F492258

General Info

Members Datasets Scaffolds Average Seq Length
1256 465 1248 103

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10304390|Ga0105249_103043902
Length 120
Sequence LRRLSLSQEIFGNKESNMADPMRIRAQAAGDKTIVRVLMAHEMETGQRKDAAGKVIPAWYIQQVQAKLNGKDVLSAQWGPAVAKNPFLQFMIKGAKAGDKVSVSWVDNRGDTRSDEAVVT

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
3 2643221683 Variovorax sp. Root473 Isolate Unclassified
4 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
5 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
6 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
7 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
8 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
11 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
82 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
83 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
84 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
85 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
86 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
87 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
88 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
89 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
90 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
91 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
96 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
97 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
98 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
99 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
117 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
118 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
119 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
126 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
131 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
132 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
198 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
203 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
204 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
205 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
206 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
207 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
208 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
209 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
210 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
211 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
212 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
213 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
214 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
215 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
216 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
217 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
218 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
219 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
220 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
221 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
222 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
223 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
224 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
225 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
226 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
227 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
228 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
229 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
230 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
231 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
232 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
233 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
234 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
235 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
236 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
237 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
238 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
239 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
240 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
241 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
242 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
243 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
244 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
245 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
246 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
247 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
248 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
249 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
250 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
251 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
252 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
253 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
254 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
255 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
256 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
257 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
258 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
259 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
260 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
261 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
262 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
263 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
264 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
265 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
266 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
267 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
268 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
269 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
270 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
271 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
272 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
273 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
274 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
275 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
276 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
277 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
278 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
279 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
280 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
281 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
282 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
283 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
284 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
285 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
286 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
287 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
288 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
289 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
290 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
291 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
292 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
293 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
294 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
295 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
296 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
297 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
298 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
299 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
300 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
301 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
302 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
303 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
304 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
305 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
306 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
307 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
308 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
309 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
310 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
311 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
312 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
313 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
314 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
315 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
316 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
317 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
318 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
319 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
320 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
321 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
322 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
323 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
324 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
325 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
326 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
327 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
328 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
329 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
330 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
331 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
332 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
333 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
334 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
335 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
336 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
337 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
338 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
339 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
340 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
341 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
342 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
343 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
344 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
345 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
346 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
347 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
348 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
349 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
350 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
351 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
352 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
353 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
354 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
355 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
356 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
357 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
358 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
359 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
360 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
361 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
362 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
363 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
364 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
365 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
366 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
367 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
368 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
369 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
370 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
371 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
372 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
373 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
374 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
375 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
376 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
377 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
378 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
379 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
380 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
381 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
382 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
383 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
384 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
385 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
386 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
387 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
388 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
389 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
392 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
393 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
394 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
395 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
396 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
397 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
398 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
399 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
400 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
401 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
402 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
403 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
404 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
405 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
406 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
407 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
408 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
409 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
410 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
411 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
412 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
413 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
414 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
415 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
416 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
417 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
418 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
419 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
420 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
421 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
422 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
423 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
424 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
425 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
426 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
427 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
428 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
429 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
430 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
431 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
432 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
433 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
434 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
435 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
436 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
437 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
438 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
439 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
440 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
441 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
442 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
443 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
444 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
445 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
446 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
447 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
448 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
449 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
450 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
451 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
452 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
453 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
454 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
455 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
456 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
457 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
458 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
459 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
460 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
461 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
462 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
463 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
464 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
465 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.36
Metatranscriptomes 0.08
Isolates 0.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.41
Nodule 0.08
Rhizoplane 2.07
Rhizosphere 77.07
Stem 0
Stem Tuber 0
Unclassified 6.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_627485 2162886007 Bacteria 996
2 rootH2_10234102 3300003320 Bacteria 1237
3 JGI26128J50194_1000784 3300003347 Bacteria 1887
4 Ga0055540_1005689 3300003792 Bacteria 5154
5 Ga0055531_10000158 3300003794 Bacteria 77918
6 Ga0065704_10144971 3300005289 Bacteria 1481
7 Ga0065712_10429716 3300005290 Bacteria 704
8 Ga0065715_10201477 3300005293 Bacteria 1359
9 Ga0065715_10284025 3300005293 Bacteria 1079
10 Ga0065707_10082401 3300005295 Bacteria 15662
11 Ga0065707_10083629 3300005295 Bacteria 8593
12 Ga0070658_11484581 3300005327 Bacteria 588
13 Ga0070676_10006509 3300005328 Bacteria 6240
14 Ga0070676_10020357 3300005328 Bacteria 3702
15 Ga0070676_10290984 3300005328 Bacteria 1104
16 Ga0070676_10413730 3300005328 Bacteria 941
17 Ga0070676_10430190 3300005328 Bacteria 924
18 Ga0070683_101531728 3300005329 Bacteria 641
19 Ga0070690_100006390 3300005330 Bacteria 6679
20 Ga0070690_100404218 3300005330 Bacteria 1003
21 Ga0070670_100014643 3300005331 Bacteria 6733
22 Ga0070670_100050018 3300005331 Bacteria 3592
23 Ga0070670_100052480 3300005331 Bacteria 3502
24 Ga0070670_100111871 3300005331 Bacteria 2353
25 Ga0070670_100203248 3300005331 Bacteria 1721
26 Ga0070670_101158358 3300005331 Unclassified 706
27 Ga0070677_10083552 3300005333 Bacteria 1372
28 Ga0070677_10089150 3300005333 Bacteria 1338
29 Ga0070677_10716834 3300005333 Bacteria 565
30 Ga0068869_100004832 3300005334 Bacteria 8413
31 Ga0068869_100009279 3300005334 Bacteria 6380
32 Ga0068869_100041362 3300005334 Bacteria 3300
33 Ga0068869_100092159 3300005334 Bacteria 2281
34 Ga0068869_100719537 3300005334 Bacteria 853
35 Ga0068869_100850959 3300005334 Bacteria 787
36 Ga0070666_10001214 3300005335 Bacteria 15546
37 Ga0070666_10398960 3300005335 Bacteria 989
38 Ga0070666_11085131 3300005335 Bacteria 595
39 Ga0070666_11151990 3300005335 Bacteria 577
40 Ga0070666_11377231 3300005335 Bacteria 527
41 Ga0070680_101058687 3300005336 Bacteria 701
42 Ga0070682_100397786 3300005337 Bacteria 1041
43 Ga0068868_100000312 3300005338 Bacteria 32587
44 Ga0068868_100014536 3300005338 Bacteria 5804
45 Ga0068868_100187978 3300005338 Bacteria 1717
46 Ga0068868_100194590 3300005338 Bacteria 1687
47 Ga0068868_100204590 3300005338 Bacteria 1647
48 Ga0068868_100277281 3300005338 Bacteria 1418
49 Ga0068868_101341118 3300005338 Bacteria 666
50 Ga0070660_100019235 3300005339 Bacteria 5000
51 Ga0070660_100436627 3300005339 Bacteria 1085
52 Ga0070660_100716819 3300005339 Bacteria 839
53 Ga0070689_100016511 3300005340 Bacteria 5403
54 Ga0070689_102026215 3300005340 Bacteria 527
55 Ga0070689_102039895 3300005340 Bacteria 525
56 Ga0070687_100047002 3300005343 Bacteria 2212
57 Ga0070687_101004405 3300005343 Bacteria 605
58 Ga0070661_100015946 3300005344 Bacteria 5303
59 Ga0070661_100764206 3300005344 Bacteria 791
60 Ga0070661_101481533 3300005344 Bacteria 572
61 Ga0070668_100481101 3300005347 Bacteria 1072
62 Ga0070669_100009785 3300005353 Bacteria 6828
63 Ga0070669_100152181 3300005353 Bacteria 1792
64 Ga0070669_100401730 3300005353 Bacteria 1121
65 Ga0070675_100001196 3300005354 Bacteria 18872
66 Ga0070675_100015225 3300005354 Bacteria 6074
67 Ga0070675_100023005 3300005354 Bacteria 4980
68 Ga0070675_101591984 3300005354 Bacteria 603
69 Ga0070671_100009402 3300005355 Bacteria 7849
70 Ga0070671_100010291 3300005355 Bacteria 7504
71 Ga0070671_100037504 3300005355 Bacteria 4020
72 Ga0070671_100063496 3300005355 Bacteria 3075
73 Ga0070671_100263723 3300005355 Bacteria 1464
74 Ga0070674_100020884 3300005356 Bacteria 4193
75 Ga0070674_100063719 3300005356 Bacteria 2581
76 Ga0070674_100234002 3300005356 Bacteria 1435
77 Ga0070674_101019640 3300005356 Bacteria 727
78 Ga0070674_101341015 3300005356 Bacteria 639
79 Ga0070673_100001001 3300005364 Bacteria 16018
80 Ga0070673_100005595 3300005364 Bacteria 8057
81 Ga0070673_100055134 3300005364 Bacteria 3131
82 Ga0070673_100135105 3300005364 Bacteria 2075
83 Ga0070673_100210093 3300005364 Bacteria 1680
84 Ga0070673_100308651 3300005364 Bacteria 1395
85 Ga0070673_101293888 3300005364 Bacteria 685
86 Ga0070688_100758398 3300005365 Bacteria 756
87 Ga0070688_100817512 3300005365 Bacteria 730
88 Ga0070659_100445191 3300005366 Bacteria 1098
89 Ga0070659_100868814 3300005366 Bacteria 787
90 Ga0070667_100008639 3300005367 Bacteria 8442
91 Ga0070667_100035464 3300005367 Bacteria 4178
92 Ga0070667_100118934 3300005367 Bacteria 2297
93 Ga0070667_100141474 3300005367 Bacteria 2107
94 Ga0070667_100195929 3300005367 Bacteria 1791
95 Ga0070667_100221111 3300005367 Bacteria 1686
96 Ga0070667_100252861 3300005367 Bacteria 1576
97 Ga0070667_101010622 3300005367 Bacteria 776
98 Ga0070703_10550155 3300005406 Bacteria 526
99 Ga0070710_11064678 3300005437 Bacteria 592
100 Ga0070701_10687047 3300005438 Bacteria 687
101 Ga0070700_100302544 3300005441 Bacteria 1168
102 Ga0070700_100418445 3300005441 Bacteria 1012
103 Ga0070708_100000359 3300005445 Bacteria 34452
104 Ga0070663_100001329 3300005455 Bacteria 13522
105 Ga0070663_100170768 3300005455 Bacteria 1681
106 Ga0070663_100509013 3300005455 Bacteria 1001
107 Ga0070663_101018089 3300005455 Bacteria 721
108 Ga0070678_100001350 3300005456 Bacteria 13053
109 Ga0070678_100019530 3300005456 Bacteria 4421
110 Ga0070678_100124088 3300005456 Bacteria 2041
111 Ga0070678_100234909 3300005456 Bacteria 1530
112 Ga0070678_100249689 3300005456 Bacteria 1487
113 Ga0070678_100380141 3300005456 Bacteria 1222
114 Ga0070678_100675272 3300005456 Bacteria 929
115 Ga0070678_101198741 3300005456 Bacteria 704
116 Ga0070662_100061191 3300005457 Bacteria 2748
117 Ga0070662_100211907 3300005457 Bacteria 1542
118 Ga0070662_100543556 3300005457 Bacteria 973
119 Ga0070662_101106604 3300005457 Bacteria 680
120 Ga0070681_10030700 3300005458 Bacteria 5392
121 Ga0070681_10194030 3300005458 Bacteria 1950
122 Ga0068867_100006369 3300005459 Bacteria 8345
123 Ga0068867_100035602 3300005459 Bacteria 3612
124 Ga0068867_100042192 3300005459 Bacteria 3336
125 Ga0068867_100087456 3300005459 Bacteria 2360
126 Ga0068867_100134339 3300005459 Bacteria 1926
127 Ga0068867_100144313 3300005459 Bacteria 1864
128 Ga0068867_100163249 3300005459 Bacteria 1758
129 Ga0068867_100192902 3300005459 Bacteria 1626
130 Ga0070685_10041723 3300005466 Bacteria 2616
131 Ga0070685_10348170 3300005466 Bacteria 1012
132 Ga0070685_10353220 3300005466 Bacteria 1006
133 Ga0070685_11394215 3300005466 Bacteria 538
134 Ga0070706_100038628 3300005467 Bacteria 4406
135 Ga0070706_100094756 3300005467 Bacteria 2770
136 Ga0070707_100121495 3300005468 Bacteria 2536
137 Ga0070707_102345970 3300005468 Bacteria 501
138 Ga0070698_100247243 3300005471 Bacteria 1716
139 Ga0070698_100346944 3300005471 Bacteria 1416
140 Ga0070699_100183198 3300005518 Bacteria 1859
141 Ga0070699_100432562 3300005518 Bacteria 1192
142 Ga0070699_100560060 3300005518 Bacteria 1041
143 Ga0070679_100028003 3300005530 Bacteria 5552
144 Ga0070679_100070126 3300005530 Bacteria 3497
145 Ga0070679_100180884 3300005530 Bacteria 2081
146 Ga0070697_100016402 3300005536 Bacteria 5824
147 Ga0068853_100003043 3300005539 Bacteria 12805
148 Ga0068853_100103028 3300005539 Bacteria 2526
149 Ga0068853_100326263 3300005539 Bacteria 1424
150 Ga0068853_100448241 3300005539 Bacteria 1214
151 Ga0068853_100449348 3300005539 Bacteria 1212
152 Ga0068853_101472901 3300005539 Bacteria 659
153 Ga0068853_102408234 3300005539 Bacteria 510
154 Ga0070672_100011526 3300005543 Bacteria 6168
155 Ga0070672_100020972 3300005543 Bacteria 4775
156 Ga0070672_100093042 3300005543 Bacteria 2435
157 Ga0070672_100151153 3300005543 Bacteria 1921
158 Ga0070686_100237573 3300005544 Bacteria 1325
159 Ga0070695_101216149 3300005545 Bacteria 620
160 Ga0070665_100010823 3300005548 Bacteria 9227
161 Ga0070665_100262938 3300005548 Bacteria 1726
162 Ga0070665_100674723 3300005548 Bacteria 1046
163 Ga0070665_101595576 3300005548 Bacteria 660
164 Ga0070704_102181534 3300005549 Bacteria 515
165 Ga0068855_100763025 3300005563 Bacteria 1030
166 Ga0070664_100077686 3300005564 Bacteria 2855
167 Ga0070664_100211134 3300005564 Bacteria 1735
168 Ga0070664_100531988 3300005564 Bacteria 1086
169 Ga0070664_100689385 3300005564 Bacteria 951
170 Ga0068857_100005109 3300005577 Bacteria 11159
171 Ga0068857_100028848 3300005577 Bacteria 4897
172 Ga0068857_100312974 3300005577 Bacteria 1449
173 Ga0068857_100320407 3300005577 Bacteria 1432
174 Ga0068857_100375393 3300005577 Bacteria 1319
175 Ga0068857_100608718 3300005577 Bacteria 1033
176 Ga0068857_101658579 3300005577 Bacteria 625
177 Ga0068857_101663630 3300005577 Bacteria 624
178 Ga0068857_102010875 3300005577 Bacteria 567
179 Ga0068854_100178843 3300005578 Bacteria 1656
180 Ga0068854_100195310 3300005578 Bacteria 1588
181 Ga0068856_100002604 3300005614 Bacteria 18562
182 Ga0070702_101359607 3300005615 Bacteria 579
183 Ga0068852_100137407 3300005616 Bacteria 2258
184 Ga0068852_100171248 3300005616 Bacteria 2035
185 Ga0068852_100358482 3300005616 Bacteria 1426
186 Ga0068852_100422081 3300005616 Bacteria 1316
187 Ga0068852_100508890 3300005616 Bacteria 1200
188 Ga0068852_101400936 3300005616 Bacteria 721
189 Ga0068852_102464367 3300005616 Bacteria 541
190 Ga0068859_100022763 3300005617 Bacteria 6283
191 Ga0068859_100074871 3300005617 Bacteria 3425
192 Ga0068859_100176798 3300005617 Bacteria 2216
193 Ga0068859_100770445 3300005617 Bacteria 1051
194 Ga0068859_101505113 3300005617 Bacteria 743
195 Ga0068859_103023221 3300005617 Bacteria 514
196 Ga0068864_100000335 3300005618 Bacteria 41329
197 Ga0068864_100008404 3300005618 Bacteria 8515
198 Ga0068864_100254048 3300005618 Bacteria 1633
199 Ga0068864_100284544 3300005618 Bacteria 1544
200 Ga0068864_101851902 3300005618 Bacteria 609
201 Ga0068866_10062011 3300005718 Bacteria 1944
202 Ga0068866_10529042 3300005718 Bacteria 785
203 Ga0068866_10911611 3300005718 Bacteria 619
204 Ga0068861_100006418 3300005719 Bacteria 8009
205 Ga0068861_100356978 3300005719 Bacteria 1284
206 Ga0068861_102431694 3300005719 Bacteria 527
207 Ga0068851_10414327 3300005834 Bacteria 795
208 Ga0068870_10110312 3300005840 Bacteria 1570
209 Ga0068870_10491782 3300005840 Bacteria 816
210 Ga0068863_100029875 3300005841 Bacteria 5205
211 Ga0068863_101598753 3300005841 Bacteria 661
212 Ga0068858_100168978 3300005842 Bacteria 2061
213 Ga0068858_100249884 3300005842 Bacteria 1684
214 Ga0068860_100001975 3300005843 Bacteria 21676
215 Ga0068860_100010220 3300005843 Bacteria 9288
216 Ga0068860_100019680 3300005843 Bacteria 6544
217 Ga0068860_100918470 3300005843 Bacteria 892
218 Ga0068862_100017460 3300005844 Bacteria 5977
219 Ga0068862_100024404 3300005844 Bacteria 5073
220 Ga0068862_100038482 3300005844 Bacteria 4056
221 Ga0068862_100616314 3300005844 Bacteria 1044
222 Ga0068862_101225019 3300005844 Bacteria 750
223 Ga0068862_101502996 3300005844 Bacteria 679
224 Ga0068862_101833773 3300005844 Bacteria 616
225 Ga0081455_10193472 3300005937 Bacteria 1529
226 Ga0081455_10510270 3300005937 Bacteria 805
227 Ga0075365_10050103 3300006038 Bacteria 2754
228 Ga0075365_10848173 3300006038 Bacteria 644
229 Ga0075368_10002000 3300006042 Bacteria 6580
230 Ga0075368_10019410 3300006042 Bacteria 2566
231 Ga0075368_10045969 3300006042 Bacteria 1726
232 Ga0075368_10156877 3300006042 Bacteria 952
233 Ga0075363_100006111 3300006048 Bacteria 5435
234 Ga0075363_100033418 3300006048 Bacteria 2678
235 Ga0075363_100159388 3300006048 Bacteria 1277
236 Ga0075363_100161113 3300006048 Bacteria 1270
237 Ga0075363_100402647 3300006048 Bacteria 804
238 Ga0075363_100426427 3300006048 Bacteria 781
239 Ga0075363_100491883 3300006048 Bacteria 728
240 Ga0075363_100643064 3300006048 Bacteria 638
241 Ga0075364_10103332 3300006051 Bacteria 1898
242 Ga0075364_10117486 3300006051 Bacteria 1778
243 Ga0075364_10160790 3300006051 Bacteria 1516
244 Ga0075364_10196524 3300006051 Bacteria 1367
245 Ga0075432_10056399 3300006058 Bacteria 1393
246 Ga0075432_10374718 3300006058 Bacteria 609
247 Ga0075362_10004294 3300006177 Bacteria 5097
248 Ga0075362_10028978 3300006177 Bacteria 2382
249 Ga0075362_10029956 3300006177 Bacteria 2348
250 Ga0075362_10037845 3300006177 Bacteria 2117
251 Ga0075362_10062083 3300006177 Bacteria 1692
252 Ga0075362_10085501 3300006177 Bacteria 1458
253 Ga0075362_10090136 3300006177 Bacteria 1422
254 Ga0075362_10091744 3300006177 Bacteria 1411
255 Ga0075362_10245705 3300006177 Bacteria 879
256 Ga0075362_10574662 3300006177 Bacteria 581
257 Ga0075367_10008658 3300006178 Bacteria 5278
258 Ga0075367_10010639 3300006178 Bacteria 4839
259 Ga0075367_10091437 3300006178 Bacteria 1851
260 Ga0075367_10121315 3300006178 Bacteria 1611
261 Ga0075367_10338695 3300006178 Bacteria 949
262 Ga0075367_10744875 3300006178 Bacteria 623
263 Ga0075367_10770292 3300006178 Bacteria 613
264 Ga0075367_10958923 3300006178 Bacteria 546
265 Ga0075369_10012606 3300006186 Bacteria 3339
266 Ga0075369_10043585 3300006186 Bacteria 1926
267 Ga0075369_10069452 3300006186 Bacteria 1549
268 Ga0075369_10132473 3300006186 Bacteria 1133
269 Ga0075369_10202469 3300006186 Bacteria 916
270 Ga0075369_10229785 3300006186 Bacteria 859
271 Ga0075427_10021345 3300006194 Bacteria 1030
272 Ga0075366_10003945 3300006195 Bacteria 7914
273 Ga0075366_10031291 3300006195 Bacteria 3131
274 Ga0075366_10036971 3300006195 Bacteria 2880
275 Ga0075366_10038103 3300006195 Bacteria 2839
276 Ga0075366_10047038 3300006195 Bacteria 2557
277 Ga0075366_10062814 3300006195 Bacteria 2207
278 Ga0075366_10068300 3300006195 Bacteria 2115
279 Ga0075366_10190153 3300006195 Bacteria 1248
280 Ga0075366_10224751 3300006195 Bacteria 1144
281 Ga0075366_10237496 3300006195 Bacteria 1111
282 Ga0075366_10271963 3300006195 Bacteria 1035
283 Ga0075366_10401545 3300006195 Bacteria 843
284 Ga0075366_10621857 3300006195 Bacteria 670
285 Ga0075366_10674752 3300006195 Bacteria 641
286 Ga0075366_11008283 3300006195 Bacteria 519
287 Ga0097621_100003156 3300006237 Bacteria 11316
288 Ga0097621_100408273 3300006237 Bacteria 1217
289 Ga0097621_100659557 3300006237 Bacteria 961
290 Ga0097621_101163078 3300006237 Bacteria 726
291 Ga0097621_101512126 3300006237 Bacteria 637
292 Ga0075370_10000069 3300006353 Bacteria 31335
293 Ga0075370_10002857 3300006353 Bacteria 8108
294 Ga0075370_10003577 3300006353 Bacteria 7430
295 Ga0075370_10003910 3300006353 Bacteria 7150
296 Ga0075370_10007647 3300006353 Bacteria 5515
297 Ga0075370_10013361 3300006353 Bacteria 4361
298 Ga0075370_10028001 3300006353 Bacteria 3130
299 Ga0075370_10049373 3300006353 Bacteria 2385
300 Ga0075370_10061038 3300006353 Bacteria 2148
301 Ga0075370_10087718 3300006353 Bacteria 1793
302 Ga0075370_10405090 3300006353 Bacteria 818
303 Ga0075370_10640439 3300006353 Bacteria 645
304 Ga0075370_10698862 3300006353 Bacteria 616
305 Ga0075370_10873815 3300006353 Bacteria 549
306 Ga0075370_10920221 3300006353 Bacteria 535
307 Ga0068871_100031944 3300006358 Bacteria 4154
308 Ga0068871_100120663 3300006358 Bacteria 2214
309 Ga0075428_100664390 3300006844 Bacteria 1111
310 Ga0075428_101185429 3300006844 Bacteria 805
311 Ga0075430_100800733 3300006846 Bacteria 777
312 Ga0075430_100814356 3300006846 Bacteria 769
313 Ga0075430_101013743 3300006846 Bacteria 684
314 Ga0075431_100026171 3300006847 Bacteria 5984
315 Ga0075434_100160470 3300006871 Bacteria 2268
316 Ga0075429_100207907 3300006880 Bacteria 1715
317 Ga0075429_101442670 3300006880 Bacteria 599
318 Ga0068865_100001690 3300006881 Bacteria 12923
319 Ga0068865_100067591 3300006881 Bacteria 2525
320 Ga0068865_100087499 3300006881 Bacteria 2252
321 Ga0068865_100487010 3300006881 Bacteria 1026
322 Ga0075436_100224033 3300006914 Bacteria 1335
323 Ga0097620_100022763 3300006931 Bacteria 6283
324 Ga0097620_100074872 3300006931 Bacteria 3425
325 Ga0097620_100176802 3300006931 Bacteria 2216
326 Ga0097620_100770446 3300006931 Bacteria 1051
327 Ga0097620_101505081 3300006931 Bacteria 743
328 Ga0097620_103023307 3300006931 Bacteria 514
329 Ga0075435_100393558 3300007076 Bacteria 1191
330 Ga0075435_101431013 3300007076 Bacteria 606
331 Ga0075435_101499860 3300007076 Bacteria 591
332 Ga0105240_10137773 3300009093 Bacteria 2921
333 Ga0105240_10202919 3300009093 Bacteria 2322
334 Ga0105240_11208746 3300009093 Bacteria 800
335 Ga0105240_11947268 3300009093 Bacteria 611
336 Ga0105245_10054814 3300009098 Bacteria 3580
337 Ga0105245_10099488 3300009098 Bacteria 2689
338 Ga0105245_10129687 3300009098 Bacteria 2364
339 Ga0105245_10144596 3300009098 Bacteria 2243
340 Ga0105245_10156093 3300009098 Bacteria 2161
341 Ga0105245_10560966 3300009098 Bacteria 1165
342 Ga0105245_11356793 3300009098 Bacteria 761
343 Ga0105245_11535534 3300009098 Bacteria 717
344 Ga0105247_10262331 3300009101 Bacteria 1185
345 Ga0105243_10006865 3300009148 Bacteria 8776
346 Ga0105243_10018982 3300009148 Bacteria 5213
347 Ga0105243_10029668 3300009148 Bacteria 4207
348 Ga0105243_10969369 3300009148 Bacteria 851
349 Ga0105243_11119629 3300009148 Bacteria 796
350 Ga0105243_11273798 3300009148 Bacteria 751
351 Ga0105243_11649857 3300009148 Bacteria 669
352 Ga0105243_11777174 3300009148 Bacteria 647
353 Ga0105241_10135019 3300009174 Bacteria 2002
354 Ga0105241_10389013 3300009174 Bacteria 1220
355 Ga0105241_10420449 3300009174 Bacteria 1176
356 Ga0105241_10633629 3300009174 Bacteria 969
357 Ga0105241_11010795 3300009174 Bacteria 778
358 Ga0105242_10002941 3300009176 Bacteria 13318
359 Ga0105242_10375600 3300009176 Bacteria 1320
360 Ga0105242_10454749 3300009176 Bacteria 1208
361 Ga0105242_10777703 3300009176 Bacteria 945
362 Ga0105242_12629649 3300009176 Bacteria 552
363 Ga0105248_10006504 3300009177 Bacteria 12816
364 Ga0105248_10701648 3300009177 Bacteria 1142
365 Ga0105248_13404229 3300009177 Bacteria 505
366 Ga0105237_10022143 3300009545 Bacteria 6520
367 Ga0105237_10022563 3300009545 Bacteria 6457
368 Ga0105237_10044937 3300009545 Bacteria 4447
369 Ga0105237_12600564 3300009545 Bacteria 517
370 Ga0105238_10381104 3300009551 Bacteria 1402
371 Ga0105238_12428565 3300009551 Bacteria 560
372 Ga0105238_12684331 3300009551 Bacteria 534
373 Ga0105249_10172034 3300009553 Bacteria 2101
374 Ga0105249_10304390 3300009553 Bacteria 1600
375 Ga0105249_10470445 3300009553 Bacteria 1298
376 Ga0105249_10975419 3300009553 Bacteria 916
377 Ga0105239_10034022 3300010375 Bacteria 5595
378 Ga0105239_11575658 3300010375 Bacteria 759
379 Ga0105239_12302028 3300010375 Bacteria 627
380 Ga0105246_10172817 3300011119 Bacteria 1656
381 Ga0105246_11127274 3300011119 Bacteria 718
382 Ga0157373_10308491 3300013100 Bacteria 1124
383 Ga0157373_10697372 3300013100 Bacteria 744
384 Ga0157370_10071975 3300013104 Bacteria 3262
385 Ga0157370_11367194 3300013104 Bacteria 637
386 Ga0157374_10009908 3300013296 Bacteria 8180
387 Ga0157374_10277170 3300013296 Bacteria 1655
388 Ga0157374_10455283 3300013296 Bacteria 1281
389 Ga0157374_10754036 3300013296 Bacteria 988
390 Ga0157374_11041713 3300013296 Bacteria 838
391 Ga0157374_11102222 3300013296 Bacteria 814
392 Ga0157378_10008788 3300013297 Bacteria 8792
393 Ga0157378_10012969 3300013297 Bacteria 7292
394 Ga0157378_10081000 3300013297 Bacteria 2934
395 Ga0157378_10146246 3300013297 Bacteria 2199
396 Ga0157378_10728291 3300013297 Bacteria 1013
397 Ga0157378_11161679 3300013297 Bacteria 811
398 Ga0157378_11710601 3300013297 Bacteria 676
399 Ga0157378_11949936 3300013297 Bacteria 637
400 Ga0163162_10000168 3300013306 Bacteria 60425
401 Ga0163162_10034511 3300013306 Bacteria 5035
402 Ga0163162_10059547 3300013306 Bacteria 3851
403 Ga0163162_10315677 3300013306 Bacteria 1695
404 Ga0163162_12189907 3300013306 Bacteria 635
405 Ga0157372_10105643 3300013307 Bacteria 3221
406 Ga0157372_10160841 3300013307 Bacteria 2595
407 Ga0157372_10331593 3300013307 Bacteria 1772
408 Ga0157375_10001422 3300013308 Bacteria 20591
409 Ga0157375_10003720 3300013308 Bacteria 13235
410 Ga0157375_10041871 3300013308 Bacteria 4427
411 Ga0157375_10135462 3300013308 Bacteria 2586
412 Ga0157375_10795507 3300013308 Bacteria 1095
413 Ga0157375_11531755 3300013308 Bacteria 787
414 Ga0163163_10000817 3300014325 Bacteria 26523
415 Ga0163163_10860999 3300014325 Bacteria 970
416 Ga0157380_10007819 3300014326 Bacteria 7609
417 Ga0157380_10024651 3300014326 Bacteria 4555
418 Ga0157380_10109031 3300014326 Bacteria 2322
419 Ga0157380_10614634 3300014326 Bacteria 1078
420 Ga0157380_11286245 3300014326 Bacteria 778
421 Ga0157380_12103911 3300014326 Bacteria 627
422 Ga0182008_10112794 3300014497 Bacteria 1347
423 Ga0157377_10239829 3300014745 Bacteria 1170
424 Ga0157377_10490301 3300014745 Bacteria 857
425 Ga0157379_10009570 3300014968 Bacteria 8440
426 Ga0157379_10026294 3300014968 Bacteria 5181
427 Ga0157379_10077463 3300014968 Bacteria 2977
428 Ga0157379_10084183 3300014968 Bacteria 2850
429 Ga0157379_10279827 3300014968 Bacteria 1518
430 Ga0157379_10637925 3300014968 Bacteria 996
431 Ga0157379_10794188 3300014968 Bacteria 893
432 Ga0157376_10003750 3300014969 Bacteria 10507
433 Ga0157376_10040924 3300014969 Bacteria 3791
434 Ga0157376_11043831 3300014969 Bacteria 841
435 Ga0157376_11142175 3300014969 Bacteria 806
436 Ga0157376_11362583 3300014969 Bacteria 740
437 Ga0163161_10046958 3300017792 Bacteria 3117
438 Ga0163161_10091021 3300017792 Bacteria 2257
439 Ga0163161_10184705 3300017792 Bacteria 1600
440 Ga0163161_10226753 3300017792 Bacteria 1449
441 Ga0213872_10000009 3300021361 Bacteria 221470
442 Ga0213872_10001063 3300021361 Bacteria 19004
443 Ga0213872_10004239 3300021361 Bacteria 7688
444 Ga0207426_1158563 3300025302 Bacteria 520
445 Ga0209051_1000315 3300025303 Bacteria 73579
446 Ga0209257_1000309 3300025304 Bacteria 104166
447 Ga0209257_1016516 3300025304 Bacteria 2980
448 Ga0207697_10017545 3300025315 Bacteria 2941
449 Ga0207697_10327890 3300025315 Bacteria 680
450 Ga0207656_10042605 3300025321 Bacteria 1932
451 Ga0207682_10002297 3300025893 Bacteria 8613
452 Ga0207682_10069487 3300025893 Bacteria 1490
453 Ga0207642_10379509 3300025899 Bacteria 841
454 Ga0207642_10575550 3300025899 Bacteria 698
455 Ga0207642_10942718 3300025899 Bacteria 554
456 Ga0207688_10747001 3300025901 Bacteria 619
457 Ga0207680_10003377 3300025903 Bacteria 7518
458 Ga0207685_10213795 3300025905 Bacteria 913
459 Ga0207685_10292505 3300025905 Bacteria 803
460 Ga0207645_10002626 3300025907 Bacteria 14018
461 Ga0207645_10003152 3300025907 Bacteria 12630
462 Ga0207645_10013698 3300025907 Bacteria 5452
463 Ga0207645_10084315 3300025907 Bacteria 2039
464 Ga0207645_10150477 3300025907 Bacteria 1519
465 Ga0207645_10433864 3300025907 Bacteria 886
466 Ga0207643_10023892 3300025908 Bacteria 3372
467 Ga0207643_10112150 3300025908 Bacteria 1607
468 Ga0207705_10645419 3300025909 Bacteria 823
469 Ga0207705_11339888 3300025909 Bacteria 546
470 Ga0207684_10085345 3300025910 Bacteria 2689
471 Ga0207684_10294104 3300025910 Bacteria 1400
472 Ga0207654_10081214 3300025911 Bacteria 1951
473 Ga0207654_10306856 3300025911 Bacteria 1081
474 Ga0207707_10002045 3300025912 Bacteria 18314
475 Ga0207707_10065229 3300025912 Bacteria 3171
476 Ga0207707_10258442 3300025912 Bacteria 1512
477 Ga0207695_10038445 3300025913 Bacteria 5152
478 Ga0207695_10103170 3300025913 Bacteria 2844
479 Ga0207695_10350675 3300025913 Bacteria 1363
480 Ga0207671_10033573 3300025914 Bacteria 3816
481 Ga0207671_10768690 3300025914 Bacteria 765
482 Ga0207660_11391444 3300025917 Bacteria 568
483 Ga0207662_10424604 3300025918 Bacteria 905
484 Ga0207657_10073512 3300025919 Bacteria 2889
485 Ga0207649_10006701 3300025920 Bacteria 6259
486 Ga0207649_10451429 3300025920 Bacteria 970
487 Ga0207649_10690849 3300025920 Bacteria 791
488 Ga0207649_11212328 3300025920 Bacteria 596
489 Ga0207652_10026703 3300025921 Bacteria 4811
490 Ga0207652_10401156 3300025921 Bacteria 1237
491 Ga0207646_10109381 3300025922 Bacteria 2480
492 Ga0207646_10149848 3300025922 Bacteria 2103
493 Ga0207681_10020212 3300025923 Bacteria 4216
494 Ga0207681_10139744 3300025923 Bacteria 1802
495 Ga0207681_10526049 3300025923 Bacteria 971
496 Ga0207681_10533567 3300025923 Bacteria 964
497 Ga0207694_10275730 3300025924 Bacteria 1380
498 Ga0207650_10077148 3300025925 Bacteria 2518
499 Ga0207650_10100023 3300025925 Bacteria 2230
500 Ga0207650_10114624 3300025925 Bacteria 2091
501 Ga0207650_10301729 3300025925 Bacteria 1308
502 Ga0207650_10417710 3300025925 Bacteria 1112
503 Ga0207659_10002305 3300025926 Bacteria 11377
504 Ga0207659_10019172 3300025926 Bacteria 4496
505 Ga0207659_10584626 3300025926 Bacteria 951
506 Ga0207687_10036807 3300025927 Bacteria 3335
507 Ga0207687_10059048 3300025927 Bacteria 2701
508 Ga0207687_10089260 3300025927 Bacteria 2244
509 Ga0207687_10155738 3300025927 Bacteria 1748
510 Ga0207687_10325683 3300025927 Bacteria 1245
511 Ga0207687_10385198 3300025927 Bacteria 1150
512 Ga0207687_10491069 3300025927 Bacteria 1024
513 Ga0207644_10010913 3300025931 Bacteria 6001
514 Ga0207644_10113665 3300025931 Bacteria 2050
515 Ga0207644_10153601 3300025931 Bacteria 1783
516 Ga0207644_10157857 3300025931 Bacteria 1761
517 Ga0207644_10753708 3300025931 Bacteria 813
518 Ga0207644_10768630 3300025931 Bacteria 805
519 Ga0207644_11553317 3300025931 Bacteria 555
520 Ga0207690_11321674 3300025932 Bacteria 603
521 Ga0207706_10073296 3300025933 Bacteria 3011
522 Ga0207706_10213269 3300025933 Bacteria 1692
523 Ga0207706_10370479 3300025933 Bacteria 1244
524 Ga0207706_10467567 3300025933 Bacteria 1090
525 Ga0207686_10019349 3300025934 Bacteria 3870
526 Ga0207686_10423557 3300025934 Bacteria 1019
527 Ga0207686_10484592 3300025934 Bacteria 957
528 Ga0207686_10896066 3300025934 Bacteria 715
529 Ga0207709_10113842 3300025935 Bacteria 1814
530 Ga0207709_10369894 3300025935 Bacteria 1088
531 Ga0207709_11060419 3300025935 Bacteria 664
532 Ga0207709_11112533 3300025935 Bacteria 649
533 Ga0207670_10010441 3300025936 Bacteria 5352
534 Ga0207669_10158749 3300025937 Bacteria 1594
535 Ga0207669_10406799 3300025937 Bacteria 1067
536 Ga0207669_10523564 3300025937 Bacteria 952
537 Ga0207704_10001176 3300025938 Bacteria 11669
538 Ga0207704_10235341 3300025938 Bacteria 1365
539 Ga0207704_10689440 3300025938 Bacteria 845
540 Ga0207691_10007352 3300025940 Bacteria 10620
541 Ga0207691_10020788 3300025940 Bacteria 6204
542 Ga0207691_10031449 3300025940 Bacteria 4953
543 Ga0207691_10134497 3300025940 Bacteria 2182
544 Ga0207711_10010839 3300025941 Bacteria 7578
545 Ga0207689_10002510 3300025942 Bacteria 17057
546 Ga0207689_10015898 3300025942 Bacteria 6373
547 Ga0207689_10041503 3300025942 Bacteria 3807
548 Ga0207689_10073322 3300025942 Bacteria 2812
549 Ga0207689_10120802 3300025942 Bacteria 2155
550 Ga0207689_10438207 3300025942 Bacteria 1091
551 Ga0207689_10672400 3300025942 Bacteria 873
552 Ga0207679_10116092 3300025945 Bacteria 2122
553 Ga0207679_10312096 3300025945 Bacteria 1359
554 Ga0207679_10526984 3300025945 Bacteria 1057
555 Ga0207679_11056570 3300025945 Bacteria 745
556 Ga0207667_11018397 3300025949 Bacteria 815
557 Ga0207651_10033946 3300025960 Bacteria 3297
558 Ga0207651_10257684 3300025960 Bacteria 1430
559 Ga0207651_10282632 3300025960 Bacteria 1372
560 Ga0207651_10352824 3300025960 Bacteria 1239
561 Ga0207651_10590025 3300025960 Bacteria 970
562 Ga0207712_10046245 3300025961 Bacteria 3017
563 Ga0207712_10144716 3300025961 Bacteria 1828
564 Ga0207712_10662255 3300025961 Bacteria 908
565 Ga0207668_10108132 3300025972 Bacteria 2081
566 Ga0207668_10137024 3300025972 Bacteria 1877
567 Ga0207668_10286686 3300025972 Bacteria 1353
568 Ga0207668_10349595 3300025972 Bacteria 1236
569 Ga0207668_10614770 3300025972 Bacteria 948
570 Ga0207640_10114940 3300025981 Bacteria 1916
571 Ga0207640_10814935 3300025981 Bacteria 810
572 Ga0207658_10026401 3300025986 Bacteria 4072
573 Ga0207658_10029661 3300025986 Bacteria 3866
574 Ga0207658_10112238 3300025986 Bacteria 2157
575 Ga0207658_10167862 3300025986 Bacteria 1805
576 Ga0207658_10220516 3300025986 Bacteria 1595
577 Ga0207658_10252980 3300025986 Bacteria 1498
578 Ga0207658_10871330 3300025986 Bacteria 819
579 Ga0207677_10009363 3300026023 Bacteria 5512
580 Ga0207677_10070855 3300026023 Bacteria 2458
581 Ga0207677_10074674 3300026023 Bacteria 2407
582 Ga0207677_10208339 3300026023 Bacteria 1559
583 Ga0207677_10852459 3300026023 Bacteria 819
584 Ga0207703_10007195 3300026035 Bacteria 8851
585 Ga0207703_10211073 3300026035 Bacteria 1731
586 Ga0207703_11225502 3300026035 Bacteria 721
587 Ga0207639_10022564 3300026041 Bacteria 4535
588 Ga0207639_10170551 3300026041 Bacteria 1842
589 Ga0207639_10328382 3300026041 Bacteria 1360
590 Ga0207639_11466101 3300026041 Bacteria 640
591 Ga0207639_11571748 3300026041 Bacteria 617
592 Ga0207678_10005182 3300026067 Bacteria 11681
593 Ga0207678_10058661 3300026067 Bacteria 3312
594 Ga0207678_10061650 3300026067 Bacteria 3226
595 Ga0207678_10384271 3300026067 Bacteria 1214
596 Ga0207708_10323990 3300026075 Bacteria 1258
597 Ga0207708_10721500 3300026075 Bacteria 853
598 Ga0207702_10045543 3300026078 Bacteria 3690
599 Ga0207702_10246158 3300026078 Bacteria 1677
600 Ga0207641_10022203 3300026088 Bacteria 5223
601 Ga0207641_10962569 3300026088 Bacteria 849
602 Ga0207641_11101144 3300026088 Bacteria 793
603 Ga0207648_10011444 3300026089 Bacteria 8355
604 Ga0207648_10013452 3300026089 Bacteria 7612
605 Ga0207648_10033988 3300026089 Bacteria 4496
606 Ga0207648_10040460 3300026089 Bacteria 4096
607 Ga0207648_10042464 3300026089 Bacteria 3991
608 Ga0207648_10045067 3300026089 Bacteria 3870
609 Ga0207648_10057182 3300026089 Bacteria 3403
610 Ga0207648_10155649 3300026089 Bacteria 2018
611 Ga0207648_10328646 3300026089 Bacteria 1375
612 Ga0207676_10009527 3300026095 Bacteria 6914
613 Ga0207676_10209491 3300026095 Bacteria 1728
614 Ga0207676_10447020 3300026095 Bacteria 1218
615 Ga0207676_10486819 3300026095 Bacteria 1169
616 Ga0207676_11699929 3300026095 Bacteria 629
617 Ga0207674_10004887 3300026116 Bacteria 16041
618 Ga0207674_10044914 3300026116 Bacteria 4549
619 Ga0207674_10088788 3300026116 Bacteria 3084
620 Ga0207674_10097618 3300026116 Bacteria 2922
621 Ga0207674_10173302 3300026116 Bacteria 2110
622 Ga0207674_10308373 3300026116 Bacteria 1532
623 Ga0207674_10383650 3300026116 Bacteria 1358
624 Ga0207675_100003168 3300026118 Bacteria 16147
625 Ga0207675_100345804 3300026118 Bacteria 1456
626 Ga0207675_101333015 3300026118 Bacteria 738
627 Ga0207683_10010616 3300026121 Bacteria 7854
628 Ga0207683_10019634 3300026121 Bacteria 5775
629 Ga0207683_10126527 3300026121 Bacteria 2297
630 Ga0207683_10172158 3300026121 Bacteria 1961
631 Ga0207683_10260942 3300026121 Bacteria 1582
632 Ga0207683_10533116 3300026121 Bacteria 1085
633 Ga0207698_10034283 3300026142 Bacteria 3698
634 Ga0207698_10115110 3300026142 Bacteria 2263
635 Ga0207698_10982938 3300026142 Bacteria 854
636 Ga0207698_11258856 3300026142 Bacteria 754
637 Ga0209995_1007125 3300027471 Bacteria 1802
638 Ga0209968_1000252 3300027526 Bacteria 9117
639 Ga0209999_1048232 3300027543 Bacteria 803
640 Ga0209588_1123609 3300027671 Bacteria 827
641 Ga0209966_1000027 3300027695 Bacteria 65242
642 Ga0209998_10025166 3300027717 Bacteria 1295
643 Ga0209813_10007685 3300027866 Bacteria 2693
644 Ga0209813_10027904 3300027866 Bacteria 1642
645 Ga0209813_10031206 3300027866 Bacteria 1572
646 Ga0209813_10074624 3300027866 Bacteria 1109
647 Ga0209813_10127363 3300027866 Bacteria 892
648 Ga0209813_10285985 3300027866 Bacteria 636
649 Ga0209974_10001546 3300027876 Bacteria 8358
650 Ga0209974_10102760 3300027876 Bacteria 1000
651 Ga0268266_10087570 3300028379 Bacteria 2725
652 Ga0268266_10204639 3300028379 Bacteria 1808
653 Ga0268266_10352863 3300028379 Bacteria 1382
654 Ga0268266_11285310 3300028379 Bacteria 707
655 Ga0268265_10053567 3300028380 Bacteria 3057
656 Ga0268265_10108252 3300028380 Bacteria 2262
657 Ga0268265_10170495 3300028380 Bacteria 1859
658 Ga0268265_10592620 3300028380 Bacteria 1058
659 Ga0268265_11827467 3300028380 Bacteria 614
660 Ga0268265_12395214 3300028380 Bacteria 534
661 Ga0268264_10015734 3300028381 Bacteria 6195
662 Ga0268264_10022308 3300028381 Bacteria 5170
663 Ga0268264_10089369 3300028381 Bacteria 2652
664 Ga0268264_10296405 3300028381 Bacteria 1521
665 Ga0268264_11473446 3300028381 Bacteria 691
666 Ga0307517_10044859 3300028786 Bacteria 4662
667 Ga0307517_10072094 3300028786 Bacteria 3084
668 Ga0307517_10258910 3300028786 Bacteria 1012
669 Ga0307517_10291403 3300028786 Bacteria 922
670 Ga0307517_10339947 3300028786 Bacteria 820
671 Ga0307517_10432990 3300028786 Bacteria 686
672 Ga0307515_10000006 3300028794 Bacteria 725810
673 Ga0307515_10000048 3300028794 Bacteria 288111
674 Ga0307515_10000178 3300028794 Bacteria 157107
675 Ga0307515_10028802 3300028794 Bacteria 9421
676 Ga0307515_10108583 3300028794 Bacteria 3268
677 Ga0307515_10112860 3300028794 Bacteria 3157
678 Ga0307515_10113929 3300028794 Bacteria 3130
679 Ga0307515_10143436 3300028794 Bacteria 2546
680 Ga0307515_10210945 3300028794 Bacteria 1786
681 Ga0307515_10239825 3300028794 Bacteria 1587
682 Ga0307511_10000082 3300030521 Bacteria 80315
683 Ga0307512_10008458 3300030522 Bacteria 10030
684 Ga0307512_10073753 3300030522 Bacteria 2511
685 Ga0265327_10047228 3300031251 Bacteria 2273
686 Ga0265327_10198720 3300031251 Bacteria 909
687 Ga0265316_10404004 3300031344 Bacteria 983
688 Ga0307513_10015075 3300031456 Bacteria 9380
689 Ga0307513_10016139 3300031456 Bacteria 9021
690 Ga0307513_10110085 3300031456 Bacteria 2750
691 Ga0307513_10256109 3300031456 Bacteria 1543
692 Ga0307513_10432393 3300031456 Bacteria 1044
693 Ga0307513_10897313 3300031456 Bacteria 594
694 Ga0307509_10000135 3300031507 Bacteria 109066
695 Ga0307509_10002023 3300031507 Bacteria 33484
696 Ga0307509_10003789 3300031507 Bacteria 22447
697 Ga0307509_10023592 3300031507 Bacteria 6902
698 Ga0307509_10049870 3300031507 Bacteria 4485
699 Ga0307509_10063411 3300031507 Bacteria 3891
700 Ga0307509_10506372 3300031507 Bacteria 891
701 Ga0307408_100037340 3300031548 Bacteria 3421
702 Ga0307408_100366711 3300031548 Bacteria 1227
703 Ga0307408_100555038 3300031548 Bacteria 1014
704 Ga0307408_101342350 3300031548 Bacteria 671
705 Ga0307408_102469856 3300031548 Bacteria 505
706 Ga0307508_10002258 3300031616 Bacteria 20542
707 Ga0307508_10003213 3300031616 Bacteria 16704
708 Ga0307508_10068798 3300031616 Bacteria 3111
709 Ga0307508_10364060 3300031616 Bacteria 1037
710 Ga0307508_10583914 3300031616 Bacteria 717
711 Ga0307514_10000567 3300031649 Bacteria 70155
712 Ga0307514_10015044 3300031649 Bacteria 6391
713 Ga0307514_10191360 3300031649 Bacteria 1302
714 Ga0307514_10322951 3300031649 Bacteria 845
715 Ga0307516_10000068 3300031730 Bacteria 111515
716 Ga0307516_10000677 3300031730 Bacteria 46191
717 Ga0307516_10001526 3300031730 Bacteria 31910
718 Ga0307516_10083550 3300031730 Bacteria 3034
719 Ga0307516_10088249 3300031730 Bacteria 2934
720 Ga0307516_10139836 3300031730 Bacteria 2192
721 Ga0307516_10531078 3300031730 Bacteria 830
722 Ga0307516_10689599 3300031730 Bacteria 678
723 Ga0307516_10815190 3300031730 Bacteria 595
724 Ga0307405_10006161 3300031731 Bacteria 5875
725 Ga0307405_11098881 3300031731 Bacteria 683
726 Ga0307405_11426447 3300031731 Bacteria 606
727 Ga0307405_11461925 3300031731 Bacteria 599
728 Ga0307413_10005022 3300031824 Bacteria 5842
729 Ga0307413_10513633 3300031824 Bacteria 965
730 Ga0307413_11369641 3300031824 Bacteria 621
731 Ga0307413_11462731 3300031824 Bacteria 603
732 Ga0307413_12088653 3300031824 Bacteria 512
733 Ga0307410_10052989 3300031852 Bacteria 2743
734 Ga0307410_10118795 3300031852 Bacteria 1925
735 Ga0307410_10147993 3300031852 Bacteria 1745
736 Ga0307410_10208782 3300031852 Unclassified 1495
737 Ga0307410_10385702 3300031852 Bacteria 1128
738 Ga0307410_10616049 3300031852 Bacteria 907
739 Ga0307410_11609936 3300031852 Bacteria 574
740 Ga0307406_10248496 3300031901 Bacteria 1338
741 Ga0307406_10371802 3300031901 Bacteria 1124
742 Ga0307406_11580603 3300031901 Bacteria 579
743 Ga0307406_11724484 3300031901 Bacteria 555
744 Ga0307407_10144012 3300031903 Bacteria 1541
745 Ga0307407_10149037 3300031903 Bacteria 1518
746 Ga0307407_10311361 3300031903 Bacteria 1101
747 Ga0307412_10028899 3300031911 Bacteria 3475
748 Ga0307412_10141870 3300031911 Bacteria 1761
749 Ga0307412_10169770 3300031911 Bacteria 1630
750 Ga0307412_10186141 3300031911 Bacteria 1566
751 Ga0307412_10217234 3300031911 Bacteria 1463
752 Ga0307412_10225048 3300031911 Bacteria 1441
753 Ga0307412_11188707 3300031911 Bacteria 682
754 Ga0307412_11204519 3300031911 Bacteria 678
755 Ga0307409_100009537 3300031995 Bacteria 5971
756 Ga0307409_100501518 3300031995 Bacteria 1182
757 Ga0307416_100025405 3300032002 Bacteria 4341
758 Ga0307416_100176148 3300032002 Bacteria 1998
759 Ga0307416_100183202 3300032002 Bacteria 1965
760 Ga0307416_100237905 3300032002 Bacteria 1762
761 Ga0307416_101087294 3300032002 Bacteria 904
762 Ga0307416_101423190 3300032002 Unclassified 799
763 Ga0307416_101933650 3300032002 Bacteria 693
764 Ga0307416_102366955 3300032002 Bacteria 631
765 Ga0307414_10056000 3300032004 Bacteria 2763
766 Ga0307414_10208303 3300032004 Bacteria 1596
767 Ga0307414_10246193 3300032004 Bacteria 1483
768 Ga0307414_10595351 3300032004 Bacteria 991
769 Ga0307414_10959937 3300032004 Bacteria 786
770 Ga0307411_10006035 3300032005 Bacteria 6021
771 Ga0307411_10142318 3300032005 Bacteria 1770
772 Ga0307411_10245047 3300032005 Bacteria 1406
773 Ga0307411_11158388 3300032005 Bacteria 699
774 Ga0307415_100006492 3300032126 Bacteria 6318
775 Ga0307415_101337455 3300032126 Bacteria 680
776 Ga0307507_10048825 3300033179 Bacteria 4111
777 Ga0307507_10106197 3300033179 Bacteria 2320
778 Ga0307510_10000170 3300033180 Bacteria 55071
779 Ga0307510_10009424 3300033180 Bacteria 11633
780 Ga0307510_10403669 3300033180 Bacteria 809
781 Ga0373959_0078851 3300034820 Bacteria 756
782 Ga0373959_0196003 3300034820 Bacteria 531
783 Ga0373926_0011423 3300035083 Bacteria 2987
784 Ga0373928_0049414 3300035084 Bacteria 989
785 Ga0373929_0229875 3300035085 Bacteria 531
786 Ga0373934_0000092 3300035086 Bacteria 31400
787 Ga0373934_0089259 3300035086 Bacteria 1241
788 Ga0373934_0360412 3300035086 Bacteria 606
789 Ga0373944_0224777 3300035089 Bacteria 686
790 Ga0373952_0182677 3300035092 Bacteria 606
791 Ga0373923_0001839 3300035111 Bacteria 6291
792 Ga0373923_0207404 3300035111 Bacteria 907
793 Ga0373932_0008780 3300035112 Bacteria 2419
794 Ga0373936_0014253 3300035113 Bacteria 3038
795 Ga0373936_0019494 3300035113 Bacteria 2628
796 Ga0373936_0136094 3300035113 Bacteria 1058
797 Ga0373936_0342077 3300035113 Bacteria 680
798 Ga0373939_0230382 3300035114 Bacteria 713
799 Ga0373945_0301848 3300035116 Bacteria 686
800 Ga0373945_0558620 3300035116 Unclassified 514
801 Ga0373953_0007328 3300035117 Bacteria 3690
802 Ga0373954_0013776 3300035118 Bacteria 3603
803 Ga0373954_0018723 3300035118 Bacteria 3119
804 Ga0373956_0004332 3300035119 Bacteria 5697
805 Ga0373956_0071476 3300035119 Bacteria 1583
806 Ga0373957_0004771 3300035120 Bacteria 4152
807 Ga0373957_0009012 3300035120 Bacteria 3253
808 Ga0373960_0092695 3300035121 Bacteria 968
809 Ga0373943_0019914 3300035170 Bacteria 3091
810 Ga0373946_0015558 3300035171 Bacteria 2887
811 Ga0373946_0329087 3300035171 Bacteria 760
812 Ga0373955_0002722 3300035172 Bacteria 7739
813 Ga0373955_0105591 3300035172 Bacteria 1622
814 Ga0373955_0152970 3300035172 Bacteria 1358
815 Ga0373955_0464919 3300035172 Bacteria 771
816 Ga0373942_0371596 3300035207 Bacteria 509
817 Ga0373924_0003563 3300035410 Bacteria 5365
818 Ga0373931_0028054 3300035691 Bacteria 2879
819 Ga0373931_0509810 3300035691 Bacteria 777
820 Ga0373931_0633107 3300035691 Bacteria 701
821 Ga0373931_0692833 3300035691 Bacteria 672
822 Ga0373935_0042801 3300035692 Bacteria 2848
823 Ga0373935_0050707 3300035692 Bacteria 2634
824 Ga0373927_0019356 3300035695 Bacteria 4464
825 Ga0373927_0027651 3300035695 Bacteria 3702
826 Ga0373933_0011004 3300035724 Bacteria 4970
827 Ga0373933_0024114 3300035724 Bacteria 3482
828 Ga0373933_0541618 3300035724 Bacteria 763
829 Ga0373947_0171798 3300035725 Bacteria 1407
830 Ga0373947_0289565 3300035725 Bacteria 1090
831 Ga0373937_0003933 3300036401 Bacteria 12555
832 Ga0373937_0049598 3300036401 Bacteria 3844
833 Ga0373937_0317900 3300036401 Bacteria 1473
834 Ga0373937_0462106 3300036401 Bacteria 1205
835 Ga0373937_0495843 3300036401 Bacteria 1160
836 Ga0373937_0607935 3300036401 Bacteria 1038
837 Ga0373937_0655170 3300036401 Bacteria 995
838 Ga0373937_1021581 3300036401 Bacteria 775
839 Ga0373937_1945048 3300036401 Bacteria 534
840 Ga0373925_0021793 3300037068 Bacteria 4671
841 Ga0373925_0038647 3300037068 Bacteria 3529
842 Ga0373925_0073187 3300037068 Bacteria 2593
843 Ga0373925_0102290 3300037068 Bacteria 2204
844 Ga0373925_0438816 3300037068 Bacteria 1068
845 Ga0373925_0475128 3300037068 Bacteria 1025
846 Ga0373925_0740020 3300037068 Bacteria 811
847 Ga0373925_1306608 3300037068 Bacteria 595
848 Ga0373925_1664843 3300037068 Bacteria 521
849 Ga0395905_0005986 3300037471 Bacteria 12317
850 Ga0395905_0006586 3300037471 Bacteria 11665
851 Ga0436364_0041268 3300037853 Bacteria 1203
852 Ga0436364_0145601 3300037853 Bacteria 2099
853 Ga0436361_0144002 3300039447 Bacteria 44507
854 Ga0436361_0427460 3300039447 Bacteria 107545
855 Ga0436361_0677106 3300039447 Bacteria 4214
856 Ga0436363_0908329 3300039450 Bacteria 517
857 Ga0439461_0011063 3300041410 Bacteria 1669
858 Ga0451787_108726 3300041441 Bacteria 786
859 Ga0451791_0258275 3300041451 Bacteria 905
860 Ga0451793_0385879 3300041452 Bacteria 540
861 Ga0451795_0098800 3300041456 Bacteria 543
862 Ga0451798_0690418 3300041458 Bacteria 782
863 Ga0451802_0097874 3300041460 Bacteria 701
864 Ga0451804_0518901 3300041463 Bacteria 744
865 Ga0451807_0660491 3300041486 Bacteria 788
866 Ga0451807_1855817 3300041486 Bacteria 780
867 Ga0451807_2535304 3300041486 Bacteria 645
868 Ga0451833_0364967 3300041491 Bacteria 646
869 Ga0451839_0985847 3300041496 Bacteria 658
870 Ga0451845_0812550 3300041501 Bacteria 547
871 Ga0451851_1327704 3300041507 Bacteria 1047
872 Ga0451843_0719174 3300041509 Bacteria 568
873 Ga0451843_1018189 3300041509 Bacteria 693
874 Ga0451843_1143476 3300041509 Bacteria 546
875 Ga0451855_0621740 3300041511 Bacteria 697
876 Ga0451853_1855892 3300041512 Bacteria 547
877 Ga0451853_2145180 3300041512 Bacteria 574
878 Ga0451853_3592373 3300041512 Bacteria 1736
879 Ga0439431_0003099 3300041997 Bacteria 3653
880 Ga0439431_0022429 3300041997 Bacteria 1521
881 Ga0439441_040866 3300042001 Bacteria 929
882 Ga0439442_083723 3300042002 Bacteria 684
883 Ga0439445_0069538 3300042004 Bacteria 972
884 Ga0439445_0095564 3300042004 Bacteria 840
885 Ga0439449_0176244 3300042007 Bacteria 799
886 Ga0439449_0375104 3300042007 Bacteria 539
887 Ga0450911_000064 3300042115 Bacteria 43716
888 Ga0450917_012394 3300042120 Bacteria 694
889 Ga0450888_013759 3300042126 Bacteria 973
890 Ga0450890_037612 3300042127 Bacteria 707
891 Ga0450896_062047 3300042133 Bacteria 610
892 Ga0450898_115335 3300042134 Bacteria 571
893 Ga0450899_011151 3300042135 Bacteria 1001
894 Ga0450889_052289 3300042144 Bacteria 504
895 Ga0450910_077718 3300042147 Bacteria 577
896 Ga0439446_0162451 3300042156 Bacteria 739
897 Ga0439434_0024180 3300042435 Bacteria 1832
898 Ga0439459_0120093 3300042438 Bacteria 662
899 Ga0451577_0000843 3300042876 Bacteria 45842
900 Ga0451577_0019207 3300042876 Bacteria 6285
901 Ga0451577_0031701 3300042876 Bacteria 4768
902 Ga0451577_0105948 3300042876 Bacteria 2513
903 Ga0451577_0128968 3300042876 Bacteria 2268
904 Ga0451577_0172323 3300042876 Bacteria 1950
905 Ga0451577_0261180 3300042876 Bacteria 1568
906 Ga0451577_0305536 3300042876 Bacteria 1441
907 Ga0451577_0637692 3300042876 Bacteria 966
908 Ga0451577_0844880 3300042876 Bacteria 826
909 Ga0453683_0242924 3300044673 Bacteria 1147
910 Ga0453684_0043301 3300044712 Bacteria 6052
911 Ga0453684_0167558 3300044712 Bacteria 2592
912 Ga0453684_0222854 3300044712 Bacteria 2183
913 Ga0453684_0326879 3300044712 Bacteria 1735
914 Ga0453684_0355134 3300044712 Bacteria 1652
915 Ga0453684_0414754 3300044712 Bacteria 1505
916 Ga0453684_0497056 3300044712 Bacteria 1351
917 Ga0453684_0545664 3300044712 Bacteria 1278
918 Ga0453684_0632424 3300044712 Bacteria 1169
919 Ga0453684_0846047 3300044712 Bacteria 983
920 Ga0451576_0016269 3300045051 Bacteria 8216
921 Ga0451576_0182140 3300045051 Bacteria 2193
922 Ga0451576_0204453 3300045051 Bacteria 2062
923 Ga0451576_0273763 3300045051 Bacteria 1765
924 Ga0451576_0396581 3300045051 Bacteria 1447
925 Ga0451576_0657900 3300045051 Bacteria 1101
926 Ga0495592_0002300 3300046454 Bacteria 13481
927 Ga0495592_0018151 3300046454 Bacteria 5346
928 Ga0495592_0045062 3300046454 Bacteria 3292
929 Ga0495592_0124858 3300046454 Bacteria 1807
930 Ga0495603_0194372 3300046455 Bacteria 1173
931 Ga0495590_0140922 3300046457 Bacteria 870
932 Ga0495629_0478951 3300046459 Bacteria 841
933 Ga0495638_0118898 3300046460 Bacteria 1563
934 Ga0495638_0153200 3300046460 Bacteria 1336
935 Ga0495638_0378659 3300046460 Bacteria 740
936 Ga0495641_0007404 3300046461 Bacteria 6861
937 Ga0495651_0001600 3300046462 Bacteria 17516
938 Ga0495651_0002209 3300046462 Bacteria 15019
939 Ga0495653_0242741 3300046463 Bacteria 1199
940 Ga0495650_0085118 3300046471 Bacteria 1212
941 Ga0495580_0017228 3300046472 Bacteria 5408
942 Ga0495582_0023691 3300046473 Bacteria 3357
943 Ga0495639_0005105 3300046475 Bacteria 5639
944 Ga0495662_0012408 3300046476 Bacteria 4158
945 Ga0495664_0035511 3300046477 Bacteria 2935
946 Ga0495583_0086491 3300046506 Bacteria 1356
947 Ga0495606_0146348 3300046507 Bacteria 1391
948 Ga0495608_0003952 3300046511 Bacteria 10652
949 Ga0495608_0293295 3300046511 Bacteria 1008
950 Ga0495616_0234446 3300046513 Bacteria 794
951 Ga0495618_0033008 3300046514 Bacteria 3244
952 Ga0495620_0153980 3300046515 Bacteria 895
953 Ga0495628_0004302 3300046516 Bacteria 12651
954 Ga0495628_0008390 3300046516 Bacteria 8861
955 Ga0495630_0186935 3300046517 Bacteria 1580
956 Ga0495630_0218555 3300046517 Bacteria 1455
957 Ga0495630_0438598 3300046517 Bacteria 1001
958 Ga0495632_0026107 3300046519 Bacteria 3079
959 Ga0495643_0200544 3300046522 Bacteria 958
960 Ga0495648_0075809 3300046524 Bacteria 1933
961 Ga0495648_0172759 3300046524 Bacteria 1106
962 Ga0495648_0431841 3300046524 Bacteria 581
963 Ga0495666_0003491 3300046526 Bacteria 7937
964 Ga0495642_0222995 3300046528 Bacteria 823
965 Ga0495652_0002967 3300046529 Bacteria 17081
966 Ga0495652_0026875 3300046529 Bacteria 5077
967 Ga0495654_0357509 3300046530 Bacteria 586
968 Ga0495665_0039307 3300046531 Bacteria 2520
969 Ga0495640_0805887 3300046533 Bacteria 559
970 Ga0495586_0016380 3300046535 Bacteria 3942
971 Ga0495586_0055189 3300046535 Bacteria 2153
972 Ga0495587_0002613 3300046536 Bacteria 12037
973 Ga0495598_0179321 3300046537 Bacteria 755
974 Ga0495597_0000116 3300046542 Bacteria 72210
975 Ga0495597_0047545 3300046542 Bacteria 1899
976 Ga0495597_0080236 3300046542 Bacteria 1396
977 Ga0495645_0017400 3300046543 Bacteria 5148
978 Ga0495622_0013250 3300046557 Bacteria 3827
979 Ga0495633_0506825 3300046558 Bacteria 544
980 Ga0495667_0058327 3300046559 Bacteria 2536
981 Ga0495667_0161254 3300046559 Bacteria 1442
982 Ga0495667_0189183 3300046559 Bacteria 1319
983 Ga0495668_0069990 3300046616 Bacteria 1929
984 Ga0495668_0443489 3300046616 Bacteria 714
985 Ga0495634_0060300 3300046642 Bacteria 2524
986 Ga0495625_0481068 3300046660 Bacteria 762
987 Ga0495625_0548161 3300046660 Bacteria 701
988 Ga0495625_0875477 3300046660 Bacteria 517
989 Ga0495635_0017152 3300046663 Bacteria 5057
990 Ga0495657_0017464 3300046675 Bacteria 5207
991 Ga0495657_0535412 3300046675 Bacteria 681
992 Ga0495599_0011947 3300046678 Bacteria 5340
993 Ga0495599_0015613 3300046678 Bacteria 4714
994 Ga0495599_0038730 3300046678 Bacteria 2996
995 Ga0495646_0018322 3300046680 Bacteria 4435
996 Ga0495646_0132969 3300046680 Bacteria 1399
997 Ga0495647_0014541 3300046681 Bacteria 2743
998 Ga0495647_0163823 3300046681 Bacteria 959
999 Ga0495658_0025108 3300046683 Bacteria 3183
1000 Ga0495658_0026522 3300046683 Bacteria 3106
1001 Ga0495658_0040043 3300046683 Bacteria 2604
1002 Ga0495658_0110485 3300046683 Bacteria 1652
1003 Ga0495658_0191753 3300046683 Bacteria 1271
1004 Ga0495658_0554276 3300046683 Bacteria 736
1005 Ga0495613_0083494 3300046689 Bacteria 2319
1006 Ga0495624_0014311 3300046690 Bacteria 5387
1007 Ga0495624_0083647 3300046690 Bacteria 1973
1008 Ga0495670_0172367 3300046691 Bacteria 1140
1009 Ga0495671_0166580 3300046692 Bacteria 1072
1010 Ga0495671_0339833 3300046692 Bacteria 720
1011 Ga0495649_0002438 3300046694 Bacteria 13091
1012 Ga0495600_0019882 3300046809 Bacteria 4292
1013 Ga0495581_0155377 3300047315 Bacteria 1337
1014 Ga0495604_0025969 3300047317 Bacteria 4665
1015 Ga0495674_0427473 3300047319 Bacteria 1066
1016 Ga0495676_0255681 3300047321 Bacteria 1193
1017 Ga0495680_0107777 3300047322 Bacteria 2068
1018 Ga0495680_0651977 3300047322 Bacteria 699
1019 Ga0495687_000328 3300047443 Bacteria 61170
1020 Ga0495687_003100 3300047443 Bacteria 12441
1021 Ga0495687_196581 3300047443 Bacteria 644
1022 Ga0495675_0001531 3300047444 Bacteria 13954
1023 Ga0495675_0094467 3300047444 Bacteria 1875
1024 Ga0495677_0198732 3300047445 Bacteria 779
1025 Ga0495679_049230 3300047446 Bacteria 1272
1026 Ga0495673_0277409 3300047469 Bacteria 606
1027 Ga0495681_0330156 3300047470 Bacteria 584
1028 Ga0495684_0005095 3300047471 Bacteria 10247
1029 Ga0495684_0304677 3300047471 Bacteria 1143
1030 Ga0495686_0000992 3300047472 Bacteria 34617
1031 Ga0495686_0167469 3300047472 Bacteria 1280
1032 Ga0495686_0421970 3300047472 Bacteria 713
1033 Ga0495593_0680229 3300047673 Bacteria 517
1034 Ga0495602_0438485 3300048088 Bacteria 924
1035 Ga0495602_0441654 3300048088 Bacteria 920
1036 Ga0495602_0943119 3300048088 Bacteria 572
1037 Ga0495626_0246832 3300048091 Bacteria 717
1038 Ga0496101_0130117 3300048904 Bacteria 1911
1039 Ga0496102_1779792 3300048905 Bacteria 533
1040 Ga0496104_0524412 3300048907 Bacteria 1096
1041 Ga0496104_0621853 3300048907 Bacteria 990
1042 Ga0496106_0055989 3300048909 Bacteria 2981
1043 Ga0496108_0058365 3300048911 Bacteria 3244
1044 Ga0496108_0219302 3300048911 Bacteria 1653
1045 Ga0496108_1757685 3300048911 Bacteria 509
1046 Ga0496109_0188793 3300048912 Bacteria 1936
1047 Ga0496110_0273726 3300048913 Bacteria 1537
1048 Ga0496112_0551025 3300048915 Bacteria 1087
1049 Ga0496113_0449754 3300048916 Bacteria 1035
1050 Ga0496113_1603142 3300048916 Bacteria 501
1051 Ga0496114_0032738 3300048917 Bacteria 4281
1052 Ga0496114_0420814 3300048917 Bacteria 1183
1053 Ga0496114_0706632 3300048917 Bacteria 884
1054 Ga0496121_0034400 3300048924 Bacteria 4561
1055 Ga0496121_0432796 3300048924 Bacteria 853
1056 Ga0496124_0048814 3300048927 Bacteria 3614
1057 Ga0496124_0155790 3300048927 Bacteria 1787
1058 Ga0496125_0141311 3300048928 Bacteria 1673
1059 Ga0496125_0182268 3300048928 Bacteria 1397
1060 Ga0496125_0766763 3300048928 Bacteria 503
1061 Ga0501297_030494 3300049520 Bacteria 716
1062 Ga0501298_020738 3300049521 Bacteria 1227
1063 Ga0501300_035560 3300049523 Bacteria 742
1064 Ga0501301_001189 3300049524 Bacteria 1632
1065 Ga0501303_001065 3300049526 Bacteria 2054
1066 Ga0501031_0001187 3300049568 Bacteria 15843
1067 Ga0501031_0118225 3300049568 Bacteria 1732
1068 Ga0501033_0034547 3300049570 Bacteria 3792
1069 Ga0501034_0223376 3300049571 Bacteria 1835
1070 Ga0501036_0083136 3300049572 Bacteria 2706
1071 Ga0501036_1043307 3300049572 Bacteria 669
1072 Ga0501037_0903778 3300049573 Bacteria 579
1073 Ga0501038_0540909 3300049574 Bacteria 887
1074 Ga0501039_0344078 3300049575 Bacteria 1172
1075 Ga0501039_0567692 3300049575 Bacteria 890
1076 Ga0501041_0001914 3300049577 Bacteria 11673
1077 Ga0501042_0096978 3300049578 Bacteria 2119
1078 Ga0501042_0828742 3300049578 Bacteria 673
1079 Ga0501043_0000059 3300049579 Bacteria 101444
1080 Ga0501043_0534957 3300049579 Bacteria 872
1081 Ga0501046_0000082 3300049580 Bacteria 101313
1082 Ga0501047_0000050 3300049581 Bacteria 155628
1083 Ga0501047_0018628 3300049581 Bacteria 6657
1084 Ga0501048_0018113 3300049582 Bacteria 5181
1085 Ga0501048_0836356 3300049582 Bacteria 662
1086 Ga0501067_0155854 3300049583 Bacteria 1272
1087 Ga0501067_0213865 3300049583 Bacteria 1074
1088 Ga0501067_0385467 3300049583 Bacteria 781
1089 Ga0501068_0010614 3300049584 Bacteria 5181
1090 Ga0501068_0866314 3300049584 Bacteria 594
1091 Ga0501069_0267212 3300049585 Bacteria 999
1092 Ga0501070_0168367 3300049586 Bacteria 1805
1093 Ga0501072_0064396 3300049588 Bacteria 2891
1094 Ga0501072_0121924 3300049588 Bacteria 2077
1095 Ga0501074_0070030 3300049590 Bacteria 2522
1096 Ga0501075_0144169 3300049591 Bacteria 1815
1097 Ga0501076_0040425 3300049592 Bacteria 3665
1098 Ga0501076_0043317 3300049592 Bacteria 3546
1099 Ga0501076_1297372 3300049592 Bacteria 599
1100 Ga0501076_1311166 3300049592 Bacteria 595
1101 Ga0501077_0004802 3300049593 Bacteria 8216
1102 Ga0501077_0378880 3300049593 Bacteria 904
1103 Ga0501198_084939 3300049649 Bacteria 619
1104 Ga0501222_017605 3300049662 Bacteria 947
1105 Ga0501223_028488 3300049663 Bacteria 1088
1106 Ga0501233_137999 3300049668 Bacteria 671
1107 Ga0501236_125398 3300049670 Bacteria 525
1108 Ga0501257_203693 3300049686 Bacteria 570
1109 Ga0501221_176672 3300049704 Bacteria 581
1110 Ga0501079_0058608 3300049741 Bacteria 2971
1111 Ga0501079_1107761 3300049741 Bacteria 624
1112 Ga0501079_1283637 3300049741 Bacteria 576
1113 Ga0501080_0003122 3300049742 Bacteria 14606
1114 Ga0501080_0409118 3300049742 Bacteria 1220
1115 Ga0501081_0274726 3300049743 Bacteria 1233
1116 Ga0501081_0357849 3300049743 Bacteria 1076
1117 Ga0501081_1554689 3300049743 Bacteria 503
1118 Ga0501083_0114806 3300049744 Bacteria 1768
1119 Ga0501262_002075 3300049759 Bacteria 2263
1120 Ga0501263_016317 3300049760 Bacteria 966
1121 Ga0501264_057141 3300049761 Bacteria 517
1122 Ga0501265_000298 3300049762 Bacteria 5106
1123 Ga0501275_069972 3300049772 Bacteria 551
1124 Ga0501283_032095 3300049779 Bacteria 884
1125 Ga0501035_0238803 3300049822 Bacteria 1546
1126 Ga0501035_0270865 3300049822 Bacteria 1437
1127 Ga0501044_1336083 3300049823 Bacteria 583
1128 Ga0501045_0004217 3300049824 Bacteria 9919
1129 Ga0501045_0387234 3300049824 Bacteria 1041
1130 nmdc:mga03683_10542_c1 3300050489 Bacteria 2981
1131 nmdc:mga03683_107762_c1 3300050489 Bacteria 1229
1132 nmdc:mga03683_19613_c1 3300050489 Bacteria 2584
1133 nmdc:mga03683_210524_c1 3300050489 Bacteria 894
1134 nmdc:mga03683_242205_c1 3300050489 Bacteria 836
1135 nmdc:mga03683_3074_c1 3300050489 Bacteria 5303
1136 nmdc:mga03683_338682_c1 3300050489 Bacteria 710
1137 nmdc:mga03683_59786_c2 3300050489 Bacteria 1235
1138 nmdc:mga03683_6406_c1 3300050489 Bacteria 4028
1139 nmdc:mga03683_654062_c1 3300050489 Bacteria 517
1140 nmdc:mga03n38_251470_c1 3300050490 Bacteria 934
1141 nmdc:mga03n38_43245_c1 3300050490 Bacteria 1974
1142 nmdc:mga03n38_923878_c1 3300050490 Bacteria 514
1143 nmdc:mga00v17_157864_c1 3300050491 Bacteria 1459
1144 nmdc:mga00v17_411953_c1 3300050491 Bacteria 878
1145 nmdc:mga00v17_463011_c1 3300050491 Bacteria 823
1146 nmdc:mga00v17_47503_c1 3300050491 Bacteria 2600
1147 nmdc:mga00v17_72040_c1 3300050491 Bacteria 2143
1148 nmdc:mga00v17_82732_c1 3300050491 Bacteria 2007
1149 nmdc:mga00v17_936622_c1 3300050491 Bacteria 547
1150 nmdc:mga0yw44_1009388_c1 3300050492 Bacteria 563
1151 nmdc:mga0yw44_124611_c1 3300050492 Bacteria 1663
1152 nmdc:mga0yw44_85085_c1 3300050492 Bacteria 1989
1153 nmdc:mga0k408_120481_c1 3300050493 Bacteria 1553
1154 nmdc:mga0k408_12739_c1 3300050493 Bacteria 4600
1155 nmdc:mga0k408_135363_c1 3300050493 Bacteria 1464
1156 nmdc:mga0k408_156678_c1 3300050493 Bacteria 1356
1157 nmdc:mga0k408_17491_c1 3300050493 Bacteria 3995
1158 nmdc:mga0k408_256133_c1 3300050493 Bacteria 1045
1159 nmdc:mga0k408_26087_c1 3300050493 Bacteria 3312
1160 nmdc:mga0k408_285891_c1 3300050493 Bacteria 984
1161 nmdc:mga0k408_34425_c1 3300050493 Bacteria 2900
1162 nmdc:mga0k408_370086_c1 3300050493 Bacteria 854
1163 nmdc:mga0k408_50096_c1 3300050493 Bacteria 2417
1164 nmdc:mga0k408_551395_c1 3300050493 Bacteria 681
1165 nmdc:mga0k408_590493_c1 3300050493 Bacteria 655
1166 nmdc:mga0k408_72200_c1 3300050493 Bacteria 2015
1167 nmdc:mga0k408_72324_c1 3300050493 Bacteria 2014
1168 nmdc:mga0k408_74617_c1 3300050493 Bacteria 1982
1169 nmdc:mga0k408_7990_c1 3300050493 Bacteria 5672
1170 nmdc:mga0k408_9000_c1 3300050493 Bacteria 5372
1171 nmdc:mga06z11_115523_c2 3300050494 Bacteria 1171
1172 nmdc:mga06z11_131555_c1 3300050494 Bacteria 1406
1173 nmdc:mga06z11_24408_c1 3300050494 Bacteria 2852
1174 nmdc:mga06z11_32152_c1 3300050494 Bacteria 2556
1175 nmdc:mga06z11_902261_c1 3300050494 Bacteria 539
1176 nmdc:mga04h51_100039_c2 3300050495 Bacteria 742
1177 nmdc:mga04h51_289046_c1 3300050495 Bacteria 665
1178 nmdc:mga04h51_399297_c1 3300050495 Bacteria 575
1179 nmdc:mga04h51_531353_c1 3300050495 Bacteria 505
1180 nmdc:mga04h51_7897_c1 3300050495 Bacteria 2828
1181 nmdc:mga07m45_139885_c1 3300050496 Bacteria 1402
1182 nmdc:mga07m45_185510_c1 3300050496 Bacteria 1210
1183 nmdc:mga07m45_19596_c1 3300050496 Bacteria 3667
1184 nmdc:mga07m45_23940_c1 3300050496 Bacteria 3340
1185 nmdc:mga07m45_26234_c1 3300050496 Bacteria 3202
1186 nmdc:mga07m45_309423_c1 3300050496 Bacteria 918
1187 nmdc:mga07m45_3313_c3 3300050496 Bacteria 2226
1188 nmdc:mga07m45_337561_c1 3300050496 Bacteria 876
1189 nmdc:mga07m45_34063_c1 3300050496 Bacteria 2830
1190 nmdc:mga07m45_34942_c1 3300050496 Bacteria 2795
1191 nmdc:mga07m45_36656_c1 3300050496 Bacteria 2733
1192 nmdc:mga07m45_47499_c1 3300050496 Bacteria 2414
1193 nmdc:mga07m45_492_c1 3300050496 Bacteria 16696
1194 nmdc:mga07m45_50366_c1 3300050496 Bacteria 2347
1195 nmdc:mga07m45_70818_c1 3300050496 Bacteria 1984
1196 nmdc:mga07m45_780537_c1 3300050496 Bacteria 548
1197 nmdc:mga07m45_79946_c1 3300050496 Bacteria 1866
1198 nmdc:mga0qj67_1084791_c1 3300050509 Bacteria 626
1199 nmdc:mga0rr50_645322_c1 3300050513 Bacteria 903
1200 nmdc:mga0rr50_901194_c1 3300050513 Bacteria 754
1201 nmdc:mga08x19_96782_c1 3300050514 Bacteria 1954
1202 nmdc:mga0sz30_171936_c1 3300050516 Bacteria 961
1203 nmdc:mga0sz30_8289_c1 3300050516 Bacteria 3920
1204 Ga0495601_0016530 3300053077 Bacteria 4472
1205 Ga0495601_0018898 3300053077 Bacteria 4199
1206 Ga0495601_0036138 3300053077 Bacteria 3084
1207 Ga0495601_0272852 3300053077 Bacteria 1103
1208 Ga0495601_0850686 3300053077 Unclassified 578
1209 Ga0495595_0004054 3300053084 Bacteria 5863
1210 Ga0495619_0034139 3300053085 Bacteria 3306
1211 Ga0495619_0318956 3300053085 Bacteria 1076
1212 Ga0495619_0791949 3300053085 Bacteria 641
1213 Ga0500578_0106801 3300053086 Bacteria 1768
1214 Ga0500578_0222131 3300053086 Bacteria 1148
1215 Ga0500644_0003614 3300053088 Bacteria 3836
1216 Ga0500644_0172087 3300053088 Bacteria 881
1217 Ga0500647_0243651 3300053091 Bacteria 794
1218 Ga0500583_0047242 3300053092 Bacteria 1983
1219 Ga0500583_0268598 3300053092 Bacteria 839
1220 Ga0500651_0044877 3300053093 Bacteria 2782
1221 Ga0500651_0197316 3300053093 Bacteria 1189
1222 Ga0500594_0002906 3300053118 Bacteria 3738
1223 Ga0500614_150910 3300053123 Bacteria 700
1224 Ga0500614_198322 3300053123 Bacteria 618
1225 Ga0500652_151887 3300053131 Bacteria 960
1226 Ga0500559_0000085 3300053136 Bacteria 73850
1227 Ga0500564_291577 3300053138 Bacteria 630
1228 Ga0500568_0006655 3300053139 Bacteria 5779
1229 Ga0500577_0111434 3300053142 Bacteria 1130
1230 Ga0500616_0018422 3300053153 Bacteria 3948
1231 Ga0500616_0106811 3300053153 Bacteria 1359
1232 Ga0500622_0002170 3300053156 Bacteria 14539
1233 Ga0500636_0341478 3300053177 Bacteria 719
1234 Ga0500637_0205680 3300053178 Bacteria 1119
1235 Ga0500637_0332409 3300053178 Bacteria 816
1236 Ga0500645_000801 3300053730 Bacteria 18863
1237 Ga0500599_020248 3300053736 Bacteria 940
1238 Ga0500587_002295 3300053739 Bacteria 2724
1239 Ga0501084_0042256 3300054114 Bacteria 3813
1240 Ga0501084_1160370 3300054114 Bacteria 648
1241 Ga0501084_1271417 3300054114 Bacteria 617
1242 Ga0590071_002082 3300059421 Bacteria 5115
1243 Ga0587111_0219246 3300060346 Bacteria 548
1244 Ga0501082_0043376 3300060353 Bacteria 3878
1245 Ga0501082_1887648 3300060353 Bacteria 521
1246 Ga0530510_0036440 3300061734 Bacteria 3545
1247 Ga0530510_0241871 3300061734 Bacteria 1344
1248 Ga0530510_1146264 3300061734 Bacteria 596

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005353 Ga0070669_100009785 Ga0070669_1000097856 99
2 3300005364 Ga0070673_100135105 Ga0070673_1001351051 99
3 3300005365 Ga0070688_100758398 Ga0070688_1007583982 99
4 3300005455 Ga0070663_101018089 Ga0070663_1010180892 99
5 3300005548 Ga0070665_100262938 Ga0070665_1002629382 99
6 3300005564 Ga0070664_100531988 Ga0070664_1005319881 99
7 3300005843 Ga0068860_100019680 Ga0068860_1000196804 99
8 3300006177 Ga0075362_10037845 Ga0075362_100378452 99
9 3300006237 Ga0097621_100659557 Ga0097621_1006595572 99
10 3300009093 Ga0105240_11208746 Ga0105240_112087462 99
11 3300009093 Ga0105240_11947268 Ga0105240_119472681 99
12 3300009098 Ga0105245_10099488 Ga0105245_100994882 99
13 3300009148 Ga0105243_10006865 Ga0105243_100068658 99
14 3300009148 Ga0105243_11649857 Ga0105243_116498572 99
15 3300009174 Ga0105241_10135019 Ga0105241_101350192 99
16 3300009174 Ga0105241_10633629 Ga0105241_106336292 99
17 3300010375 Ga0105239_12302028 Ga0105239_123020282 99
18 3300013296 Ga0157374_11041713 Ga0157374_110417131 99
19 3300013297 Ga0157378_10081000 Ga0157378_100810003 99
20 3300013308 Ga0157375_10003720 Ga0157375_1000372013 99
21 3300014326 Ga0157380_10614634 Ga0157380_106146342 99
22 3300014745 Ga0157377_10239829 Ga0157377_102398291 99
23 3300014968 Ga0157379_10084183 Ga0157379_100841833 99
24 3300017792 Ga0163161_10046958 Ga0163161_100469584 99
25 3300025923 Ga0207681_10139744 Ga0207681_101397442 99
26 3300025931 Ga0207644_10153601 Ga0207644_101536012 99
27 3300026035 Ga0207703_11225502 Ga0207703_112255022 99
28 3300028379 Ga0268266_10204639 Ga0268266_102046392 99
29 3300028381 Ga0268264_10022308 Ga0268264_100223084 99
30 3300037068 Ga0373925_0438816 Ga0373925_0438816_469_768 99
31 3300037068 Ga0373925_0740020 Ga0373925_0740020_410_709 99
32 3300037471 Ga0395905_0005986 Ga0395905_0005986_5662_5961 99
33 3300039447 Ga0436361_0144002 Ga0436361_0144002_35833_36132 99
34 3300041511 Ga0451855_0621740 Ga0451855_0621740_118_417 99
35 3300042876 Ga0451577_0844880 Ga0451577_0844880_331_630 99
36 3300044712 Ga0453684_0043301 Ga0453684_0043301_3662_3961 99
37 3300046542 Ga0495597_0000116 Ga0495597_0000116_64080_64379 99
38 3300046683 Ga0495658_0040043 Ga0495658_0040043_1824_2123 99
39 3300047472 Ga0495686_0000992 Ga0495686_0000992_3334_3636 99
40 3300048907 Ga0496104_0621853 Ga0496104_0621853_267_566 99
41 3300049570 Ga0501033_0034547 Ga0501033_0034547_2523_2822 99
42 3300049571 Ga0501034_0223376 Ga0501034_0223376_218_517 99
43 3300049572 Ga0501036_0083136 Ga0501036_0083136_198_497 99
44 3300049573 Ga0501037_0903778 Ga0501037_0903778_47_346 99
45 3300049574 Ga0501038_0540909 Ga0501038_0540909_121_420 99
46 3300049575 Ga0501039_0344078 Ga0501039_0344078_771_1070 99
47 3300049577 Ga0501041_0001914 Ga0501041_0001914_10285_10584 99
48 3300049578 Ga0501042_0096978 Ga0501042_0096978_647_946 99
49 3300049579 Ga0501043_0534957 Ga0501043_0534957_88_387 99
50 3300049583 Ga0501067_0385467 Ga0501067_0385467_347_646 99
51 3300049584 Ga0501068_0010614 Ga0501068_0010614_710_1009 99
52 3300049588 Ga0501072_0064396 Ga0501072_0064396_513_812 99
53 3300049590 Ga0501074_0070030 Ga0501074_0070030_586_885 99
54 3300049591 Ga0501075_0144169 Ga0501075_0144169_1403_1702 99
55 3300049592 Ga0501076_0040425 Ga0501076_0040425_3245_3544 99
56 3300049592 Ga0501076_1311166 Ga0501076_1311166_60_359 99
57 3300049593 Ga0501077_0004802 Ga0501077_0004802_5808_6107 99
58 3300049741 Ga0501079_0058608 Ga0501079_0058608_1941_2240 99
59 3300049742 Ga0501080_0409118 Ga0501080_0409118_687_986 99
60 3300049743 Ga0501081_0274726 Ga0501081_0274726_887_1186 99
61 3300049743 Ga0501081_0357849 Ga0501081_0357849_565_864 99
62 3300050491 nmdc:mga00v17_411953_c1 nmdc:mga00v17_411953_c1_234_533 99
63 3300050492 nmdc:mga0yw44_1009388_c1 nmdc:mga0yw44_1009388_c1_190_489 99
64 3300050493 nmdc:mga0k408_26087_c1 nmdc:mga0k408_26087_c1_2098_2400 99
65 3300050494 nmdc:mga06z11_32152_c1 nmdc:mga06z11_32152_c1_2154_2453 99
66 3300050495 nmdc:mga04h51_289046_c1 nmdc:mga04h51_289046_c1_57_359 99
67 3300050496 nmdc:mga07m45_309423_c1 nmdc:mga07m45_309423_c1_359_658 99
68 3300050496 nmdc:mga07m45_47499_c1 nmdc:mga07m45_47499_c1_959_1261 99
69 3300050496 nmdc:mga07m45_492_c1 nmdc:mga07m45_492_c1_14594_14893 99
70 3300050509 nmdc:mga0qj67_1084791_c1 nmdc:mga0qj67_1084791_c1_22_321 99
71 3300053139 Ga0500568_0006655 Ga0500568_0006655_2653_2952 99
72 3300054114 Ga0501084_0042256 Ga0501084_0042256_2958_3257 99
73 3300060353 Ga0501082_0043376 Ga0501082_0043376_513_812 99
74 3300061734 Ga0530510_0036440 Ga0530510_0036440_2957_3256 99
75 iso_pu_bacteria 2643221654 2644305474 99
76 iso_pu_bacteria 2643221683 2644466416 99
77 iso_pu_bacteria 2881101125 2881101328 99
78 iso_pu_bacteria 2894023352 2894026431 99
79 iso_pu_bacteria 2904541872 2904543396 99
80 iso_pu_bacteria 2929160207 2929160629 99
81 iso_pu_bacteria 2939631187 2939635423 99
82 2162886007 SwRhRL2b_contig_627485 SwRhRL2b_0929.00007540 103
83 3300003320 rootH2_10234102 rootH2_102341021 103
84 3300003347 JGI26128J50194_1000784 JGI26128J50194_10007843 103
85 3300003792 Ga0055540_1005689 Ga0055540_10056893 103
86 3300003794 Ga0055531_10000158 Ga0055531_1000015854 103
87 3300005289 Ga0065704_10144971 Ga0065704_101449712 103
88 3300005290 Ga0065712_10429716 Ga0065712_104297161 103
89 3300005293 Ga0065715_10201477 Ga0065715_102014772 103
90 3300005293 Ga0065715_10284025 Ga0065715_102840251 103
91 3300005295 Ga0065707_10082401 Ga0065707_1008240113 103
92 3300005295 Ga0065707_10083629 Ga0065707_100836299 103
93 3300005327 Ga0070658_11484581 Ga0070658_114845812 103
94 3300005328 Ga0070676_10006509 Ga0070676_100065097 103
95 3300005328 Ga0070676_10020357 Ga0070676_100203572 103
96 3300005328 Ga0070676_10290984 Ga0070676_102909842 103
97 3300005328 Ga0070676_10413730 Ga0070676_104137301 103
98 3300005328 Ga0070676_10430190 Ga0070676_104301901 103
99 3300005329 Ga0070683_101531728 Ga0070683_1015317282 103
100 3300005330 Ga0070690_100006390 Ga0070690_1000063906 103
101 3300005330 Ga0070690_100404218 Ga0070690_1004042182 103
102 3300005331 Ga0070670_100014643 Ga0070670_1000146435 103
103 3300005331 Ga0070670_100050018 Ga0070670_1000500184 103
104 3300005331 Ga0070670_100052480 Ga0070670_1000524803 103
105 3300005331 Ga0070670_100111871 Ga0070670_1001118713 103
106 3300005331 Ga0070670_100203248 Ga0070670_1002032482 103
107 3300005331 Ga0070670_101158358 Ga0070670_1011583581 103
108 3300005333 Ga0070677_10083552 Ga0070677_100835522 103
109 3300005333 Ga0070677_10089150 Ga0070677_100891501 103
110 3300005333 Ga0070677_10716834 Ga0070677_107168342 103
111 3300005334 Ga0068869_100004832 Ga0068869_1000048329 103
112 3300005334 Ga0068869_100009279 Ga0068869_1000092796 103
113 3300005334 Ga0068869_100041362 Ga0068869_1000413622 103
114 3300005334 Ga0068869_100092159 Ga0068869_1000921593 103
115 3300005334 Ga0068869_100719537 Ga0068869_1007195372 103
116 3300005334 Ga0068869_100850959 Ga0068869_1008509592 103
117 3300005335 Ga0070666_10001214 Ga0070666_100012148 103
118 3300005335 Ga0070666_10398960 Ga0070666_103989601 103
119 3300005335 Ga0070666_11085131 Ga0070666_110851311 103
120 3300005335 Ga0070666_11151990 Ga0070666_111519901 103
121 3300005335 Ga0070666_11377231 Ga0070666_113772311 103
122 3300005336 Ga0070680_101058687 Ga0070680_1010586872 103
123 3300005337 Ga0070682_100397786 Ga0070682_1003977862 103
124 3300005338 Ga0068868_100000312 Ga0068868_10000031232 103
125 3300005338 Ga0068868_100014536 Ga0068868_1000145364 103
126 3300005338 Ga0068868_100187978 Ga0068868_1001879781 103
127 3300005338 Ga0068868_100194590 Ga0068868_1001945902 103
128 3300005338 Ga0068868_100204590 Ga0068868_1002045903 103
129 3300005338 Ga0068868_100277281 Ga0068868_1002772812 103
130 3300005338 Ga0068868_101341118 Ga0068868_1013411182 103
131 3300005339 Ga0070660_100019235 Ga0070660_1000192355 103
132 3300005339 Ga0070660_100436627 Ga0070660_1004366272 103
133 3300005339 Ga0070660_100716819 Ga0070660_1007168192 103
134 3300005340 Ga0070689_100016511 Ga0070689_1000165112 103
135 3300005340 Ga0070689_102026215 Ga0070689_1020262152 103
136 3300005340 Ga0070689_102039895 Ga0070689_1020398951 103
137 3300005343 Ga0070687_100047002 Ga0070687_1000470023 103
138 3300005343 Ga0070687_101004405 Ga0070687_1010044052 103
139 3300005344 Ga0070661_100015946 Ga0070661_1000159464 103
140 3300005344 Ga0070661_100764206 Ga0070661_1007642061 103
141 3300005344 Ga0070661_101481533 Ga0070661_1014815331 103
142 3300005347 Ga0070668_100481101 Ga0070668_1004811012 103
143 3300005353 Ga0070669_100152181 Ga0070669_1001521812 103
144 3300005353 Ga0070669_100401730 Ga0070669_1004017302 103
145 3300005354 Ga0070675_100001196 Ga0070675_1000011963 103
146 3300005354 Ga0070675_100015225 Ga0070675_1000152253 103
147 3300005354 Ga0070675_100023005 Ga0070675_1000230055 103
148 3300005354 Ga0070675_101591984 Ga0070675_1015919841 103
149 3300005355 Ga0070671_100009402 Ga0070671_1000094029 103
150 3300005355 Ga0070671_100010291 Ga0070671_1000102917 103
151 3300005355 Ga0070671_100037504 Ga0070671_1000375042 103
152 3300005355 Ga0070671_100063496 Ga0070671_1000634964 103
153 3300005355 Ga0070671_100263723 Ga0070671_1002637232 103
154 3300005356 Ga0070674_100020884 Ga0070674_1000208844 103
155 3300005356 Ga0070674_100063719 Ga0070674_1000637191 103
156 3300005356 Ga0070674_100234002 Ga0070674_1002340023 103
157 3300005356 Ga0070674_101019640 Ga0070674_1010196401 103
158 3300005356 Ga0070674_101341015 Ga0070674_1013410152 103
159 3300005364 Ga0070673_100001001 Ga0070673_10000100114 103
160 3300005364 Ga0070673_100005595 Ga0070673_1000055954 103
161 3300005364 Ga0070673_100055134 Ga0070673_1000551342 103
162 3300005364 Ga0070673_100210093 Ga0070673_1002100932 103
163 3300005364 Ga0070673_100308651 Ga0070673_1003086513 103
164 3300005364 Ga0070673_101293888 Ga0070673_1012938882 103
165 3300005365 Ga0070688_100817512 Ga0070688_1008175122 103
166 3300005366 Ga0070659_100445191 Ga0070659_1004451913 103
167 3300005366 Ga0070659_100868814 Ga0070659_1008688142 103
168 3300005367 Ga0070667_100008639 Ga0070667_1000086397 103
169 3300005367 Ga0070667_100035464 Ga0070667_1000354644 103
170 3300005367 Ga0070667_100118934 Ga0070667_1001189344 103
171 3300005367 Ga0070667_100141474 Ga0070667_1001414743 103
172 3300005367 Ga0070667_100195929 Ga0070667_1001959292 103
173 3300005367 Ga0070667_100221111 Ga0070667_1002211112 103
174 3300005367 Ga0070667_100252861 Ga0070667_1002528612 103
175 3300005367 Ga0070667_101010622 Ga0070667_1010106222 103
176 3300005406 Ga0070703_10550155 Ga0070703_105501552 103
177 3300005437 Ga0070710_11064678 Ga0070710_110646782 103
178 3300005438 Ga0070701_10687047 Ga0070701_106870472 103
179 3300005441 Ga0070700_100302544 Ga0070700_1003025442 103
180 3300005441 Ga0070700_100418445 Ga0070700_1004184452 103
181 3300005445 Ga0070708_100000359 Ga0070708_10000035929 103
182 3300005455 Ga0070663_100001329 Ga0070663_10000132910 103
183 3300005455 Ga0070663_100170768 Ga0070663_1001707683 103
184 3300005455 Ga0070663_100509013 Ga0070663_1005090132 103
185 3300005456 Ga0070678_100001350 Ga0070678_10000135011 103
186 3300005456 Ga0070678_100019530 Ga0070678_1000195301 103
187 3300005456 Ga0070678_100124088 Ga0070678_1001240883 103
188 3300005456 Ga0070678_100234909 Ga0070678_1002349092 103
189 3300005456 Ga0070678_100249689 Ga0070678_1002496892 103
190 3300005456 Ga0070678_100380141 Ga0070678_1003801413 103
191 3300005456 Ga0070678_100675272 Ga0070678_1006752722 103
192 3300005456 Ga0070678_101198741 Ga0070678_1011987412 103
193 3300005457 Ga0070662_100061191 Ga0070662_1000611914 103
194 3300005457 Ga0070662_100211907 Ga0070662_1002119072 103
195 3300005457 Ga0070662_100543556 Ga0070662_1005435562 103
196 3300005457 Ga0070662_101106604 Ga0070662_1011066042 103
197 3300005458 Ga0070681_10030700 Ga0070681_100307003 103
198 3300005458 Ga0070681_10194030 Ga0070681_101940303 103
199 3300005459 Ga0068867_100006369 Ga0068867_1000063694 103
200 3300005459 Ga0068867_100035602 Ga0068867_1000356024 103
201 3300005459 Ga0068867_100042192 Ga0068867_1000421921 103
202 3300005459 Ga0068867_100087456 Ga0068867_1000874562 103
203 3300005459 Ga0068867_100134339 Ga0068867_1001343393 103
204 3300005459 Ga0068867_100144313 Ga0068867_1001443133 103
205 3300005459 Ga0068867_100163249 Ga0068867_1001632491 103
206 3300005459 Ga0068867_100192902 Ga0068867_1001929023 103
207 3300005466 Ga0070685_10041723 Ga0070685_100417232 103
208 3300005466 Ga0070685_10348170 Ga0070685_103481702 103
209 3300005466 Ga0070685_10353220 Ga0070685_103532202 103
210 3300005466 Ga0070685_11394215 Ga0070685_113942151 103
211 3300005467 Ga0070706_100038628 Ga0070706_1000386281 103
212 3300005467 Ga0070706_100094756 Ga0070706_1000947564 103
213 3300005468 Ga0070707_100121495 Ga0070707_1001214951 103
214 3300005468 Ga0070707_102345970 Ga0070707_1023459702 103
215 3300005471 Ga0070698_100247243 Ga0070698_1002472433 103
216 3300005471 Ga0070698_100346944 Ga0070698_1003469442 103
217 3300005518 Ga0070699_100183198 Ga0070699_1001831982 103
218 3300005518 Ga0070699_100432562 Ga0070699_1004325622 103
219 3300005518 Ga0070699_100560060 Ga0070699_1005600602 103
220 3300005530 Ga0070679_100028003 Ga0070679_1000280036 103
221 3300005530 Ga0070679_100070126 Ga0070679_1000701262 103
222 3300005530 Ga0070679_100180884 Ga0070679_1001808842 103
223 3300005536 Ga0070697_100016402 Ga0070697_1000164026 103
224 3300005539 Ga0068853_100003043 Ga0068853_1000030432 103
225 3300005539 Ga0068853_100103028 Ga0068853_1001030283 103
226 3300005539 Ga0068853_100326263 Ga0068853_1003262632 103
227 3300005539 Ga0068853_100448241 Ga0068853_1004482411 103
228 3300005539 Ga0068853_100449348 Ga0068853_1004493482 103
229 3300005539 Ga0068853_101472901 Ga0068853_1014729011 103
230 3300005539 Ga0068853_102408234 Ga0068853_1024082342 103
231 3300005543 Ga0070672_100011526 Ga0070672_1000115267 103
232 3300005543 Ga0070672_100020972 Ga0070672_1000209722 103
233 3300005543 Ga0070672_100093042 Ga0070672_1000930424 103
234 3300005543 Ga0070672_100151153 Ga0070672_1001511531 103
235 3300005544 Ga0070686_100237573 Ga0070686_1002375733 103
236 3300005545 Ga0070695_101216149 Ga0070695_1012161491 103
237 3300005548 Ga0070665_100010823 Ga0070665_1000108236 103
238 3300005548 Ga0070665_100674723 Ga0070665_1006747232 103
239 3300005548 Ga0070665_101595576 Ga0070665_1015955762 103
240 3300005549 Ga0070704_102181534 Ga0070704_1021815341 103
241 3300005563 Ga0068855_100763025 Ga0068855_1007630251 103
242 3300005564 Ga0070664_100077686 Ga0070664_1000776861 103
243 3300005564 Ga0070664_100211134 Ga0070664_1002111342 103
244 3300005564 Ga0070664_100689385 Ga0070664_1006893852 103
245 3300005577 Ga0068857_100005109 Ga0068857_1000051092 103
246 3300005577 Ga0068857_100028848 Ga0068857_1000288483 103
247 3300005577 Ga0068857_100312974 Ga0068857_1003129743 103
248 3300005577 Ga0068857_100320407 Ga0068857_1003204071 103
249 3300005577 Ga0068857_100375393 Ga0068857_1003753932 103
250 3300005577 Ga0068857_100608718 Ga0068857_1006087181 103
251 3300005577 Ga0068857_101658579 Ga0068857_1016585791 103
252 3300005577 Ga0068857_101663630 Ga0068857_1016636302 103
253 3300005577 Ga0068857_102010875 Ga0068857_1020108751 103
254 3300005578 Ga0068854_100178843 Ga0068854_1001788432 103
255 3300005578 Ga0068854_100195310 Ga0068854_1001953102 103
256 3300005614 Ga0068856_100002604 Ga0068856_10000260411 103
257 3300005615 Ga0070702_101359607 Ga0070702_1013596072 103
258 3300005616 Ga0068852_100137407 Ga0068852_1001374072 103
259 3300005616 Ga0068852_100171248 Ga0068852_1001712484 103
260 3300005616 Ga0068852_100358482 Ga0068852_1003584822 103
261 3300005616 Ga0068852_100422081 Ga0068852_1004220812 103
262 3300005616 Ga0068852_100508890 Ga0068852_1005088902 103
263 3300005616 Ga0068852_101400936 Ga0068852_1014009362 103
264 3300005616 Ga0068852_102464367 Ga0068852_1024643671 103
265 3300005617 Ga0068859_100022763 Ga0068859_1000227634 103
266 3300005617 Ga0068859_100074871 Ga0068859_1000748714 103
267 3300005617 Ga0068859_100176798 Ga0068859_1001767983 103
268 3300005617 Ga0068859_100770445 Ga0068859_1007704452 103
269 3300005617 Ga0068859_101505113 Ga0068859_1015051132 103
270 3300005617 Ga0068859_103023221 Ga0068859_1030232211 103
271 3300005618 Ga0068864_100000335 Ga0068864_10000033510 103
272 3300005618 Ga0068864_100008404 Ga0068864_1000084047 103
273 3300005618 Ga0068864_100254048 Ga0068864_1002540481 103
274 3300005618 Ga0068864_100284544 Ga0068864_1002845441 103
275 3300005618 Ga0068864_101851902 Ga0068864_1018519022 103
276 3300005718 Ga0068866_10062011 Ga0068866_100620111 103
277 3300005718 Ga0068866_10529042 Ga0068866_105290421 103
278 3300005718 Ga0068866_10911611 Ga0068866_109116112 103
279 3300005719 Ga0068861_100006418 Ga0068861_1000064187 103
280 3300005719 Ga0068861_100356978 Ga0068861_1003569782 103
281 3300005719 Ga0068861_102431694 Ga0068861_1024316941 103
282 3300005834 Ga0068851_10414327 Ga0068851_104143272 103
283 3300005840 Ga0068870_10110312 Ga0068870_101103123 103
284 3300005840 Ga0068870_10491782 Ga0068870_104917822 103
285 3300005841 Ga0068863_100029875 Ga0068863_10002987511 103
286 3300005841 Ga0068863_101598753 Ga0068863_1015987531 103
287 3300005842 Ga0068858_100168978 Ga0068858_1001689782 103
288 3300005842 Ga0068858_100249884 Ga0068858_1002498843 103
289 3300005843 Ga0068860_100001975 Ga0068860_10000197515 103
290 3300005843 Ga0068860_100010220 Ga0068860_1000102205 103
291 3300005843 Ga0068860_100918470 Ga0068860_1009184702 103
292 3300005844 Ga0068862_100017460 Ga0068862_1000174604 103
293 3300005844 Ga0068862_100024404 Ga0068862_1000244043 103
294 3300005844 Ga0068862_100038482 Ga0068862_1000384823 103
295 3300005844 Ga0068862_100616314 Ga0068862_1006163142 103
296 3300005844 Ga0068862_101225019 Ga0068862_1012250192 103
297 3300005844 Ga0068862_101502996 Ga0068862_1015029962 103
298 3300005844 Ga0068862_101833773 Ga0068862_1018337731 103
299 3300005937 Ga0081455_10193472 Ga0081455_101934721 103
300 3300005937 Ga0081455_10510270 Ga0081455_105102702 103
301 3300006038 Ga0075365_10050103 Ga0075365_100501033 103
302 3300006038 Ga0075365_10848173 Ga0075365_108481732 103
303 3300006042 Ga0075368_10002000 Ga0075368_100020002 103
304 3300006042 Ga0075368_10019410 Ga0075368_100194103 103
305 3300006042 Ga0075368_10045969 Ga0075368_100459692 103
306 3300006042 Ga0075368_10156877 Ga0075368_101568772 103
307 3300006048 Ga0075363_100006111 Ga0075363_1000061113 103
308 3300006048 Ga0075363_100033418 Ga0075363_1000334183 103
309 3300006048 Ga0075363_100159388 Ga0075363_1001593882 103
310 3300006048 Ga0075363_100161113 Ga0075363_1001611132 103
311 3300006048 Ga0075363_100402647 Ga0075363_1004026472 103
312 3300006048 Ga0075363_100426427 Ga0075363_1004264272 103
313 3300006048 Ga0075363_100491883 Ga0075363_1004918832 103
314 3300006048 Ga0075363_100643064 Ga0075363_1006430642 103
315 3300006051 Ga0075364_10103332 Ga0075364_101033321 103
316 3300006051 Ga0075364_10117486 Ga0075364_101174862 103
317 3300006051 Ga0075364_10160790 Ga0075364_101607902 103
318 3300006051 Ga0075364_10196524 Ga0075364_101965242 103
319 3300006058 Ga0075432_10056399 Ga0075432_100563992 103
320 3300006058 Ga0075432_10374718 Ga0075432_103747182 103
321 3300006177 Ga0075362_10004294 Ga0075362_100042945 103
322 3300006177 Ga0075362_10028978 Ga0075362_100289783 103
323 3300006177 Ga0075362_10029956 Ga0075362_100299564 103
324 3300006177 Ga0075362_10062083 Ga0075362_100620832 103
325 3300006177 Ga0075362_10085501 Ga0075362_100855012 103
326 3300006177 Ga0075362_10090136 Ga0075362_100901362 103
327 3300006177 Ga0075362_10091744 Ga0075362_100917442 103
328 3300006177 Ga0075362_10245705 Ga0075362_102457052 103
329 3300006177 Ga0075362_10574662 Ga0075362_105746621 103
330 3300006178 Ga0075367_10008658 Ga0075367_100086584 103
331 3300006178 Ga0075367_10010639 Ga0075367_100106394 103
332 3300006178 Ga0075367_10091437 Ga0075367_100914372 103
333 3300006178 Ga0075367_10121315 Ga0075367_101213152 103
334 3300006178 Ga0075367_10338695 Ga0075367_103386952 103
335 3300006178 Ga0075367_10744875 Ga0075367_107448752 103
336 3300006178 Ga0075367_10770292 Ga0075367_107702922 103
337 3300006178 Ga0075367_10958923 Ga0075367_109589231 103
338 3300006186 Ga0075369_10012606 Ga0075369_100126064 103
339 3300006186 Ga0075369_10043585 Ga0075369_100435852 103
340 3300006186 Ga0075369_10069452 Ga0075369_100694523 103
341 3300006186 Ga0075369_10132473 Ga0075369_101324733 103
342 3300006186 Ga0075369_10202469 Ga0075369_102024692 103
343 3300006186 Ga0075369_10229785 Ga0075369_102297852 103
344 3300006194 Ga0075427_10021345 Ga0075427_100213452 103
345 3300006195 Ga0075366_10003945 Ga0075366_100039457 103
346 3300006195 Ga0075366_10031291 Ga0075366_100312913 103
347 3300006195 Ga0075366_10036971 Ga0075366_100369712 103
348 3300006195 Ga0075366_10038103 Ga0075366_100381034 103
349 3300006195 Ga0075366_10047038 Ga0075366_100470382 103
350 3300006195 Ga0075366_10062814 Ga0075366_100628143 103
351 3300006195 Ga0075366_10068300 Ga0075366_100683002 103
352 3300006195 Ga0075366_10190153 Ga0075366_101901532 103
353 3300006195 Ga0075366_10224751 Ga0075366_102247512 103
354 3300006195 Ga0075366_10237496 Ga0075366_102374961 103
355 3300006195 Ga0075366_10271963 Ga0075366_102719632 103
356 3300006195 Ga0075366_10401545 Ga0075366_104015452 103
357 3300006195 Ga0075366_10621857 Ga0075366_106218572 103
358 3300006195 Ga0075366_10674752 Ga0075366_106747522 103
359 3300006195 Ga0075366_11008283 Ga0075366_110082832 103
360 3300006237 Ga0097621_100003156 Ga0097621_1000031569 103
361 3300006237 Ga0097621_100408273 Ga0097621_1004082733 103
362 3300006237 Ga0097621_101163078 Ga0097621_1011630782 103
363 3300006237 Ga0097621_101512126 Ga0097621_1015121262 103
364 3300006353 Ga0075370_10000069 Ga0075370_100000699 103
365 3300006353 Ga0075370_10002857 Ga0075370_100028574 103
366 3300006353 Ga0075370_10003577 Ga0075370_100035772 103
367 3300006353 Ga0075370_10003910 Ga0075370_100039107 103
368 3300006353 Ga0075370_10007647 Ga0075370_100076474 103
369 3300006353 Ga0075370_10013361 Ga0075370_100133613 103
370 3300006353 Ga0075370_10028001 Ga0075370_100280014 103
371 3300006353 Ga0075370_10049373 Ga0075370_100493732 103
372 3300006353 Ga0075370_10061038 Ga0075370_100610384 103
373 3300006353 Ga0075370_10087718 Ga0075370_100877182 103
374 3300006353 Ga0075370_10405090 Ga0075370_104050902 103
375 3300006353 Ga0075370_10640439 Ga0075370_106404392 103
376 3300006353 Ga0075370_10698862 Ga0075370_106988622 103
377 3300006353 Ga0075370_10873815 Ga0075370_108738152 103
378 3300006353 Ga0075370_10920221 Ga0075370_109202212 103
379 3300006358 Ga0068871_100031944 Ga0068871_1000319444 103
380 3300006358 Ga0068871_100120663 Ga0068871_1001206632 103
381 3300006844 Ga0075428_100664390 Ga0075428_1006643902 103
382 3300006844 Ga0075428_101185429 Ga0075428_1011854292 103
383 3300006846 Ga0075430_100800733 Ga0075430_1008007332 103
384 3300006846 Ga0075430_100814356 Ga0075430_1008143562 103
385 3300006846 Ga0075430_101013743 Ga0075430_1010137432 103
386 3300006847 Ga0075431_100026171 Ga0075431_1000261717 103
387 3300006871 Ga0075434_100160470 Ga0075434_1001604701 103
388 3300006880 Ga0075429_100207907 Ga0075429_1002079072 103
389 3300006880 Ga0075429_101442670 Ga0075429_1014426702 103
390 3300006881 Ga0068865_100001690 Ga0068865_10000169011 103
391 3300006881 Ga0068865_100067591 Ga0068865_1000675913 103
392 3300006881 Ga0068865_100087499 Ga0068865_1000874993 103
393 3300006881 Ga0068865_100487010 Ga0068865_1004870102 103
394 3300006914 Ga0075436_100224033 Ga0075436_1002240332 103
395 3300006931 Ga0097620_100022763 Ga0097620_1000227634 103
396 3300006931 Ga0097620_100074872 Ga0097620_1000748724 103
397 3300006931 Ga0097620_100176802 Ga0097620_1001768023 103
398 3300006931 Ga0097620_100770446 Ga0097620_1007704462 103
399 3300006931 Ga0097620_101505081 Ga0097620_1015050812 103
400 3300006931 Ga0097620_103023307 Ga0097620_1030233071 103
401 3300007076 Ga0075435_100393558 Ga0075435_1003935582 103
402 3300007076 Ga0075435_101431013 Ga0075435_1014310131 103
403 3300007076 Ga0075435_101499860 Ga0075435_1014998602 103
404 3300009093 Ga0105240_10137773 Ga0105240_101377732 103
405 3300009093 Ga0105240_10202919 Ga0105240_102029191 103
406 3300009098 Ga0105245_10054814 Ga0105245_100548144 103
407 3300009098 Ga0105245_10129687 Ga0105245_101296874 103
408 3300009098 Ga0105245_10144596 Ga0105245_101445964 103
409 3300009098 Ga0105245_10156093 Ga0105245_101560932 103
410 3300009098 Ga0105245_10560966 Ga0105245_105609661 103
411 3300009098 Ga0105245_11356793 Ga0105245_113567933 103
412 3300009098 Ga0105245_11535534 Ga0105245_115355341 103
413 3300009101 Ga0105247_10262331 Ga0105247_102623311 103
414 3300009148 Ga0105243_10018982 Ga0105243_100189824 103
415 3300009148 Ga0105243_10029668 Ga0105243_100296684 103
416 3300009148 Ga0105243_10969369 Ga0105243_109693691 103
417 3300009148 Ga0105243_11119629 Ga0105243_111196292 103
418 3300009148 Ga0105243_11273798 Ga0105243_112737982 103
419 3300009148 Ga0105243_11777174 Ga0105243_117771742 103
420 3300009174 Ga0105241_10389013 Ga0105241_103890133 103
421 3300009174 Ga0105241_10420449 Ga0105241_104204492 103
422 3300009174 Ga0105241_11010795 Ga0105241_110107952 103
423 3300009176 Ga0105242_10002941 Ga0105242_100029419 103
424 3300009176 Ga0105242_10375600 Ga0105242_103756002 103
425 3300009176 Ga0105242_10454749 Ga0105242_104547492 103
426 3300009176 Ga0105242_10777703 Ga0105242_107777032 103
427 3300009176 Ga0105242_12629649 Ga0105242_126296492 103
428 3300009177 Ga0105248_10006504 Ga0105248_100065049 103
429 3300009177 Ga0105248_10701648 Ga0105248_107016482 103
430 3300009177 Ga0105248_13404229 Ga0105248_134042291 103
431 3300009545 Ga0105237_10022143 Ga0105237_100221436 103
432 3300009545 Ga0105237_10022563 Ga0105237_100225633 103
433 3300009545 Ga0105237_10044937 Ga0105237_100449374 103
434 3300009545 Ga0105237_12600564 Ga0105237_126005641 103
435 3300009551 Ga0105238_10381104 Ga0105238_103811042 103
436 3300009551 Ga0105238_12428565 Ga0105238_124285652 103
437 3300009551 Ga0105238_12684331 Ga0105238_126843311 103
438 3300009553 Ga0105249_10172034 Ga0105249_101720343 103
439 3300009553 Ga0105249_10304390 Ga0105249_103043902 103
440 3300009553 Ga0105249_10470445 Ga0105249_104704452 103
441 3300009553 Ga0105249_10975419 Ga0105249_109754192 103
442 3300010375 Ga0105239_10034022 Ga0105239_100340222 103
443 3300010375 Ga0105239_11575658 Ga0105239_115756581 103
444 3300011119 Ga0105246_10172817 Ga0105246_101728172 103
445 3300011119 Ga0105246_11127274 Ga0105246_111272742 103
446 3300013100 Ga0157373_10308491 Ga0157373_103084912 103
447 3300013100 Ga0157373_10697372 Ga0157373_106973721 103
448 3300013104 Ga0157370_10071975 Ga0157370_100719754 103
449 3300013104 Ga0157370_11367194 Ga0157370_113671942 103
450 3300013296 Ga0157374_10009908 Ga0157374_100099088 103
451 3300013296 Ga0157374_10277170 Ga0157374_102771702 103
452 3300013296 Ga0157374_10455283 Ga0157374_104552832 103
453 3300013296 Ga0157374_10754036 Ga0157374_107540361 103
454 3300013296 Ga0157374_11102222 Ga0157374_111022221 103
455 3300013297 Ga0157378_10008788 Ga0157378_100087885 103
456 3300013297 Ga0157378_10012969 Ga0157378_100129693 103
457 3300013297 Ga0157378_10146246 Ga0157378_101462462 103
458 3300013297 Ga0157378_10728291 Ga0157378_107282912 103
459 3300013297 Ga0157378_11161679 Ga0157378_111616792 103
460 3300013297 Ga0157378_11710601 Ga0157378_117106012 103
461 3300013297 Ga0157378_11949936 Ga0157378_119499362 103
462 3300013306 Ga0163162_10000168 Ga0163162_1000016859 103
463 3300013306 Ga0163162_10034511 Ga0163162_100345117 103
464 3300013306 Ga0163162_10059547 Ga0163162_100595472 103
465 3300013306 Ga0163162_10315677 Ga0163162_103156773 103
466 3300013306 Ga0163162_12189907 Ga0163162_121899072 103
467 3300013307 Ga0157372_10105643 Ga0157372_101056433 103
468 3300013307 Ga0157372_10160841 Ga0157372_101608413 103
469 3300013307 Ga0157372_10331593 Ga0157372_103315932 103
470 3300013308 Ga0157375_10001422 Ga0157375_100014229 103
471 3300013308 Ga0157375_10041871 Ga0157375_100418713 103
472 3300013308 Ga0157375_10135462 Ga0157375_101354623 103
473 3300013308 Ga0157375_10795507 Ga0157375_107955072 103
474 3300013308 Ga0157375_11531755 Ga0157375_115317552 103
475 3300014325 Ga0163163_10000817 Ga0163163_1000081729 103
476 3300014325 Ga0163163_10860999 Ga0163163_108609992 103
477 3300014326 Ga0157380_10007819 Ga0157380_100078198 103
478 3300014326 Ga0157380_10024651 Ga0157380_100246513 103
479 3300014326 Ga0157380_10109031 Ga0157380_101090313 103
480 3300014326 Ga0157380_11286245 Ga0157380_112862452 103
481 3300014326 Ga0157380_12103911 Ga0157380_121039112 103
482 3300014497 Ga0182008_10112794 Ga0182008_101127942 103
483 3300014745 Ga0157377_10490301 Ga0157377_104903012 103
484 3300014968 Ga0157379_10009570 Ga0157379_100095707 103
485 3300014968 Ga0157379_10026294 Ga0157379_100262945 103
486 3300014968 Ga0157379_10077463 Ga0157379_100774633 103
487 3300014968 Ga0157379_10279827 Ga0157379_102798272 103
488 3300014968 Ga0157379_10637925 Ga0157379_106379252 103
489 3300014968 Ga0157379_10794188 Ga0157379_107941882 103
490 3300014969 Ga0157376_10003750 Ga0157376_100037509 103
491 3300014969 Ga0157376_10040924 Ga0157376_100409242 103
492 3300014969 Ga0157376_11043831 Ga0157376_110438312 103
493 3300014969 Ga0157376_11142175 Ga0157376_111421752 103
494 3300014969 Ga0157376_11362583 Ga0157376_113625832 103
495 3300017792 Ga0163161_10091021 Ga0163161_100910212 103
496 3300017792 Ga0163161_10184705 Ga0163161_101847052 103
497 3300017792 Ga0163161_10226753 Ga0163161_102267533 103
498 3300021361 Ga0213872_10000009 Ga0213872_1000000920 103
499 3300021361 Ga0213872_10001063 Ga0213872_1000106310 103
500 3300021361 Ga0213872_10004239 Ga0213872_100042393 103
501 3300025302 Ga0207426_1158563 Ga0207426_11585631 103
502 3300025303 Ga0209051_1000315 Ga0209051_100031540 103
503 3300025304 Ga0209257_1000309 Ga0209257_100030952 103
504 3300025304 Ga0209257_1016516 Ga0209257_10165161 103
505 3300025315 Ga0207697_10017545 Ga0207697_100175454 103
506 3300025315 Ga0207697_10327890 Ga0207697_103278901 103
507 3300025321 Ga0207656_10042605 Ga0207656_100426051 103
508 3300025893 Ga0207682_10002297 Ga0207682_100022979 103
509 3300025893 Ga0207682_10069487 Ga0207682_100694872 103
510 3300025899 Ga0207642_10379509 Ga0207642_103795092 103
511 3300025899 Ga0207642_10575550 Ga0207642_105755501 103
512 3300025899 Ga0207642_10942718 Ga0207642_109427181 103
513 3300025901 Ga0207688_10747001 Ga0207688_107470011 103
514 3300025903 Ga0207680_10003377 Ga0207680_100033777 103
515 3300025905 Ga0207685_10213795 Ga0207685_102137951 103
516 3300025905 Ga0207685_10292505 Ga0207685_102925052 103
517 3300025907 Ga0207645_10002626 Ga0207645_1000262610 103
518 3300025907 Ga0207645_10003152 Ga0207645_100031522 103
519 3300025907 Ga0207645_10013698 Ga0207645_100136985 103
520 3300025907 Ga0207645_10084315 Ga0207645_100843152 103
521 3300025907 Ga0207645_10150477 Ga0207645_101504772 103
522 3300025907 Ga0207645_10433864 Ga0207645_104338642 103
523 3300025908 Ga0207643_10023892 Ga0207643_100238923 103
524 3300025908 Ga0207643_10112150 Ga0207643_101121502 103
525 3300025909 Ga0207705_10645419 Ga0207705_106454192 103
526 3300025909 Ga0207705_11339888 Ga0207705_113398881 103
527 3300025910 Ga0207684_10085345 Ga0207684_100853454 103
528 3300025910 Ga0207684_10294104 Ga0207684_102941041 103
529 3300025911 Ga0207654_10081214 Ga0207654_100812142 103
530 3300025911 Ga0207654_10306856 Ga0207654_103068562 103
531 3300025912 Ga0207707_10002045 Ga0207707_100020455 103
532 3300025912 Ga0207707_10065229 Ga0207707_100652294 103
533 3300025912 Ga0207707_10258442 Ga0207707_102584423 103
534 3300025913 Ga0207695_10038445 Ga0207695_100384453 103
535 3300025913 Ga0207695_10103170 Ga0207695_101031704 103
536 3300025913 Ga0207695_10350675 Ga0207695_103506752 103
537 3300025914 Ga0207671_10033573 Ga0207671_100335733 103
538 3300025914 Ga0207671_10768690 Ga0207671_107686902 103
539 3300025917 Ga0207660_11391444 Ga0207660_113914441 103
540 3300025918 Ga0207662_10424604 Ga0207662_104246042 103
541 3300025919 Ga0207657_10073512 Ga0207657_100735123 103
542 3300025920 Ga0207649_10006701 Ga0207649_100067016 103
543 3300025920 Ga0207649_10451429 Ga0207649_104514292 103
544 3300025920 Ga0207649_10690849 Ga0207649_106908492 103
545 3300025920 Ga0207649_11212328 Ga0207649_112123282 103
546 3300025921 Ga0207652_10026703 Ga0207652_100267033 103
547 3300025921 Ga0207652_10401156 Ga0207652_104011563 103
548 3300025922 Ga0207646_10109381 Ga0207646_101093812 103
549 3300025922 Ga0207646_10149848 Ga0207646_101498483 103
550 3300025923 Ga0207681_10020212 Ga0207681_100202122 103
551 3300025923 Ga0207681_10526049 Ga0207681_105260492 103
552 3300025923 Ga0207681_10533567 Ga0207681_105335672 103
553 3300025924 Ga0207694_10275730 Ga0207694_102757302 103
554 3300025925 Ga0207650_10077148 Ga0207650_100771483 103
555 3300025925 Ga0207650_10100023 Ga0207650_101000232 103
556 3300025925 Ga0207650_10114624 Ga0207650_101146242 103
557 3300025925 Ga0207650_10301729 Ga0207650_103017292 103
558 3300025925 Ga0207650_10417710 Ga0207650_104177102 103
559 3300025926 Ga0207659_10002305 Ga0207659_100023056 103
560 3300025926 Ga0207659_10019172 Ga0207659_100191721 103
561 3300025926 Ga0207659_10584626 Ga0207659_105846262 103
562 3300025927 Ga0207687_10036807 Ga0207687_100368073 103
563 3300025927 Ga0207687_10059048 Ga0207687_100590482 103
564 3300025927 Ga0207687_10089260 Ga0207687_100892603 103
565 3300025927 Ga0207687_10155738 Ga0207687_101557381 103
566 3300025927 Ga0207687_10325683 Ga0207687_103256833 103
567 3300025927 Ga0207687_10385198 Ga0207687_103851982 103
568 3300025927 Ga0207687_10491069 Ga0207687_104910692 103
569 3300025931 Ga0207644_10010913 Ga0207644_100109135 103
570 3300025931 Ga0207644_10113665 Ga0207644_101136651 103
571 3300025931 Ga0207644_10157857 Ga0207644_101578573 103
572 3300025931 Ga0207644_10753708 Ga0207644_107537082 103
573 3300025931 Ga0207644_10768630 Ga0207644_107686302 103
574 3300025931 Ga0207644_11553317 Ga0207644_115533172 103
575 3300025932 Ga0207690_11321674 Ga0207690_113216742 103
576 3300025933 Ga0207706_10073296 Ga0207706_100732964 103
577 3300025933 Ga0207706_10213269 Ga0207706_102132692 103
578 3300025933 Ga0207706_10370479 Ga0207706_103704793 103
579 3300025933 Ga0207706_10467567 Ga0207706_104675672 103
580 3300025934 Ga0207686_10019349 Ga0207686_100193493 103
581 3300025934 Ga0207686_10423557 Ga0207686_104235572 103
582 3300025934 Ga0207686_10484592 Ga0207686_104845922 103
583 3300025934 Ga0207686_10896066 Ga0207686_108960662 103
584 3300025935 Ga0207709_10113842 Ga0207709_101138423 103
585 3300025935 Ga0207709_10369894 Ga0207709_103698942 103
586 3300025935 Ga0207709_11060419 Ga0207709_110604191 103
587 3300025935 Ga0207709_11112533 Ga0207709_111125332 103
588 3300025936 Ga0207670_10010441 Ga0207670_100104416 103
589 3300025937 Ga0207669_10158749 Ga0207669_101587494 103
590 3300025937 Ga0207669_10406799 Ga0207669_104067992 103
591 3300025937 Ga0207669_10523564 Ga0207669_105235642 103
592 3300025938 Ga0207704_10001176 Ga0207704_100011764 103
593 3300025938 Ga0207704_10235341 Ga0207704_102353413 103
594 3300025938 Ga0207704_10689440 Ga0207704_106894402 103
595 3300025940 Ga0207691_10007352 Ga0207691_1000735212 103
596 3300025940 Ga0207691_10020788 Ga0207691_100207887 103
597 3300025940 Ga0207691_10031449 Ga0207691_100314496 103
598 3300025940 Ga0207691_10134497 Ga0207691_101344971 103
599 3300025941 Ga0207711_10010839 Ga0207711_100108397 103
600 3300025942 Ga0207689_10002510 Ga0207689_1000251012 103
601 3300025942 Ga0207689_10015898 Ga0207689_100158987 103
602 3300025942 Ga0207689_10041503 Ga0207689_100415033 103
603 3300025942 Ga0207689_10073322 Ga0207689_100733222 103
604 3300025942 Ga0207689_10120802 Ga0207689_101208023 103
605 3300025942 Ga0207689_10438207 Ga0207689_104382072 103
606 3300025942 Ga0207689_10672400 Ga0207689_106724002 103
607 3300025945 Ga0207679_10116092 Ga0207679_101160923 103
608 3300025945 Ga0207679_10312096 Ga0207679_103120962 103
609 3300025945 Ga0207679_10526984 Ga0207679_105269841 103
610 3300025945 Ga0207679_11056570 Ga0207679_110565702 103
611 3300025949 Ga0207667_11018397 Ga0207667_110183972 103
612 3300025960 Ga0207651_10033946 Ga0207651_100339464 103
613 3300025960 Ga0207651_10257684 Ga0207651_102576842 103
614 3300025960 Ga0207651_10282632 Ga0207651_102826323 103
615 3300025960 Ga0207651_10352824 Ga0207651_103528243 103
616 3300025960 Ga0207651_10590025 Ga0207651_105900251 103
617 3300025961 Ga0207712_10046245 Ga0207712_100462454 103
618 3300025961 Ga0207712_10144716 Ga0207712_101447162 103
619 3300025961 Ga0207712_10662255 Ga0207712_106622552 103
620 3300025972 Ga0207668_10108132 Ga0207668_101081323 103
621 3300025972 Ga0207668_10137024 Ga0207668_101370243 103
622 3300025972 Ga0207668_10286686 Ga0207668_102866862 103
623 3300025972 Ga0207668_10349595 Ga0207668_103495952 103
624 3300025972 Ga0207668_10614770 Ga0207668_106147702 103
625 3300025981 Ga0207640_10114940 Ga0207640_101149403 103
626 3300025981 Ga0207640_10814935 Ga0207640_108149352 103
627 3300025986 Ga0207658_10026401 Ga0207658_100264015 103
628 3300025986 Ga0207658_10029661 Ga0207658_100296614 103
629 3300025986 Ga0207658_10112238 Ga0207658_101122381 103
630 3300025986 Ga0207658_10167862 Ga0207658_101678622 103
631 3300025986 Ga0207658_10220516 Ga0207658_102205163 103
632 3300025986 Ga0207658_10252980 Ga0207658_102529802 103
633 3300025986 Ga0207658_10871330 Ga0207658_108713301 103
634 3300026023 Ga0207677_10009363 Ga0207677_100093632 103
635 3300026023 Ga0207677_10070855 Ga0207677_100708554 103
636 3300026023 Ga0207677_10074674 Ga0207677_100746742 103
637 3300026023 Ga0207677_10208339 Ga0207677_102083392 103
638 3300026023 Ga0207677_10852459 Ga0207677_108524591 103
639 3300026035 Ga0207703_10007195 Ga0207703_100071956 103
640 3300026035 Ga0207703_10211073 Ga0207703_102110732 103
641 3300026041 Ga0207639_10022564 Ga0207639_100225643 103
642 3300026041 Ga0207639_10170551 Ga0207639_101705511 103
643 3300026041 Ga0207639_10328382 Ga0207639_103283823 103
644 3300026041 Ga0207639_11466101 Ga0207639_114661011 103
645 3300026041 Ga0207639_11571748 Ga0207639_115717481 103
646 3300026067 Ga0207678_10005182 Ga0207678_100051825 103
647 3300026067 Ga0207678_10058661 Ga0207678_100586613 103
648 3300026067 Ga0207678_10061650 Ga0207678_100616504 103
649 3300026067 Ga0207678_10384271 Ga0207678_103842711 103
650 3300026075 Ga0207708_10323990 Ga0207708_103239901 103
651 3300026075 Ga0207708_10721500 Ga0207708_107215002 103
652 3300026078 Ga0207702_10045543 Ga0207702_100455434 103
653 3300026078 Ga0207702_10246158 Ga0207702_102461582 103
654 3300026088 Ga0207641_10022203 Ga0207641_100222039 103
655 3300026088 Ga0207641_10962569 Ga0207641_109625692 103
656 3300026088 Ga0207641_11101144 Ga0207641_111011442 103
657 3300026089 Ga0207648_10011444 Ga0207648_100114447 103
658 3300026089 Ga0207648_10013452 Ga0207648_100134527 103
659 3300026089 Ga0207648_10033988 Ga0207648_100339885 103
660 3300026089 Ga0207648_10040460 Ga0207648_100404602 103
661 3300026089 Ga0207648_10042464 Ga0207648_100424644 103
662 3300026089 Ga0207648_10045067 Ga0207648_100450675 103
663 3300026089 Ga0207648_10057182 Ga0207648_100571824 103
664 3300026089 Ga0207648_10155649 Ga0207648_101556493 103
665 3300026089 Ga0207648_10328646 Ga0207648_103286462 103
666 3300026095 Ga0207676_10009527 Ga0207676_100095274 103
667 3300026095 Ga0207676_10209491 Ga0207676_102094911 103
668 3300026095 Ga0207676_10447020 Ga0207676_104470202 103
669 3300026095 Ga0207676_10486819 Ga0207676_104868191 103
670 3300026095 Ga0207676_11699929 Ga0207676_116999292 103
671 3300026116 Ga0207674_10004887 Ga0207674_1000488713 103
672 3300026116 Ga0207674_10044914 Ga0207674_100449144 103
673 3300026116 Ga0207674_10088788 Ga0207674_100887883 103
674 3300026116 Ga0207674_10097618 Ga0207674_100976183 103
675 3300026116 Ga0207674_10173302 Ga0207674_101733023 103
676 3300026116 Ga0207674_10308373 Ga0207674_103083731 103
677 3300026116 Ga0207674_10383650 Ga0207674_103836503 103
678 3300026118 Ga0207675_100003168 Ga0207675_10000316815 103
679 3300026118 Ga0207675_100345804 Ga0207675_1003458042 103
680 3300026118 Ga0207675_101333015 Ga0207675_1013330152 103
681 3300026121 Ga0207683_10010616 Ga0207683_100106168 103
682 3300026121 Ga0207683_10019634 Ga0207683_100196345 103
683 3300026121 Ga0207683_10126527 Ga0207683_101265273 103
684 3300026121 Ga0207683_10172158 Ga0207683_101721583 103
685 3300026121 Ga0207683_10260942 Ga0207683_102609422 103
686 3300026121 Ga0207683_10533116 Ga0207683_105331162 103
687 3300026142 Ga0207698_10034283 Ga0207698_100342834 103
688 3300026142 Ga0207698_10115110 Ga0207698_101151103 103
689 3300026142 Ga0207698_10982938 Ga0207698_109829382 103
690 3300026142 Ga0207698_11258856 Ga0207698_112588561 103
691 3300027471 Ga0209995_1007125 Ga0209995_10071252 103
692 3300027526 Ga0209968_1000252 Ga0209968_10002526 103
693 3300027543 Ga0209999_1048232 Ga0209999_10482322 103
694 3300027671 Ga0209588_1123609 Ga0209588_11236092 103
695 3300027695 Ga0209966_1000027 Ga0209966_100002746 103
696 3300027717 Ga0209998_10025166 Ga0209998_100251662 103
697 3300027866 Ga0209813_10007685 Ga0209813_100076852 103
698 3300027866 Ga0209813_10027904 Ga0209813_100279043 103
699 3300027866 Ga0209813_10031206 Ga0209813_100312062 103
700 3300027866 Ga0209813_10074624 Ga0209813_100746242 103
701 3300027866 Ga0209813_10127363 Ga0209813_101273631 103
702 3300027866 Ga0209813_10285985 Ga0209813_102859852 103
703 3300027876 Ga0209974_10001546 Ga0209974_100015461 103
704 3300027876 Ga0209974_10102760 Ga0209974_101027602 103
705 3300028379 Ga0268266_10087570 Ga0268266_100875702 103
706 3300028379 Ga0268266_10352863 Ga0268266_103528632 103
707 3300028379 Ga0268266_11285310 Ga0268266_112853102 103
708 3300028380 Ga0268265_10053567 Ga0268265_100535674 103
709 3300028380 Ga0268265_10108252 Ga0268265_101082522 103
710 3300028380 Ga0268265_10170495 Ga0268265_101704953 103
711 3300028380 Ga0268265_10592620 Ga0268265_105926202 103
712 3300028380 Ga0268265_11827467 Ga0268265_118274672 103
713 3300028380 Ga0268265_12395214 Ga0268265_123952142 103
714 3300028381 Ga0268264_10015734 Ga0268264_100157347 103
715 3300028381 Ga0268264_10089369 Ga0268264_100893692 103
716 3300028381 Ga0268264_10296405 Ga0268264_102964053 103
717 3300028381 Ga0268264_11473446 Ga0268264_114734462 103
718 3300028786 Ga0307517_10044859 Ga0307517_100448595 103
719 3300028786 Ga0307517_10072094 Ga0307517_100720944 103
720 3300028786 Ga0307517_10258910 Ga0307517_102589102 103
721 3300028786 Ga0307517_10291403 Ga0307517_102914032 103
722 3300028786 Ga0307517_10339947 Ga0307517_103399472 103
723 3300028786 Ga0307517_10432990 Ga0307517_104329902 103
724 3300028794 Ga0307515_10000006 Ga0307515_10000006589 103
725 3300028794 Ga0307515_10000048 Ga0307515_1000004859 103
726 3300028794 Ga0307515_10000178 Ga0307515_1000017881 103
727 3300028794 Ga0307515_10028802 Ga0307515_100288029 103
728 3300028794 Ga0307515_10108583 Ga0307515_101085834 103
729 3300028794 Ga0307515_10112860 Ga0307515_101128603 103
730 3300028794 Ga0307515_10113929 Ga0307515_101139293 103
731 3300028794 Ga0307515_10143436 Ga0307515_101434361 103
732 3300028794 Ga0307515_10210945 Ga0307515_102109452 103
733 3300028794 Ga0307515_10239825 Ga0307515_102398253 103
734 3300030521 Ga0307511_10000082 Ga0307511_1000008277 103
735 3300030522 Ga0307512_10008458 Ga0307512_100084585 103
736 3300030522 Ga0307512_10073753 Ga0307512_100737534 103
737 3300031251 Ga0265327_10047228 Ga0265327_100472283 103
738 3300031251 Ga0265327_10198720 Ga0265327_101987201 103
739 3300031344 Ga0265316_10404004 Ga0265316_104040042 103
740 3300031456 Ga0307513_10015075 Ga0307513_100150753 103
741 3300031456 Ga0307513_10016139 Ga0307513_100161392 103
742 3300031456 Ga0307513_10110085 Ga0307513_101100851 103
743 3300031456 Ga0307513_10256109 Ga0307513_102561093 103
744 3300031456 Ga0307513_10432393 Ga0307513_104323932 103
745 3300031456 Ga0307513_10897313 Ga0307513_108973131 103
746 3300031507 Ga0307509_10000135 Ga0307509_1000013562 103
747 3300031507 Ga0307509_10002023 Ga0307509_100020233 103
748 3300031507 Ga0307509_10003789 Ga0307509_1000378917 103
749 3300031507 Ga0307509_10023592 Ga0307509_100235923 103
750 3300031507 Ga0307509_10049870 Ga0307509_100498704 103
751 3300031507 Ga0307509_10063411 Ga0307509_100634112 103
752 3300031507 Ga0307509_10506372 Ga0307509_105063721 103
753 3300031548 Ga0307408_100037340 Ga0307408_1000373402 103
754 3300031548 Ga0307408_100366711 Ga0307408_1003667113 103
755 3300031548 Ga0307408_100555038 Ga0307408_1005550382 103
756 3300031548 Ga0307408_101342350 Ga0307408_1013423502 103
757 3300031548 Ga0307408_102469856 Ga0307408_1024698561 103
758 3300031616 Ga0307508_10002258 Ga0307508_100022587 103
759 3300031616 Ga0307508_10003213 Ga0307508_1000321310 103
760 3300031616 Ga0307508_10068798 Ga0307508_100687983 103
761 3300031616 Ga0307508_10364060 Ga0307508_103640602 103
762 3300031616 Ga0307508_10583914 Ga0307508_105839142 103
763 3300031649 Ga0307514_10000567 Ga0307514_1000056741 103
764 3300031649 Ga0307514_10015044 Ga0307514_100150444 103
765 3300031649 Ga0307514_10191360 Ga0307514_101913602 103
766 3300031649 Ga0307514_10322951 Ga0307514_103229512 103
767 3300031730 Ga0307516_10000068 Ga0307516_1000006833 103
768 3300031730 Ga0307516_10000677 Ga0307516_1000067738 103
769 3300031730 Ga0307516_10001526 Ga0307516_100015265 103
770 3300031730 Ga0307516_10083550 Ga0307516_100835502 103
771 3300031730 Ga0307516_10088249 Ga0307516_100882493 103
772 3300031730 Ga0307516_10139836 Ga0307516_101398362 103
773 3300031730 Ga0307516_10531078 Ga0307516_105310782 103
774 3300031730 Ga0307516_10689599 Ga0307516_106895992 103
775 3300031730 Ga0307516_10815190 Ga0307516_108151901 103
776 3300031731 Ga0307405_10006161 Ga0307405_100061613 103
777 3300031731 Ga0307405_11098881 Ga0307405_110988812 103
778 3300031731 Ga0307405_11426447 Ga0307405_114264472 103
779 3300031731 Ga0307405_11461925 Ga0307405_114619251 103
780 3300031824 Ga0307413_10005022 Ga0307413_100050222 103
781 3300031824 Ga0307413_10513633 Ga0307413_105136332 103
782 3300031824 Ga0307413_11369641 Ga0307413_113696412 103
783 3300031824 Ga0307413_11462731 Ga0307413_114627311 103
784 3300031824 Ga0307413_12088653 Ga0307413_120886531 103
785 3300031852 Ga0307410_10052989 Ga0307410_100529894 103
786 3300031852 Ga0307410_10118795 Ga0307410_101187952 103
787 3300031852 Ga0307410_10147993 Ga0307410_101479933 103
788 3300031852 Ga0307410_10208782 Ga0307410_102087824 103
789 3300031852 Ga0307410_10385702 Ga0307410_103857021 103
790 3300031852 Ga0307410_10616049 Ga0307410_106160492 103
791 3300031852 Ga0307410_11609936 Ga0307410_116099362 103
792 3300031901 Ga0307406_10248496 Ga0307406_102484962 103
793 3300031901 Ga0307406_10371802 Ga0307406_103718022 103
794 3300031901 Ga0307406_11580603 Ga0307406_115806032 103
795 3300031901 Ga0307406_11724484 Ga0307406_117244842 103
796 3300031903 Ga0307407_10144012 Ga0307407_101440123 103
797 3300031903 Ga0307407_10149037 Ga0307407_101490372 103
798 3300031903 Ga0307407_10311361 Ga0307407_103113612 103
799 3300031911 Ga0307412_10028899 Ga0307412_100288992 103
800 3300031911 Ga0307412_10141870 Ga0307412_101418703 103
801 3300031911 Ga0307412_10169770 Ga0307412_101697703 103
802 3300031911 Ga0307412_10186141 Ga0307412_101861413 103
803 3300031911 Ga0307412_10217234 Ga0307412_102172343 103
804 3300031911 Ga0307412_10225048 Ga0307412_102250482 103
805 3300031911 Ga0307412_11188707 Ga0307412_111887072 103
806 3300031911 Ga0307412_11204519 Ga0307412_112045191 103
807 3300031995 Ga0307409_100009537 Ga0307409_1000095372 103
808 3300031995 Ga0307409_100501518 Ga0307409_1005015182 103
809 3300032002 Ga0307416_100025405 Ga0307416_1000254054 103
810 3300032002 Ga0307416_100176148 Ga0307416_1001761483 103
811 3300032002 Ga0307416_100183202 Ga0307416_1001832023 103
812 3300032002 Ga0307416_100237905 Ga0307416_1002379053 103
813 3300032002 Ga0307416_101087294 Ga0307416_1010872942 103
814 3300032002 Ga0307416_101423190 Ga0307416_1014231902 103
815 3300032002 Ga0307416_101933650 Ga0307416_1019336502 103
816 3300032002 Ga0307416_102366955 Ga0307416_1023669552 103
817 3300032004 Ga0307414_10056000 Ga0307414_100560002 103
818 3300032004 Ga0307414_10208303 Ga0307414_102083032 103
819 3300032004 Ga0307414_10246193 Ga0307414_102461932 103
820 3300032004 Ga0307414_10595351 Ga0307414_105953511 103
821 3300032004 Ga0307414_10959937 Ga0307414_109599372 103
822 3300032005 Ga0307411_10006035 Ga0307411_100060356 103
823 3300032005 Ga0307411_10142318 Ga0307411_101423183 103
824 3300032005 Ga0307411_10245047 Ga0307411_102450472 103
825 3300032005 Ga0307411_11158388 Ga0307411_111583881 103
826 3300032126 Ga0307415_100006492 Ga0307415_1000064922 103
827 3300032126 Ga0307415_101337455 Ga0307415_1013374551 103
828 3300033179 Ga0307507_10048825 Ga0307507_100488254 103
829 3300033179 Ga0307507_10106197 Ga0307507_101061972 103
830 3300033180 Ga0307510_10000170 Ga0307510_1000017034 103
831 3300033180 Ga0307510_10009424 Ga0307510_100094242 103
832 3300033180 Ga0307510_10403669 Ga0307510_104036692 103
833 3300034820 Ga0373959_0078851 Ga0373959_0078851_142_453 103
834 3300034820 Ga0373959_0196003 Ga0373959_0196003_52_363 103
835 3300035083 Ga0373926_0011423 Ga0373926_0011423_1836_2150 103
836 3300035084 Ga0373928_0049414 Ga0373928_0049414_148_459 103
837 3300035085 Ga0373929_0229875 Ga0373929_0229875_180_500 103
838 3300035086 Ga0373934_0000092 Ga0373934_0000092_19110_19424 103
839 3300035086 Ga0373934_0089259 Ga0373934_0089259_349_663 103
840 3300035086 Ga0373934_0360412 Ga0373934_0360412_167_478 103
841 3300035089 Ga0373944_0224777 Ga0373944_0224777_54_368 103
842 3300035092 Ga0373952_0182677 Ga0373952_0182677_111_422 103
843 3300035111 Ga0373923_0001839 Ga0373923_0001839_3629_3943 103
844 3300035111 Ga0373923_0207404 Ga0373923_0207404_445_759 103
845 3300035112 Ga0373932_0008780 Ga0373932_0008780_1150_1461 103
846 3300035113 Ga0373936_0014253 Ga0373936_0014253_2510_2824 103
847 3300035113 Ga0373936_0019494 Ga0373936_0019494_1475_1786 103
848 3300035113 Ga0373936_0136094 Ga0373936_0136094_23_337 103
849 3300035113 Ga0373936_0342077 Ga0373936_0342077_318_635 103
850 3300035114 Ga0373939_0230382 Ga0373939_0230382_185_499 103
851 3300035116 Ga0373945_0301848 Ga0373945_0301848_287_601 103
852 3300035116 Ga0373945_0558620 Ga0373945_0558620_27_338 103
853 3300035117 Ga0373953_0007328 Ga0373953_0007328_2418_2732 103
854 3300035118 Ga0373954_0013776 Ga0373954_0013776_858_1172 103
855 3300035118 Ga0373954_0018723 Ga0373954_0018723_880_1197 103
856 3300035119 Ga0373956_0004332 Ga0373956_0004332_4369_4686 103
857 3300035119 Ga0373956_0071476 Ga0373956_0071476_723_1037 103
858 3300035120 Ga0373957_0004771 Ga0373957_0004771_3469_3786 103
859 3300035120 Ga0373957_0009012 Ga0373957_0009012_205_519 103
860 3300035121 Ga0373960_0092695 Ga0373960_0092695_182_493 103
861 3300035170 Ga0373943_0019914 Ga0373943_0019914_476_790 103
862 3300035171 Ga0373946_0015558 Ga0373946_0015558_1309_1623 103
863 3300035171 Ga0373946_0329087 Ga0373946_0329087_164_475 103
864 3300035172 Ga0373955_0002722 Ga0373955_0002722_3441_3758 103
865 3300035172 Ga0373955_0105591 Ga0373955_0105591_579_893 103
866 3300035172 Ga0373955_0152970 Ga0373955_0152970_698_1012 103
867 3300035172 Ga0373955_0464919 Ga0373955_0464919_302_613 103
868 3300035207 Ga0373942_0371596 Ga0373942_0371596_129_449 103
869 3300035410 Ga0373924_0003563 Ga0373924_0003563_3501_3815 103
870 3300035691 Ga0373931_0028054 Ga0373931_0028054_2475_2786 103
871 3300035691 Ga0373931_0509810 Ga0373931_0509810_214_525 103
872 3300035691 Ga0373931_0633107 Ga0373931_0633107_72_386 103
873 3300035691 Ga0373931_0692833 Ga0373931_0692833_118_429 103
874 3300035692 Ga0373935_0042801 Ga0373935_0042801_26_337 103
875 3300035692 Ga0373935_0050707 Ga0373935_0050707_1742_2056 103
876 3300035695 Ga0373927_0019356 Ga0373927_0019356_2060_2374 103
877 3300035695 Ga0373927_0027651 Ga0373927_0027651_3343_3654 103
878 3300035724 Ga0373933_0011004 Ga0373933_0011004_4452_4766 103
879 3300035724 Ga0373933_0024114 Ga0373933_0024114_635_952 103
880 3300035724 Ga0373933_0541618 Ga0373933_0541618_205_519 103
881 3300035725 Ga0373947_0171798 Ga0373947_0171798_676_987 103
882 3300035725 Ga0373947_0289565 Ga0373947_0289565_409_720 103
883 3300036401 Ga0373937_0003933 Ga0373937_0003933_10206_10523 103
884 3300036401 Ga0373937_0049598 Ga0373937_0049598_2599_2910 103
885 3300036401 Ga0373937_0317900 Ga0373937_0317900_876_1187 103
886 3300036401 Ga0373937_0462106 Ga0373937_0462106_687_1001 103
887 3300036401 Ga0373937_0495843 Ga0373937_0495843_302_619 103
888 3300036401 Ga0373937_0607935 Ga0373937_0607935_589_900 103
889 3300036401 Ga0373937_0655170 Ga0373937_0655170_477_791 103
890 3300036401 Ga0373937_1021581 Ga0373937_1021581_341_652 103
891 3300036401 Ga0373937_1945048 Ga0373937_1945048_131_442 103
892 3300037068 Ga0373925_0021793 Ga0373925_0021793_2750_3061 103
893 3300037068 Ga0373925_0038647 Ga0373925_0038647_1865_2176 103
894 3300037068 Ga0373925_0073187 Ga0373925_0073187_1558_1872 103
895 3300037068 Ga0373925_0102290 Ga0373925_0102290_961_1272 103
896 3300037068 Ga0373925_0475128 Ga0373925_0475128_221_532 103
897 3300037068 Ga0373925_1306608 Ga0373925_1306608_189_500 103
898 3300037068 Ga0373925_1664843 Ga0373925_1664843_45_362 103
899 3300037471 Ga0395905_0006586 Ga0395905_0006586_2803_3114 103
900 3300037853 Ga0436364_0041268 Ga0436364_0041268_683_1009 103
901 3300037853 Ga0436364_0145601 Ga0436364_0145601_1482_1793 103
902 3300039447 Ga0436361_0427460 Ga0436361_0427460_19869_20180 103
903 3300039447 Ga0436361_0677106 Ga0436361_0677106_3649_3960 103
904 3300039450 Ga0436363_0908329 Ga0436363_0908329_157_468 103
905 3300041410 Ga0439461_0011063 Ga0439461_0011063_395_706 103
906 3300041441 Ga0451787_108726 Ga0451787_108726_194_505 103
907 3300041451 Ga0451791_0258275 Ga0451791_0258275_540_851 103
908 3300041452 Ga0451793_0385879 Ga0451793_0385879_131_442 103
909 3300041456 Ga0451795_0098800 Ga0451795_0098800_180_491 103
910 3300041458 Ga0451798_0690418 Ga0451798_0690418_349_660 103
911 3300041460 Ga0451802_0097874 Ga0451802_0097874_124_435 103
912 3300041463 Ga0451804_0518901 Ga0451804_0518901_417_728 103
913 3300041486 Ga0451807_0660491 Ga0451807_0660491_140_451 103
914 3300041486 Ga0451807_1855817 Ga0451807_1855817_369_680 103
915 3300041486 Ga0451807_2535304 Ga0451807_2535304_107_418 103
916 3300041491 Ga0451833_0364967 Ga0451833_0364967_196_507 103
917 3300041496 Ga0451839_0985847 Ga0451839_0985847_140_451 103
918 3300041501 Ga0451845_0812550 Ga0451845_0812550_110_421 103
919 3300041507 Ga0451851_1327704 Ga0451851_1327704_497_808 103
920 3300041509 Ga0451843_0719174 Ga0451843_0719174_114_425 103
921 3300041509 Ga0451843_1018189 Ga0451843_1018189_109_420 103
922 3300041509 Ga0451843_1143476 Ga0451843_1143476_116_427 103
923 3300041512 Ga0451853_1855892 Ga0451853_1855892_207_518 103
924 3300041512 Ga0451853_2145180 Ga0451853_2145180_117_428 103
925 3300041512 Ga0451853_3592373 Ga0451853_3592373_526_837 103
926 3300041997 Ga0439431_0003099 Ga0439431_0003099_748_1059 103
927 3300041997 Ga0439431_0022429 Ga0439431_0022429_804_1115 103
928 3300042001 Ga0439441_040866 Ga0439441_040866_258_572 103
929 3300042002 Ga0439442_083723 Ga0439442_083723_163_474 103
930 3300042004 Ga0439445_0069538 Ga0439445_0069538_632_943 103
931 3300042004 Ga0439445_0095564 Ga0439445_0095564_196_507 103
932 3300042007 Ga0439449_0176244 Ga0439449_0176244_361_672 103
933 3300042007 Ga0439449_0375104 Ga0439449_0375104_213_524 103
934 3300042115 Ga0450911_000064 Ga0450911_000064_41081_41392 103
935 3300042120 Ga0450917_012394 Ga0450917_012394_353_667 103
936 3300042126 Ga0450888_013759 Ga0450888_013759_244_555 103
937 3300042127 Ga0450890_037612 Ga0450890_037612_96_410 103
938 3300042133 Ga0450896_062047 Ga0450896_062047_230_541 103
939 3300042134 Ga0450898_115335 Ga0450898_115335_165_476 103
940 3300042135 Ga0450899_011151 Ga0450899_011151_191_502 103
941 3300042144 Ga0450889_052289 Ga0450889_052289_143_454 103
942 3300042147 Ga0450910_077718 Ga0450910_077718_22_333 103
943 3300042156 Ga0439446_0162451 Ga0439446_0162451_40_351 103
944 3300042435 Ga0439434_0024180 Ga0439434_0024180_910_1221 103
945 3300042438 Ga0439459_0120093 Ga0439459_0120093_114_425 103
946 3300042876 Ga0451577_0000843 Ga0451577_0000843_34179_34490 103
947 3300042876 Ga0451577_0019207 Ga0451577_0019207_2255_2566 103
948 3300042876 Ga0451577_0031701 Ga0451577_0031701_2251_2562 103
949 3300042876 Ga0451577_0105948 Ga0451577_0105948_1294_1605 103
950 3300042876 Ga0451577_0128968 Ga0451577_0128968_1332_1643 103
951 3300042876 Ga0451577_0172323 Ga0451577_0172323_447_758 103
952 3300042876 Ga0451577_0261180 Ga0451577_0261180_775_1086 103
953 3300042876 Ga0451577_0305536 Ga0451577_0305536_602_913 103
954 3300042876 Ga0451577_0637692 Ga0451577_0637692_69_380 103
955 3300044673 Ga0453683_0242924 Ga0453683_0242924_101_412 103
956 3300044712 Ga0453684_0167558 Ga0453684_0167558_1256_1567 103
957 3300044712 Ga0453684_0222854 Ga0453684_0222854_806_1117 103
958 3300044712 Ga0453684_0326879 Ga0453684_0326879_1398_1709 103
959 3300044712 Ga0453684_0355134 Ga0453684_0355134_829_1140 103
960 3300044712 Ga0453684_0414754 Ga0453684_0414754_320_631 103
961 3300044712 Ga0453684_0497056 Ga0453684_0497056_848_1159 103
962 3300044712 Ga0453684_0545664 Ga0453684_0545664_718_1029 103
963 3300044712 Ga0453684_0632424 Ga0453684_0632424_714_1025 103
964 3300044712 Ga0453684_0846047 Ga0453684_0846047_157_468 103
965 3300045051 Ga0451576_0016269 Ga0451576_0016269_4335_4646 103
966 3300045051 Ga0451576_0182140 Ga0451576_0182140_38_349 103
967 3300045051 Ga0451576_0204453 Ga0451576_0204453_1221_1532 103
968 3300045051 Ga0451576_0273763 Ga0451576_0273763_232_591 103
969 3300045051 Ga0451576_0396581 Ga0451576_0396581_660_971 103
970 3300045051 Ga0451576_0657900 Ga0451576_0657900_251_562 103
971 3300046454 Ga0495592_0002300 Ga0495592_0002300_2671_2988 103
972 3300046454 Ga0495592_0018151 Ga0495592_0018151_3596_3907 103
973 3300046454 Ga0495592_0045062 Ga0495592_0045062_1551_1865 103
974 3300046454 Ga0495592_0124858 Ga0495592_0124858_675_989 103
975 3300046455 Ga0495603_0194372 Ga0495603_0194372_399_713 103
976 3300046457 Ga0495590_0140922 Ga0495590_0140922_100_411 103
977 3300046459 Ga0495629_0478951 Ga0495629_0478951_330_641 103
978 3300046460 Ga0495638_0118898 Ga0495638_0118898_139_450 103
979 3300046460 Ga0495638_0153200 Ga0495638_0153200_414_725 103
980 3300046460 Ga0495638_0378659 Ga0495638_0378659_287_598 103
981 3300046461 Ga0495641_0007404 Ga0495641_0007404_2188_2502 103
982 3300046462 Ga0495651_0001600 Ga0495651_0001600_3650_3964 103
983 3300046462 Ga0495651_0002209 Ga0495651_0002209_5379_5696 103
984 3300046463 Ga0495653_0242741 Ga0495653_0242741_477_791 103
985 3300046471 Ga0495650_0085118 Ga0495650_0085118_150_461 103
986 3300046472 Ga0495580_0017228 Ga0495580_0017228_2727_3041 103
987 3300046473 Ga0495582_0023691 Ga0495582_0023691_2537_2851 103
988 3300046475 Ga0495639_0005105 Ga0495639_0005105_3266_3580 103
989 3300046476 Ga0495662_0012408 Ga0495662_0012408_1315_1629 103
990 3300046477 Ga0495664_0035511 Ga0495664_0035511_1278_1592 103
991 3300046506 Ga0495583_0086491 Ga0495583_0086491_37_348 103
992 3300046507 Ga0495606_0146348 Ga0495606_0146348_406_717 103
993 3300046511 Ga0495608_0003952 Ga0495608_0003952_383_697 103
994 3300046511 Ga0495608_0293295 Ga0495608_0293295_580_897 103
995 3300046513 Ga0495616_0234446 Ga0495616_0234446_408_719 103
996 3300046514 Ga0495618_0033008 Ga0495618_0033008_281_595 103
997 3300046515 Ga0495620_0153980 Ga0495620_0153980_553_864 103
998 3300046516 Ga0495628_0004302 Ga0495628_0004302_661_978 103
999 3300046516 Ga0495628_0008390 Ga0495628_0008390_3762_4076 103
1000 3300046517 Ga0495630_0186935 Ga0495630_0186935_409_723 103
1001 3300046517 Ga0495630_0218555 Ga0495630_0218555_162_479 103
1002 3300046517 Ga0495630_0438598 Ga0495630_0438598_236_547 103
1003 3300046519 Ga0495632_0026107 Ga0495632_0026107_2552_2863 103
1004 3300046522 Ga0495643_0200544 Ga0495643_0200544_542_853 103
1005 3300046524 Ga0495648_0075809 Ga0495648_0075809_688_999 103
1006 3300046524 Ga0495648_0172759 Ga0495648_0172759_73_384 103
1007 3300046524 Ga0495648_0431841 Ga0495648_0431841_105_416 103
1008 3300046526 Ga0495666_0003491 Ga0495666_0003491_6680_6994 103
1009 3300046528 Ga0495642_0222995 Ga0495642_0222995_205_516 103
1010 3300046529 Ga0495652_0002967 Ga0495652_0002967_3845_4162 103
1011 3300046529 Ga0495652_0026875 Ga0495652_0026875_3272_3586 103
1012 3300046530 Ga0495654_0357509 Ga0495654_0357509_109_420 103
1013 3300046531 Ga0495665_0039307 Ga0495665_0039307_363_677 103
1014 3300046533 Ga0495640_0805887 Ga0495640_0805887_42_356 103
1015 3300046535 Ga0495586_0016380 Ga0495586_0016380_3280_3594 103
1016 3300046535 Ga0495586_0055189 Ga0495586_0055189_236_547 103
1017 3300046536 Ga0495587_0002613 Ga0495587_0002613_9774_10088 103
1018 3300046537 Ga0495598_0179321 Ga0495598_0179321_81_392 103
1019 3300046542 Ga0495597_0047545 Ga0495597_0047545_1428_1739 103
1020 3300046542 Ga0495597_0080236 Ga0495597_0080236_1015_1326 103
1021 3300046543 Ga0495645_0017400 Ga0495645_0017400_1206_1523 103
1022 3300046557 Ga0495622_0013250 Ga0495622_0013250_2202_2516 103
1023 3300046558 Ga0495633_0506825 Ga0495633_0506825_34_345 103
1024 3300046559 Ga0495667_0058327 Ga0495667_0058327_1661_1978 103
1025 3300046559 Ga0495667_0161254 Ga0495667_0161254_411_725 103
1026 3300046559 Ga0495667_0189183 Ga0495667_0189183_801_1115 103
1027 3300046616 Ga0495668_0069990 Ga0495668_0069990_1184_1495 103
1028 3300046616 Ga0495668_0443489 Ga0495668_0443489_121_432 103
1029 3300046642 Ga0495634_0060300 Ga0495634_0060300_1353_1667 103
1030 3300046660 Ga0495625_0481068 Ga0495625_0481068_160_471 103
1031 3300046660 Ga0495625_0548161 Ga0495625_0548161_308_619 103
1032 3300046660 Ga0495625_0875477 Ga0495625_0875477_138_449 103
1033 3300046663 Ga0495635_0017152 Ga0495635_0017152_2537_2851 103
1034 3300046675 Ga0495657_0017464 Ga0495657_0017464_3370_3684 103
1035 3300046675 Ga0495657_0535412 Ga0495657_0535412_274_591 103
1036 3300046678 Ga0495599_0011947 Ga0495599_0011947_4600_4917 103
1037 3300046678 Ga0495599_0015613 Ga0495599_0015613_2245_2559 103
1038 3300046678 Ga0495599_0038730 Ga0495599_0038730_2341_2655 103
1039 3300046680 Ga0495646_0018322 Ga0495646_0018322_498_809 103
1040 3300046680 Ga0495646_0132969 Ga0495646_0132969_676_990 103
1041 3300046681 Ga0495647_0014541 Ga0495647_0014541_1942_2256 103
1042 3300046681 Ga0495647_0163823 Ga0495647_0163823_328_639 103
1043 3300046683 Ga0495658_0025108 Ga0495658_0025108_2083_2394 103
1044 3300046683 Ga0495658_0026522 Ga0495658_0026522_2070_2384 103
1045 3300046683 Ga0495658_0110485 Ga0495658_0110485_953_1264 103
1046 3300046683 Ga0495658_0191753 Ga0495658_0191753_472_783 103
1047 3300046683 Ga0495658_0554276 Ga0495658_0554276_189_500 103
1048 3300046689 Ga0495613_0083494 Ga0495613_0083494_1428_1742 103
1049 3300046690 Ga0495624_0014311 Ga0495624_0014311_1898_2212 103
1050 3300046690 Ga0495624_0083647 Ga0495624_0083647_1553_1864 103
1051 3300046691 Ga0495670_0172367 Ga0495670_0172367_22_333 103
1052 3300046692 Ga0495671_0166580 Ga0495671_0166580_711_1022 103
1053 3300046692 Ga0495671_0339833 Ga0495671_0339833_27_338 103
1054 3300046694 Ga0495649_0002438 Ga0495649_0002438_12602_12913 103
1055 3300046809 Ga0495600_0019882 Ga0495600_0019882_3774_4088 103
1056 3300047315 Ga0495581_0155377 Ga0495581_0155377_992_1306 103
1057 3300047317 Ga0495604_0025969 Ga0495604_0025969_723_1037 103
1058 3300047319 Ga0495674_0427473 Ga0495674_0427473_23_337 103
1059 3300047321 Ga0495676_0255681 Ga0495676_0255681_714_1025 103
1060 3300047322 Ga0495680_0107777 Ga0495680_0107777_204_518 103
1061 3300047322 Ga0495680_0651977 Ga0495680_0651977_371_685 103
1062 3300047443 Ga0495687_000328 Ga0495687_000328_43215_43526 103
1063 3300047443 Ga0495687_003100 Ga0495687_003100_6994_7305 103
1064 3300047443 Ga0495687_196581 Ga0495687_196581_53_364 103
1065 3300047444 Ga0495675_0001531 Ga0495675_0001531_1837_2151 103
1066 3300047444 Ga0495675_0094467 Ga0495675_0094467_657_974 103
1067 3300047445 Ga0495677_0198732 Ga0495677_0198732_54_365 103
1068 3300047446 Ga0495679_049230 Ga0495679_049230_815_1126 103
1069 3300047469 Ga0495673_0277409 Ga0495673_0277409_32_343 103
1070 3300047470 Ga0495681_0330156 Ga0495681_0330156_200_511 103
1071 3300047471 Ga0495684_0005095 Ga0495684_0005095_543_857 103
1072 3300047471 Ga0495684_0304677 Ga0495684_0304677_133_447 103
1073 3300047472 Ga0495686_0167469 Ga0495686_0167469_194_505 103
1074 3300047472 Ga0495686_0421970 Ga0495686_0421970_51_362 103
1075 3300047673 Ga0495593_0680229 Ga0495593_0680229_27_338 103
1076 3300048088 Ga0495602_0438485 Ga0495602_0438485_433_744 103
1077 3300048088 Ga0495602_0441654 Ga0495602_0441654_575_886 103
1078 3300048088 Ga0495602_0943119 Ga0495602_0943119_98_415 103
1079 3300048091 Ga0495626_0246832 Ga0495626_0246832_364_675 103
1080 3300048904 Ga0496101_0130117 Ga0496101_0130117_741_1052 103
1081 3300048905 Ga0496102_1779792 Ga0496102_1779792_188_499 103
1082 3300048907 Ga0496104_0524412 Ga0496104_0524412_737_1048 103
1083 3300048909 Ga0496106_0055989 Ga0496106_0055989_524_835 103
1084 3300048911 Ga0496108_0058365 Ga0496108_0058365_828_1139 103
1085 3300048911 Ga0496108_0219302 Ga0496108_0219302_459_770 103
1086 3300048911 Ga0496108_1757685 Ga0496108_1757685_22_333 103
1087 3300048912 Ga0496109_0188793 Ga0496109_0188793_973_1284 103
1088 3300048913 Ga0496110_0273726 Ga0496110_0273726_976_1287 103
1089 3300048915 Ga0496112_0551025 Ga0496112_0551025_477_788 103
1090 3300048916 Ga0496113_0449754 Ga0496113_0449754_701_1012 103
1091 3300048916 Ga0496113_1603142 Ga0496113_1603142_153_464 103
1092 3300048917 Ga0496114_0032738 Ga0496114_0032738_3015_3326 103
1093 3300048917 Ga0496114_0420814 Ga0496114_0420814_376_687 103
1094 3300048917 Ga0496114_0706632 Ga0496114_0706632_285_596 103
1095 3300048924 Ga0496121_0034400 Ga0496121_0034400_604_915 103
1096 3300048924 Ga0496121_0432796 Ga0496121_0432796_530_841 103
1097 3300048927 Ga0496124_0048814 Ga0496124_0048814_829_1140 103
1098 3300048927 Ga0496124_0155790 Ga0496124_0155790_833_1153 103
1099 3300048928 Ga0496125_0141311 Ga0496125_0141311_810_1121 103
1100 3300048928 Ga0496125_0182268 Ga0496125_0182268_432_743 103
1101 3300048928 Ga0496125_0766763 Ga0496125_0766763_70_381 103
1102 3300049520 Ga0501297_030494 Ga0501297_030494_389_700 103
1103 3300049521 Ga0501298_020738 Ga0501298_020738_664_975 103
1104 3300049523 Ga0501300_035560 Ga0501300_035560_202_513 103
1105 3300049524 Ga0501301_001189 Ga0501301_001189_490_801 103
1106 3300049526 Ga0501303_001065 Ga0501303_001065_725_1036 103
1107 3300049568 Ga0501031_0001187 Ga0501031_0001187_8485_8796 103
1108 3300049568 Ga0501031_0118225 Ga0501031_0118225_1136_1447 103
1109 3300049572 Ga0501036_1043307 Ga0501036_1043307_164_475 103
1110 3300049575 Ga0501039_0567692 Ga0501039_0567692_67_378 103
1111 3300049578 Ga0501042_0828742 Ga0501042_0828742_165_476 103
1112 3300049579 Ga0501043_0000059 Ga0501043_0000059_85111_85422 103
1113 3300049580 Ga0501046_0000082 Ga0501046_0000082_85002_85313 103
1114 3300049581 Ga0501047_0000050 Ga0501047_0000050_16023_16334 103
1115 3300049581 Ga0501047_0018628 Ga0501047_0018628_6157_6468 103
1116 3300049582 Ga0501048_0018113 Ga0501048_0018113_2435_2746 103
1117 3300049582 Ga0501048_0836356 Ga0501048_0836356_286_597 103
1118 3300049583 Ga0501067_0155854 Ga0501067_0155854_683_994 103
1119 3300049583 Ga0501067_0213865 Ga0501067_0213865_730_1041 103
1120 3300049584 Ga0501068_0866314 Ga0501068_0866314_199_510 103
1121 3300049585 Ga0501069_0267212 Ga0501069_0267212_601_912 103
1122 3300049586 Ga0501070_0168367 Ga0501070_0168367_1469_1780 103
1123 3300049588 Ga0501072_0121924 Ga0501072_0121924_188_499 103
1124 3300049592 Ga0501076_0043317 Ga0501076_0043317_2919_3230 103
1125 3300049592 Ga0501076_1297372 Ga0501076_1297372_93_404 103
1126 3300049593 Ga0501077_0378880 Ga0501077_0378880_168_479 103
1127 3300049649 Ga0501198_084939 Ga0501198_084939_61_372 103
1128 3300049662 Ga0501222_017605 Ga0501222_017605_315_626 103
1129 3300049663 Ga0501223_028488 Ga0501223_028488_750_1061 103
1130 3300049668 Ga0501233_137999 Ga0501233_137999_38_349 103
1131 3300049670 Ga0501236_125398 Ga0501236_125398_164_475 103
1132 3300049686 Ga0501257_203693 Ga0501257_203693_146_457 103
1133 3300049704 Ga0501221_176672 Ga0501221_176672_52_363 103
1134 3300049741 Ga0501079_1107761 Ga0501079_1107761_121_432 103
1135 3300049741 Ga0501079_1283637 Ga0501079_1283637_43_354 103
1136 3300049742 Ga0501080_0003122 Ga0501080_0003122_13077_13388 103
1137 3300049743 Ga0501081_1554689 Ga0501081_1554689_19_330 103
1138 3300049744 Ga0501083_0114806 Ga0501083_0114806_1342_1653 103
1139 3300049759 Ga0501262_002075 Ga0501262_002075_394_705 103
1140 3300049760 Ga0501263_016317 Ga0501263_016317_211_522 103
1141 3300049761 Ga0501264_057141 Ga0501264_057141_66_377 103
1142 3300049762 Ga0501265_000298 Ga0501265_000298_3336_3647 103
1143 3300049772 Ga0501275_069972 Ga0501275_069972_53_364 103
1144 3300049779 Ga0501283_032095 Ga0501283_032095_350_661 103
1145 3300049822 Ga0501035_0238803 Ga0501035_0238803_292_603 103
1146 3300049822 Ga0501035_0270865 Ga0501035_0270865_10_321 103
1147 3300049823 Ga0501044_1336083 Ga0501044_1336083_83_394 103
1148 3300049824 Ga0501045_0004217 Ga0501045_0004217_9221_9532 103
1149 3300049824 Ga0501045_0387234 Ga0501045_0387234_236_547 103
1150 3300050489 nmdc:mga03683_10542_c1 nmdc:mga03683_10542_c1_1074_1385 103
1151 3300050489 nmdc:mga03683_107762_c1 nmdc:mga03683_107762_c1_99_410 103
1152 3300050489 nmdc:mga03683_19613_c1 nmdc:mga03683_19613_c1_1249_1563 103
1153 3300050489 nmdc:mga03683_210524_c1 nmdc:mga03683_210524_c1_103_465 103
1154 3300050489 nmdc:mga03683_242205_c1 nmdc:mga03683_242205_c1_166_477 103
1155 3300050489 nmdc:mga03683_3074_c1 nmdc:mga03683_3074_c1_3565_3876 103
1156 3300050489 nmdc:mga03683_338682_c1 nmdc:mga03683_338682_c1_275_586 103
1157 3300050489 nmdc:mga03683_59786_c2 nmdc:mga03683_59786_c2_20_331 103
1158 3300050489 nmdc:mga03683_6406_c1 nmdc:mga03683_6406_c1_2019_2351 103
1159 3300050489 nmdc:mga03683_654062_c1 nmdc:mga03683_654062_c1_88_399 103
1160 3300050490 nmdc:mga03n38_251470_c1 nmdc:mga03n38_251470_c1_346_678 103
1161 3300050490 nmdc:mga03n38_43245_c1 nmdc:mga03n38_43245_c1_378_692 103
1162 3300050490 nmdc:mga03n38_923878_c1 nmdc:mga03n38_923878_c1_10_321 103
1163 3300050491 nmdc:mga00v17_157864_c1 nmdc:mga00v17_157864_c1_156_467 103
1164 3300050491 nmdc:mga00v17_463011_c1 nmdc:mga00v17_463011_c1_88_420 103
1165 3300050491 nmdc:mga00v17_47503_c1 nmdc:mga00v17_47503_c1_1211_1522 103
1166 3300050491 nmdc:mga00v17_72040_c1 nmdc:mga00v17_72040_c1_1505_1816 103
1167 3300050491 nmdc:mga00v17_82732_c1 nmdc:mga00v17_82732_c1_412_726 103
1168 3300050491 nmdc:mga00v17_936622_c1 nmdc:mga00v17_936622_c1_168_479 103
1169 3300050492 nmdc:mga0yw44_124611_c1 nmdc:mga0yw44_124611_c1_259_573 103
1170 3300050492 nmdc:mga0yw44_85085_c1 nmdc:mga0yw44_85085_c1_1176_1487 103
1171 3300050493 nmdc:mga0k408_120481_c1 nmdc:mga0k408_120481_c1_822_1133 103
1172 3300050493 nmdc:mga0k408_12739_c1 nmdc:mga0k408_12739_c1_2150_2482 103
1173 3300050493 nmdc:mga0k408_135363_c1 nmdc:mga0k408_135363_c1_1015_1326 103
1174 3300050493 nmdc:mga0k408_156678_c1 nmdc:mga0k408_156678_c1_861_1172 103
1175 3300050493 nmdc:mga0k408_17491_c1 nmdc:mga0k408_17491_c1_2080_2394 103
1176 3300050493 nmdc:mga0k408_256133_c1 nmdc:mga0k408_256133_c1_450_764 103
1177 3300050493 nmdc:mga0k408_285891_c1 nmdc:mga0k408_285891_c1_279_590 103
1178 3300050493 nmdc:mga0k408_34425_c1 nmdc:mga0k408_34425_c1_1371_1682 103
1179 3300050493 nmdc:mga0k408_370086_c1 nmdc:mga0k408_370086_c1_242_553 103
1180 3300050493 nmdc:mga0k408_50096_c1 nmdc:mga0k408_50096_c1_864_1178 103
1181 3300050493 nmdc:mga0k408_551395_c1 nmdc:mga0k408_551395_c1_167_478 103
1182 3300050493 nmdc:mga0k408_590493_c1 nmdc:mga0k408_590493_c1_59_370 103
1183 3300050493 nmdc:mga0k408_72200_c1 nmdc:mga0k408_72200_c1_771_1082 103
1184 3300050493 nmdc:mga0k408_72324_c1 nmdc:mga0k408_72324_c1_1464_1796 103
1185 3300050493 nmdc:mga0k408_74617_c1 nmdc:mga0k408_74617_c1_531_842 103
1186 3300050493 nmdc:mga0k408_7990_c1 nmdc:mga0k408_7990_c1_1670_1981 103
1187 3300050493 nmdc:mga0k408_9000_c1 nmdc:mga0k408_9000_c1_2271_2582 103
1188 3300050494 nmdc:mga06z11_115523_c2 nmdc:mga06z11_115523_c2_779_1090 103
1189 3300050494 nmdc:mga06z11_131555_c1 nmdc:mga06z11_131555_c1_613_945 103
1190 3300050494 nmdc:mga06z11_24408_c1 nmdc:mga06z11_24408_c1_1737_2048 103
1191 3300050494 nmdc:mga06z11_902261_c1 nmdc:mga06z11_902261_c1_137_451 103
1192 3300050495 nmdc:mga04h51_100039_c2 nmdc:mga04h51_100039_c2_208_540 103
1193 3300050495 nmdc:mga04h51_399297_c1 nmdc:mga04h51_399297_c1_221_532 103
1194 3300050495 nmdc:mga04h51_531353_c1 nmdc:mga04h51_531353_c1_15_326 103
1195 3300050495 nmdc:mga04h51_7897_c1 nmdc:mga04h51_7897_c1_1280_1591 103
1196 3300050496 nmdc:mga07m45_139885_c1 nmdc:mga07m45_139885_c1_756_1070 103
1197 3300050496 nmdc:mga07m45_185510_c1 nmdc:mga07m45_185510_c1_420_731 103
1198 3300050496 nmdc:mga07m45_19596_c1 nmdc:mga07m45_19596_c1_1929_2240 103
1199 3300050496 nmdc:mga07m45_23940_c1 nmdc:mga07m45_23940_c1_2991_3302 103
1200 3300050496 nmdc:mga07m45_26234_c1 nmdc:mga07m45_26234_c1_1819_2130 103
1201 3300050496 nmdc:mga07m45_3313_c3 nmdc:mga07m45_3313_c3_953_1267 103
1202 3300050496 nmdc:mga07m45_337561_c1 nmdc:mga07m45_337561_c1_432_743 103
1203 3300050496 nmdc:mga07m45_34063_c1 nmdc:mga07m45_34063_c1_421_732 103
1204 3300050496 nmdc:mga07m45_34942_c1 nmdc:mga07m45_34942_c1_1527_1838 103
1205 3300050496 nmdc:mga07m45_36656_c1 nmdc:mga07m45_36656_c1_2293_2604 103
1206 3300050496 nmdc:mga07m45_492_c1 nmdc:mga07m45_492_c1_3604_3915 103
1207 3300050496 nmdc:mga07m45_50366_c1 nmdc:mga07m45_50366_c1_92_424 103
1208 3300050496 nmdc:mga07m45_70818_c1 nmdc:mga07m45_70818_c1_50_382 103
1209 3300050496 nmdc:mga07m45_780537_c1 nmdc:mga07m45_780537_c1_20_331 103
1210 3300050496 nmdc:mga07m45_79946_c1 nmdc:mga07m45_79946_c1_1497_1811 103
1211 3300050513 nmdc:mga0rr50_645322_c1 nmdc:mga0rr50_645322_c1_336_662 103
1212 3300050513 nmdc:mga0rr50_901194_c1 nmdc:mga0rr50_901194_c1_126_437 103
1213 3300050514 nmdc:mga08x19_96782_c1 nmdc:mga08x19_96782_c1_456_776 103
1214 3300050516 nmdc:mga0sz30_171936_c1 nmdc:mga0sz30_171936_c1_320_652 103
1215 3300050516 nmdc:mga0sz30_8289_c1 nmdc:mga0sz30_8289_c1_1602_1913 103
1216 3300053077 Ga0495601_0016530 Ga0495601_0016530_202_519 103
1217 3300053077 Ga0495601_0018898 Ga0495601_0018898_3868_4182 103
1218 3300053077 Ga0495601_0036138 Ga0495601_0036138_2753_3067 103
1219 3300053077 Ga0495601_0272852 Ga0495601_0272852_777_1091 103
1220 3300053077 Ga0495601_0850686 Ga0495601_0850686_22_333 103
1221 3300053084 Ga0495595_0004054 Ga0495595_0004054_3375_3689 103
1222 3300053085 Ga0495619_0034139 Ga0495619_0034139_1992_2306 103
1223 3300053085 Ga0495619_0318956 Ga0495619_0318956_208_519 103
1224 3300053085 Ga0495619_0791949 Ga0495619_0791949_194_508 103
1225 3300053086 Ga0500578_0106801 Ga0500578_0106801_668_979 103
1226 3300053086 Ga0500578_0222131 Ga0500578_0222131_724_1035 103
1227 3300053088 Ga0500644_0003614 Ga0500644_0003614_3470_3781 103
1228 3300053088 Ga0500644_0172087 Ga0500644_0172087_486_797 103
1229 3300053091 Ga0500647_0243651 Ga0500647_0243651_128_439 103
1230 3300053092 Ga0500583_0047242 Ga0500583_0047242_1440_1751 103
1231 3300053092 Ga0500583_0268598 Ga0500583_0268598_324_638 103
1232 3300053093 Ga0500651_0044877 Ga0500651_0044877_2306_2617 103
1233 3300053093 Ga0500651_0197316 Ga0500651_0197316_408_719 103
1234 3300053118 Ga0500594_0002906 Ga0500594_0002906_985_1296 103
1235 3300053123 Ga0500614_150910 Ga0500614_150910_293_604 103
1236 3300053123 Ga0500614_198322 Ga0500614_198322_87_398 103
1237 3300053131 Ga0500652_151887 Ga0500652_151887_332_643 103
1238 3300053136 Ga0500559_0000085 Ga0500559_0000085_17085_17396 103
1239 3300053138 Ga0500564_291577 Ga0500564_291577_207_518 103
1240 3300053142 Ga0500577_0111434 Ga0500577_0111434_500_811 103
1241 3300053153 Ga0500616_0018422 Ga0500616_0018422_807_1118 103
1242 3300053153 Ga0500616_0106811 Ga0500616_0106811_989_1300 103
1243 3300053156 Ga0500622_0002170 Ga0500622_0002170_7919_8230 103
1244 3300053177 Ga0500636_0341478 Ga0500636_0341478_221_532 103
1245 3300053178 Ga0500637_0205680 Ga0500637_0205680_328_642 103
1246 3300053178 Ga0500637_0332409 Ga0500637_0332409_11_325 103
1247 3300053730 Ga0500645_000801 Ga0500645_000801_14406_14717 103
1248 3300053736 Ga0500599_020248 Ga0500599_020248_34_345 103
1249 3300053739 Ga0500587_002295 Ga0500587_002295_2372_2683 103
1250 3300054114 Ga0501084_1160370 Ga0501084_1160370_198_509 103
1251 3300054114 Ga0501084_1271417 Ga0501084_1271417_174_485 103
1252 3300059421 Ga0590071_002082 Ga0590071_002082_988_1311 103
1253 3300060346 Ga0587111_0219246 Ga0587111_0219246_224_535 103
1254 3300060353 Ga0501082_1887648 Ga0501082_1887648_133_444 103
1255 3300061734 Ga0530510_0241871 Ga0530510_0241871_372_683 103
1256 3300061734 Ga0530510_1146264 Ga0530510_1146264_156_467 103

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08770

SoxZ

Sulphur oxidation protein SoxZ

22

118

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oxg-assembly4.cif.gz_E the soxyz complex of paracoccus pantotrophus 0.7596 4 103
2oxg-assembly3.cif.gz_C the soxyz complex of paracoccus pantotrophus 0.755 4 103
1mby-assembly1.cif.gz_A murine sak polo domain 0.7519 42 103
2ox5-assembly3.cif.gz_C the soxyz complex of paracoccus pantotrophus 0.747 4 103
1v8h-assembly1.cif.gz_B crystal structure of tt0351 protein from thermus thermophilus hb8 0.7379 4 102
ID Description Score Start End Superfamily
2oxgE00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7596 4 103 2.60.40.10
1mbyA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.7519 42 103 2.40.50.930
1v8hB00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7379 4 102 2.60.40.10
2oxgE00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7141 4 103 2.60.40.10
af_Q924C5_1262_1337_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7079 42 103 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A6N6ZSP4-F1-model_v4 Sulfur compound chelating protein SoxZ 0.9231 43 103
AF-A0A0S8DUM2-F1-model_v4 Thiosulfate oxidation carrier complex protein SoxZ 0.915 44 103
AF-A0A6N6ZSP4-F1-model_v4 Sulfur compound chelating protein SoxZ 0.9094 43 103
AF-A0A0S8DUM2-F1-model_v4 Thiosulfate oxidation carrier complex protein SoxZ 0.9013 44 103
AF-A0A1E4L687-F1-model_v4 Thiosulfate oxidation carrier complex protein SoxZ 0.8894 36 103

Feature Viewer

pLDDT pTM Quality
87.13 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map