 | nmdc:mga0sz30_8289_c1 | 3300050516 | Bacteria | 3920 |
| 1204 | Ga0495601_0016530 | 3300053077 | Bacteria | 4472 |
| 1205 | Ga0495601_0018898 | 3300053077 | Bacteria | 4199 |
| 1206 | Ga0495601_0036138 | 3300053077 | Bacteria | 3084 |
| 1207 | Ga0495601_0272852 | 3300053077 | Bacteria | 1103 |
| 1208 | Ga0495601_0850686 | 3300053077 | Unclassified | 578 |
| 1209 | Ga0495595_0004054 | 3300053084 | Bacteria | 5863 |
| 1210 | Ga0495619_0034139 | 3300053085 | Bacteria | 3306 |
| 1211 | Ga0495619_0318956 | 3300053085 | Bacteria | 1076 |
| 1212 | Ga0495619_0791949 | 3300053085 | Bacteria | 641 |
| 1213 | Ga0500578_0106801 | 3300053086 | Bacteria | 1768 |
| 1214 | Ga0500578_0222131 | 3300053086 | Bacteria | 1148 |
| 1215 | Ga0500644_0003614 | 3300053088 | Bacteria | 3836 |
| 1216 | Ga0500644_0172087 | 3300053088 | Bacteria | 881 |
| 1217 | Ga0500647_0243651 | 3300053091 | Bacteria | 794 |
| 1218 | Ga0500583_0047242 | 3300053092 | Bacteria | 1983 |
| 1219 | Ga0500583_0268598 | 3300053092 | Bacteria | 839 |
| 1220 | Ga0500651_0044877 | 3300053093 | Bacteria | 2782 |
| 1221 | Ga0500651_0197316 | 3300053093 | Bacteria | 1189 |
| 1222 | Ga0500594_0002906 | 3300053118 | Bacteria | 3738 |
| 1223 | Ga0500614_150910 | 3300053123 | Bacteria | 700 |
| 1224 | Ga0500614_198322 | 3300053123 | Bacteria | 618 |
| 1225 | Ga0500652_151887 | 3300053131 | Bacteria | 960 |
| 1226 | Ga0500559_0000085 | 3300053136 | Bacteria | 73850 |
| 1227 | Ga0500564_291577 | 3300053138 | Bacteria | 630 |
| 1228 | Ga0500568_0006655 | 3300053139 | Bacteria | 5779 |
| 1229 | Ga0500577_0111434 | 3300053142 | Bacteria | 1130 |
| 1230 | Ga0500616_0018422 | 3300053153 | Bacteria | 3948 |
| 1231 | Ga0500616_0106811 | 3300053153 | Bacteria | 1359 |
| 1232 | Ga0500622_0002170 | 3300053156 | Bacteria | 14539 |
| 1233 | Ga0500636_0341478 | 3300053177 | Bacteria | 719 |
| 1234 | Ga0500637_0205680 | 3300053178 | Bacteria | 1119 |
| 1235 | Ga0500637_0332409 | 3300053178 | Bacteria | 816 |
| 1236 | Ga0500645_000801 | 3300053730 | Bacteria | 18863 |
| 1237 | Ga0500599_020248 | 3300053736 | Bacteria | 940 |
| 1238 | Ga0500587_002295 | 3300053739 | Bacteria | 2724 |
| 1239 | Ga0501084_0042256 | 3300054114 | Bacteria | 3813 |
| 1240 | Ga0501084_1160370 | 3300054114 | Bacteria | 648 |
| 1241 | Ga0501084_1271417 | 3300054114 | Bacteria | 617 |
| 1242 | Ga0590071_002082 | 3300059421 | Bacteria | 5115 |
| 1243 | Ga0587111_0219246 | 3300060346 | Bacteria | 548 |
| 1244 | Ga0501082_0043376 | 3300060353 | Bacteria | 3878 |
| 1245 | Ga0501082_1887648 | 3300060353 | Bacteria | 521 |
| 1246 | Ga0530510_0036440 | 3300061734 | Bacteria | 3545 |
| 1247 | Ga0530510_0241871 | 3300061734 | Bacteria | 1344 |
| 1248 | Ga0530510_1146264 | 3300061734 | Bacteria | 596 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005353 | Ga0070669_100009785 | Ga0070669_1000097856 | 99 |
| 2 | 3300005364 | Ga0070673_100135105 | Ga0070673_1001351051 | 99 |
| 3 | 3300005365 | Ga0070688_100758398 | Ga0070688_1007583982 | 99 |
| 4 | 3300005455 | Ga0070663_101018089 | Ga0070663_1010180892 | 99 |
| 5 | 3300005548 | Ga0070665_100262938 | Ga0070665_1002629382 | 99 |
| 6 | 3300005564 | Ga0070664_100531988 | Ga0070664_1005319881 | 99 |
| 7 | 3300005843 | Ga0068860_100019680 | Ga0068860_1000196804 | 99 |
| 8 | 3300006177 | Ga0075362_10037845 | Ga0075362_100378452 | 99 |
| 9 | 3300006237 | Ga0097621_100659557 | Ga0097621_1006595572 | 99 |
| 10 | 3300009093 | Ga0105240_11208746 | Ga0105240_112087462 | 99 |
| 11 | 3300009093 | Ga0105240_11947268 | Ga0105240_119472681 | 99 |
| 12 | 3300009098 | Ga0105245_10099488 | Ga0105245_100994882 | 99 |
| 13 | 3300009148 | Ga0105243_10006865 | Ga0105243_100068658 | 99 |
| 14 | 3300009148 | Ga0105243_11649857 | Ga0105243_116498572 | 99 |
| 15 | 3300009174 | Ga0105241_10135019 | Ga0105241_101350192 | 99 |
| 16 | 3300009174 | Ga0105241_10633629 | Ga0105241_106336292 | 99 |
| 17 | 3300010375 | Ga0105239_12302028 | Ga0105239_123020282 | 99 |
| 18 | 3300013296 | Ga0157374_11041713 | Ga0157374_110417131 | 99 |
| 19 | 3300013297 | Ga0157378_10081000 | Ga0157378_100810003 | 99 |
| 20 | 3300013308 | Ga0157375_10003720 | Ga0157375_1000372013 | 99 |
| 21 | 3300014326 | Ga0157380_10614634 | Ga0157380_106146342 | 99 |
| 22 | 3300014745 | Ga0157377_10239829 | Ga0157377_102398291 | 99 |
| 23 | 3300014968 | Ga0157379_10084183 | Ga0157379_100841833 | 99 |
| 24 | 3300017792 | Ga0163161_10046958 | Ga0163161_100469584 | 99 |
| 25 | 3300025923 | Ga0207681_10139744 | Ga0207681_101397442 | 99 |
| 26 | 3300025931 | Ga0207644_10153601 | Ga0207644_101536012 | 99 |
| 27 | 3300026035 | Ga0207703_11225502 | Ga0207703_112255022 | 99 |
| 28 | 3300028379 | Ga0268266_10204639 | Ga0268266_102046392 | 99 |
| 29 | 3300028381 | Ga0268264_10022308 | Ga0268264_100223084 | 99 |
| 30 | 3300037068 | Ga0373925_0438816 | Ga0373925_0438816_469_768 | 99 |
| 31 | 3300037068 | Ga0373925_0740020 | Ga0373925_0740020_410_709 | 99 |
| 32 | 3300037471 | Ga0395905_0005986 | Ga0395905_0005986_5662_5961 | 99 |
| 33 | 3300039447 | Ga0436361_0144002 | Ga0436361_0144002_35833_36132 | 99 |
| 34 | 3300041511 | Ga0451855_0621740 | Ga0451855_0621740_118_417 | 99 |
| 35 | 3300042876 | Ga0451577_0844880 | Ga0451577_0844880_331_630 | 99 |
| 36 | 3300044712 | Ga0453684_0043301 | Ga0453684_0043301_3662_3961 | 99 |
| 37 | 3300046542 | Ga0495597_0000116 | Ga0495597_0000116_64080_64379 | 99 |
| 38 | 3300046683 | Ga0495658_0040043 | Ga0495658_0040043_1824_2123 | 99 |
| 39 | 3300047472 | Ga0495686_0000992 | Ga0495686_0000992_3334_3636 | 99 |
| 40 | 3300048907 | Ga0496104_0621853 | Ga0496104_0621853_267_566 | 99 |
| 41 | 3300049570 | Ga0501033_0034547 | Ga0501033_0034547_2523_2822 | 99 |
| 42 | 3300049571 | Ga0501034_0223376 | Ga0501034_0223376_218_517 | 99 |
| 43 | 3300049572 | Ga0501036_0083136 | Ga0501036_0083136_198_497 | 99 |
| 44 | 3300049573 | Ga0501037_0903778 | Ga0501037_0903778_47_346 | 99 |
| 45 | 3300049574 | Ga0501038_0540909 | Ga0501038_0540909_121_420 | 99 |
| 46 | 3300049575 | Ga0501039_0344078 | Ga0501039_0344078_771_1070 | 99 |
| 47 | 3300049577 | Ga0501041_0001914 | Ga0501041_0001914_10285_10584 | 99 |
| 48 | 3300049578 | Ga0501042_0096978 | Ga0501042_0096978_647_946 | 99 |
| 49 | 3300049579 | Ga0501043_0534957 | Ga0501043_0534957_88_387 | 99 |
| 50 | 3300049583 | Ga0501067_0385467 | Ga0501067_0385467_347_646 | 99 |
| 51 | 3300049584 | Ga0501068_0010614 | Ga0501068_0010614_710_1009 | 99 |
| 52 | 3300049588 | Ga0501072_0064396 | Ga0501072_0064396_513_812 | 99 |
| 53 | 3300049590 | Ga0501074_0070030 | Ga0501074_0070030_586_885 | 99 |
| 54 | 3300049591 | Ga0501075_0144169 | Ga0501075_0144169_1403_1702 | 99 |
| 55 | 3300049592 | Ga0501076_0040425 | Ga0501076_0040425_3245_3544 | 99 |
| 56 | 3300049592 | Ga0501076_1311166 | Ga0501076_1311166_60_359 | 99 |
| 57 | 3300049593 | Ga0501077_0004802 | Ga0501077_0004802_5808_6107 | 99 |
| 58 | 3300049741 | Ga0501079_0058608 | Ga0501079_0058608_1941_2240 | 99 |
| 59 | 3300049742 | Ga0501080_0409118 | Ga0501080_0409118_687_986 | 99 |
| 60 | 3300049743 | Ga0501081_0274726 | Ga0501081_0274726_887_1186 | 99 |
| 61 | 3300049743 | Ga0501081_0357849 | Ga0501081_0357849_565_864 | 99 |
| 62 | 3300050491 | nmdc:mga00v17_411953_c1 | nmdc:mga00v17_411953_c1_234_533 | 99 |
| 63 | 3300050492 | nmdc:mga0yw44_1009388_c1 | nmdc:mga0yw44_1009388_c1_190_489 | 99 |
| 64 | 3300050493 | nmdc:mga0k408_26087_c1 | nmdc:mga0k408_26087_c1_2098_2400 | 99 |
| 65 | 3300050494 | nmdc:mga06z11_32152_c1 | nmdc:mga06z11_32152_c1_2154_2453 | 99 |
| 66 | 3300050495 | nmdc:mga04h51_289046_c1 | nmdc:mga04h51_289046_c1_57_359 | 99 |
| 67 | 3300050496 | nmdc:mga07m45_309423_c1 | nmdc:mga07m45_309423_c1_359_658 | 99 |
| 68 | 3300050496 | nmdc:mga07m45_47499_c1 | nmdc:mga07m45_47499_c1_959_1261 | 99 |
| 69 | 3300050496 | nmdc:mga07m45_492_c1 | nmdc:mga07m45_492_c1_14594_14893 | 99 |
| 70 | 3300050509 | nmdc:mga0qj67_1084791_c1 | nmdc:mga0qj67_1084791_c1_22_321 | 99 |
| 71 | 3300053139 | Ga0500568_0006655 | Ga0500568_0006655_2653_2952 | 99 |
| 72 | 3300054114 | Ga0501084_0042256 | Ga0501084_0042256_2958_3257 | 99 |
| 73 | 3300060353 | Ga0501082_0043376 | Ga0501082_0043376_513_812 | 99 |
| 74 | 3300061734 | Ga0530510_0036440 | Ga0530510_0036440_2957_3256 | 99 |
| 75 | iso_pu_bacteria | 2643221654 | 2644305474 | 99 |
| 76 | iso_pu_bacteria | 2643221683 | 2644466416 | 99 |
| 77 | iso_pu_bacteria | 2881101125 | 2881101328 | 99 |
| 78 | iso_pu_bacteria | 2894023352 | 2894026431 | 99 |
| 79 | iso_pu_bacteria | 2904541872 | 2904543396 | 99 |
| 80 | iso_pu_bacteria | 2929160207 | 2929160629 | 99 |
| 81 | iso_pu_bacteria | 2939631187 | 2939635423 | 99 |
| 82 | 2162886007 | SwRhRL2b_contig_627485 | SwRhRL2b_0929.00007540 | 103 |
| 83 | 3300003320 | rootH2_10234102 | rootH2_102341021 | 103 |
| 84 | 3300003347 | JGI26128J50194_1000784 | JGI26128J50194_10007843 | 103 |
| 85 | 3300003792 | Ga0055540_1005689 | Ga0055540_10056893 | 103 |
| 86 | 3300003794 | Ga0055531_10000158 | Ga0055531_1000015854 | 103 |
| 87 | 3300005289 | Ga0065704_10144971 | Ga0065704_101449712 | 103 |
| 88 | 3300005290 | Ga0065712_10429716 | Ga0065712_104297161 | 103 |
| 89 | 3300005293 | Ga0065715_10201477 | Ga0065715_102014772 | 103 |
| 90 | 3300005293 | Ga0065715_10284025 | Ga0065715_102840251 | 103 |
| 91 | 3300005295 | Ga0065707_10082401 | Ga0065707_1008240113 | 103 |
| 92 | 3300005295 | Ga0065707_10083629 | Ga0065707_100836299 | 103 |
| 93 | 3300005327 | Ga0070658_11484581 | Ga0070658_114845812 | 103 |
| 94 | 3300005328 | Ga0070676_10006509 | Ga0070676_100065097 | 103 |
| 95 | 3300005328 | Ga0070676_10020357 | Ga0070676_100203572 | 103 |
| 96 | 3300005328 | Ga0070676_10290984 | Ga0070676_102909842 | 103 |
| 97 | 3300005328 | Ga0070676_10413730 | Ga0070676_104137301 | 103 |
| 98 | 3300005328 | Ga0070676_10430190 | Ga0070676_104301901 | 103 |
| 99 | 3300005329 | Ga0070683_101531728 | Ga0070683_1015317282 | 103 |
| 100 | 3300005330 | Ga0070690_100006390 | Ga0070690_1000063906 | 103 |
| 101 | 3300005330 | Ga0070690_100404218 | Ga0070690_1004042182 | 103 |
| 102 | 3300005331 | Ga0070670_100014643 | Ga0070670_1000146435 | 103 |
| 103 | 3300005331 | Ga0070670_100050018 | Ga0070670_1000500184 | 103 |
| 104 | 3300005331 | Ga0070670_100052480 | Ga0070670_1000524803 | 103 |
| 105 | 3300005331 | Ga0070670_100111871 | Ga0070670_1001118713 | 103 |
| 106 | 3300005331 | Ga0070670_100203248 | Ga0070670_1002032482 | 103 |
| 107 | 3300005331 | Ga0070670_101158358 | Ga0070670_1011583581 | 103 |
| 108 | 3300005333 | Ga0070677_10083552 | Ga0070677_100835522 | 103 |
| 109 | 3300005333 | Ga0070677_10089150 | Ga0070677_100891501 | 103 |
| 110 | 3300005333 | Ga0070677_10716834 | Ga0070677_107168342 | 103 |
| 111 | 3300005334 | Ga0068869_100004832 | Ga0068869_1000048329 | 103 |
| 112 | 3300005334 | Ga0068869_100009279 | Ga0068869_1000092796 | 103 |
| 113 | 3300005334 | Ga0068869_100041362 | Ga0068869_1000413622 | 103 |
| 114 | 3300005334 | Ga0068869_100092159 | Ga0068869_1000921593 | 103 |
| 115 | 3300005334 | Ga0068869_100719537 | Ga0068869_1007195372 | 103 |
| 116 | 3300005334 | Ga0068869_100850959 | Ga0068869_1008509592 | 103 |
| 117 | 3300005335 | Ga0070666_10001214 | Ga0070666_100012148 | 103 |
| 118 | 3300005335 | Ga0070666_10398960 | Ga0070666_103989601 | 103 |
| 119 | 3300005335 | Ga0070666_11085131 | Ga0070666_110851311 | 103 |
| 120 | 3300005335 | Ga0070666_11151990 | Ga0070666_111519901 | 103 |
| 121 | 3300005335 | Ga0070666_11377231 | Ga0070666_113772311 | 103 |
| 122 | 3300005336 | Ga0070680_101058687 | Ga0070680_1010586872 | 103 |
| 123 | 3300005337 | Ga0070682_100397786 | Ga0070682_1003977862 | 103 |
| 124 | 3300005338 | Ga0068868_100000312 | Ga0068868_10000031232 | 103 |
| 125 | 3300005338 | Ga0068868_100014536 | Ga0068868_1000145364 | 103 |
| 126 | 3300005338 | Ga0068868_100187978 | Ga0068868_1001879781 | 103 |
| 127 | 3300005338 | Ga0068868_100194590 | Ga0068868_1001945902 | 103 |
| 128 | 3300005338 | Ga0068868_100204590 | Ga0068868_1002045903 | 103 |
| 129 | 3300005338 | Ga0068868_100277281 | Ga0068868_1002772812 | 103 |
| 130 | 3300005338 | Ga0068868_101341118 | Ga0068868_1013411182 | 103 |
| 131 | 3300005339 | Ga0070660_100019235 | Ga0070660_1000192355 | 103 |
| 132 | 3300005339 | Ga0070660_100436627 | Ga0070660_1004366272 | 103 |
| 133 | 3300005339 | Ga0070660_100716819 | Ga0070660_1007168192 | 103 |
| 134 | 3300005340 | Ga0070689_100016511 | Ga0070689_1000165112 | 103 |
| 135 | 3300005340 | Ga0070689_102026215 | Ga0070689_1020262152 | 103 |
| 136 | 3300005340 | Ga0070689_102039895 | Ga0070689_1020398951 | 103 |
| 137 | 3300005343 | Ga0070687_100047002 | Ga0070687_1000470023 | 103 |
| 138 | 3300005343 | Ga0070687_101004405 | Ga0070687_1010044052 | 103 |
| 139 | 3300005344 | Ga0070661_100015946 | Ga0070661_1000159464 | 103 |
| 140 | 3300005344 | Ga0070661_100764206 | Ga0070661_1007642061 | 103 |
| 141 | 3300005344 | Ga0070661_101481533 | Ga0070661_1014815331 | 103 |
| 142 | 3300005347 | Ga0070668_100481101 | Ga0070668_1004811012 | 103 |
| 143 | 3300005353 | Ga0070669_100152181 | Ga0070669_1001521812 | 103 |
| 144 | 3300005353 | Ga0070669_100401730 | Ga0070669_1004017302 | 103 |
| 145 | 3300005354 | Ga0070675_100001196 | Ga0070675_1000011963 | 103 |
| 146 | 3300005354 | Ga0070675_100015225 | Ga0070675_1000152253 | 103 |
| 147 | 3300005354 | Ga0070675_100023005 | Ga0070675_1000230055 | 103 |
| 148 | 3300005354 | Ga0070675_101591984 | Ga0070675_1015919841 | 103 |
| 149 | 3300005355 | Ga0070671_100009402 | Ga0070671_1000094029 | 103 |
| 150 | 3300005355 | Ga0070671_100010291 | Ga0070671_1000102917 | 103 |
| 151 | 3300005355 | Ga0070671_100037504 | Ga0070671_1000375042 | 103 |
| 152 | 3300005355 | Ga0070671_100063496 | Ga0070671_1000634964 | 103 |
| 153 | 3300005355 | Ga0070671_100263723 | Ga0070671_1002637232 | 103 |
| 154 | 3300005356 | Ga0070674_100020884 | Ga0070674_1000208844 | 103 |
| 155 | 3300005356 | Ga0070674_100063719 | Ga0070674_1000637191 | 103 |
| 156 | 3300005356 | Ga0070674_100234002 | Ga0070674_1002340023 | 103 |
| 157 | 3300005356 | Ga0070674_101019640 | Ga0070674_1010196401 | 103 |
| 158 | 3300005356 | Ga0070674_101341015 | Ga0070674_1013410152 | 103 |
| 159 | 3300005364 | Ga0070673_100001001 | Ga0070673_10000100114 | 103 |
| 160 | 3300005364 | Ga0070673_100005595 | Ga0070673_1000055954 | 103 |
| 161 | 3300005364 | Ga0070673_100055134 | Ga0070673_1000551342 | 103 |
| 162 | 3300005364 | Ga0070673_100210093 | Ga0070673_1002100932 | 103 |
| 163 | 3300005364 | Ga0070673_100308651 | Ga0070673_1003086513 | 103 |
| 164 | 3300005364 | Ga0070673_101293888 | Ga0070673_1012938882 | 103 |
| 165 | 3300005365 | Ga0070688_100817512 | Ga0070688_1008175122 | 103 |
| 166 | 3300005366 | Ga0070659_100445191 | Ga0070659_1004451913 | 103 |
| 167 | 3300005366 | Ga0070659_100868814 | Ga0070659_1008688142 | 103 |
| 168 | 3300005367 | Ga0070667_100008639 | Ga0070667_1000086397 | 103 |
| 169 | 3300005367 | Ga0070667_100035464 | Ga0070667_1000354644 | 103 |
| 170 | 3300005367 | Ga0070667_100118934 | Ga0070667_1001189344 | 103 |
| 171 | 3300005367 | Ga0070667_100141474 | Ga0070667_1001414743 | 103 |
| 172 | 3300005367 | Ga0070667_100195929 | Ga0070667_1001959292 | 103 |
| 173 | 3300005367 | Ga0070667_100221111 | Ga0070667_1002211112 | 103 |
| 174 | 3300005367 | Ga0070667_100252861 | Ga0070667_1002528612 | 103 |
| 175 | 3300005367 | Ga0070667_101010622 | Ga0070667_1010106222 | 103 |
| 176 | 3300005406 | Ga0070703_10550155 | Ga0070703_105501552 | 103 |
| 177 | 3300005437 | Ga0070710_11064678 | Ga0070710_110646782 | 103 |
| 178 | 3300005438 | Ga0070701_10687047 | Ga0070701_106870472 | 103 |
| 179 | 3300005441 | Ga0070700_100302544 | Ga0070700_1003025442 | 103 |
| 180 | 3300005441 | Ga0070700_100418445 | Ga0070700_1004184452 | 103 |
| 181 | 3300005445 | Ga0070708_100000359 | Ga0070708_10000035929 | 103 |
| 182 | 3300005455 | Ga0070663_100001329 | Ga0070663_10000132910 | 103 |
| 183 | 3300005455 | Ga0070663_100170768 | Ga0070663_1001707683 | 103 |
| 184 | 3300005455 | Ga0070663_100509013 | Ga0070663_1005090132 | 103 |
| 185 | 3300005456 | Ga0070678_100001350 | Ga0070678_10000135011 | 103 |
| 186 | 3300005456 | Ga0070678_100019530 | Ga0070678_1000195301 | 103 |
| 187 | 3300005456 | Ga0070678_100124088 | Ga0070678_1001240883 | 103 |
| 188 | 3300005456 | Ga0070678_100234909 | Ga0070678_1002349092 | 103 |
| 189 | 3300005456 | Ga0070678_100249689 | Ga0070678_1002496892 | 103 |
| 190 | 3300005456 | Ga0070678_100380141 | Ga0070678_1003801413 | 103 |
| 191 | 3300005456 | Ga0070678_100675272 | Ga0070678_1006752722 | 103 |
| 192 | 3300005456 | Ga0070678_101198741 | Ga0070678_1011987412 | 103 |
| 193 | 3300005457 | Ga0070662_100061191 | Ga0070662_1000611914 | 103 |
| 194 | 3300005457 | Ga0070662_100211907 | Ga0070662_1002119072 | 103 |
| 195 | 3300005457 | Ga0070662_100543556 | Ga0070662_1005435562 | 103 |
| 196 | 3300005457 | Ga0070662_101106604 | Ga0070662_1011066042 | 103 |
| 197 | 3300005458 | Ga0070681_10030700 | Ga0070681_100307003 | 103 |
| 198 | 3300005458 | Ga0070681_10194030 | Ga0070681_101940303 | 103 |
| 199 | 3300005459 | Ga0068867_100006369 | Ga0068867_1000063694 | 103 |
| 200 | 3300005459 | Ga0068867_100035602 | Ga0068867_1000356024 | 103 |
| 201 | 3300005459 | Ga0068867_100042192 | Ga0068867_1000421921 | 103 |
| 202 | 3300005459 | Ga0068867_100087456 | Ga0068867_1000874562 | 103 |
| 203 | 3300005459 | Ga0068867_100134339 | Ga0068867_1001343393 | 103 |
| 204 | 3300005459 | Ga0068867_100144313 | Ga0068867_1001443133 | 103 |
| 205 | 3300005459 | Ga0068867_100163249 | Ga0068867_1001632491 | 103 |
| 206 | 3300005459 | Ga0068867_100192902 | Ga0068867_1001929023 | 103 |
| 207 | 3300005466 | Ga0070685_10041723 | Ga0070685_100417232 | 103 |
| 208 | 3300005466 | Ga0070685_10348170 | Ga0070685_103481702 | 103 |
| 209 | 3300005466 | Ga0070685_10353220 | Ga0070685_103532202 | 103 |
| 210 | 3300005466 | Ga0070685_11394215 | Ga0070685_113942151 | 103 |
| 211 | 3300005467 | Ga0070706_100038628 | Ga0070706_1000386281 | 103 |
| 212 | 3300005467 | Ga0070706_100094756 | Ga0070706_1000947564 | 103 |
| 213 | 3300005468 | Ga0070707_100121495 | Ga0070707_1001214951 | 103 |
| 214 | 3300005468 | Ga0070707_102345970 | Ga0070707_1023459702 | 103 |
| 215 | 3300005471 | Ga0070698_100247243 | Ga0070698_1002472433 | 103 |
| 216 | 3300005471 | Ga0070698_100346944 | Ga0070698_1003469442 | 103 |
| 217 | 3300005518 | Ga0070699_100183198 | Ga0070699_1001831982 | 103 |
| 218 | 3300005518 | Ga0070699_100432562 | Ga0070699_1004325622 | 103 |
| 219 | 3300005518 | Ga0070699_100560060 | Ga0070699_1005600602 | 103 |
| 220 | 3300005530 | Ga0070679_100028003 | Ga0070679_1000280036 | 103 |
| 221 | 3300005530 | Ga0070679_100070126 | Ga0070679_1000701262 | 103 |
| 222 | 3300005530 | Ga0070679_100180884 | Ga0070679_1001808842 | 103 |
| 223 | 3300005536 | Ga0070697_100016402 | Ga0070697_1000164026 | 103 |
| 224 | 3300005539 | Ga0068853_100003043 | Ga0068853_1000030432 | 103 |
| 225 | 3300005539 | Ga0068853_100103028 | Ga0068853_1001030283 | 103 |
| 226 | 3300005539 | Ga0068853_100326263 | Ga0068853_1003262632 | 103 |
| 227 | 3300005539 | Ga0068853_100448241 | Ga0068853_1004482411 | 103 |
| 228 | 3300005539 | Ga0068853_100449348 | Ga0068853_1004493482 | 103 |
| 229 | 3300005539 | Ga0068853_101472901 | Ga0068853_1014729011 | 103 |
| 230 | 3300005539 | Ga0068853_102408234 | Ga0068853_1024082342 | 103 |
| 231 | 3300005543 | Ga0070672_100011526 | Ga0070672_1000115267 | 103 |
| 232 | 3300005543 | Ga0070672_100020972 | Ga0070672_1000209722 | 103 |
| 233 | 3300005543 | Ga0070672_100093042 | Ga0070672_1000930424 | 103 |
| 234 | 3300005543 | Ga0070672_100151153 | Ga0070672_1001511531 | 103 |
| 235 | 3300005544 | Ga0070686_100237573 | Ga0070686_1002375733 | 103 |
| 236 | 3300005545 | Ga0070695_101216149 | Ga0070695_1012161491 | 103 |
| 237 | 3300005548 | Ga0070665_100010823 | Ga0070665_1000108236 | 103 |
| 238 | 3300005548 | Ga0070665_100674723 | Ga0070665_1006747232 | 103 |
| 239 | 3300005548 | Ga0070665_101595576 | Ga0070665_1015955762 | 103 |
| 240 | 3300005549 | Ga0070704_102181534 | Ga0070704_1021815341 | 103 |
| 241 | 3300005563 | Ga0068855_100763025 | Ga0068855_1007630251 | 103 |
| 242 | 3300005564 | Ga0070664_100077686 | Ga0070664_1000776861 | 103 |
| 243 | 3300005564 | Ga0070664_100211134 | Ga0070664_1002111342 | 103 |
| 244 | 3300005564 | Ga0070664_100689385 | Ga0070664_1006893852 | 103 |
| 245 | 3300005577 | Ga0068857_100005109 | Ga0068857_1000051092 | 103 |
| 246 | 3300005577 | Ga0068857_100028848 | Ga0068857_1000288483 | 103 |
| 247 | 3300005577 | Ga0068857_100312974 | Ga0068857_1003129743 | 103 |
| 248 | 3300005577 | Ga0068857_100320407 | Ga0068857_1003204071 | 103 |
| 249 | 3300005577 | Ga0068857_100375393 | Ga0068857_1003753932 | 103 |
| 250 | 3300005577 | Ga0068857_100608718 | Ga0068857_1006087181 | 103 |
| 251 | 3300005577 | Ga0068857_101658579 | Ga0068857_1016585791 | 103 |
| 252 | 3300005577 | Ga0068857_101663630 | Ga0068857_1016636302 | 103 |
| 253 | 3300005577 | Ga0068857_102010875 | Ga0068857_1020108751 | 103 |
| 254 | 3300005578 | Ga0068854_100178843 | Ga0068854_1001788432 | 103 |
| 255 | 3300005578 | Ga0068854_100195310 | Ga0068854_1001953102 | 103 |
| 256 | 3300005614 | Ga0068856_100002604 | Ga0068856_10000260411 | 103 |
| 257 | 3300005615 | Ga0070702_101359607 | Ga0070702_1013596072 | 103 |
| 258 | 3300005616 | Ga0068852_100137407 | Ga0068852_1001374072 | 103 |
| 259 | 3300005616 | Ga0068852_100171248 | Ga0068852_1001712484 | 103 |
| 260 | 3300005616 | Ga0068852_100358482 | Ga0068852_1003584822 | 103 |
| 261 | 3300005616 | Ga0068852_100422081 | Ga0068852_1004220812 | 103 |
| 262 | 3300005616 | Ga0068852_100508890 | Ga0068852_1005088902 | 103 |
| 263 | 3300005616 | Ga0068852_101400936 | Ga0068852_1014009362 | 103 |
| 264 | 3300005616 | Ga0068852_102464367 | Ga0068852_1024643671 | 103 |
| 265 | 3300005617 | Ga0068859_100022763 | Ga0068859_1000227634 | 103 |
| 266 | 3300005617 | Ga0068859_100074871 | Ga0068859_1000748714 | 103 |
| 267 | 3300005617 | Ga0068859_100176798 | Ga0068859_1001767983 | 103 |
| 268 | 3300005617 | Ga0068859_100770445 | Ga0068859_1007704452 | 103 |
| 269 | 3300005617 | Ga0068859_101505113 | Ga0068859_1015051132 | 103 |
| 270 | 3300005617 | Ga0068859_103023221 | Ga0068859_1030232211 | 103 |
| 271 | 3300005618 | Ga0068864_100000335 | Ga0068864_10000033510 | 103 |
| 272 | 3300005618 | Ga0068864_100008404 | Ga0068864_1000084047 | 103 |
| 273 | 3300005618 | Ga0068864_100254048 | Ga0068864_1002540481 | 103 |
| 274 | 3300005618 | Ga0068864_100284544 | Ga0068864_1002845441 | 103 |
| 275 | 3300005618 | Ga0068864_101851902 | Ga0068864_1018519022 | 103 |
| 276 | 3300005718 | Ga0068866_10062011 | Ga0068866_100620111 | 103 |
| 277 | 3300005718 | Ga0068866_10529042 | Ga0068866_105290421 | 103 |
| 278 | 3300005718 | Ga0068866_10911611 | Ga0068866_109116112 | 103 |
| 279 | 3300005719 | Ga0068861_100006418 | Ga0068861_1000064187 | 103 |
| 280 | 3300005719 | Ga0068861_100356978 | Ga0068861_1003569782 | 103 |
| 281 | 3300005719 | Ga0068861_102431694 | Ga0068861_1024316941 | 103 |
| 282 | 3300005834 | Ga0068851_10414327 | Ga0068851_104143272 | 103 |
| 283 | 3300005840 | Ga0068870_10110312 | Ga0068870_101103123 | 103 |
| 284 | 3300005840 | Ga0068870_10491782 | Ga0068870_104917822 | 103 |
| 285 | 3300005841 | Ga0068863_100029875 | Ga0068863_10002987511 | 103 |
| 286 | 3300005841 | Ga0068863_101598753 | Ga0068863_1015987531 | 103 |
| 287 | 3300005842 | Ga0068858_100168978 | Ga0068858_1001689782 | 103 |
| 288 | 3300005842 | Ga0068858_100249884 | Ga0068858_1002498843 | 103 |
| 289 | 3300005843 | Ga0068860_100001975 | Ga0068860_10000197515 | 103 |
| 290 | 3300005843 | Ga0068860_100010220 | Ga0068860_1000102205 | 103 |
| 291 | 3300005843 | Ga0068860_100918470 | Ga0068860_1009184702 | 103 |
| 292 | 3300005844 | Ga0068862_100017460 | Ga0068862_1000174604 | 103 |
| 293 | 3300005844 | Ga0068862_100024404 | Ga0068862_1000244043 | 103 |
| 294 | 3300005844 | Ga0068862_100038482 | Ga0068862_1000384823 | 103 |
| 295 | 3300005844 | Ga0068862_100616314 | Ga0068862_1006163142 | 103 |
| 296 | 3300005844 | Ga0068862_101225019 | Ga0068862_1012250192 | 103 |
| 297 | 3300005844 | Ga0068862_101502996 | Ga0068862_1015029962 | 103 |
| 298 | 3300005844 | Ga0068862_101833773 | Ga0068862_1018337731 | 103 |
| 299 | 3300005937 | Ga0081455_10193472 | Ga0081455_101934721 | 103 |
| 300 | 3300005937 | Ga0081455_10510270 | Ga0081455_105102702 | 103 |
| 301 | 3300006038 | Ga0075365_10050103 | Ga0075365_100501033 | 103 |
| 302 | 3300006038 | Ga0075365_10848173 | Ga0075365_108481732 | 103 |
| 303 | 3300006042 | Ga0075368_10002000 | Ga0075368_100020002 | 103 |
| 304 | 3300006042 | Ga0075368_10019410 | Ga0075368_100194103 | 103 |
| 305 | 3300006042 | Ga0075368_10045969 | Ga0075368_100459692 | 103 |
| 306 | 3300006042 | Ga0075368_10156877 | Ga0075368_101568772 | 103 |
| 307 | 3300006048 | Ga0075363_100006111 | Ga0075363_1000061113 | 103 |
| 308 | 3300006048 | Ga0075363_100033418 | Ga0075363_1000334183 | 103 |
| 309 | 3300006048 | Ga0075363_100159388 | Ga0075363_1001593882 | 103 |
| 310 | 3300006048 | Ga0075363_100161113 | Ga0075363_1001611132 | 103 |
| 311 | 3300006048 | Ga0075363_100402647 | Ga0075363_1004026472 | 103 |
| 312 | 3300006048 | Ga0075363_100426427 | Ga0075363_1004264272 | 103 |
| 313 | 3300006048 | Ga0075363_100491883 | Ga0075363_1004918832 | 103 |
| 314 | 3300006048 | Ga0075363_100643064 | Ga0075363_1006430642 | 103 |
| 315 | 3300006051 | Ga0075364_10103332 | Ga0075364_101033321 | 103 |
| 316 | 3300006051 | Ga0075364_10117486 | Ga0075364_101174862 | 103 |
| 317 | 3300006051 | Ga0075364_10160790 | Ga0075364_101607902 | 103 |
| 318 | 3300006051 | Ga0075364_10196524 | Ga0075364_101965242 | 103 |
| 319 | 3300006058 | Ga0075432_10056399 | Ga0075432_100563992 | 103 |
| 320 | 3300006058 | Ga0075432_10374718 | Ga0075432_103747182 | 103 |
| 321 | 3300006177 | Ga0075362_10004294 | Ga0075362_100042945 | 103 |
| 322 | 3300006177 | Ga0075362_10028978 | Ga0075362_100289783 | 103 |
| 323 | 3300006177 | Ga0075362_10029956 | Ga0075362_100299564 | 103 |
| 324 | 3300006177 | Ga0075362_10062083 | Ga0075362_100620832 | 103 |
| 325 | 3300006177 | Ga0075362_10085501 | Ga0075362_100855012 | 103 |
| 326 | 3300006177 | Ga0075362_10090136 | Ga0075362_100901362 | 103 |
| 327 | 3300006177 | Ga0075362_10091744 | Ga0075362_100917442 | 103 |
| 328 | 3300006177 | Ga0075362_10245705 | Ga0075362_102457052 | 103 |
| 329 | 3300006177 | Ga0075362_10574662 | Ga0075362_105746621 | 103 |
| 330 | 3300006178 | Ga0075367_10008658 | Ga0075367_100086584 | 103 |
| 331 | 3300006178 | Ga0075367_10010639 | Ga0075367_100106394 | 103 |
| 332 | 3300006178 | Ga0075367_10091437 | Ga0075367_100914372 | 103 |
| 333 | 3300006178 | Ga0075367_10121315 | Ga0075367_101213152 | 103 |
| 334 | 3300006178 | Ga0075367_10338695 | Ga0075367_103386952 | 103 |
| 335 | 3300006178 | Ga0075367_10744875 | Ga0075367_107448752 | 103 |
| 336 | 3300006178 | Ga0075367_10770292 | Ga0075367_107702922 | 103 |
| 337 | 3300006178 | Ga0075367_10958923 | Ga0075367_109589231 | 103 |
| 338 | 3300006186 | Ga0075369_10012606 | Ga0075369_100126064 | 103 |
| 339 | 3300006186 | Ga0075369_10043585 | Ga0075369_100435852 | 103 |
| 340 | 3300006186 | Ga0075369_10069452 | Ga0075369_100694523 | 103 |
| 341 | 3300006186 | Ga0075369_10132473 | Ga0075369_101324733 | 103 |
| 342 | 3300006186 | Ga0075369_10202469 | Ga0075369_102024692 | 103 |
| 343 | 3300006186 | Ga0075369_10229785 | Ga0075369_102297852 | 103 |
| 344 | 3300006194 | Ga0075427_10021345 | Ga0075427_100213452 | 103 |
| 345 | 3300006195 | Ga0075366_10003945 | Ga0075366_100039457 | 103 |
| 346 | 3300006195 | Ga0075366_10031291 | Ga0075366_100312913 | 103 |
| 347 | 3300006195 | Ga0075366_10036971 | Ga0075366_100369712 | 103 |
| 348 | 3300006195 | Ga0075366_10038103 | Ga0075366_100381034 | 103 |
| 349 | 3300006195 | Ga0075366_10047038 | Ga0075366_100470382 | 103 |
| 350 | 3300006195 | Ga0075366_10062814 | Ga0075366_100628143 | 103 |
| 351 | 3300006195 | Ga0075366_10068300 | Ga0075366_100683002 | 103 |
| 352 | 3300006195 | Ga0075366_10190153 | Ga0075366_101901532 | 103 |
| 353 | 3300006195 | Ga0075366_10224751 | Ga0075366_102247512 | 103 |
| 354 | 3300006195 | Ga0075366_10237496 | Ga0075366_102374961 | 103 |
| 355 | 3300006195 | Ga0075366_10271963 | Ga0075366_102719632 | 103 |
| 356 | 3300006195 | Ga0075366_10401545 | Ga0075366_104015452 | 103 |
| 357 | 3300006195 | Ga0075366_10621857 | Ga0075366_106218572 | 103 |
| 358 | 3300006195 | Ga0075366_10674752 | Ga0075366_106747522 | 103 |
| 359 | 3300006195 | Ga0075366_11008283 | Ga0075366_110082832 | 103 |
| 360 | 3300006237 | Ga0097621_100003156 | Ga0097621_1000031569 | 103 |
| 361 | 3300006237 | Ga0097621_100408273 | Ga0097621_1004082733 | 103 |
| 362 | 3300006237 | Ga0097621_101163078 | Ga0097621_1011630782 | 103 |
| 363 | 3300006237 | Ga0097621_101512126 | Ga0097621_1015121262 | 103 |
| 364 | 3300006353 | Ga0075370_10000069 | Ga0075370_100000699 | 103 |
| 365 | 3300006353 | Ga0075370_10002857 | Ga0075370_100028574 | 103 |
| 366 | 3300006353 | Ga0075370_10003577 | Ga0075370_100035772 | 103 |
| 367 | 3300006353 | Ga0075370_10003910 | Ga0075370_100039107 | 103 |
| 368 | 3300006353 | Ga0075370_10007647 | Ga0075370_100076474 | 103 |
| 369 | 3300006353 | Ga0075370_10013361 | Ga0075370_100133613 | 103 |
| 370 | 3300006353 | Ga0075370_10028001 | Ga0075370_100280014 | 103 |
| 371 | 3300006353 | Ga0075370_10049373 | Ga0075370_100493732 | 103 |
| 372 | 3300006353 | Ga0075370_10061038 | Ga0075370_100610384 | 103 |
| 373 | 3300006353 | Ga0075370_10087718 | Ga0075370_100877182 | 103 |
| 374 | 3300006353 | Ga0075370_10405090 | Ga0075370_104050902 | 103 |
| 375 | 3300006353 | Ga0075370_10640439 | Ga0075370_106404392 | 103 |
| 376 | 3300006353 | Ga0075370_10698862 | Ga0075370_106988622 | 103 |
| 377 | 3300006353 | Ga0075370_10873815 | Ga0075370_108738152 | 103 |
| 378 | 3300006353 | Ga0075370_10920221 | Ga0075370_109202212 | 103 |
| 379 | 3300006358 | Ga0068871_100031944 | Ga0068871_1000319444 | 103 |
| 380 | 3300006358 | Ga0068871_100120663 | Ga0068871_1001206632 | 103 |
| 381 | 3300006844 | Ga0075428_100664390 | Ga0075428_1006643902 | 103 |
| 382 | 3300006844 | Ga0075428_101185429 | Ga0075428_1011854292 | 103 |
| 383 | 3300006846 | Ga0075430_100800733 | Ga0075430_1008007332 | 103 |
| 384 | 3300006846 | Ga0075430_100814356 | Ga0075430_1008143562 | 103 |
| 385 | 3300006846 | Ga0075430_101013743 | Ga0075430_1010137432 | 103 |
| 386 | 3300006847 | Ga0075431_100026171 | Ga0075431_1000261717 | 103 |
| 387 | 3300006871 | Ga0075434_100160470 | Ga0075434_1001604701 | 103 |
| 388 | 3300006880 | Ga0075429_100207907 | Ga0075429_1002079072 | 103 |
| 389 | 3300006880 | Ga0075429_101442670 | Ga0075429_1014426702 | 103 |
| 390 | 3300006881 | Ga0068865_100001690 | Ga0068865_10000169011 | 103 |
| 391 | 3300006881 | Ga0068865_100067591 | Ga0068865_1000675913 | 103 |
| 392 | 3300006881 | Ga0068865_100087499 | Ga0068865_1000874993 | 103 |
| 393 | 3300006881 | Ga0068865_100487010 | Ga0068865_1004870102 | 103 |
| 394 | 3300006914 | Ga0075436_100224033 | Ga0075436_1002240332 | 103 |
| 395 | 3300006931 | Ga0097620_100022763 | Ga0097620_1000227634 | 103 |
| 396 | 3300006931 | Ga0097620_100074872 | Ga0097620_1000748724 | 103 |
| 397 | 3300006931 | Ga0097620_100176802 | Ga0097620_1001768023 | 103 |
| 398 | 3300006931 | Ga0097620_100770446 | Ga0097620_1007704462 | 103 |
| 399 | 3300006931 | Ga0097620_101505081 | Ga0097620_1015050812 | 103 |
| 400 | 3300006931 | Ga0097620_103023307 | Ga0097620_1030233071 | 103 |
| 401 | 3300007076 | Ga0075435_100393558 | Ga0075435_1003935582 | 103 |
| 402 | 3300007076 | Ga0075435_101431013 | Ga0075435_1014310131 | 103 |
| 403 | 3300007076 | Ga0075435_101499860 | Ga0075435_1014998602 | 103 |
| 404 | 3300009093 | Ga0105240_10137773 | Ga0105240_101377732 | 103 |
| 405 | 3300009093 | Ga0105240_10202919 | Ga0105240_102029191 | 103 |
| 406 | 3300009098 | Ga0105245_10054814 | Ga0105245_100548144 | 103 |
| 407 | 3300009098 | Ga0105245_10129687 | Ga0105245_101296874 | 103 |
| 408 | 3300009098 | Ga0105245_10144596 | Ga0105245_101445964 | 103 |
| 409 | 3300009098 | Ga0105245_10156093 | Ga0105245_101560932 | 103 |
| 410 | 3300009098 | Ga0105245_10560966 | Ga0105245_105609661 | 103 |
| 411 | 3300009098 | Ga0105245_11356793 | Ga0105245_113567933 | 103 |
| 412 | 3300009098 | Ga0105245_11535534 | Ga0105245_115355341 | 103 |
| 413 | 3300009101 | Ga0105247_10262331 | Ga0105247_102623311 | 103 |
| 414 | 3300009148 | Ga0105243_10018982 | Ga0105243_100189824 | 103 |
| 415 | 3300009148 | Ga0105243_10029668 | Ga0105243_100296684 | 103 |
| 416 | 3300009148 | Ga0105243_10969369 | Ga0105243_109693691 | 103 |
| 417 | 3300009148 | Ga0105243_11119629 | Ga0105243_111196292 | 103 |
| 418 | 3300009148 | Ga0105243_11273798 | Ga0105243_112737982 | 103 |
| 419 | 3300009148 | Ga0105243_11777174 | Ga0105243_117771742 | 103 |
| 420 | 3300009174 | Ga0105241_10389013 | Ga0105241_103890133 | 103 |
| 421 | 3300009174 | Ga0105241_10420449 | Ga0105241_104204492 | 103 |
| 422 | 3300009174 | Ga0105241_11010795 | Ga0105241_110107952 | 103 |
| 423 | 3300009176 | Ga0105242_10002941 | Ga0105242_100029419 | 103 |
| 424 | 3300009176 | Ga0105242_10375600 | Ga0105242_103756002 | 103 |
| 425 | 3300009176 | Ga0105242_10454749 | Ga0105242_104547492 | 103 |
| 426 | 3300009176 | Ga0105242_10777703 | Ga0105242_107777032 | 103 |
| 427 | 3300009176 | Ga0105242_12629649 | Ga0105242_126296492 | 103 |
| 428 | 3300009177 | Ga0105248_10006504 | Ga0105248_100065049 | 103 |
| 429 | 3300009177 | Ga0105248_10701648 | Ga0105248_107016482 | 103 |
| 430 | 3300009177 | Ga0105248_13404229 | Ga0105248_134042291 | 103 |
| 431 | 3300009545 | Ga0105237_10022143 | Ga0105237_100221436 | 103 |
| 432 | 3300009545 | Ga0105237_10022563 | Ga0105237_100225633 | 103 |
| 433 | 3300009545 | Ga0105237_10044937 | Ga0105237_100449374 | 103 |
| 434 | 3300009545 | Ga0105237_12600564 | Ga0105237_126005641 | 103 |
| 435 | 3300009551 | Ga0105238_10381104 | Ga0105238_103811042 | 103 |
| 436 | 3300009551 | Ga0105238_12428565 | Ga0105238_124285652 | 103 |
| 437 | 3300009551 | Ga0105238_12684331 | Ga0105238_126843311 | 103 |
| 438 | 3300009553 | Ga0105249_10172034 | Ga0105249_101720343 | 103 |
| 439 | 3300009553 | Ga0105249_10304390 | Ga0105249_103043902 | 103 |
| 440 | 3300009553 | Ga0105249_10470445 | Ga0105249_104704452 | 103 |
| 441 | 3300009553 | Ga0105249_10975419 | Ga0105249_109754192 | 103 |
| 442 | 3300010375 | Ga0105239_10034022 | Ga0105239_100340222 | 103 |
| 443 | 3300010375 | Ga0105239_11575658 | Ga0105239_115756581 | 103 |
| 444 | 3300011119 | Ga0105246_10172817 | Ga0105246_101728172 | 103 |
| 445 | 3300011119 | Ga0105246_11127274 | Ga0105246_111272742 | 103 |
| 446 | 3300013100 | Ga0157373_10308491 | Ga0157373_103084912 | 103 |
| 447 | 3300013100 | Ga0157373_10697372 | Ga0157373_106973721 | 103 |
| 448 | 3300013104 | Ga0157370_10071975 | Ga0157370_100719754 | 103 |
| 449 | 3300013104 | Ga0157370_11367194 | Ga0157370_113671942 | 103 |
| 450 | 3300013296 | Ga0157374_10009908 | Ga0157374_100099088 | 103 |
| 451 | 3300013296 | Ga0157374_10277170 | Ga0157374_102771702 | 103 |
| 452 | 3300013296 | Ga0157374_10455283 | Ga0157374_104552832 | 103 |
| 453 | 3300013296 | Ga0157374_10754036 | Ga0157374_107540361 | 103 |
| 454 | 3300013296 | Ga0157374_11102222 | Ga0157374_111022221 | 103 |
| 455 | 3300013297 | Ga0157378_10008788 | Ga0157378_100087885 | 103 |
| 456 | 3300013297 | Ga0157378_10012969 | Ga0157378_100129693 | 103 |
| 457 | 3300013297 | Ga0157378_10146246 | Ga0157378_101462462 | 103 |
| 458 | 3300013297 | Ga0157378_10728291 | Ga0157378_107282912 | 103 |
| 459 | 3300013297 | Ga0157378_11161679 | Ga0157378_111616792 | 103 |
| 460 | 3300013297 | Ga0157378_11710601 | Ga0157378_117106012 | 103 |
| 461 | 3300013297 | Ga0157378_11949936 | Ga0157378_119499362 | 103 |
| 462 | 3300013306 | Ga0163162_10000168 | Ga0163162_1000016859 | 103 |
| 463 | 3300013306 | Ga0163162_10034511 | Ga0163162_100345117 | 103 |
| 464 | 3300013306 | Ga0163162_10059547 | Ga0163162_100595472 | 103 |
| 465 | 3300013306 | Ga0163162_10315677 | Ga0163162_103156773 | 103 |
| 466 | 3300013306 | Ga0163162_12189907 | Ga0163162_121899072 | 103 |
| 467 | 3300013307 | Ga0157372_10105643 | Ga0157372_101056433 | 103 |
| 468 | 3300013307 | Ga0157372_10160841 | Ga0157372_101608413 | 103 |
| 469 | 3300013307 | Ga0157372_10331593 | Ga0157372_103315932 | 103 |
| 470 | 3300013308 | Ga0157375_10001422 | Ga0157375_100014229 | 103 |
| 471 | 3300013308 | Ga0157375_10041871 | Ga0157375_100418713 | 103 |
| 472 | 3300013308 | Ga0157375_10135462 | Ga0157375_101354623 | 103 |
| 473 | 3300013308 | Ga0157375_10795507 | Ga0157375_107955072 | 103 |
| 474 | 3300013308 | Ga0157375_11531755 | Ga0157375_115317552 | 103 |
| 475 | 3300014325 | Ga0163163_10000817 | Ga0163163_1000081729 | 103 |
| 476 | 3300014325 | Ga0163163_10860999 | Ga0163163_108609992 | 103 |
| 477 | 3300014326 | Ga0157380_10007819 | Ga0157380_100078198 | 103 |
| 478 | 3300014326 | Ga0157380_10024651 | Ga0157380_100246513 | 103 |
| 479 | 3300014326 | Ga0157380_10109031 | Ga0157380_101090313 | 103 |
| 480 | 3300014326 | Ga0157380_11286245 | Ga0157380_112862452 | 103 |
| 481 | 3300014326 | Ga0157380_12103911 | Ga0157380_121039112 | 103 |
| 482 | 3300014497 | Ga0182008_10112794 | Ga0182008_101127942 | 103 |
| 483 | 3300014745 | Ga0157377_10490301 | Ga0157377_104903012 | 103 |
| 484 | 3300014968 | Ga0157379_10009570 | Ga0157379_100095707 | 103 |
| 485 | 3300014968 | Ga0157379_10026294 | Ga0157379_100262945 | 103 |
| 486 | 3300014968 | Ga0157379_10077463 | Ga0157379_100774633 | 103 |
| 487 | 3300014968 | Ga0157379_10279827 | Ga0157379_102798272 | 103 |
| 488 | 3300014968 | Ga0157379_10637925 | Ga0157379_106379252 | 103 |
| 489 | 3300014968 | Ga0157379_10794188 | Ga0157379_107941882 | 103 |
| 490 | 3300014969 | Ga0157376_10003750 | Ga0157376_100037509 | 103 |
| 491 | 3300014969 | Ga0157376_10040924 | Ga0157376_100409242 | 103 |
| 492 | 3300014969 | Ga0157376_11043831 | Ga0157376_110438312 | 103 |
| 493 | 3300014969 | Ga0157376_11142175 | Ga0157376_111421752 | 103 |
| 494 | 3300014969 | Ga0157376_11362583 | Ga0157376_113625832 | 103 |
| 495 | 3300017792 | Ga0163161_10091021 | Ga0163161_100910212 | 103 |
| 496 | 3300017792 | Ga0163161_10184705 | Ga0163161_101847052 | 103 |
| 497 | 3300017792 | Ga0163161_10226753 | Ga0163161_102267533 | 103 |
| 498 | 3300021361 | Ga0213872_10000009 | Ga0213872_1000000920 | 103 |
| 499 | 3300021361 | Ga0213872_10001063 | Ga0213872_1000106310 | 103 |
| 500 | 3300021361 | Ga0213872_10004239 | Ga0213872_100042393 | 103 |
| 501 | 3300025302 | Ga0207426_1158563 | Ga0207426_11585631 | 103 |
| 502 | 3300025303 | Ga0209051_1000315 | Ga0209051_100031540 | 103 |
| 503 | 3300025304 | Ga0209257_1000309 | Ga0209257_100030952 | 103 |
| 504 | 3300025304 | Ga0209257_1016516 | Ga0209257_10165161 | 103 |
| 505 | 3300025315 | Ga0207697_10017545 | Ga0207697_100175454 | 103 |
| 506 | 3300025315 | Ga0207697_10327890 | Ga0207697_103278901 | 103 |
| 507 | 3300025321 | Ga0207656_10042605 | Ga0207656_100426051 | 103 |
| 508 | 3300025893 | Ga0207682_10002297 | Ga0207682_100022979 | 103 |
| 509 | 3300025893 | Ga0207682_10069487 | Ga0207682_100694872 | 103 |
| 510 | 3300025899 | Ga0207642_10379509 | Ga0207642_103795092 | 103 |
| 511 | 3300025899 | Ga0207642_10575550 | Ga0207642_105755501 | 103 |
| 512 | 3300025899 | Ga0207642_10942718 | Ga0207642_109427181 | 103 |
| 513 | 3300025901 | Ga0207688_10747001 | Ga0207688_107470011 | 103 |
| 514 | 3300025903 | Ga0207680_10003377 | Ga0207680_100033777 | 103 |
| 515 | 3300025905 | Ga0207685_10213795 | Ga0207685_102137951 | 103 |
| 516 | 3300025905 | Ga0207685_10292505 | Ga0207685_102925052 | 103 |
| 517 | 3300025907 | Ga0207645_10002626 | Ga0207645_1000262610 | 103 |
| 518 | 3300025907 | Ga0207645_10003152 | Ga0207645_100031522 | 103 |
| 519 | 3300025907 | Ga0207645_10013698 | Ga0207645_100136985 | 103 |
| 520 | 3300025907 | Ga0207645_10084315 | Ga0207645_100843152 | 103 |
| 521 | 3300025907 | Ga0207645_10150477 | Ga0207645_101504772 | 103 |
| 522 | 3300025907 | Ga0207645_10433864 | Ga0207645_104338642 | 103 |
| 523 | 3300025908 | Ga0207643_10023892 | Ga0207643_100238923 | 103 |
| 524 | 3300025908 | Ga0207643_10112150 | Ga0207643_101121502 | 103 |
| 525 | 3300025909 | Ga0207705_10645419 | Ga0207705_106454192 | 103 |
| 526 | 3300025909 | Ga0207705_11339888 | Ga0207705_113398881 | 103 |
| 527 | 3300025910 | Ga0207684_10085345 | Ga0207684_100853454 | 103 |
| 528 | 3300025910 | Ga0207684_10294104 | Ga0207684_102941041 | 103 |
| 529 | 3300025911 | Ga0207654_10081214 | Ga0207654_100812142 | 103 |
| 530 | 3300025911 | Ga0207654_10306856 | Ga0207654_103068562 | 103 |
| 531 | 3300025912 | Ga0207707_10002045 | Ga0207707_100020455 | 103 |
| 532 | 3300025912 | Ga0207707_10065229 | Ga0207707_100652294 | 103 |
| 533 | 3300025912 | Ga0207707_10258442 | Ga0207707_102584423 | 103 |
| 534 | 3300025913 | Ga0207695_10038445 | Ga0207695_100384453 | 103 |
| 535 | 3300025913 | Ga0207695_10103170 | Ga0207695_101031704 | 103 |
| 536 | 3300025913 | Ga0207695_10350675 | Ga0207695_103506752 | 103 |
| 537 | 3300025914 | Ga0207671_10033573 | Ga0207671_100335733 | 103 |
| 538 | 3300025914 | Ga0207671_10768690 | Ga0207671_107686902 | 103 |
| 539 | 3300025917 | Ga0207660_11391444 | Ga0207660_113914441 | 103 |
| 540 | 3300025918 | Ga0207662_10424604 | Ga0207662_104246042 | 103 |
| 541 | 3300025919 | Ga0207657_10073512 | Ga0207657_100735123 | 103 |
| 542 | 3300025920 | Ga0207649_10006701 | Ga0207649_100067016 | 103 |
| 543 | 3300025920 | Ga0207649_10451429 | Ga0207649_104514292 | 103 |
| 544 | 3300025920 | Ga0207649_10690849 | Ga0207649_106908492 | 103 |
| 545 | 3300025920 | Ga0207649_11212328 | Ga0207649_112123282 | 103 |
| 546 | 3300025921 | Ga0207652_10026703 | Ga0207652_100267033 | 103 |
| 547 | 3300025921 | Ga0207652_10401156 | Ga0207652_104011563 | 103 |
| 548 | 3300025922 | Ga0207646_10109381 | Ga0207646_101093812 | 103 |
| 549 | 3300025922 | Ga0207646_10149848 | Ga0207646_101498483 | 103 |
| 550 | 3300025923 | Ga0207681_10020212 | Ga0207681_100202122 | 103 |
| 551 | 3300025923 | Ga0207681_10526049 | Ga0207681_105260492 | 103 |
| 552 | 3300025923 | Ga0207681_10533567 | Ga0207681_105335672 | 103 |
| 553 | 3300025924 | Ga0207694_10275730 | Ga0207694_102757302 | 103 |
| 554 | 3300025925 | Ga0207650_10077148 | Ga0207650_100771483 | 103 |
| 555 | 3300025925 | Ga0207650_10100023 | Ga0207650_101000232 | 103 |
| 556 | 3300025925 | Ga0207650_10114624 | Ga0207650_101146242 | 103 |
| 557 | 3300025925 | Ga0207650_10301729 | Ga0207650_103017292 | 103 |
| 558 | 3300025925 | Ga0207650_10417710 | Ga0207650_104177102 | 103 |
| 559 | 3300025926 | Ga0207659_10002305 | Ga0207659_100023056 | 103 |
| 560 | 3300025926 | Ga0207659_10019172 | Ga0207659_100191721 | 103 |
| 561 | 3300025926 | Ga0207659_10584626 | Ga0207659_105846262 | 103 |
| 562 | 3300025927 | Ga0207687_10036807 | Ga0207687_100368073 | 103 |
| 563 | 3300025927 | Ga0207687_10059048 | Ga0207687_100590482 | 103 |
| 564 | 3300025927 | Ga0207687_10089260 | Ga0207687_100892603 | 103 |
| 565 | 3300025927 | Ga0207687_10155738 | Ga0207687_101557381 | 103 |
| 566 | 3300025927 | Ga0207687_10325683 | Ga0207687_103256833 | 103 |
| 567 | 3300025927 | Ga0207687_10385198 | Ga0207687_103851982 | 103 |
| 568 | 3300025927 | Ga0207687_10491069 | Ga0207687_104910692 | 103 |
| 569 | 3300025931 | Ga0207644_10010913 | Ga0207644_100109135 | 103 |
| 570 | 3300025931 | Ga0207644_10113665 | Ga0207644_101136651 | 103 |
| 571 | 3300025931 | Ga0207644_10157857 | Ga0207644_101578573 | 103 |
| 572 | 3300025931 | Ga0207644_10753708 | Ga0207644_107537082 | 103 |
| 573 | 3300025931 | Ga0207644_10768630 | Ga0207644_107686302 | 103 |
| 574 | 3300025931 | Ga0207644_11553317 | Ga0207644_115533172 | 103 |
| 575 | 3300025932 | Ga0207690_11321674 | Ga0207690_113216742 | 103 |
| 576 | 3300025933 | Ga0207706_10073296 | Ga0207706_100732964 | 103 |
| 577 | 3300025933 | Ga0207706_10213269 | Ga0207706_102132692 | 103 |
| 578 | 3300025933 | Ga0207706_10370479 | Ga0207706_103704793 | 103 |
| 579 | 3300025933 | Ga0207706_10467567 | Ga0207706_104675672 | 103 |
| 580 | 3300025934 | Ga0207686_10019349 | Ga0207686_100193493 | 103 |
| 581 | 3300025934 | Ga0207686_10423557 | Ga0207686_104235572 | 103 |
| 582 | 3300025934 | Ga0207686_10484592 | Ga0207686_104845922 | 103 |
| 583 | 3300025934 | Ga0207686_10896066 | Ga0207686_108960662 | 103 |
| 584 | 3300025935 | Ga0207709_10113842 | Ga0207709_101138423 | 103 |
| 585 | 3300025935 | Ga0207709_10369894 | Ga0207709_103698942 | 103 |
| 586 | 3300025935 | Ga0207709_11060419 | Ga0207709_110604191 | 103 |
| 587 | 3300025935 | Ga0207709_11112533 | Ga0207709_111125332 | 103 |
| 588 | 3300025936 | Ga0207670_10010441 | Ga0207670_100104416 | 103 |
| 589 | 3300025937 | Ga0207669_10158749 | Ga0207669_101587494 | 103 |
| 590 | 3300025937 | Ga0207669_10406799 | Ga0207669_104067992 | 103 |
| 591 | 3300025937 | Ga0207669_10523564 | Ga0207669_105235642 | 103 |
| 592 | 3300025938 | Ga0207704_10001176 | Ga0207704_100011764 | 103 |
| 593 | 3300025938 | Ga0207704_10235341 | Ga0207704_102353413 | 103 |
| 594 | 3300025938 | Ga0207704_10689440 | Ga0207704_106894402 | 103 |
| 595 | 3300025940 | Ga0207691_10007352 | Ga0207691_1000735212 | 103 |
| 596 | 3300025940 | Ga0207691_10020788 | Ga0207691_100207887 | 103 |
| 597 | 3300025940 | Ga0207691_10031449 | Ga0207691_100314496 | 103 |
| 598 | 3300025940 | Ga0207691_10134497 | Ga0207691_101344971 | 103 |
| 599 | 3300025941 | Ga0207711_10010839 | Ga0207711_100108397 | 103 |
| 600 | 3300025942 | Ga0207689_10002510 | Ga0207689_1000251012 | 103 |
| 601 | 3300025942 | Ga0207689_10015898 | Ga0207689_100158987 | 103 |
| 602 | 3300025942 | Ga0207689_10041503 | Ga0207689_100415033 | 103 |
| 603 | 3300025942 | Ga0207689_10073322 | Ga0207689_100733222 | 103 |
| 604 | 3300025942 | Ga0207689_10120802 | Ga0207689_101208023 | 103 |
| 605 | 3300025942 | Ga0207689_10438207 | Ga0207689_104382072 | 103 |
| 606 | 3300025942 | Ga0207689_10672400 | Ga0207689_106724002 | 103 |
| 607 | 3300025945 | Ga0207679_10116092 | Ga0207679_101160923 | 103 |
| 608 | 3300025945 | Ga0207679_10312096 | Ga0207679_103120962 | 103 |
| 609 | 3300025945 | Ga0207679_10526984 | Ga0207679_105269841 | 103 |
| 610 | 3300025945 | Ga0207679_11056570 | Ga0207679_110565702 | 103 |
| 611 | 3300025949 | Ga0207667_11018397 | Ga0207667_110183972 | 103 |
| 612 | 3300025960 | Ga0207651_10033946 | Ga0207651_100339464 | 103 |
| 613 | 3300025960 | Ga0207651_10257684 | Ga0207651_102576842 | 103 |
| 614 | 3300025960 | Ga0207651_10282632 | Ga0207651_102826323 | 103 |
| 615 | 3300025960 | Ga0207651_10352824 | Ga0207651_103528243 | 103 |
| 616 | 3300025960 | Ga0207651_10590025 | Ga0207651_105900251 | 103 |
| 617 | 3300025961 | Ga0207712_10046245 | Ga0207712_100462454 | 103 |
| 618 | 3300025961 | Ga0207712_10144716 | Ga0207712_101447162 | 103 |
| 619 | 3300025961 | Ga0207712_10662255 | Ga0207712_106622552 | 103 |
| 620 | 3300025972 | Ga0207668_10108132 | Ga0207668_101081323 | 103 |
| 621 | 3300025972 | Ga0207668_10137024 | Ga0207668_101370243 | 103 |
| 622 | 3300025972 | Ga0207668_10286686 | Ga0207668_102866862 | 103 |
| 623 | 3300025972 | Ga0207668_10349595 | Ga0207668_103495952 | 103 |
| 624 | 3300025972 | Ga0207668_10614770 | Ga0207668_106147702 | 103 |
| 625 | 3300025981 | Ga0207640_10114940 | Ga0207640_101149403 | 103 |
| 626 | 3300025981 | Ga0207640_10814935 | Ga0207640_108149352 | 103 |
| 627 | 3300025986 | Ga0207658_10026401 | Ga0207658_100264015 | 103 |
| 628 | 3300025986 | Ga0207658_10029661 | Ga0207658_100296614 | 103 |
| 629 | 3300025986 | Ga0207658_10112238 | Ga0207658_101122381 | 103 |
| 630 | 3300025986 | Ga0207658_10167862 | Ga0207658_101678622 | 103 |
| 631 | 3300025986 | Ga0207658_10220516 | Ga0207658_102205163 | 103 |
| 632 | 3300025986 | Ga0207658_10252980 | Ga0207658_102529802 | 103 |
| 633 | 3300025986 | Ga0207658_10871330 | Ga0207658_108713301 | 103 |
| 634 | 3300026023 | Ga0207677_10009363 | Ga0207677_100093632 | 103 |
| 635 | 3300026023 | Ga0207677_10070855 | Ga0207677_100708554 | 103 |
| 636 | 3300026023 | Ga0207677_10074674 | Ga0207677_100746742 | 103 |
| 637 | 3300026023 | Ga0207677_10208339 | Ga0207677_102083392 | 103 |
| 638 | 3300026023 | Ga0207677_10852459 | Ga0207677_108524591 | 103 |
| 639 | 3300026035 | Ga0207703_10007195 | Ga0207703_100071956 | 103 |
| 640 | 3300026035 | Ga0207703_10211073 | Ga0207703_102110732 | 103 |
| 641 | 3300026041 | Ga0207639_10022564 | Ga0207639_100225643 | 103 |
| 642 | 3300026041 | Ga0207639_10170551 | Ga0207639_101705511 | 103 |
| 643 | 3300026041 | Ga0207639_10328382 | Ga0207639_103283823 | 103 |
| 644 | 3300026041 | Ga0207639_11466101 | Ga0207639_114661011 | 103 |
| 645 | 3300026041 | Ga0207639_11571748 | Ga0207639_115717481 | 103 |
| 646 | 3300026067 | Ga0207678_10005182 | Ga0207678_100051825 | 103 |
| 647 | 3300026067 | Ga0207678_10058661 | Ga0207678_100586613 | 103 |
| 648 | 3300026067 | Ga0207678_10061650 | Ga0207678_100616504 | 103 |
| 649 | 3300026067 | Ga0207678_10384271 | Ga0207678_103842711 | 103 |
| 650 | 3300026075 | Ga0207708_10323990 | Ga0207708_103239901 | 103 |
| 651 | 3300026075 | Ga0207708_10721500 | Ga0207708_107215002 | 103 |
| 652 | 3300026078 | Ga0207702_10045543 | Ga0207702_100455434 | 103 |
| 653 | 3300026078 | Ga0207702_10246158 | Ga0207702_102461582 | 103 |
| 654 | 3300026088 | Ga0207641_10022203 | Ga0207641_100222039 | 103 |
| 655 | 3300026088 | Ga0207641_10962569 | Ga0207641_109625692 | 103 |
| 656 | 3300026088 | Ga0207641_11101144 | Ga0207641_111011442 | 103 |
| 657 | 3300026089 | Ga0207648_10011444 | Ga0207648_100114447 | 103 |
| 658 | 3300026089 | Ga0207648_10013452 | Ga0207648_100134527 | 103 |
| 659 | 3300026089 | Ga0207648_10033988 | Ga0207648_100339885 | 103 |
| 660 | 3300026089 | Ga0207648_10040460 | Ga0207648_100404602 | 103 |
| 661 | 3300026089 | Ga0207648_10042464 | Ga0207648_100424644 | 103 |
| 662 | 3300026089 | Ga0207648_10045067 | Ga0207648_100450675 | 103 |
| 663 | 3300026089 | Ga0207648_10057182 | Ga0207648_100571824 | 103 |
| 664 | 3300026089 | Ga0207648_10155649 | Ga0207648_101556493 | 103 |
| 665 | 3300026089 | Ga0207648_10328646 | Ga0207648_103286462 | 103 |
| 666 | 3300026095 | Ga0207676_10009527 | Ga0207676_100095274 | 103 |
| 667 | 3300026095 | Ga0207676_10209491 | Ga0207676_102094911 | 103 |
| 668 | 3300026095 | Ga0207676_10447020 | Ga0207676_104470202 | 103 |
| 669 | 3300026095 | Ga0207676_10486819 | Ga0207676_104868191 | 103 |
| 670 | 3300026095 | Ga0207676_11699929 | Ga0207676_116999292 | 103 |
| 671 | 3300026116 | Ga0207674_10004887 | Ga0207674_1000488713 | 103 |
| 672 | 3300026116 | Ga0207674_10044914 | Ga0207674_100449144 | 103 |
| 673 | 3300026116 | Ga0207674_10088788 | Ga0207674_100887883 | 103 |
| 674 | 3300026116 | Ga0207674_10097618 | Ga0207674_100976183 | 103 |
| 675 | 3300026116 | Ga0207674_10173302 | Ga0207674_101733023 | 103 |
| 676 | 3300026116 | Ga0207674_10308373 | Ga0207674_103083731 | 103 |
| 677 | 3300026116 | Ga0207674_10383650 | Ga0207674_103836503 | 103 |
| 678 | 3300026118 | Ga0207675_100003168 | Ga0207675_10000316815 | 103 |
| 679 | 3300026118 | Ga0207675_100345804 | Ga0207675_1003458042 | 103 |
| 680 | 3300026118 | Ga0207675_101333015 | Ga0207675_1013330152 | 103 |
| 681 | 3300026121 | Ga0207683_10010616 | Ga0207683_100106168 | 103 |
| 682 | 3300026121 | Ga0207683_10019634 | Ga0207683_100196345 | 103 |
| 683 | 3300026121 | Ga0207683_10126527 | Ga0207683_101265273 | 103 |
| 684 | 3300026121 | Ga0207683_10172158 | Ga0207683_101721583 | 103 |
| 685 | 3300026121 | Ga0207683_10260942 | Ga0207683_102609422 | 103 |
| 686 | 3300026121 | Ga0207683_10533116 | Ga0207683_105331162 | 103 |
| 687 | 3300026142 | Ga0207698_10034283 | Ga0207698_100342834 | 103 |
| 688 | 3300026142 | Ga0207698_10115110 | Ga0207698_101151103 | 103 |
| 689 | 3300026142 | Ga0207698_10982938 | Ga0207698_109829382 | 103 |
| 690 | 3300026142 | Ga0207698_11258856 | Ga0207698_112588561 | 103 |
| 691 | 3300027471 | Ga0209995_1007125 | Ga0209995_10071252 | 103 |
| 692 | 3300027526 | Ga0209968_1000252 | Ga0209968_10002526 | 103 |
| 693 | 3300027543 | Ga0209999_1048232 | Ga0209999_10482322 | 103 |
| 694 | 3300027671 | Ga0209588_1123609 | Ga0209588_11236092 | 103 |
| 695 | 3300027695 | Ga0209966_1000027 | Ga0209966_100002746 | 103 |
| 696 | 3300027717 | Ga0209998_10025166 | Ga0209998_100251662 | 103 |
| 697 | 3300027866 | Ga0209813_10007685 | Ga0209813_100076852 | 103 |
| 698 | 3300027866 | Ga0209813_10027904 | Ga0209813_100279043 | 103 |
| 699 | 3300027866 | Ga0209813_10031206 | Ga0209813_100312062 | 103 |
| 700 | 3300027866 | Ga0209813_10074624 | Ga0209813_100746242 | 103 |
| 701 | 3300027866 | Ga0209813_10127363 | Ga0209813_101273631 | 103 |
| 702 | 3300027866 | Ga0209813_10285985 | Ga0209813_102859852 | 103 |
| 703 | 3300027876 | Ga0209974_10001546 | Ga0209974_100015461 | 103 |
| 704 | 3300027876 | Ga0209974_10102760 | Ga0209974_101027602 | 103 |
| 705 | 3300028379 | Ga0268266_10087570 | Ga0268266_100875702 | 103 |
| 706 | 3300028379 | Ga0268266_10352863 | Ga0268266_103528632 | 103 |
| 707 | 3300028379 | Ga0268266_11285310 | Ga0268266_112853102 | 103 |
| 708 | 3300028380 | Ga0268265_10053567 | Ga0268265_100535674 | 103 |
| 709 | 3300028380 | Ga0268265_10108252 | Ga0268265_101082522 | 103 |
| 710 | 3300028380 | Ga0268265_10170495 | Ga0268265_101704953 | 103 |
| 711 | 3300028380 | Ga0268265_10592620 | Ga0268265_105926202 | 103 |
| 712 | 3300028380 | Ga0268265_11827467 | Ga0268265_118274672 | 103 |
| 713 | 3300028380 | Ga0268265_12395214 | Ga0268265_123952142 | 103 |
| 714 | 3300028381 | Ga0268264_10015734 | Ga0268264_100157347 | 103 |
| 715 | 3300028381 | Ga0268264_10089369 | Ga0268264_100893692 | 103 |
| 716 | 3300028381 | Ga0268264_10296405 | Ga0268264_102964053 | 103 |
| 717 | 3300028381 | Ga0268264_11473446 | Ga0268264_114734462 | 103 |
| 718 | 3300028786 | Ga0307517_10044859 | Ga0307517_100448595 | 103 |
| 719 | 3300028786 | Ga0307517_10072094 | Ga0307517_100720944 | 103 |
| 720 | 3300028786 | Ga0307517_10258910 | Ga0307517_102589102 | 103 |
| 721 | 3300028786 | Ga0307517_10291403 | Ga0307517_102914032 | 103 |
| 722 | 3300028786 | Ga0307517_10339947 | Ga0307517_103399472 | 103 |
| 723 | 3300028786 | Ga0307517_10432990 | Ga0307517_104329902 | 103 |
| 724 | 3300028794 | Ga0307515_10000006 | Ga0307515_10000006589 | 103 |
| 725 | 3300028794 | Ga0307515_10000048 | Ga0307515_1000004859 | 103 |
| 726 | 3300028794 | Ga0307515_10000178 | Ga0307515_1000017881 | 103 |
| 727 | 3300028794 | Ga0307515_10028802 | Ga0307515_100288029 | 103 |
| 728 | 3300028794 | Ga0307515_10108583 | Ga0307515_101085834 | 103 |
| 729 | 3300028794 | Ga0307515_10112860 | Ga0307515_101128603 | 103 |
| 730 | 3300028794 | Ga0307515_10113929 | Ga0307515_101139293 | 103 |
| 731 | 3300028794 | Ga0307515_10143436 | Ga0307515_101434361 | 103 |
| 732 | 3300028794 | Ga0307515_10210945 | Ga0307515_102109452 | 103 |
| 733 | 3300028794 | Ga0307515_10239825 | Ga0307515_102398253 | 103 |
| 734 | 3300030521 | Ga0307511_10000082 | Ga0307511_1000008277 | 103 |
| 735 | 3300030522 | Ga0307512_10008458 | Ga0307512_100084585 | 103 |
| 736 | 3300030522 | Ga0307512_10073753 | Ga0307512_100737534 | 103 |
| 737 | 3300031251 | Ga0265327_10047228 | Ga0265327_100472283 | 103 |
| 738 | 3300031251 | Ga0265327_10198720 | Ga0265327_101987201 | 103 |
| 739 | 3300031344 | Ga0265316_10404004 | Ga0265316_104040042 | 103 |
| 740 | 3300031456 | Ga0307513_10015075 | Ga0307513_100150753 | 103 |
| 741 | 3300031456 | Ga0307513_10016139 | Ga0307513_100161392 | 103 |
| 742 | 3300031456 | Ga0307513_10110085 | Ga0307513_101100851 | 103 |
| 743 | 3300031456 | Ga0307513_10256109 | Ga0307513_102561093 | 103 |
| 744 | 3300031456 | Ga0307513_10432393 | Ga0307513_104323932 | 103 |
| 745 | 3300031456 | Ga0307513_10897313 | Ga0307513_108973131 | 103 |
| 746 | 3300031507 | Ga0307509_10000135 | Ga0307509_1000013562 | 103 |
| 747 | 3300031507 | Ga0307509_10002023 | Ga0307509_100020233 | 103 |
| 748 | 3300031507 | Ga0307509_10003789 | Ga0307509_1000378917 | 103 |
| 749 | 3300031507 | Ga0307509_10023592 | Ga0307509_100235923 | 103 |
| 750 | 3300031507 | Ga0307509_10049870 | Ga0307509_100498704 | 103 |
| 751 | 3300031507 | Ga0307509_10063411 | Ga0307509_100634112 | 103 |
| 752 | 3300031507 | Ga0307509_10506372 | Ga0307509_105063721 | 103 |
| 753 | 3300031548 | Ga0307408_100037340 | Ga0307408_1000373402 | 103 |
| 754 | 3300031548 | Ga0307408_100366711 | Ga0307408_1003667113 | 103 |
| 755 | 3300031548 | Ga0307408_100555038 | Ga0307408_1005550382 | 103 |
| 756 | 3300031548 | Ga0307408_101342350 | Ga0307408_1013423502 | 103 |
| 757 | 3300031548 | Ga0307408_102469856 | Ga0307408_1024698561 | 103 |
| 758 | 3300031616 | Ga0307508_10002258 | Ga0307508_100022587 | 103 |
| 759 | 3300031616 | Ga0307508_10003213 | Ga0307508_1000321310 | 103 |
| 760 | 3300031616 | Ga0307508_10068798 | Ga0307508_100687983 | 103 |
| 761 | 3300031616 | Ga0307508_10364060 | Ga0307508_103640602 | 103 |
| 762 | 3300031616 | Ga0307508_10583914 | Ga0307508_105839142 | 103 |
| 763 | 3300031649 | Ga0307514_10000567 | Ga0307514_1000056741 | 103 |
| 764 | 3300031649 | Ga0307514_10015044 | Ga0307514_100150444 | 103 |
| 765 | 3300031649 | Ga0307514_10191360 | Ga0307514_101913602 | 103 |
| 766 | 3300031649 | Ga0307514_10322951 | Ga0307514_103229512 | 103 |
| 767 | 3300031730 | Ga0307516_10000068 | Ga0307516_1000006833 | 103 |
| 768 | 3300031730 | Ga0307516_10000677 | Ga0307516_1000067738 | 103 |
| 769 | 3300031730 | Ga0307516_10001526 | Ga0307516_100015265 | 103 |
| 770 | 3300031730 | Ga0307516_10083550 | Ga0307516_100835502 | 103 |
| 771 | 3300031730 | Ga0307516_10088249 | Ga0307516_100882493 | 103 |
| 772 | 3300031730 | Ga0307516_10139836 | Ga0307516_101398362 | 103 |
| 773 | 3300031730 | Ga0307516_10531078 | Ga0307516_105310782 | 103 |
| 774 | 3300031730 | Ga0307516_10689599 | Ga0307516_106895992 | 103 |
| 775 | 3300031730 | Ga0307516_10815190 | Ga0307516_108151901 | 103 |
| 776 | 3300031731 | Ga0307405_10006161 | Ga0307405_100061613 | 103 |
| 777 | 3300031731 | Ga0307405_11098881 | Ga0307405_110988812 | 103 |
| 778 | 3300031731 | Ga0307405_11426447 | Ga0307405_114264472 | 103 |
| 779 | 3300031731 | Ga0307405_11461925 | Ga0307405_114619251 | 103 |
| 780 | 3300031824 | Ga0307413_10005022 | Ga0307413_100050222 | 103 |
| 781 | 3300031824 | Ga0307413_10513633 | Ga0307413_105136332 | 103 |
| 782 | 3300031824 | Ga0307413_11369641 | Ga0307413_113696412 | 103 |
| 783 | 3300031824 | Ga0307413_11462731 | Ga0307413_114627311 | 103 |
| 784 | 3300031824 | Ga0307413_12088653 | Ga0307413_120886531 | 103 |
| 785 | 3300031852 | Ga0307410_10052989 | Ga0307410_100529894 | 103 |
| 786 | 3300031852 | Ga0307410_10118795 | Ga0307410_101187952 | 103 |
| 787 | 3300031852 | Ga0307410_10147993 | Ga0307410_101479933 | 103 |
| 788 | 3300031852 | Ga0307410_10208782 | Ga0307410_102087824 | 103 |
| 789 | 3300031852 | Ga0307410_10385702 | Ga0307410_103857021 | 103 |
| 790 | 3300031852 | Ga0307410_10616049 | Ga0307410_106160492 | 103 |
| 791 | 3300031852 | Ga0307410_11609936 | Ga0307410_116099362 | 103 |
| 792 | 3300031901 | Ga0307406_10248496 | Ga0307406_102484962 | 103 |
| 793 | 3300031901 | Ga0307406_10371802 | Ga0307406_103718022 | 103 |
| 794 | 3300031901 | Ga0307406_11580603 | Ga0307406_115806032 | 103 |
| 795 | 3300031901 | Ga0307406_11724484 | Ga0307406_117244842 | 103 |
| 796 | 3300031903 | Ga0307407_10144012 | Ga0307407_101440123 | 103 |
| 797 | 3300031903 | Ga0307407_10149037 | Ga0307407_101490372 | 103 |
| 798 | 3300031903 | Ga0307407_10311361 | Ga0307407_103113612 | 103 |
| 799 | 3300031911 | Ga0307412_10028899 | Ga0307412_100288992 | 103 |
| 800 | 3300031911 | Ga0307412_10141870 | Ga0307412_101418703 | 103 |
| 801 | 3300031911 | Ga0307412_10169770 | Ga0307412_101697703 | 103 |
| 802 | 3300031911 | Ga0307412_10186141 | Ga0307412_101861413 | 103 |
| 803 | 3300031911 | Ga0307412_10217234 | Ga0307412_102172343 | 103 |
| 804 | 3300031911 | Ga0307412_10225048 | Ga0307412_102250482 | 103 |
| 805 | 3300031911 | Ga0307412_11188707 | Ga0307412_111887072 | 103 |
| 806 | 3300031911 | Ga0307412_11204519 | Ga0307412_112045191 | 103 |
| 807 | 3300031995 | Ga0307409_100009537 | Ga0307409_1000095372 | 103 |
| 808 | 3300031995 | Ga0307409_100501518 | Ga0307409_1005015182 | 103 |
| 809 | 3300032002 | Ga0307416_100025405 | Ga0307416_1000254054 | 103 |
| 810 | 3300032002 | Ga0307416_100176148 | Ga0307416_1001761483 | 103 |
| 811 | 3300032002 | Ga0307416_100183202 | Ga0307416_1001832023 | 103 |
| 812 | 3300032002 | Ga0307416_100237905 | Ga0307416_1002379053 | 103 |
| 813 | 3300032002 | Ga0307416_101087294 | Ga0307416_1010872942 | 103 |
| 814 | 3300032002 | Ga0307416_101423190 | Ga0307416_1014231902 | 103 |
| 815 | 3300032002 | Ga0307416_101933650 | Ga0307416_1019336502 | 103 |
| 816 | 3300032002 | Ga0307416_102366955 | Ga0307416_1023669552 | 103 |
| 817 | 3300032004 | Ga0307414_10056000 | Ga0307414_100560002 | 103 |
| 818 | 3300032004 | Ga0307414_10208303 | Ga0307414_102083032 | 103 |
| 819 | 3300032004 | Ga0307414_10246193 | Ga0307414_102461932 | 103 |
| 820 | 3300032004 | Ga0307414_10595351 | Ga0307414_105953511 | 103 |
| 821 | 3300032004 | Ga0307414_10959937 | Ga0307414_109599372 | 103 |
| 822 | 3300032005 | Ga0307411_10006035 | Ga0307411_100060356 | 103 |
| 823 | 3300032005 | Ga0307411_10142318 | Ga0307411_101423183 | 103 |
| 824 | 3300032005 | Ga0307411_10245047 | Ga0307411_102450472 | 103 |
| 825 | 3300032005 | Ga0307411_11158388 | Ga0307411_111583881 | 103 |
| 826 | 3300032126 | Ga0307415_100006492 | Ga0307415_1000064922 | 103 |
| 827 | 3300032126 | Ga0307415_101337455 | Ga0307415_1013374551 | 103 |
| 828 | 3300033179 | Ga0307507_10048825 | Ga0307507_100488254 | 103 |
| 829 | 3300033179 | Ga0307507_10106197 | Ga0307507_101061972 | 103 |
| 830 | 3300033180 | Ga0307510_10000170 | Ga0307510_1000017034 | 103 |
| 831 | 3300033180 | Ga0307510_10009424 | Ga0307510_100094242 | 103 |
| 832 | 3300033180 | Ga0307510_10403669 | Ga0307510_104036692 | 103 |
| 833 | 3300034820 | Ga0373959_0078851 | Ga0373959_0078851_142_453 | 103 |
| 834 | 3300034820 | Ga0373959_0196003 | Ga0373959_0196003_52_363 | 103 |
| 835 | 3300035083 | Ga0373926_0011423 | Ga0373926_0011423_1836_2150 | 103 |
| 836 | 3300035084 | Ga0373928_0049414 | Ga0373928_0049414_148_459 | 103 |
| 837 | 3300035085 | Ga0373929_0229875 | Ga0373929_0229875_180_500 | 103 |
| 838 | 3300035086 | Ga0373934_0000092 | Ga0373934_0000092_19110_19424 | 103 |
| 839 | 3300035086 | Ga0373934_0089259 | Ga0373934_0089259_349_663 | 103 |
| 840 | 3300035086 | Ga0373934_0360412 | Ga0373934_0360412_167_478 | 103 |
| 841 | 3300035089 | Ga0373944_0224777 | Ga0373944_0224777_54_368 | 103 |
| 842 | 3300035092 | Ga0373952_0182677 | Ga0373952_0182677_111_422 | 103 |
| 843 | 3300035111 | Ga0373923_0001839 | Ga0373923_0001839_3629_3943 | 103 |
| 844 | 3300035111 | Ga0373923_0207404 | Ga0373923_0207404_445_759 | 103 |
| 845 | 3300035112 | Ga0373932_0008780 | Ga0373932_0008780_1150_1461 | 103 |
| 846 | 3300035113 | Ga0373936_0014253 | Ga0373936_0014253_2510_2824 | 103 |
| 847 | 3300035113 | Ga0373936_0019494 | Ga0373936_0019494_1475_1786 | 103 |
| 848 | 3300035113 | Ga0373936_0136094 | Ga0373936_0136094_23_337 | 103 |
| 849 | 3300035113 | Ga0373936_0342077 | Ga0373936_0342077_318_635 | 103 |
| 850 | 3300035114 | Ga0373939_0230382 | Ga0373939_0230382_185_499 | 103 |
| 851 | 3300035116 | Ga0373945_0301848 | Ga0373945_0301848_287_601 | 103 |
| 852 | 3300035116 | Ga0373945_0558620 | Ga0373945_0558620_27_338 | 103 |
| 853 | 3300035117 | Ga0373953_0007328 | Ga0373953_0007328_2418_2732 | 103 |
| 854 | 3300035118 | Ga0373954_0013776 | Ga0373954_0013776_858_1172 | 103 |
| 855 | 3300035118 | Ga0373954_0018723 | Ga0373954_0018723_880_1197 | 103 |
| 856 | 3300035119 | Ga0373956_0004332 | Ga0373956_0004332_4369_4686 | 103 |
| 857 | 3300035119 | Ga0373956_0071476 | Ga0373956_0071476_723_1037 | 103 |
| 858 | 3300035120 | Ga0373957_0004771 | Ga0373957_0004771_3469_3786 | 103 |
| 859 | 3300035120 | Ga0373957_0009012 | Ga0373957_0009012_205_519 | 103 |
| 860 | 3300035121 | Ga0373960_0092695 | Ga0373960_0092695_182_493 | 103 |
| 861 | 3300035170 | Ga0373943_0019914 | Ga0373943_0019914_476_790 | 103 |
| 862 | 3300035171 | Ga0373946_0015558 | Ga0373946_0015558_1309_1623 | 103 |
| 863 | 3300035171 | Ga0373946_0329087 | Ga0373946_0329087_164_475 | 103 |
| 864 | 3300035172 | Ga0373955_0002722 | Ga0373955_0002722_3441_3758 | 103 |
| 865 | 3300035172 | Ga0373955_0105591 | Ga0373955_0105591_579_893 | 103 |
| 866 | 3300035172 | Ga0373955_0152970 | Ga0373955_0152970_698_1012 | 103 |
| 867 | 3300035172 | Ga0373955_0464919 | Ga0373955_0464919_302_613 | 103 |
| 868 | 3300035207 | Ga0373942_0371596 | Ga0373942_0371596_129_449 | 103 |
| 869 | 3300035410 | Ga0373924_0003563 | Ga0373924_0003563_3501_3815 | 103 |
| 870 | 3300035691 | Ga0373931_0028054 | Ga0373931_0028054_2475_2786 | 103 |
| 871 | 3300035691 | Ga0373931_0509810 | Ga0373931_0509810_214_525 | 103 |
| 872 | 3300035691 | Ga0373931_0633107 | Ga0373931_0633107_72_386 | 103 |
| 873 | 3300035691 | Ga0373931_0692833 | Ga0373931_0692833_118_429 | 103 |
| 874 | 3300035692 | Ga0373935_0042801 | Ga0373935_0042801_26_337 | 103 |
| 875 | 3300035692 | Ga0373935_0050707 | Ga0373935_0050707_1742_2056 | 103 |
| 876 | 3300035695 | Ga0373927_0019356 | Ga0373927_0019356_2060_2374 | 103 |
| 877 | 3300035695 | Ga0373927_0027651 | Ga0373927_0027651_3343_3654 | 103 |
| 878 | 3300035724 | Ga0373933_0011004 | Ga0373933_0011004_4452_4766 | 103 |
| 879 | 3300035724 | Ga0373933_0024114 | Ga0373933_0024114_635_952 | 103 |
| 880 | 3300035724 | Ga0373933_0541618 | Ga0373933_0541618_205_519 | 103 |
| 881 | 3300035725 | Ga0373947_0171798 | Ga0373947_0171798_676_987 | 103 |
| 882 | 3300035725 | Ga0373947_0289565 | Ga0373947_0289565_409_720 | 103 |
| 883 | 3300036401 | Ga0373937_0003933 | Ga0373937_0003933_10206_10523 | 103 |
| 884 | 3300036401 | Ga0373937_0049598 | Ga0373937_0049598_2599_2910 | 103 |
| 885 | 3300036401 | Ga0373937_0317900 | Ga0373937_0317900_876_1187 | 103 |
| 886 | 3300036401 | Ga0373937_0462106 | Ga0373937_0462106_687_1001 | 103 |
| 887 | 3300036401 | Ga0373937_0495843 | Ga0373937_0495843_302_619 | 103 |
| 888 | 3300036401 | Ga0373937_0607935 | Ga0373937_0607935_589_900 | 103 |
| 889 | 3300036401 | Ga0373937_0655170 | Ga0373937_0655170_477_791 | 103 |
| 890 | 3300036401 | Ga0373937_1021581 | Ga0373937_1021581_341_652 | 103 |
| 891 | 3300036401 | Ga0373937_1945048 | Ga0373937_1945048_131_442 | 103 |
| 892 | 3300037068 | Ga0373925_0021793 | Ga0373925_0021793_2750_3061 | 103 |
| 893 | 3300037068 | Ga0373925_0038647 | Ga0373925_0038647_1865_2176 | 103 |
| 894 | 3300037068 | Ga0373925_0073187 | Ga0373925_0073187_1558_1872 | 103 |
| 895 | 3300037068 | Ga0373925_0102290 | Ga0373925_0102290_961_1272 | 103 |
| 896 | 3300037068 | Ga0373925_0475128 | Ga0373925_0475128_221_532 | 103 |
| 897 | 3300037068 | Ga0373925_1306608 | Ga0373925_1306608_189_500 | 103 |
| 898 | 3300037068 | Ga0373925_1664843 | Ga0373925_1664843_45_362 | 103 |
| 899 | 3300037471 | Ga0395905_0006586 | Ga0395905_0006586_2803_3114 | 103 |
| 900 | 3300037853 | Ga0436364_0041268 | Ga0436364_0041268_683_1009 | 103 |
| 901 | 3300037853 | Ga0436364_0145601 | Ga0436364_0145601_1482_1793 | 103 |
| 902 | 3300039447 | Ga0436361_0427460 | Ga0436361_0427460_19869_20180 | 103 |
| 903 | 3300039447 | Ga0436361_0677106 | Ga0436361_0677106_3649_3960 | 103 |
| 904 | 3300039450 | Ga0436363_0908329 | Ga0436363_0908329_157_468 | 103 |
| 905 | 3300041410 | Ga0439461_0011063 | Ga0439461_0011063_395_706 | 103 |
| 906 | 3300041441 | Ga0451787_108726 | Ga0451787_108726_194_505 | 103 |
| 907 | 3300041451 | Ga0451791_0258275 | Ga0451791_0258275_540_851 | 103 |
| 908 | 3300041452 | Ga0451793_0385879 | Ga0451793_0385879_131_442 | 103 |
| 909 | 3300041456 | Ga0451795_0098800 | Ga0451795_0098800_180_491 | 103 |
| 910 | 3300041458 | Ga0451798_0690418 | Ga0451798_0690418_349_660 | 103 |
| 911 | 3300041460 | Ga0451802_0097874 | Ga0451802_0097874_124_435 | 103 |
| 912 | 3300041463 | Ga0451804_0518901 | Ga0451804_0518901_417_728 | 103 |
| 913 | 3300041486 | Ga0451807_0660491 | Ga0451807_0660491_140_451 | 103 |
| 914 | 3300041486 | Ga0451807_1855817 | Ga0451807_1855817_369_680 | 103 |
| 915 | 3300041486 | Ga0451807_2535304 | Ga0451807_2535304_107_418 | 103 |
| 916 | 3300041491 | Ga0451833_0364967 | Ga0451833_0364967_196_507 | 103 |
| 917 | 3300041496 | Ga0451839_0985847 | Ga0451839_0985847_140_451 | 103 |
| 918 | 3300041501 | Ga0451845_0812550 | Ga0451845_0812550_110_421 | 103 |
| 919 | 3300041507 | Ga0451851_1327704 | Ga0451851_1327704_497_808 | 103 |
| 920 | 3300041509 | Ga0451843_0719174 | Ga0451843_0719174_114_425 | 103 |
| 921 | 3300041509 | Ga0451843_1018189 | Ga0451843_1018189_109_420 | 103 |
| 922 | 3300041509 | Ga0451843_1143476 | Ga0451843_1143476_116_427 | 103 |
| 923 | 3300041512 | Ga0451853_1855892 | Ga0451853_1855892_207_518 | 103 |
| 924 | 3300041512 | Ga0451853_2145180 | Ga0451853_2145180_117_428 | 103 |
| 925 | 3300041512 | Ga0451853_3592373 | Ga0451853_3592373_526_837 | 103 |
| 926 | 3300041997 | Ga0439431_0003099 | Ga0439431_0003099_748_1059 | 103 |
| 927 | 3300041997 | Ga0439431_0022429 | Ga0439431_0022429_804_1115 | 103 |
| 928 | 3300042001 | Ga0439441_040866 | Ga0439441_040866_258_572 | 103 |
| 929 | 3300042002 | Ga0439442_083723 | Ga0439442_083723_163_474 | 103 |
| 930 | 3300042004 | Ga0439445_0069538 | Ga0439445_0069538_632_943 | 103 |
| 931 | 3300042004 | Ga0439445_0095564 | Ga0439445_0095564_196_507 | 103 |
| 932 | 3300042007 | Ga0439449_0176244 | Ga0439449_0176244_361_672 | 103 |
| 933 | 3300042007 | Ga0439449_0375104 | Ga0439449_0375104_213_524 | 103 |
| 934 | 3300042115 | Ga0450911_000064 | Ga0450911_000064_41081_41392 | 103 |
| 935 | 3300042120 | Ga0450917_012394 | Ga0450917_012394_353_667 | 103 |
| 936 | 3300042126 | Ga0450888_013759 | Ga0450888_013759_244_555 | 103 |
| 937 | 3300042127 | Ga0450890_037612 | Ga0450890_037612_96_410 | 103 |
| 938 | 3300042133 | Ga0450896_062047 | Ga0450896_062047_230_541 | 103 |
| 939 | 3300042134 | Ga0450898_115335 | Ga0450898_115335_165_476 | 103 |
| 940 | 3300042135 | Ga0450899_011151 | Ga0450899_011151_191_502 | 103 |
| 941 | 3300042144 | Ga0450889_052289 | Ga0450889_052289_143_454 | 103 |
| 942 | 3300042147 | Ga0450910_077718 | Ga0450910_077718_22_333 | 103 |
| 943 | 3300042156 | Ga0439446_0162451 | Ga0439446_0162451_40_351 | 103 |
| 944 | 3300042435 | Ga0439434_0024180 | Ga0439434_0024180_910_1221 | 103 |
| 945 | 3300042438 | Ga0439459_0120093 | Ga0439459_0120093_114_425 | 103 |
| 946 | 3300042876 | Ga0451577_0000843 | Ga0451577_0000843_34179_34490 | 103 |
| 947 | 3300042876 | Ga0451577_0019207 | Ga0451577_0019207_2255_2566 | 103 |
| 948 | 3300042876 | Ga0451577_0031701 | Ga0451577_0031701_2251_2562 | 103 |
| 949 | 3300042876 | Ga0451577_0105948 | Ga0451577_0105948_1294_1605 | 103 |
| 950 | 3300042876 | Ga0451577_0128968 | Ga0451577_0128968_1332_1643 | 103 |
| 951 | 3300042876 | Ga0451577_0172323 | Ga0451577_0172323_447_758 | 103 |
| 952 | 3300042876 | Ga0451577_0261180 | Ga0451577_0261180_775_1086 | 103 |
| 953 | 3300042876 | Ga0451577_0305536 | Ga0451577_0305536_602_913 | 103 |
| 954 | 3300042876 | Ga0451577_0637692 | Ga0451577_0637692_69_380 | 103 |
| 955 | 3300044673 | Ga0453683_0242924 | Ga0453683_0242924_101_412 | 103 |
| 956 | 3300044712 | Ga0453684_0167558 | Ga0453684_0167558_1256_1567 | 103 |
| 957 | 3300044712 | Ga0453684_0222854 | Ga0453684_0222854_806_1117 | 103 |
| 958 | 3300044712 | Ga0453684_0326879 | Ga0453684_0326879_1398_1709 | 103 |
| 959 | 3300044712 | Ga0453684_0355134 | Ga0453684_0355134_829_1140 | 103 |
| 960 | 3300044712 | Ga0453684_0414754 | Ga0453684_0414754_320_631 | 103 |
| 961 | 3300044712 | Ga0453684_0497056 | Ga0453684_0497056_848_1159 | 103 |
| 962 | 3300044712 | Ga0453684_0545664 | Ga0453684_0545664_718_1029 | 103 |
| 963 | 3300044712 | Ga0453684_0632424 | Ga0453684_0632424_714_1025 | 103 |
| 964 | 3300044712 | Ga0453684_0846047 | Ga0453684_0846047_157_468 | 103 |
| 965 | 3300045051 | Ga0451576_0016269 | Ga0451576_0016269_4335_4646 | 103 |
| 966 | 3300045051 | Ga0451576_0182140 | Ga0451576_0182140_38_349 | 103 |
| 967 | 3300045051 | Ga0451576_0204453 | Ga0451576_0204453_1221_1532 | 103 |
| 968 | 3300045051 | Ga0451576_0273763 | Ga0451576_0273763_232_591 | 103 |
| 969 | 3300045051 | Ga0451576_0396581 | Ga0451576_0396581_660_971 | 103 |
| 970 | 3300045051 | Ga0451576_0657900 | Ga0451576_0657900_251_562 | 103 |
| 971 | 3300046454 | Ga0495592_0002300 | Ga0495592_0002300_2671_2988 | 103 |
| 972 | 3300046454 | Ga0495592_0018151 | Ga0495592_0018151_3596_3907 | 103 |
| 973 | 3300046454 | Ga0495592_0045062 | Ga0495592_0045062_1551_1865 | 103 |
| 974 | 3300046454 | Ga0495592_0124858 | Ga0495592_0124858_675_989 | 103 |
| 975 | 3300046455 | Ga0495603_0194372 | Ga0495603_0194372_399_713 | 103 |
| 976 | 3300046457 | Ga0495590_0140922 | Ga0495590_0140922_100_411 | 103 |
| 977 | 3300046459 | Ga0495629_0478951 | Ga0495629_0478951_330_641 | 103 |
| 978 | 3300046460 | Ga0495638_0118898 | Ga0495638_0118898_139_450 | 103 |
| 979 | 3300046460 | Ga0495638_0153200 | Ga0495638_0153200_414_725 | 103 |
| 980 | 3300046460 | Ga0495638_0378659 | Ga0495638_0378659_287_598 | 103 |
| 981 | 3300046461 | Ga0495641_0007404 | Ga0495641_0007404_2188_2502 | 103 |
| 982 | 3300046462 | Ga0495651_0001600 | Ga0495651_0001600_3650_3964 | 103 |
| 983 | 3300046462 | Ga0495651_0002209 | Ga0495651_0002209_5379_5696 | 103 |
| 984 | 3300046463 | Ga0495653_0242741 | Ga0495653_0242741_477_791 | 103 |
| 985 | 3300046471 | Ga0495650_0085118 | Ga0495650_0085118_150_461 | 103 |
| 986 | 3300046472 | Ga0495580_0017228 | Ga0495580_0017228_2727_3041 | 103 |
| 987 | 3300046473 | Ga0495582_0023691 | Ga0495582_0023691_2537_2851 | 103 |
| 988 | 3300046475 | Ga0495639_0005105 | Ga0495639_0005105_3266_3580 | 103 |
| 989 | 3300046476 | Ga0495662_0012408 | Ga0495662_0012408_1315_1629 | 103 |
| 990 | 3300046477 | Ga0495664_0035511 | Ga0495664_0035511_1278_1592 | 103 |
| 991 | 3300046506 | Ga0495583_0086491 | Ga0495583_0086491_37_348 | 103 |
| 992 | 3300046507 | Ga0495606_0146348 | Ga0495606_0146348_406_717 | 103 |
| 993 | 3300046511 | Ga0495608_0003952 | Ga0495608_0003952_383_697 | 103 |
| 994 | 3300046511 | Ga0495608_0293295 | Ga0495608_0293295_580_897 | 103 |
| 995 | 3300046513 | Ga0495616_0234446 | Ga0495616_0234446_408_719 | 103 |
| 996 | 3300046514 | Ga0495618_0033008 | Ga0495618_0033008_281_595 | 103 |
| 997 | 3300046515 | Ga0495620_0153980 | Ga0495620_0153980_553_864 | 103 |
| 998 | 3300046516 | Ga0495628_0004302 | Ga0495628_0004302_661_978 | 103 |
| 999 | 3300046516 | Ga0495628_0008390 | Ga0495628_0008390_3762_4076 | 103 |
| 1000 | 3300046517 | Ga0495630_0186935 | Ga0495630_0186935_409_723 | 103 |
| 1001 | 3300046517 | Ga0495630_0218555 | Ga0495630_0218555_162_479 | 103 |
| 1002 | 3300046517 | Ga0495630_0438598 | Ga0495630_0438598_236_547 | 103 |
| 1003 | 3300046519 | Ga0495632_0026107 | Ga0495632_0026107_2552_2863 | 103 |
| 1004 | 3300046522 | Ga0495643_0200544 | Ga0495643_0200544_542_853 | 103 |
| 1005 | 3300046524 | Ga0495648_0075809 | Ga0495648_0075809_688_999 | 103 |
| 1006 | 3300046524 | Ga0495648_0172759 | Ga0495648_0172759_73_384 | 103 |
| 1007 | 3300046524 | Ga0495648_0431841 | Ga0495648_0431841_105_416 | 103 |
| 1008 | 3300046526 | Ga0495666_0003491 | Ga0495666_0003491_6680_6994 | 103 |
| 1009 | 3300046528 | Ga0495642_0222995 | Ga0495642_0222995_205_516 | 103 |
| 1010 | 3300046529 | Ga0495652_0002967 | Ga0495652_0002967_3845_4162 | 103 |
| 1011 | 3300046529 | Ga0495652_0026875 | Ga0495652_0026875_3272_3586 | 103 |
| 1012 | 3300046530 | Ga0495654_0357509 | Ga0495654_0357509_109_420 | 103 |
| 1013 | 3300046531 | Ga0495665_0039307 | Ga0495665_0039307_363_677 | 103 |
| 1014 | 3300046533 | Ga0495640_0805887 | Ga0495640_0805887_42_356 | 103 |
| 1015 | 3300046535 | Ga0495586_0016380 | Ga0495586_0016380_3280_3594 | 103 |
| 1016 | 3300046535 | Ga0495586_0055189 | Ga0495586_0055189_236_547 | 103 |
| 1017 | 3300046536 | Ga0495587_0002613 | Ga0495587_0002613_9774_10088 | 103 |
| 1018 | 3300046537 | Ga0495598_0179321 | Ga0495598_0179321_81_392 | 103 |
| 1019 | 3300046542 | Ga0495597_0047545 | Ga0495597_0047545_1428_1739 | 103 |
| 1020 | 3300046542 | Ga0495597_0080236 | Ga0495597_0080236_1015_1326 | 103 |
| 1021 | 3300046543 | Ga0495645_0017400 | Ga0495645_0017400_1206_1523 | 103 |
| 1022 | 3300046557 | Ga0495622_0013250 | Ga0495622_0013250_2202_2516 | 103 |
| 1023 | 3300046558 | Ga0495633_0506825 | Ga0495633_0506825_34_345 | 103 |
| 1024 | 3300046559 | Ga0495667_0058327 | Ga0495667_0058327_1661_1978 | 103 |
| 1025 | 3300046559 | Ga0495667_0161254 | Ga0495667_0161254_411_725 | 103 |
| 1026 | 3300046559 | Ga0495667_0189183 | Ga0495667_0189183_801_1115 | 103 |
| 1027 | 3300046616 | Ga0495668_0069990 | Ga0495668_0069990_1184_1495 | 103 |
| 1028 | 3300046616 | Ga0495668_0443489 | Ga0495668_0443489_121_432 | 103 |
| 1029 | 3300046642 | Ga0495634_0060300 | Ga0495634_0060300_1353_1667 | 103 |
| 1030 | 3300046660 | Ga0495625_0481068 | Ga0495625_0481068_160_471 | 103 |
| 1031 | 3300046660 | Ga0495625_0548161 | Ga0495625_0548161_308_619 | 103 |
| 1032 | 3300046660 | Ga0495625_0875477 | Ga0495625_0875477_138_449 | 103 |
| 1033 | 3300046663 | Ga0495635_0017152 | Ga0495635_0017152_2537_2851 | 103 |
| 1034 | 3300046675 | Ga0495657_0017464 | Ga0495657_0017464_3370_3684 | 103 |
| 1035 | 3300046675 | Ga0495657_0535412 | Ga0495657_0535412_274_591 | 103 |
| 1036 | 3300046678 | Ga0495599_0011947 | Ga0495599_0011947_4600_4917 | 103 |
| 1037 | 3300046678 | Ga0495599_0015613 | Ga0495599_0015613_2245_2559 | 103 |
| 1038 | 3300046678 | Ga0495599_0038730 | Ga0495599_0038730_2341_2655 | 103 |
| 1039 | 3300046680 | Ga0495646_0018322 | Ga0495646_0018322_498_809 | 103 |
| 1040 | 3300046680 | Ga0495646_0132969 | Ga0495646_0132969_676_990 | 103 |
| 1041 | 3300046681 | Ga0495647_0014541 | Ga0495647_0014541_1942_2256 | 103 |
| 1042 | 3300046681 | Ga0495647_0163823 | Ga0495647_0163823_328_639 | 103 |
| 1043 | 3300046683 | Ga0495658_0025108 | Ga0495658_0025108_2083_2394 | 103 |
| 1044 | 3300046683 | Ga0495658_0026522 | Ga0495658_0026522_2070_2384 | 103 |
| 1045 | 3300046683 | Ga0495658_0110485 | Ga0495658_0110485_953_1264 | 103 |
| 1046 | 3300046683 | Ga0495658_0191753 | Ga0495658_0191753_472_783 | 103 |
| 1047 | 3300046683 | Ga0495658_0554276 | Ga0495658_0554276_189_500 | 103 |
| 1048 | 3300046689 | Ga0495613_0083494 | Ga0495613_0083494_1428_1742 | 103 |
| 1049 | 3300046690 | Ga0495624_0014311 | Ga0495624_0014311_1898_2212 | 103 |
| 1050 | 3300046690 | Ga0495624_0083647 | Ga0495624_0083647_1553_1864 | 103 |
| 1051 | 3300046691 | Ga0495670_0172367 | Ga0495670_0172367_22_333 | 103 |
| 1052 | 3300046692 | Ga0495671_0166580 | Ga0495671_0166580_711_1022 | 103 |
| 1053 | 3300046692 | Ga0495671_0339833 | Ga0495671_0339833_27_338 | 103 |
| 1054 | 3300046694 | Ga0495649_0002438 | Ga0495649_0002438_12602_12913 | 103 |
| 1055 | 3300046809 | Ga0495600_0019882 | Ga0495600_0019882_3774_4088 | 103 |
| 1056 | 3300047315 | Ga0495581_0155377 | Ga0495581_0155377_992_1306 | 103 |
| 1057 | 3300047317 | Ga0495604_0025969 | Ga0495604_0025969_723_1037 | 103 |
| 1058 | 3300047319 | Ga0495674_0427473 | Ga0495674_0427473_23_337 | 103 |
| 1059 | 3300047321 | Ga0495676_0255681 | Ga0495676_0255681_714_1025 | 103 |
| 1060 | 3300047322 | Ga0495680_0107777 | Ga0495680_0107777_204_518 | 103 |
| 1061 | 3300047322 | Ga0495680_0651977 | Ga0495680_0651977_371_685 | 103 |
| 1062 | 3300047443 | Ga0495687_000328 | Ga0495687_000328_43215_43526 | 103 |
| 1063 | 3300047443 | Ga0495687_003100 | Ga0495687_003100_6994_7305 | 103 |
| 1064 | 3300047443 | Ga0495687_196581 | Ga0495687_196581_53_364 | 103 |
| 1065 | 3300047444 | Ga0495675_0001531 | Ga0495675_0001531_1837_2151 | 103 |
| 1066 | 3300047444 | Ga0495675_0094467 | Ga0495675_0094467_657_974 | 103 |
| 1067 | 3300047445 | Ga0495677_0198732 | Ga0495677_0198732_54_365 | 103 |
| 1068 | 3300047446 | Ga0495679_049230 | Ga0495679_049230_815_1126 | 103 |
| 1069 | 3300047469 | Ga0495673_0277409 | Ga0495673_0277409_32_343 | 103 |
| 1070 | 3300047470 | Ga0495681_0330156 | Ga0495681_0330156_200_511 | 103 |
| 1071 | 3300047471 | Ga0495684_0005095 | Ga0495684_0005095_543_857 | 103 |
| 1072 | 3300047471 | Ga0495684_0304677 | Ga0495684_0304677_133_447 | 103 |
| 1073 | 3300047472 | Ga0495686_0167469 | Ga0495686_0167469_194_505 | 103 |
| 1074 | 3300047472 | Ga0495686_0421970 | Ga0495686_0421970_51_362 | 103 |
| 1075 | 3300047673 | Ga0495593_0680229 | Ga0495593_0680229_27_338 | 103 |
| 1076 | 3300048088 | Ga0495602_0438485 | Ga0495602_0438485_433_744 | 103 |
| 1077 | 3300048088 | Ga0495602_0441654 | Ga0495602_0441654_575_886 | 103 |
| 1078 | 3300048088 | Ga0495602_0943119 | Ga0495602_0943119_98_415 | 103 |
| 1079 | 3300048091 | Ga0495626_0246832 | Ga0495626_0246832_364_675 | 103 |
| 1080 | 3300048904 | Ga0496101_0130117 | Ga0496101_0130117_741_1052 | 103 |
| 1081 | 3300048905 | Ga0496102_1779792 | Ga0496102_1779792_188_499 | 103 |
| 1082 | 3300048907 | Ga0496104_0524412 | Ga0496104_0524412_737_1048 | 103 |
| 1083 | 3300048909 | Ga0496106_0055989 | Ga0496106_0055989_524_835 | 103 |
| 1084 | 3300048911 | Ga0496108_0058365 | Ga0496108_0058365_828_1139 | 103 |
| 1085 | 3300048911 | Ga0496108_0219302 | Ga0496108_0219302_459_770 | 103 |
| 1086 | 3300048911 | Ga0496108_1757685 | Ga0496108_1757685_22_333 | 103 |
| 1087 | 3300048912 | Ga0496109_0188793 | Ga0496109_0188793_973_1284 | 103 |
| 1088 | 3300048913 | Ga0496110_0273726 | Ga0496110_0273726_976_1287 | 103 |
| 1089 | 3300048915 | Ga0496112_0551025 | Ga0496112_0551025_477_788 | 103 |
| 1090 | 3300048916 | Ga0496113_0449754 | Ga0496113_0449754_701_1012 | 103 |
| 1091 | 3300048916 | Ga0496113_1603142 | Ga0496113_1603142_153_464 | 103 |
| 1092 | 3300048917 | Ga0496114_0032738 | Ga0496114_0032738_3015_3326 | 103 |
| 1093 | 3300048917 | Ga0496114_0420814 | Ga0496114_0420814_376_687 | 103 |
| 1094 | 3300048917 | Ga0496114_0706632 | Ga0496114_0706632_285_596 | 103 |
| 1095 | 3300048924 | Ga0496121_0034400 | Ga0496121_0034400_604_915 | 103 |
| 1096 | 3300048924 | Ga0496121_0432796 | Ga0496121_0432796_530_841 | 103 |
| 1097 | 3300048927 | Ga0496124_0048814 | Ga0496124_0048814_829_1140 | 103 |
| 1098 | 3300048927 | Ga0496124_0155790 | Ga0496124_0155790_833_1153 | 103 |
| 1099 | 3300048928 | Ga0496125_0141311 | Ga0496125_0141311_810_1121 | 103 |
| 1100 | 3300048928 | Ga0496125_0182268 | Ga0496125_0182268_432_743 | 103 |
| 1101 | 3300048928 | Ga0496125_0766763 | Ga0496125_0766763_70_381 | 103 |
| 1102 | 3300049520 | Ga0501297_030494 | Ga0501297_030494_389_700 | 103 |
| 1103 | 3300049521 | Ga0501298_020738 | Ga0501298_020738_664_975 | 103 |
| 1104 | 3300049523 | Ga0501300_035560 | Ga0501300_035560_202_513 | 103 |
| 1105 | 3300049524 | Ga0501301_001189 | Ga0501301_001189_490_801 | 103 |
| 1106 | 3300049526 | Ga0501303_001065 | Ga0501303_001065_725_1036 | 103 |
| 1107 | 3300049568 | Ga0501031_0001187 | Ga0501031_0001187_8485_8796 | 103 |
| 1108 | 3300049568 | Ga0501031_0118225 | Ga0501031_0118225_1136_1447 | 103 |
| 1109 | 3300049572 | Ga0501036_1043307 | Ga0501036_1043307_164_475 | 103 |
| 1110 | 3300049575 | Ga0501039_0567692 | Ga0501039_0567692_67_378 | 103 |
| 1111 | 3300049578 | Ga0501042_0828742 | Ga0501042_0828742_165_476 | 103 |
| 1112 | 3300049579 | Ga0501043_0000059 | Ga0501043_0000059_85111_85422 | 103 |
| 1113 | 3300049580 | Ga0501046_0000082 | Ga0501046_0000082_85002_85313 | 103 |
| 1114 | 3300049581 | Ga0501047_0000050 | Ga0501047_0000050_16023_16334 | 103 |
| 1115 | 3300049581 | Ga0501047_0018628 | Ga0501047_0018628_6157_6468 | 103 |
| 1116 | 3300049582 | Ga0501048_0018113 | Ga0501048_0018113_2435_2746 | 103 |
| 1117 | 3300049582 | Ga0501048_0836356 | Ga0501048_0836356_286_597 | 103 |
| 1118 | 3300049583 | Ga0501067_0155854 | Ga0501067_0155854_683_994 | 103 |
| 1119 | 3300049583 | Ga0501067_0213865 | Ga0501067_0213865_730_1041 | 103 |
| 1120 | 3300049584 | Ga0501068_0866314 | Ga0501068_0866314_199_510 | 103 |
| 1121 | 3300049585 | Ga0501069_0267212 | Ga0501069_0267212_601_912 | 103 |
| 1122 | 3300049586 | Ga0501070_0168367 | Ga0501070_0168367_1469_1780 | 103 |
| 1123 | 3300049588 | Ga0501072_0121924 | Ga0501072_0121924_188_499 | 103 |
| 1124 | 3300049592 | Ga0501076_0043317 | Ga0501076_0043317_2919_3230 | 103 |
| 1125 | 3300049592 | Ga0501076_1297372 | Ga0501076_1297372_93_404 | 103 |
| 1126 | 3300049593 | Ga0501077_0378880 | Ga0501077_0378880_168_479 | 103 |
| 1127 | 3300049649 | Ga0501198_084939 | Ga0501198_084939_61_372 | 103 |
| 1128 | 3300049662 | Ga0501222_017605 | Ga0501222_017605_315_626 | 103 |
| 1129 | 3300049663 | Ga0501223_028488 | Ga0501223_028488_750_1061 | 103 |
| 1130 | 3300049668 | Ga0501233_137999 | Ga0501233_137999_38_349 | 103 |
| 1131 | 3300049670 | Ga0501236_125398 | Ga0501236_125398_164_475 | 103 |
| 1132 | 3300049686 | Ga0501257_203693 | Ga0501257_203693_146_457 | 103 |
| 1133 | 3300049704 | Ga0501221_176672 | Ga0501221_176672_52_363 | 103 |
| 1134 | 3300049741 | Ga0501079_1107761 | Ga0501079_1107761_121_432 | 103 |
| 1135 | 3300049741 | Ga0501079_1283637 | Ga0501079_1283637_43_354 | 103 |
| 1136 | 3300049742 | Ga0501080_0003122 | Ga0501080_0003122_13077_13388 | 103 |
| 1137 | 3300049743 | Ga0501081_1554689 | Ga0501081_1554689_19_330 | 103 |
| 1138 | 3300049744 | Ga0501083_0114806 | Ga0501083_0114806_1342_1653 | 103 |
| 1139 | 3300049759 | Ga0501262_002075 | Ga0501262_002075_394_705 | 103 |
| 1140 | 3300049760 | Ga0501263_016317 | Ga0501263_016317_211_522 | 103 |
| 1141 | 3300049761 | Ga0501264_057141 | Ga0501264_057141_66_377 | 103 |
| 1142 | 3300049762 | Ga0501265_000298 | Ga0501265_000298_3336_3647 | 103 |
| 1143 | 3300049772 | Ga0501275_069972 | Ga0501275_069972_53_364 | 103 |
| 1144 | 3300049779 | Ga0501283_032095 | Ga0501283_032095_350_661 | 103 |
| 1145 | 3300049822 | Ga0501035_0238803 | Ga0501035_0238803_292_603 | 103 |
| 1146 | 3300049822 | Ga0501035_0270865 | Ga0501035_0270865_10_321 | 103 |
| 1147 | 3300049823 | Ga0501044_1336083 | Ga0501044_1336083_83_394 | 103 |
| 1148 | 3300049824 | Ga0501045_0004217 | Ga0501045_0004217_9221_9532 | 103 |
| 1149 | 3300049824 | Ga0501045_0387234 | Ga0501045_0387234_236_547 | 103 |
| 1150 | 3300050489 | nmdc:mga03683_10542_c1 | nmdc:mga03683_10542_c1_1074_1385 | 103 |
| 1151 | 3300050489 | nmdc:mga03683_107762_c1 | nmdc:mga03683_107762_c1_99_410 | 103 |
| 1152 | 3300050489 | nmdc:mga03683_19613_c1 | nmdc:mga03683_19613_c1_1249_1563 | 103 |
| 1153 | 3300050489 | nmdc:mga03683_210524_c1 | nmdc:mga03683_210524_c1_103_465 | 103 |
| 1154 | 3300050489 | nmdc:mga03683_242205_c1 | nmdc:mga03683_242205_c1_166_477 | 103 |
| 1155 | 3300050489 | nmdc:mga03683_3074_c1 | nmdc:mga03683_3074_c1_3565_3876 | 103 |
| 1156 | 3300050489 | nmdc:mga03683_338682_c1 | nmdc:mga03683_338682_c1_275_586 | 103 |
| 1157 | 3300050489 | nmdc:mga03683_59786_c2 | nmdc:mga03683_59786_c2_20_331 | 103 |
| 1158 | 3300050489 | nmdc:mga03683_6406_c1 | nmdc:mga03683_6406_c1_2019_2351 | 103 |
| 1159 | 3300050489 | nmdc:mga03683_654062_c1 | nmdc:mga03683_654062_c1_88_399 | 103 |
| 1160 | 3300050490 | nmdc:mga03n38_251470_c1 | nmdc:mga03n38_251470_c1_346_678 | 103 |
| 1161 | 3300050490 | nmdc:mga03n38_43245_c1 | nmdc:mga03n38_43245_c1_378_692 | 103 |
| 1162 | 3300050490 | nmdc:mga03n38_923878_c1 | nmdc:mga03n38_923878_c1_10_321 | 103 |
| 1163 | 3300050491 | nmdc:mga00v17_157864_c1 | nmdc:mga00v17_157864_c1_156_467 | 103 |
| 1164 | 3300050491 | nmdc:mga00v17_463011_c1 | nmdc:mga00v17_463011_c1_88_420 | 103 |
| 1165 | 3300050491 | nmdc:mga00v17_47503_c1 | nmdc:mga00v17_47503_c1_1211_1522 | 103 |
| 1166 | 3300050491 | nmdc:mga00v17_72040_c1 | nmdc:mga00v17_72040_c1_1505_1816 | 103 |
| 1167 | 3300050491 | nmdc:mga00v17_82732_c1 | nmdc:mga00v17_82732_c1_412_726 | 103 |
| 1168 | 3300050491 | nmdc:mga00v17_936622_c1 | nmdc:mga00v17_936622_c1_168_479 | 103 |
| 1169 | 3300050492 | nmdc:mga0yw44_124611_c1 | nmdc:mga0yw44_124611_c1_259_573 | 103 |
| 1170 | 3300050492 | nmdc:mga0yw44_85085_c1 | nmdc:mga0yw44_85085_c1_1176_1487 | 103 |
| 1171 | 3300050493 | nmdc:mga0k408_120481_c1 | nmdc:mga0k408_120481_c1_822_1133 | 103 |
| 1172 | 3300050493 | nmdc:mga0k408_12739_c1 | nmdc:mga0k408_12739_c1_2150_2482 | 103 |
| 1173 | 3300050493 | nmdc:mga0k408_135363_c1 | nmdc:mga0k408_135363_c1_1015_1326 | 103 |
| 1174 | 3300050493 | nmdc:mga0k408_156678_c1 | nmdc:mga0k408_156678_c1_861_1172 | 103 |
| 1175 | 3300050493 | nmdc:mga0k408_17491_c1 | nmdc:mga0k408_17491_c1_2080_2394 | 103 |
| 1176 | 3300050493 | nmdc:mga0k408_256133_c1 | nmdc:mga0k408_256133_c1_450_764 | 103 |
| 1177 | 3300050493 | nmdc:mga0k408_285891_c1 | nmdc:mga0k408_285891_c1_279_590 | 103 |
| 1178 | 3300050493 | nmdc:mga0k408_34425_c1 | nmdc:mga0k408_34425_c1_1371_1682 | 103 |
| 1179 | 3300050493 | nmdc:mga0k408_370086_c1 | nmdc:mga0k408_370086_c1_242_553 | 103 |
| 1180 | 3300050493 | nmdc:mga0k408_50096_c1 | nmdc:mga0k408_50096_c1_864_1178 | 103 |
| 1181 | 3300050493 | nmdc:mga0k408_551395_c1 | nmdc:mga0k408_551395_c1_167_478 | 103 |
| 1182 | 3300050493 | nmdc:mga0k408_590493_c1 | nmdc:mga0k408_590493_c1_59_370 | 103 |
| 1183 | 3300050493 | nmdc:mga0k408_72200_c1 | nmdc:mga0k408_72200_c1_771_1082 | 103 |
| 1184 | 3300050493 | nmdc:mga0k408_72324_c1 | nmdc:mga0k408_72324_c1_1464_1796 | 103 |
| 1185 | 3300050493 | nmdc:mga0k408_74617_c1 | nmdc:mga0k408_74617_c1_531_842 | 103 |
| 1186 | 3300050493 | nmdc:mga0k408_7990_c1 | nmdc:mga0k408_7990_c1_1670_1981 | 103 |
| 1187 | 3300050493 | nmdc:mga0k408_9000_c1 | nmdc:mga0k408_9000_c1_2271_2582 | 103 |
| 1188 | 3300050494 | nmdc:mga06z11_115523_c2 | nmdc:mga06z11_115523_c2_779_1090 | 103 |
| 1189 | 3300050494 | nmdc:mga06z11_131555_c1 | nmdc:mga06z11_131555_c1_613_945 | 103 |
| 1190 | 3300050494 | nmdc:mga06z11_24408_c1 | nmdc:mga06z11_24408_c1_1737_2048 | 103 |
| 1191 | 3300050494 | nmdc:mga06z11_902261_c1 | nmdc:mga06z11_902261_c1_137_451 | 103 |
| 1192 | 3300050495 | nmdc:mga04h51_100039_c2 | nmdc:mga04h51_100039_c2_208_540 | 103 |
| 1193 | 3300050495 | nmdc:mga04h51_399297_c1 | nmdc:mga04h51_399297_c1_221_532 | 103 |
| 1194 | 3300050495 | nmdc:mga04h51_531353_c1 | nmdc:mga04h51_531353_c1_15_326 | 103 |
| 1195 | 3300050495 | nmdc:mga04h51_7897_c1 | nmdc:mga04h51_7897_c1_1280_1591 | 103 |
| 1196 | 3300050496 | nmdc:mga07m45_139885_c1 | nmdc:mga07m45_139885_c1_756_1070 | 103 |
| 1197 | 3300050496 | nmdc:mga07m45_185510_c1 | nmdc:mga07m45_185510_c1_420_731 | 103 |
| 1198 | 3300050496 | nmdc:mga07m45_19596_c1 | nmdc:mga07m45_19596_c1_1929_2240 | 103 |
| 1199 | 3300050496 | nmdc:mga07m45_23940_c1 | nmdc:mga07m45_23940_c1_2991_3302 | 103 |
| 1200 | 3300050496 | nmdc:mga07m45_26234_c1 | nmdc:mga07m45_26234_c1_1819_2130 | 103 |
| 1201 | 3300050496 | nmdc:mga07m45_3313_c3 | nmdc:mga07m45_3313_c3_953_1267 | 103 |
| 1202 | 3300050496 | nmdc:mga07m45_337561_c1 | nmdc:mga07m45_337561_c1_432_743 | 103 |
| 1203 | 3300050496 | nmdc:mga07m45_34063_c1 | nmdc:mga07m45_34063_c1_421_732 | 103 |
| 1204 | 3300050496 | nmdc:mga07m45_34942_c1 | nmdc:mga07m45_34942_c1_1527_1838 | 103 |
| 1205 | 3300050496 | nmdc:mga07m45_36656_c1 | nmdc:mga07m45_36656_c1_2293_2604 | 103 |
| 1206 | 3300050496 | nmdc:mga07m45_492_c1 | nmdc:mga07m45_492_c1_3604_3915 | 103 |
| 1207 | 3300050496 | nmdc:mga07m45_50366_c1 | nmdc:mga07m45_50366_c1_92_424 | 103 |
| 1208 | 3300050496 | nmdc:mga07m45_70818_c1 | nmdc:mga07m45_70818_c1_50_382 | 103 |
| 1209 | 3300050496 | nmdc:mga07m45_780537_c1 | nmdc:mga07m45_780537_c1_20_331 | 103 |
| 1210 | 3300050496 | nmdc:mga07m45_79946_c1 | nmdc:mga07m45_79946_c1_1497_1811 | 103 |
| 1211 | 3300050513 | nmdc:mga0rr50_645322_c1 | nmdc:mga0rr50_645322_c1_336_662 | 103 |
| 1212 | 3300050513 | nmdc:mga0rr50_901194_c1 | nmdc:mga0rr50_901194_c1_126_437 | 103 |
| 1213 | 3300050514 | nmdc:mga08x19_96782_c1 | nmdc:mga08x19_96782_c1_456_776 | 103 |
| 1214 | 3300050516 | nmdc:mga0sz30_171936_c1 | nmdc:mga0sz30_171936_c1_320_652 | 103 |
| 1215 | 3300050516 | nmdc:mga0sz30_8289_c1 | nmdc:mga0sz30_8289_c1_1602_1913 | 103 |
| 1216 | 3300053077 | Ga0495601_0016530 | Ga0495601_0016530_202_519 | 103 |
| 1217 | 3300053077 | Ga0495601_0018898 | Ga0495601_0018898_3868_4182 | 103 |
| 1218 | 3300053077 | Ga0495601_0036138 | Ga0495601_0036138_2753_3067 | 103 |
| 1219 | 3300053077 | Ga0495601_0272852 | Ga0495601_0272852_777_1091 | 103 |
| 1220 | 3300053077 | Ga0495601_0850686 | Ga0495601_0850686_22_333 | 103 |
| 1221 | 3300053084 | Ga0495595_0004054 | Ga0495595_0004054_3375_3689 | 103 |
| 1222 | 3300053085 | Ga0495619_0034139 | Ga0495619_0034139_1992_2306 | 103 |
| 1223 | 3300053085 | Ga0495619_0318956 | Ga0495619_0318956_208_519 | 103 |
| 1224 | 3300053085 | Ga0495619_0791949 | Ga0495619_0791949_194_508 | 103 |
| 1225 | 3300053086 | Ga0500578_0106801 | Ga0500578_0106801_668_979 | 103 |
| 1226 | 3300053086 | Ga0500578_0222131 | Ga0500578_0222131_724_1035 | 103 |
| 1227 | 3300053088 | Ga0500644_0003614 | Ga0500644_0003614_3470_3781 | 103 |
| 1228 | 3300053088 | Ga0500644_0172087 | Ga0500644_0172087_486_797 | 103 |
| 1229 | 3300053091 | Ga0500647_0243651 | Ga0500647_0243651_128_439 | 103 |
| 1230 | 3300053092 | Ga0500583_0047242 | Ga0500583_0047242_1440_1751 | 103 |
| 1231 | 3300053092 | Ga0500583_0268598 | Ga0500583_0268598_324_638 | 103 |
| 1232 | 3300053093 | Ga0500651_0044877 | Ga0500651_0044877_2306_2617 | 103 |
| 1233 | 3300053093 | Ga0500651_0197316 | Ga0500651_0197316_408_719 | 103 |
| 1234 | 3300053118 | Ga0500594_0002906 | Ga0500594_0002906_985_1296 | 103 |
| 1235 | 3300053123 | Ga0500614_150910 | Ga0500614_150910_293_604 | 103 |
| 1236 | 3300053123 | Ga0500614_198322 | Ga0500614_198322_87_398 | 103 |
| 1237 | 3300053131 | Ga0500652_151887 | Ga0500652_151887_332_643 | 103 |
| 1238 | 3300053136 | Ga0500559_0000085 | Ga0500559_0000085_17085_17396 | 103 |
| 1239 | 3300053138 | Ga0500564_291577 | Ga0500564_291577_207_518 | 103 |
| 1240 | 3300053142 | Ga0500577_0111434 | Ga0500577_0111434_500_811 | 103 |
| 1241 | 3300053153 | Ga0500616_0018422 | Ga0500616_0018422_807_1118 | 103 |
| 1242 | 3300053153 | Ga0500616_0106811 | Ga0500616_0106811_989_1300 | 103 |
| 1243 | 3300053156 | Ga0500622_0002170 | Ga0500622_0002170_7919_8230 | 103 |
| 1244 | 3300053177 | Ga0500636_0341478 | Ga0500636_0341478_221_532 | 103 |
| 1245 | 3300053178 | Ga0500637_0205680 | Ga0500637_0205680_328_642 | 103 |
| 1246 | 3300053178 | Ga0500637_0332409 | Ga0500637_0332409_11_325 | 103 |
| 1247 | 3300053730 | Ga0500645_000801 | Ga0500645_000801_14406_14717 | 103 |
| 1248 | 3300053736 | Ga0500599_020248 | Ga0500599_020248_34_345 | 103 |
| 1249 | 3300053739 | Ga0500587_002295 | Ga0500587_002295_2372_2683 | 103 |
| 1250 | 3300054114 | Ga0501084_1160370 | Ga0501084_1160370_198_509 | 103 |
| 1251 | 3300054114 | Ga0501084_1271417 | Ga0501084_1271417_174_485 | 103 |
| 1252 | 3300059421 | Ga0590071_002082 | Ga0590071_002082_988_1311 | 103 |
| 1253 | 3300060346 | Ga0587111_0219246 | Ga0587111_0219246_224_535 | 103 |
| 1254 | 3300060353 | Ga0501082_1887648 | Ga0501082_1887648_133_444 | 103 |
| 1255 | 3300061734 | Ga0530510_0241871 | Ga0530510_0241871_372_683 | 103 |
| 1256 | 3300061734 | Ga0530510_1146264 | Ga0530510_1146264_156_467 | 103 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2oxg-assembly4.cif.gz_E | the soxyz complex of paracoccus pantotrophus | 0.7596 | 4 | 103 |
| 2oxg-assembly3.cif.gz_C | the soxyz complex of paracoccus pantotrophus | 0.755 | 4 | 103 |
| 1mby-assembly1.cif.gz_A | murine sak polo domain | 0.7519 | 42 | 103 |
| 2ox5-assembly3.cif.gz_C | the soxyz complex of paracoccus pantotrophus | 0.747 | 4 | 103 |
| 1v8h-assembly1.cif.gz_B | crystal structure of tt0351 protein from thermus thermophilus hb8 | 0.7379 | 4 | 102 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2oxgE00 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.7596 | 4 | 103 | 2.60.40.10 |
| 1mbyA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); | 0.7519 | 42 | 103 | 2.40.50.930 |
| 1v8hB00 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.7379 | 4 | 102 | 2.60.40.10 |
| 2oxgE00 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.7141 | 4 | 103 | 2.60.40.10 |
| af_Q924C5_1262_1337_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.7079 | 42 | 103 | 2.60.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6N6ZSP4-F1-model_v4 | Sulfur compound chelating protein SoxZ | 0.9231 | 43 | 103 |
|
| AF-A0A0S8DUM2-F1-model_v4 | Thiosulfate oxidation carrier complex protein SoxZ | 0.915 | 44 | 103 |
|
| AF-A0A6N6ZSP4-F1-model_v4 | Sulfur compound chelating protein SoxZ | 0.9094 | 43 | 103 |
|
| AF-A0A0S8DUM2-F1-model_v4 | Thiosulfate oxidation carrier complex protein SoxZ | 0.9013 | 44 | 103 |
|
| AF-A0A1E4L687-F1-model_v4 | Thiosulfate oxidation carrier complex protein SoxZ | 0.8894 | 36 | 103 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar