F492232

General Info

Members Datasets Scaffolds Average Seq Length
1254 454 1235 266

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10317630|Ga0157380_103176301
Length 240
Sequence MTTRGRFSLVNLTALTLGLAFLYLPIAILVINSFNDSRLVTVWGGWSLRWYRALMNDEAMLEAASVSFRVAFLSATAATVLGTLAALALTRVARFRGRLLFSGMIYAPLVMPEVITGLSLLLLFVAVAIDRGFWTIVIAHTTVVQARLVTFDRSLEEAALDLGCPPLRTFLTVTLPLIWPAVASGWMLAFALSLDDLVLASFVTGPGATTLPIRIYSEVRLGVKPEINAVCTIMILGARL

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
3 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
4 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
5 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
6 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
7 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
8 2643221719 Rhizobium sp. Root274 Isolate Unclassified
9 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
10 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
11 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
12 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
13 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
14 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
15 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
16 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
17 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
18 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
19 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
20 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
21 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
22 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
23 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
24 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
25 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
26 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
27 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
28 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
29 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
30 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
31 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
32 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
33 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
34 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
35 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
36 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
38 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
39 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
40 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
41 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
42 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
43 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
44 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
45 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
46 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
47 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
48 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
49 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
50 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
51 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
52 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
53 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
54 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
55 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
56 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
57 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
58 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
59 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
60 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
61 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
62 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
63 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
64 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
65 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
66 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
67 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
68 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
69 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
70 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
71 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
72 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
73 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
74 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
75 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
76 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
77 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
78 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
79 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
80 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
81 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
82 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
83 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
84 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
85 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
86 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
87 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
88 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
89 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
90 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
91 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
92 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
93 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
94 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
95 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
96 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
97 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
98 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
99 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
100 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
101 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
102 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
103 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
104 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
105 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
106 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
107 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
108 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
109 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
110 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
111 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
112 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
113 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
114 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
115 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
116 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
117 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
118 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
119 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
120 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
121 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
122 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
123 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
124 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
125 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
126 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
127 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
128 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
129 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
130 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
131 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
132 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
133 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
134 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
135 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
136 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
137 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
138 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
139 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
140 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
141 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
142 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
143 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
144 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
145 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
146 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
147 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
148 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
149 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
150 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
151 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
152 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
153 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
154 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
155 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
156 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
157 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
158 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
159 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
160 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
161 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
162 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
163 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
164 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
165 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
166 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
167 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
168 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
169 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
170 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
171 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
172 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
173 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
174 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
175 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
176 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
248 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
249 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
251 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
255 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
256 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
257 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
258 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
259 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
260 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
261 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
262 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
263 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
264 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
265 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
266 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
267 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
268 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
269 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
270 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
271 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
272 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
273 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
274 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
275 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
276 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
277 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
278 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
279 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
280 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
281 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
282 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
283 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
284 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
285 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
286 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
287 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
288 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
289 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
290 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
291 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
292 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
293 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
294 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
295 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
296 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
297 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
298 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
299 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
300 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
301 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
302 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
303 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
304 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
305 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
306 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
307 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
308 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
309 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
310 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
311 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
312 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
313 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
314 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
315 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
316 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
317 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
318 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
319 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
320 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
321 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
322 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
323 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
324 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
325 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
326 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
327 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
328 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
329 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
330 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
331 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
332 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
333 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
334 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
335 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
336 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
337 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
338 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
339 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
340 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
341 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
342 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
343 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
344 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
345 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
346 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
347 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
348 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
349 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
350 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
351 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
352 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
353 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
354 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
355 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
356 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
357 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
358 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
359 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
360 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
361 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
362 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
363 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
364 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
365 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
366 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
367 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
368 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
369 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
370 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
371 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
372 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
373 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
374 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
375 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
376 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
377 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
378 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
379 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
380 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
381 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
382 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
383 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
384 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
385 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
386 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
387 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
388 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
389 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
390 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
391 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
392 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
393 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
394 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
395 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
396 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
397 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
398 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
399 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
400 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
401 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
402 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
403 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
404 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
405 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
406 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
407 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
408 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
409 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
410 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
411 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
412 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
413 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
414 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
415 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
416 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
417 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
418 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
419 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
420 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
421 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
422 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
423 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
424 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
425 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
426 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
427 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
428 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
429 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
430 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
431 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
432 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
433 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
434 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
435 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
436 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
437 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
438 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
439 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
440 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
441 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
442 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
443 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
444 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
445 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
446 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
447 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
448 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
449 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
450 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
451 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
452 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
453 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
454 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.41
Metatranscriptomes 0.08
Isolates 1.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.95
Nodule 0.16
Rhizoplane 8.93
Rhizosphere 85.73
Stem 0
Stem Tuber 0
Unclassified 2.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214544950 2209111006 Bacteria 6067
2 ARSoilYngRDRAFT_c00466 3300000042 Bacteria 4846
3 ARcpr5yngRDRAFT_c000049 3300000043 Bacteria 18697
4 ARSoilOldRDRAFT_c000098 3300000044 Bacteria 16580
5 ARCol0oldRDRAFT_c02080 3300000045 Bacteria 994
6 ARCol0yngRDRAFT_1000072 3300000652 Bacteria 18771
7 JGI24746J21847_1000258 3300001977 Bacteria 7462
8 JGI24747J21853_1000085 3300001978 Bacteria 4032
9 JGI24739J22299_10001196 3300001989 Bacteria 9713
10 JGI24737J22298_10029747 3300001990 Bacteria 1712
11 JGI24750J21931_1000008 3300002070 Bacteria 23752
12 JGI24745J21846_1002238 3300002073 Bacteria 1958
13 JGI24748J21848_1000236 3300002074 Bacteria 6659
14 JGI24738J21930_10006575 3300002075 Bacteria 2716
15 JGI24749J21850_1000740 3300002076 Bacteria 4714
16 JGI24744J21845_10001834 3300002077 Bacteria 4267
17 JGI24035J26624_1000177 3300002126 Bacteria 5948
18 JGI24034J26672_10006134 3300002239 Bacteria 1731
19 JGI25405J52794_10007826 3300003911 Bacteria 1981
20 Ga0065165_1003754 3300005262 Bacteria 10207
21 Ga0065714_10173446 3300005288 Bacteria 980
22 Ga0065712_10068786 3300005290 Bacteria 9030
23 Ga0065715_10093830 3300005293 Bacteria 4533
24 Ga0065715_10141948 3300005293 Bacteria 1836
25 Ga0070658_10013155 3300005327 Bacteria 6638
26 Ga0070658_10020050 3300005327 Bacteria 5356
27 Ga0070658_10039467 3300005327 Bacteria 3809
28 Ga0070658_10459182 3300005327 Bacteria 1098
29 Ga0070676_10000092 3300005328 Bacteria 31160
30 Ga0070676_10050881 3300005328 Bacteria 2430
31 Ga0070683_100000314 3300005329 Bacteria 33370
32 Ga0070683_100131827 3300005329 Bacteria 2366
33 Ga0070683_100200212 3300005329 Bacteria 1896
34 Ga0070690_100001103 3300005330 Bacteria 13884
35 Ga0070690_100107758 3300005330 Bacteria 1855
36 Ga0070690_100203901 3300005330 Bacteria 1377
37 Ga0070670_100007568 3300005331 Bacteria 9218
38 Ga0070670_100008919 3300005331 Bacteria 8563
39 Ga0070670_100101237 3300005331 Bacteria 2481
40 Ga0070670_100310896 3300005331 Bacteria 1379
41 Ga0070677_10003218 3300005333 Bacteria 5253
42 Ga0068869_100103056 3300005334 Bacteria 2161
43 Ga0068869_100454969 3300005334 Bacteria 1062
44 Ga0070666_10015039 3300005335 Bacteria 4932
45 Ga0070680_100000515 3300005336 Bacteria 26512
46 Ga0070680_100023201 3300005336 Bacteria 4947
47 Ga0070680_100035627 3300005336 Bacteria 4018
48 Ga0070680_100120872 3300005336 Bacteria 2186
49 Ga0070682_100000230 3300005337 Bacteria 40502
50 Ga0070682_100099062 3300005337 Bacteria 1921
51 Ga0070682_100143625 3300005337 Bacteria 1630
52 Ga0068868_100002107 3300005338 Bacteria 13708
53 Ga0068868_100043507 3300005338 Bacteria 3508
54 Ga0068868_100049608 3300005338 Bacteria 3295
55 Ga0070660_100000175 3300005339 Bacteria 42249
56 Ga0070660_100018546 3300005339 Bacteria 5086
57 Ga0070660_100019108 3300005339 Bacteria 5016
58 Ga0070660_100041752 3300005339 Bacteria 3497
59 Ga0070660_100204423 3300005339 Bacteria 1603
60 Ga0070689_100000145 3300005340 Bacteria 40970
61 Ga0070689_100003166 3300005340 Bacteria 10885
62 Ga0070689_100018210 3300005340 Bacteria 5170
63 Ga0070689_100080944 3300005340 Bacteria 2549
64 Ga0070691_10000107 3300005341 Bacteria 24697
65 Ga0070691_10013630 3300005341 Bacteria 3725
66 Ga0070691_10075822 3300005341 Bacteria 1639
67 Ga0070687_100001052 3300005343 Bacteria 9437
68 Ga0070687_100003332 3300005343 Bacteria 6219
69 Ga0070687_100017014 3300005343 Bacteria 3334
70 Ga0070687_100030216 3300005343 Bacteria 2647
71 Ga0070687_100119675 3300005343 Bacteria 1504
72 Ga0070661_100000808 3300005344 Bacteria 22497
73 Ga0070661_100063216 3300005344 Bacteria 2718
74 Ga0070661_100138531 3300005344 Bacteria 1832
75 Ga0070661_100311389 3300005344 Bacteria 1228
76 Ga0070692_10009324 3300005345 Bacteria 4423
77 Ga0070692_10045229 3300005345 Bacteria 2269
78 Ga0070668_100001569 3300005347 Bacteria 16509
79 Ga0070668_100167382 3300005347 Bacteria 1787
80 Ga0070669_100000343 3300005353 Bacteria 36254
81 Ga0070669_100024890 3300005353 Bacteria 4296
82 Ga0070675_100000210 3300005354 Bacteria 37423
83 Ga0070675_100017095 3300005354 Bacteria 5764
84 Ga0070675_100159380 3300005354 Bacteria 1939
85 Ga0070671_100000396 3300005355 Bacteria 29967
86 Ga0070671_100017777 3300005355 Bacteria 5765
87 Ga0070671_100056913 3300005355 Bacteria 3253
88 Ga0070674_100164621 3300005356 Bacteria 1685
89 Ga0070673_100000130 3300005364 Bacteria 35440
90 Ga0070673_100028586 3300005364 Bacteria 4148
91 Ga0070673_100048528 3300005364 Bacteria 3310
92 Ga0070673_100529387 3300005364 Bacteria 1069
93 Ga0070688_100003254 3300005365 Bacteria 8321
94 Ga0070688_100006796 3300005365 Bacteria 6136
95 Ga0070688_100022612 3300005365 Bacteria 3688
96 Ga0070688_100345005 3300005365 Bacteria 1088
97 Ga0070659_100000629 3300005366 Bacteria 25796
98 Ga0070659_100093279 3300005366 Bacteria 2416
99 Ga0070659_100129126 3300005366 Bacteria 2051
100 Ga0070659_100166411 3300005366 Bacteria 1804
101 Ga0070659_100468469 3300005366 Bacteria 1071
102 Ga0070667_100002803 3300005367 Bacteria 15042
103 Ga0070667_100057429 3300005367 Bacteria 3289
104 Ga0070667_100147596 3300005367 Bacteria 2063
105 Ga0070667_100340924 3300005367 Bacteria 1355
106 Ga0070703_10005788 3300005406 Bacteria 3465
107 Ga0070709_10005456 3300005434 Bacteria 6888
108 Ga0070709_10099842 3300005434 Bacteria 1931
109 Ga0070709_10215261 3300005434 Bacteria 1367
110 Ga0070714_100112929 3300005435 Bacteria 2408
111 Ga0070714_100648040 3300005435 Bacteria 1017
112 Ga0070714_100648601 3300005435 Bacteria 1016
113 Ga0070713_100001523 3300005436 Bacteria 14775
114 Ga0070713_100004000 3300005436 Bacteria 9812
115 Ga0070713_100024266 3300005436 Bacteria 4721
116 Ga0070713_100027849 3300005436 Bacteria 4455
117 Ga0070713_100088503 3300005436 Bacteria 2658
118 Ga0070713_100206667 3300005436 Bacteria 1776
119 Ga0070710_10040802 3300005437 Bacteria 2559
120 Ga0070710_10124247 3300005437 Bacteria 1566
121 Ga0070710_10145745 3300005437 Bacteria 1456
122 Ga0070701_10000012 3300005438 Bacteria 46531
123 Ga0070701_10132282 3300005438 Bacteria 1418
124 Ga0070711_100035728 3300005439 Bacteria 3325
125 Ga0070711_100044247 3300005439 Bacteria 3021
126 Ga0070711_100060019 3300005439 Bacteria 2643
127 Ga0070711_100075213 3300005439 Bacteria 2391
128 Ga0070711_100077576 3300005439 Bacteria 2358
129 Ga0070711_100129090 3300005439 Bacteria 1880
130 Ga0070711_100406951 3300005439 Bacteria 1106
131 Ga0070705_100000341 3300005440 Bacteria 27488
132 Ga0070705_100213178 3300005440 Bacteria 1332
133 Ga0070705_100213571 3300005440 Bacteria 1331
134 Ga0070700_100001073 3300005441 Bacteria 13564
135 Ga0070700_100001658 3300005441 Bacteria 11149
136 Ga0070700_100010159 3300005441 Bacteria 5187
137 Ga0070694_100003223 3300005444 Bacteria 9742
138 Ga0070694_100025320 3300005444 Bacteria 3838
139 Ga0070663_100000097 3300005455 Bacteria 39662
140 Ga0070663_100026755 3300005455 Bacteria 3910
141 Ga0070663_100030754 3300005455 Bacteria 3684
142 Ga0070678_100000315 3300005456 Bacteria 22573
143 Ga0070678_100014741 3300005456 Bacteria 4943
144 Ga0070678_100395320 3300005456 Bacteria 1199
145 Ga0070662_100000336 3300005457 Bacteria 28144
146 Ga0070662_100022179 3300005457 Bacteria 4342
147 Ga0070662_100263407 3300005457 Bacteria 1389
148 Ga0070681_10005380 3300005458 Bacteria 12363
149 Ga0070681_10008239 3300005458 Bacteria 10198
150 Ga0070681_10111438 3300005458 Bacteria 2675
151 Ga0070681_10213609 3300005458 Bacteria 1845
152 Ga0070681_10214148 3300005458 Bacteria 1843
153 Ga0070681_10349940 3300005458 Bacteria 1388
154 Ga0068867_100000731 3300005459 Bacteria 22005
155 Ga0068867_100348852 3300005459 Bacteria 1234
156 Ga0070685_10009628 3300005466 Bacteria 5000
157 Ga0070707_100009211 3300005468 Bacteria 9162
158 Ga0070699_100003057 3300005518 Bacteria 14839
159 Ga0070699_100292960 3300005518 Bacteria 1459
160 Ga0070679_100013447 3300005530 Bacteria 7837
161 Ga0070679_100041270 3300005530 Bacteria 4592
162 Ga0070679_100080514 3300005530 Bacteria 3246
163 Ga0070679_100095294 3300005530 Bacteria 2964
164 Ga0070679_100623633 3300005530 Bacteria 1021
165 Ga0070684_100000157 3300005535 Bacteria 46152
166 Ga0070684_100045060 3300005535 Bacteria 3818
167 Ga0070684_100184479 3300005535 Bacteria 1897
168 Ga0070684_100191403 3300005535 Bacteria 1861
169 Ga0070684_100276642 3300005535 Bacteria 1537
170 Ga0070697_100148569 3300005536 Bacteria 1974
171 Ga0068853_100000843 3300005539 Bacteria 21412
172 Ga0068853_100148947 3300005539 Bacteria 2105
173 Ga0070672_100007233 3300005543 Bacteria 7520
174 Ga0070672_100012387 3300005543 Bacteria 5985
175 Ga0070686_100000127 3300005544 Bacteria 53295
176 Ga0070686_100004524 3300005544 Bacteria 7668
177 Ga0070695_100000496 3300005545 Bacteria 20629
178 Ga0070695_100262472 3300005545 Bacteria 1262
179 Ga0070696_100000219 3300005546 Bacteria 34543
180 Ga0070696_100034495 3300005546 Bacteria 3481
181 Ga0070696_100184382 3300005546 Bacteria 1550
182 Ga0070693_100000414 3300005547 Bacteria 19333
183 Ga0070693_100013772 3300005547 Bacteria 4126
184 Ga0070665_100016548 3300005548 Bacteria 7394
185 Ga0070665_100026572 3300005548 Bacteria 5829
186 Ga0070665_100048481 3300005548 Bacteria 4264
187 Ga0070665_100241968 3300005548 Bacteria 1805
188 Ga0070704_100001560 3300005549 Bacteria 12358
189 Ga0070704_100072507 3300005549 Bacteria 2505
190 Ga0068855_100032556 3300005563 Bacteria 6224
191 Ga0068855_100132818 3300005563 Bacteria 2842
192 Ga0068855_100277219 3300005563 Bacteria 1863
193 Ga0068855_100434933 3300005563 Bacteria 1434
194 Ga0070664_100000326 3300005564 Bacteria 34609
195 Ga0070664_100082783 3300005564 Bacteria 2768
196 Ga0070664_100224221 3300005564 Bacteria 1682
197 Ga0068857_100000063 3300005577 Bacteria 60089
198 Ga0068857_100147581 3300005577 Bacteria 2129
199 Ga0068854_100000220 3300005578 Bacteria 38637
200 Ga0068854_100428976 3300005578 Bacteria 1100
201 Ga0068856_100000815 3300005614 Bacteria 33600
202 Ga0068856_100140229 3300005614 Bacteria 2424
203 Ga0070702_100000350 3300005615 Bacteria 16109
204 Ga0070702_100003968 3300005615 Bacteria 6711
205 Ga0068852_100001377 3300005616 Bacteria 16326
206 Ga0068852_100038834 3300005616 Bacteria 4004
207 Ga0068852_100170832 3300005616 Bacteria 2038
208 Ga0068852_100382741 3300005616 Bacteria 1380
209 Ga0068852_100462036 3300005616 Bacteria 1258
210 Ga0068852_100609751 3300005616 Bacteria 1096
211 Ga0068859_100037236 3300005617 Bacteria 4883
212 Ga0068859_100051427 3300005617 Bacteria 4141
213 Ga0068859_100154924 3300005617 Bacteria 2368
214 Ga0068859_100157297 3300005617 Bacteria 2350
215 Ga0068859_100174553 3300005617 Bacteria 2231
216 Ga0068859_100361366 3300005617 Bacteria 1547
217 Ga0068864_100000380 3300005618 Bacteria 38785
218 Ga0068864_100007988 3300005618 Bacteria 8724
219 Ga0068864_100286937 3300005618 Bacteria 1538
220 Ga0068866_10000193 3300005718 Bacteria 28522
221 Ga0068866_10084220 3300005718 Bacteria 1715
222 Ga0068861_100000101 3300005719 Bacteria 42384
223 Ga0068851_10071417 3300005834 Bacteria 1796
224 Ga0068851_10262417 3300005834 Bacteria 983
225 Ga0068870_10000028 3300005840 Bacteria 45368
226 Ga0068870_10000463 3300005840 Bacteria 15423
227 Ga0068863_100000386 3300005841 Bacteria 44817
228 Ga0068863_100055166 3300005841 Bacteria 3763
229 Ga0068863_100636989 3300005841 Bacteria 1057
230 Ga0068858_100038594 3300005842 Bacteria 4431
231 Ga0068858_100050186 3300005842 Bacteria 3862
232 Ga0068858_100095834 3300005842 Bacteria 2765
233 Ga0068858_100448796 3300005842 Bacteria 1243
234 Ga0068860_100038130 3300005843 Bacteria 4598
235 Ga0068860_100063913 3300005843 Bacteria 3495
236 Ga0068860_100345539 3300005843 Bacteria 1463
237 Ga0068862_100000950 3300005844 Bacteria 27906
238 Ga0068862_100008130 3300005844 Bacteria 8675
239 Ga0081455_10000695 3300005937 Bacteria 43608
240 Ga0081455_10003621 3300005937 Bacteria 17706
241 Ga0081455_10086707 3300005937 Bacteria 2550
242 Ga0081540_1097927 3300005983 Bacteria 1271
243 Ga0070717_10000396 3300006028 Bacteria 27915
244 Ga0070717_10383486 3300006028 Bacteria 1260
245 Ga0075365_10000608 3300006038 Bacteria 14084
246 Ga0075365_10002013 3300006038 Bacteria 9639
247 Ga0075365_10006190 3300006038 Bacteria 6559
248 Ga0075368_10034121 3300006042 Bacteria 1982
249 Ga0075368_10045594 3300006042 Bacteria 1732
250 Ga0070715_10004318 3300006163 Bacteria 4643
251 Ga0070715_10011020 3300006163 Bacteria 3241
252 Ga0070715_10023073 3300006163 Bacteria 2434
253 Ga0070715_10174929 3300006163 Bacteria 1072
254 Ga0070716_100008465 3300006173 Bacteria 5103
255 Ga0070712_100000600 3300006175 Bacteria 21109
256 Ga0070712_100082678 3300006175 Bacteria 2330
257 Ga0070712_100088588 3300006175 Bacteria 2262
258 Ga0075367_10000931 3300006178 Bacteria 11866
259 Ga0075367_10015469 3300006178 Bacteria 4149
260 Ga0075427_10029777 3300006194 Bacteria 893
261 Ga0097621_100000268 3300006237 Bacteria 35289
262 Ga0097621_100053732 3300006237 Bacteria 3283
263 Ga0075370_10030448 3300006353 Bacteria 3011
264 Ga0075370_10183531 3300006353 Bacteria 1232
265 Ga0068871_100000298 3300006358 Bacteria 34572
266 Ga0068871_100080645 3300006358 Bacteria 2694
267 Ga0075428_100010816 3300006844 Bacteria 10143
268 Ga0075428_100164087 3300006844 Bacteria 2410
269 Ga0075430_100002695 3300006846 Bacteria 14826
270 Ga0075430_100010689 3300006846 Bacteria 7778
271 Ga0075431_100006613 3300006847 Bacteria 11520
272 Ga0075431_100013819 3300006847 Bacteria 8153
273 Ga0075431_100826221 3300006847 Bacteria 899
274 Ga0075433_10006195 3300006852 Bacteria 9435
275 Ga0075433_10030679 3300006852 Bacteria 4588
276 Ga0075433_10043077 3300006852 Bacteria 3918
277 Ga0075434_100027307 3300006871 Bacteria 5603
278 Ga0075434_100040249 3300006871 Bacteria 4629
279 Ga0075434_100065948 3300006871 Bacteria 3606
280 Ga0075434_100120511 3300006871 Bacteria 2638
281 Ga0075434_100254532 3300006871 Bacteria 1775
282 Ga0075429_100018597 3300006880 Bacteria 6018
283 Ga0075429_100034156 3300006880 Bacteria 4418
284 Ga0068865_100000125 3300006881 Bacteria 39482
285 Ga0068865_100203088 3300006881 Bacteria 1540
286 Ga0075436_100123566 3300006914 Bacteria 1813
287 Ga0075436_100472708 3300006914 Bacteria 915
288 Ga0097620_100037233 3300006931 Bacteria 4883
289 Ga0097620_100051424 3300006931 Bacteria 4141
290 Ga0097620_100154916 3300006931 Bacteria 2368
291 Ga0097620_100157294 3300006931 Bacteria 2350
292 Ga0097620_100174546 3300006931 Bacteria 2231
293 Ga0097620_100361412 3300006931 Bacteria 1547
294 Ga0075435_100049484 3300007076 Bacteria 3380
295 Ga0075435_100062344 3300007076 Bacteria 3026
296 Ga0075435_100584482 3300007076 Bacteria 968
297 Ga0099794_10000521 3300007265 Bacteria 12874
298 Ga0099795_10005655 3300007788 Bacteria 3347
299 Ga0099795_10022421 3300007788 Bacteria 2084
300 Ga0105251_10052152 3300009011 Bacteria 1948
301 Ga0105251_10060876 3300009011 Bacteria 1776
302 Ga0105250_10044875 3300009092 Bacteria 1772
303 Ga0105250_10106047 3300009092 Bacteria 1149
304 Ga0111539_10000548 3300009094 Bacteria 47926
305 Ga0111539_10000954 3300009094 Bacteria 37915
306 Ga0111539_10001271 3300009094 Bacteria 33681
307 Ga0111539_10037752 3300009094 Bacteria 5831
308 Ga0111539_10048215 3300009094 Bacteria 5087
309 Ga0111539_10208978 3300009094 Bacteria 2274
310 Ga0105245_10000173 3300009098 Bacteria 61528
311 Ga0105245_10006042 3300009098 Bacteria 10647
312 Ga0105245_10010115 3300009098 Bacteria 8215
313 Ga0105245_10060380 3300009098 Bacteria 3414
314 Ga0105245_10565729 3300009098 Bacteria 1160
315 Ga0105247_10003197 3300009101 Bacteria 10793
316 Ga0105247_10024754 3300009101 Bacteria 3619
317 Ga0114129_10003643 3300009147 Bacteria 21672
318 Ga0114129_10006300 3300009147 Bacteria 16824
319 Ga0114129_10012821 3300009147 Bacteria 11929
320 Ga0114129_10165396 3300009147 Bacteria 3019
321 Ga0114129_10572031 3300009147 Bacteria 1467
322 Ga0105243_10000377 3300009148 Bacteria 47825
323 Ga0105243_10017816 3300009148 Bacteria 5374
324 Ga0105243_10056240 3300009148 Bacteria 3128
325 Ga0105243_10082939 3300009148 Bacteria 2621
326 Ga0105243_10118098 3300009148 Bacteria 2231
327 Ga0105243_10140394 3300009148 Bacteria 2060
328 Ga0105241_10003995 3300009174 Bacteria 10903
329 Ga0105241_10062924 3300009174 Bacteria 2861
330 Ga0105241_10130267 3300009174 Bacteria 2036
331 Ga0105242_10000419 3300009176 Bacteria 33812
332 Ga0105242_10044589 3300009176 Bacteria 3592
333 Ga0105242_10054201 3300009176 Bacteria 3277
334 Ga0105242_10102030 3300009176 Bacteria 2432
335 Ga0105242_10140060 3300009176 Bacteria 2098
336 Ga0105248_10000643 3300009177 Bacteria 39655
337 Ga0105248_10044136 3300009177 Bacteria 5000
338 Ga0105248_10068597 3300009177 Bacteria 3981
339 Ga0105248_10337537 3300009177 Bacteria 1697
340 Ga0105237_10011622 3300009545 Bacteria 9318
341 Ga0105237_10032413 3300009545 Bacteria 5291
342 Ga0105237_10228040 3300009545 Bacteria 1863
343 Ga0105237_10239725 3300009545 Bacteria 1815
344 Ga0105238_10026829 3300009551 Bacteria 5872
345 Ga0105238_10041417 3300009551 Bacteria 4664
346 Ga0105238_10067253 3300009551 Bacteria 3585
347 Ga0105238_10076969 3300009551 Bacteria 3328
348 Ga0105238_10085300 3300009551 Bacteria 3146
349 Ga0105238_10556288 3300009551 Bacteria 1152
350 Ga0105249_10003200 3300009553 Bacteria 14176
351 Ga0105249_10037064 3300009553 Bacteria 4425
352 Ga0105249_10610394 3300009553 Bacteria 1146
353 Ga0105249_10628843 3300009553 Bacteria 1130
354 Ga0099796_10038869 3300010159 Bacteria 1599
355 Ga0105239_10248612 3300010375 Bacteria 1997
356 Ga0105239_10475101 3300010375 Bacteria 1420
357 Ga0105239_10495638 3300010375 Bacteria 1389
358 Ga0105246_10002148 3300011119 Bacteria 11887
359 Ga0105246_10192305 3300011119 Bacteria 1580
360 Ga0105246_10329946 3300011119 Bacteria 1243
361 Ga0157320_1000682 3300012481 Bacteria 1480
362 Ga0157345_1002916 3300012498 Bacteria 1228
363 Ga0157338_1000069 3300012515 Bacteria 4445
364 Ga0157373_10029938 3300013100 Bacteria 3919
365 Ga0157373_10077885 3300013100 Bacteria 2339
366 Ga0157373_10175604 3300013100 Bacteria 1508
367 Ga0157371_10037695 3300013102 Bacteria 3459
368 Ga0157369_10108963 3300013105 Bacteria 2945
369 Ga0157369_10146548 3300013105 Bacteria 2496
370 Ga0157369_10423456 3300013105 Bacteria 1380
371 Ga0157374_10004172 3300013296 Bacteria 12134
372 Ga0157374_10015034 3300013296 Bacteria 6785
373 Ga0157374_10046157 3300013296 Bacteria 4034
374 Ga0157378_10000993 3300013297 Bacteria 25998
375 Ga0157378_10032077 3300013297 Bacteria 4641
376 Ga0157378_10074855 3300013297 Bacteria 3047
377 Ga0157378_10130755 3300013297 Bacteria 2323
378 Ga0157378_10188256 3300013297 Bacteria 1945
379 Ga0157378_10232184 3300013297 Bacteria 1758
380 Ga0163162_10001671 3300013306 Bacteria 20815
381 Ga0163162_10138593 3300013306 Bacteria 2544
382 Ga0163162_10155852 3300013306 Bacteria 2404
383 Ga0157372_10052105 3300013307 Bacteria 4556
384 Ga0157372_10172693 3300013307 Bacteria 2501
385 Ga0157375_10000283 3300013308 Bacteria 46225
386 Ga0157375_10017237 3300013308 Bacteria 6512
387 Ga0157375_10320450 3300013308 Bacteria 1715
388 Ga0163163_10000757 3300014325 Bacteria 27476
389 Ga0163163_10016749 3300014325 Bacteria 6819
390 Ga0163163_10022059 3300014325 Bacteria 6022
391 Ga0163163_10040155 3300014325 Bacteria 4568
392 Ga0157380_10000095 3300014326 Bacteria 48588
393 Ga0157380_10026333 3300014326 Bacteria 4416
394 Ga0157380_10108259 3300014326 Bacteria 2329
395 Ga0157380_10317630 3300014326 Bacteria 1443
396 Ga0157377_10000295 3300014745 Bacteria 23523
397 Ga0157377_10002726 3300014745 Bacteria 7857
398 Ga0157379_10004769 3300014968 Bacteria 11651
399 Ga0157379_10009736 3300014968 Bacteria 8373
400 Ga0157379_10180199 3300014968 Bacteria 1909
401 Ga0157379_10207550 3300014968 Bacteria 1773
402 Ga0157379_10267708 3300014968 Bacteria 1553
403 Ga0157379_10437083 3300014968 Bacteria 1206
404 Ga0157376_10000634 3300014969 Bacteria 22779
405 Ga0157376_10045894 3300014969 Bacteria 3600
406 Ga0157376_10144570 3300014969 Bacteria 2138
407 Ga0157376_10602366 3300014969 Bacteria 1094
408 Ga0163161_10000542 3300017792 Bacteria 30658
409 Ga0163161_10027218 3300017792 Bacteria 4056
410 Ga0206353_11965552 3300020082 Bacteria 4204
411 Ga0213872_10014346 3300021361 Bacteria 3697
412 Ga0213876_10012177 3300021384 Bacteria 4581
413 Ga0224572_1014624 3300024225 Bacteria 1500
414 Ga0228598_1001606 3300024227 Bacteria 4944
415 Ga0207666_1000045 3300025271 Bacteria 24475
416 Ga0207666_1006280 3300025271 Bacteria 1536
417 Ga0207697_10000551 3300025315 Bacteria 21235
418 Ga0207653_10002740 3300025885 Bacteria 5602
419 Ga0207682_10005256 3300025893 Bacteria 5294
420 Ga0207682_10043715 3300025893 Bacteria 1834
421 Ga0207692_10008266 3300025898 Bacteria 4304
422 Ga0207692_10009761 3300025898 Bacteria 4020
423 Ga0207692_10119990 3300025898 Bacteria 1471
424 Ga0207642_10000259 3300025899 Bacteria 15837
425 Ga0207710_10003740 3300025900 Bacteria 6736
426 Ga0207710_10005879 3300025900 Bacteria 5263
427 Ga0207688_10000039 3300025901 Bacteria 44849
428 Ga0207688_10002001 3300025901 Bacteria 10935
429 Ga0207688_10112678 3300025901 Bacteria 1580
430 Ga0207680_10013194 3300025903 Bacteria 4236
431 Ga0207647_10016425 3300025904 Bacteria 5053
432 Ga0207647_10026190 3300025904 Bacteria 3818
433 Ga0207685_10003505 3300025905 Bacteria 3827
434 Ga0207685_10005689 3300025905 Bacteria 3319
435 Ga0207685_10016945 3300025905 Bacteria 2343
436 Ga0207699_10186566 3300025906 Bacteria 1397
437 Ga0207645_10000080 3300025907 Bacteria 68968
438 Ga0207643_10000135 3300025908 Bacteria 49853
439 Ga0207643_10001337 3300025908 Bacteria 14257
440 Ga0207705_10084589 3300025909 Bacteria 2316
441 Ga0207705_10141766 3300025909 Bacteria 1795
442 Ga0207705_10435285 3300025909 Bacteria 1016
443 Ga0207684_10018056 3300025910 Bacteria 6046
444 Ga0207654_10042196 3300025911 Bacteria 2580
445 Ga0207654_10054733 3300025911 Bacteria 2307
446 Ga0207654_10126318 3300025911 Bacteria 1613
447 Ga0207654_10155953 3300025911 Bacteria 1470
448 Ga0207707_10002095 3300025912 Bacteria 18045
449 Ga0207707_10004353 3300025912 Bacteria 12528
450 Ga0207707_10049919 3300025912 Bacteria 3645
451 Ga0207707_10087772 3300025912 Bacteria 2717
452 Ga0207707_10189089 3300025912 Bacteria 1796
453 Ga0207671_10028827 3300025914 Bacteria 4147
454 Ga0207671_10144440 3300025914 Bacteria 1835
455 Ga0207693_10003570 3300025915 Bacteria 13292
456 Ga0207693_10006700 3300025915 Bacteria 9510
457 Ga0207693_10006778 3300025915 Bacteria 9458
458 Ga0207693_10007806 3300025915 Bacteria 8783
459 Ga0207693_10178729 3300025915 Bacteria 1670
460 Ga0207663_10018450 3300025916 Bacteria 3910
461 Ga0207663_10021173 3300025916 Bacteria 3698
462 Ga0207663_10033349 3300025916 Bacteria 3067
463 Ga0207663_10051331 3300025916 Bacteria 2567
464 Ga0207663_10065805 3300025916 Bacteria 2318
465 Ga0207660_10002445 3300025917 Bacteria 12199
466 Ga0207660_10042093 3300025917 Bacteria 3204
467 Ga0207660_10093076 3300025917 Bacteria 2238
468 Ga0207660_10097784 3300025917 Bacteria 2188
469 Ga0207662_10000336 3300025918 Bacteria 21233
470 Ga0207662_10001601 3300025918 Bacteria 11088
471 Ga0207662_10026989 3300025918 Bacteria 3315
472 Ga0207662_10206364 3300025918 Bacteria 1274
473 Ga0207657_10002336 3300025919 Bacteria 20569
474 Ga0207657_10007357 3300025919 Bacteria 11295
475 Ga0207657_10017992 3300025919 Bacteria 6762
476 Ga0207657_10084548 3300025919 Bacteria 2659
477 Ga0207657_10127407 3300025919 Bacteria 2090
478 Ga0207657_10131101 3300025919 Bacteria 2054
479 Ga0207649_10000571 3300025920 Bacteria 25261
480 Ga0207649_10074201 3300025920 Bacteria 2182
481 Ga0207652_10001096 3300025921 Bacteria 24512
482 Ga0207652_10024326 3300025921 Bacteria 5024
483 Ga0207652_10028056 3300025921 Bacteria 4694
484 Ga0207652_10036717 3300025921 Bacteria 4143
485 Ga0207652_10070802 3300025921 Bacteria 3029
486 Ga0207652_10131671 3300025921 Bacteria 2231
487 Ga0207652_10411903 3300025921 Bacteria 1219
488 Ga0207681_10001995 3300025923 Bacteria 13117
489 Ga0207681_10038114 3300025923 Bacteria 3182
490 Ga0207694_10306960 3300025924 Bacteria 1307
491 Ga0207650_10002486 3300025925 Bacteria 12815
492 Ga0207650_10002540 3300025925 Bacteria 12659
493 Ga0207650_10209043 3300025925 Bacteria 1567
494 Ga0207659_10000127 3300025926 Bacteria 44761
495 Ga0207659_10009920 3300025926 Bacteria 5959
496 Ga0207687_10000334 3300025927 Bacteria 31485
497 Ga0207687_10007796 3300025927 Bacteria 7023
498 Ga0207687_10137937 3300025927 Bacteria 1847
499 Ga0207700_10000379 3300025928 Bacteria 25793
500 Ga0207700_10025593 3300025928 Bacteria 4100
501 Ga0207700_10179641 3300025928 Bacteria 1771
502 Ga0207700_10338193 3300025928 Bacteria 1308
503 Ga0207700_10437444 3300025928 Bacteria 1151
504 Ga0207664_10005567 3300025929 Bacteria 8627
505 Ga0207664_10095660 3300025929 Bacteria 2444
506 Ga0207644_10002918 3300025931 Bacteria 11013
507 Ga0207644_10017238 3300025931 Bacteria 4873
508 Ga0207644_10076800 3300025931 Bacteria 2458
509 Ga0207644_10084280 3300025931 Bacteria 2356
510 Ga0207690_10000571 3300025932 Bacteria 24086
511 Ga0207690_10272513 3300025932 Bacteria 1315
512 Ga0207690_10429338 3300025932 Bacteria 1058
513 Ga0207706_10001765 3300025933 Bacteria 21233
514 Ga0207706_10006968 3300025933 Bacteria 10448
515 Ga0207706_10009390 3300025933 Bacteria 8978
516 Ga0207706_10018247 3300025933 Bacteria 6314
517 Ga0207706_10101056 3300025933 Bacteria 2537
518 Ga0207706_10392640 3300025933 Bacteria 1203
519 Ga0207686_10000297 3300025934 Bacteria 36292
520 Ga0207686_10044357 3300025934 Bacteria 2729
521 Ga0207686_10060158 3300025934 Bacteria 2403
522 Ga0207686_10106106 3300025934 Bacteria 1885
523 Ga0207709_10000257 3300025935 Bacteria 63623
524 Ga0207709_10004698 3300025935 Bacteria 7855
525 Ga0207709_10029892 3300025935 Bacteria 3165
526 Ga0207709_10079847 3300025935 Bacteria 2105
527 Ga0207670_10000371 3300025936 Bacteria 25929
528 Ga0207670_10003900 3300025936 Bacteria 7959
529 Ga0207670_10036616 3300025936 Bacteria 3192
530 Ga0207670_10065705 3300025936 Bacteria 2490
531 Ga0207669_10000089 3300025937 Bacteria 46184
532 Ga0207669_10002276 3300025937 Bacteria 8167
533 Ga0207669_10095076 3300025937 Bacteria 1952
534 Ga0207704_10002403 3300025938 Bacteria 8415
535 Ga0207704_10147497 3300025938 Bacteria 1655
536 Ga0207704_10210183 3300025938 Bacteria 1431
537 Ga0207665_10000286 3300025939 Bacteria 35188
538 Ga0207665_10042095 3300025939 Bacteria 3053
539 Ga0207665_10102604 3300025939 Bacteria 1999
540 Ga0207691_10000439 3300025940 Bacteria 41424
541 Ga0207691_10001737 3300025940 Bacteria 21481
542 Ga0207691_10432927 3300025940 Bacteria 1120
543 Ga0207711_10007990 3300025941 Bacteria 8851
544 Ga0207711_10010452 3300025941 Bacteria 7705
545 Ga0207711_10022455 3300025941 Bacteria 5276
546 Ga0207711_10378042 3300025941 Bacteria 1314
547 Ga0207689_10000095 3300025942 Bacteria 71568
548 Ga0207689_10001936 3300025942 Bacteria 19598
549 Ga0207689_10141671 3300025942 Bacteria 1980
550 Ga0207661_10001967 3300025944 Bacteria 14147
551 Ga0207661_10060251 3300025944 Bacteria 3062
552 Ga0207661_10250420 3300025944 Bacteria 1574
553 Ga0207679_10000073 3300025945 Bacteria 89687
554 Ga0207679_10078649 3300025945 Bacteria 2513
555 Ga0207679_10318680 3300025945 Bacteria 1345
556 Ga0207667_10019155 3300025949 Bacteria 7653
557 Ga0207667_10037097 3300025949 Bacteria 5214
558 Ga0207667_10140860 3300025949 Bacteria 2483
559 Ga0207667_10554410 3300025949 Bacteria 1162
560 Ga0207651_10002317 3300025960 Bacteria 9071
561 Ga0207651_10034042 3300025960 Bacteria 3294
562 Ga0207651_10207301 3300025960 Bacteria 1575
563 Ga0207651_10224298 3300025960 Bacteria 1521
564 Ga0207712_10000457 3300025961 Bacteria 34730
565 Ga0207712_10015429 3300025961 Bacteria 4930
566 Ga0207712_10022855 3300025961 Bacteria 4122
567 Ga0207712_10231107 3300025961 Bacteria 1485
568 Ga0207668_10000900 3300025972 Bacteria 17944
569 Ga0207668_10007427 3300025972 Bacteria 6516
570 Ga0207668_10233938 3300025972 Bacteria 1483
571 Ga0207640_10078245 3300025981 Bacteria 2250
572 Ga0207658_10003961 3300025986 Bacteria 10399
573 Ga0207658_10185640 3300025986 Bacteria 1724
574 Ga0207658_10427324 3300025986 Bacteria 1169
575 Ga0207658_10537504 3300025986 Bacteria 1045
576 Ga0207677_10009295 3300026023 Bacteria 5526
577 Ga0207677_10034616 3300026023 Bacteria 3272
578 Ga0207677_10099552 3300026023 Bacteria 2135
579 Ga0207677_10205908 3300026023 Bacteria 1567
580 Ga0207703_10002103 3300026035 Bacteria 17526
581 Ga0207703_10050527 3300026035 Bacteria 3366
582 Ga0207703_10074613 3300026035 Bacteria 2809
583 Ga0207703_10239104 3300026035 Bacteria 1632
584 Ga0207639_10021948 3300026041 Bacteria 4592
585 Ga0207639_10093322 3300026041 Bacteria 2413
586 Ga0207639_10447774 3300026041 Bacteria 1172
587 Ga0207678_10000426 3300026067 Bacteria 38181
588 Ga0207678_10038173 3300026067 Bacteria 4174
589 Ga0207678_10096997 3300026067 Bacteria 2519
590 Ga0207678_10181207 3300026067 Bacteria 1799
591 Ga0207708_10000624 3300026075 Bacteria 27228
592 Ga0207708_10000991 3300026075 Bacteria 21233
593 Ga0207708_10081663 3300026075 Bacteria 2485
594 Ga0207702_10051329 3300026078 Bacteria 3485
595 Ga0207702_10054124 3300026078 Bacteria 3400
596 Ga0207702_10579059 3300026078 Bacteria 1100
597 Ga0207702_10827603 3300026078 Bacteria 916
598 Ga0207641_10001067 3300026088 Bacteria 27627
599 Ga0207641_10134558 3300026088 Bacteria 2223
600 Ga0207641_10237851 3300026088 Bacteria 1695
601 Ga0207641_10525547 3300026088 Bacteria 1151
602 Ga0207648_10000207 3300026089 Bacteria 62972
603 Ga0207648_10001430 3300026089 Bacteria 26279
604 Ga0207648_10712812 3300026089 Bacteria 930
605 Ga0207676_10000875 3300026095 Bacteria 23361
606 Ga0207676_10006351 3300026095 Bacteria 8349
607 Ga0207676_10061987 3300026095 Bacteria 2964
608 Ga0207674_10001021 3300026116 Bacteria 36545
609 Ga0207674_10144849 3300026116 Bacteria 2334
610 Ga0207675_100001849 3300026118 Bacteria 21247
611 Ga0207675_100031722 3300026118 Bacteria 4923
612 Ga0207675_100074493 3300026118 Bacteria 3177
613 Ga0207683_10000096 3300026121 Bacteria 71829
614 Ga0207683_10006569 3300026121 Bacteria 9957
615 Ga0207683_10016637 3300026121 Bacteria 6258
616 Ga0207683_10154405 3300026121 Bacteria 2073
617 Ga0207698_10000956 3300026142 Bacteria 16770
618 Ga0207698_10106294 3300026142 Bacteria 2340
619 Ga0207698_10311069 3300026142 Bacteria 1471
620 Ga0209984_1005880 3300027424 Bacteria 1489
621 Ga0209179_1000585 3300027512 Bacteria 3830
622 Ga0210002_1000525 3300027617 Bacteria 5168
623 Ga0209971_1024519 3300027682 Bacteria 1441
624 Ga0209966_1021922 3300027695 Bacteria 1246
625 Ga0209998_10000428 3300027717 Bacteria 11824
626 Ga0209998_10006934 3300027717 Bacteria 2349
627 Ga0209813_10024258 3300027866 Bacteria 1733
628 Ga0209974_10009241 3300027876 Bacteria 3347
629 Ga0207428_10000160 3300027907 Bacteria 92379
630 Ga0207428_10000200 3300027907 Bacteria 83533
631 Ga0207428_10000370 3300027907 Bacteria 57548
632 Ga0268266_10019348 3300028379 Bacteria 5798
633 Ga0268266_10028097 3300028379 Bacteria 4783
634 Ga0268266_10251480 3300028379 Bacteria 1635
635 Ga0268265_10001781 3300028380 Bacteria 17271
636 Ga0268264_10038041 3300028381 Bacteria 3970
637 Ga0268264_10053121 3300028381 Bacteria 3380
638 Ga0268264_10118074 3300028381 Bacteria 2334
639 Ga0268264_10123485 3300028381 Bacteria 2285
640 Ga0268264_10378008 3300028381 Bacteria 1356
641 Ga0265330_10051258 3300031235 Bacteria 1809
642 Ga0265325_10000004 3300031241 Bacteria 347347
643 Ga0265339_10016485 3300031249 Bacteria 4402
644 Ga0265339_10122867 3300031249 Bacteria 1333
645 Ga0307513_10299406 3300031456 Bacteria 1376
646 Ga0265313_10033885 3300031595 Bacteria 2589
647 Ga0265314_10048426 3300031711 Bacteria 2983
648 Ga0265342_10001643 3300031712 Bacteria 20603
649 Ga0307416_100231431 3300032002 Bacteria 1782
650 Ga0373930_0001208 3300034816 Bacteria 3801
651 Ga0373948_0000334 3300034817 Bacteria 5758
652 Ga0373950_0013126 3300034818 Bacteria 1377
653 Ga0373958_0000505 3300034819 Bacteria 4839
654 Ga0373938_0000033 3300034957 Bacteria 17806
655 Ga0373938_0002272 3300034957 Bacteria 3086
656 Ga0373926_0002095 3300035083 Bacteria 6285
657 Ga0373926_0035679 3300035083 Bacteria 1765
658 Ga0373928_0000751 3300035084 Bacteria 6339
659 Ga0373928_0002785 3300035084 Bacteria 3373
660 Ga0373934_0002254 3300035086 Bacteria 7086
661 Ga0373934_0020726 3300035086 Bacteria 2528
662 Ga0373940_0002344 3300035088 Bacteria 3662
663 Ga0373944_0000846 3300035089 Bacteria 7513
664 Ga0373949_0002920 3300035090 Bacteria 4213
665 Ga0373951_0000151 3300035091 Bacteria 25256
666 Ga0373951_0001138 3300035091 Bacteria 7054
667 Ga0373951_0011387 3300035091 Bacteria 1996
668 Ga0373952_0002453 3300035092 Bacteria 3345
669 Ga0373952_0006520 3300035092 Bacteria 2159
670 Ga0373923_0000300 3300035111 Bacteria 10987
671 Ga0373923_0000490 3300035111 Bacteria 9506
672 Ga0373923_0012636 3300035111 Bacteria 3127
673 Ga0373932_0003086 3300035112 Bacteria 4060
674 Ga0373932_0003580 3300035112 Bacteria 3717
675 Ga0373932_0005273 3300035112 Bacteria 3040
676 Ga0373936_0002617 3300035113 Bacteria 6737
677 Ga0373936_0009185 3300035113 Bacteria 3726
678 Ga0373936_0070849 3300035113 Bacteria 1437
679 Ga0373939_0001391 3300035114 Bacteria 5857
680 Ga0373939_0009034 3300035114 Bacteria 2460
681 Ga0373939_0102342 3300035114 Bacteria 985
682 Ga0373945_0000782 3300035116 Bacteria 9304
683 Ga0373945_0009702 3300035116 Bacteria 3158
684 Ga0373953_0000111 3300035117 Bacteria 19729
685 Ga0373953_0001285 3300035117 Bacteria 7193
686 Ga0373953_0003588 3300035117 Bacteria 4853
687 Ga0373954_0000300 3300035118 Bacteria 17956
688 Ga0373954_0011115 3300035118 Bacteria 3983
689 Ga0373954_0028526 3300035118 Bacteria 2566
690 Ga0373956_0001245 3300035119 Bacteria 10539
691 Ga0373956_0015303 3300035119 Bacteria 3210
692 Ga0373956_0022189 3300035119 Bacteria 2714
693 Ga0373956_0062032 3300035119 Bacteria 1694
694 Ga0373956_0144849 3300035119 Bacteria 1116
695 Ga0373957_0000236 3300035120 Bacteria 13729
696 Ga0373957_0002366 3300035120 Bacteria 5365
697 Ga0373957_0008008 3300035120 Bacteria 3407
698 Ga0373960_0000463 3300035121 Bacteria 8007
699 Ga0373960_0002285 3300035121 Bacteria 4313
700 Ga0373960_0031850 3300035121 Bacteria 1477
701 Ga0373943_0004590 3300035170 Bacteria 6240
702 Ga0373943_0007545 3300035170 Bacteria 4885
703 Ga0373943_0037247 3300035170 Bacteria 2334
704 Ga0373943_0061648 3300035170 Bacteria 1876
705 Ga0373943_0162283 3300035170 Bacteria 1217
706 Ga0373946_0000328 3300035171 Bacteria 15398
707 Ga0373946_0011843 3300035171 Bacteria 3260
708 Ga0373955_0007704 3300035172 Bacteria 4959
709 Ga0373955_0009202 3300035172 Bacteria 4619
710 Ga0373955_0015379 3300035172 Bacteria 3745
711 Ga0373942_0001015 3300035207 Bacteria 7643
712 Ga0373942_0017453 3300035207 Bacteria 1769
713 Ga0373942_0032081 3300035207 Bacteria 1393
714 Ga0373961_0000507 3300035241 Bacteria 14951
715 Ga0373961_0005656 3300035241 Bacteria 3000
716 Ga0373961_0007487 3300035241 Bacteria 2641
717 Ga0373962_0005038 3300035242 Bacteria 3193
718 Ga0373962_0006073 3300035242 Bacteria 2920
719 Ga0373962_0007889 3300035242 Bacteria 2612
720 Ga0373924_0001495 3300035410 Bacteria 7610
721 Ga0373924_0042484 3300035410 Bacteria 1865
722 Ga0373931_0009310 3300035691 Bacteria 4692
723 Ga0373931_0011436 3300035691 Bacteria 4288
724 Ga0373931_0031193 3300035691 Bacteria 2749
725 Ga0373931_0129083 3300035691 Bacteria 1453
726 Ga0373931_0219482 3300035691 Bacteria 1144
727 Ga0373931_0255098 3300035691 Bacteria 1068
728 Ga0373931_0365313 3300035691 Bacteria 906
729 Ga0373935_0002234 3300035692 Bacteria 11016
730 Ga0373935_0002426 3300035692 Bacteria 10671
731 Ga0373935_0013222 3300035692 Bacteria 4977
732 Ga0373935_0054097 3300035692 Bacteria 2554
733 Ga0373935_0302577 3300035692 Bacteria 1131
734 Ga0373927_0005714 3300035695 Bacteria 8539
735 Ga0373927_0014805 3300035695 Bacteria 5157
736 Ga0373927_0030360 3300035695 Bacteria 3526
737 Ga0373927_0050433 3300035695 Bacteria 2691
738 Ga0373927_0235516 3300035695 Bacteria 1203
739 Ga0373933_0002450 3300035724 Bacteria 10444
740 Ga0373933_0003172 3300035724 Bacteria 9183
741 Ga0373933_0004760 3300035724 Bacteria 7421
742 Ga0373933_0010871 3300035724 Bacteria 4996
743 Ga0373947_0008877 3300035725 Bacteria 5784
744 Ga0373947_0011163 3300035725 Bacteria 5157
745 Ga0373947_0016348 3300035725 Bacteria 4264
746 Ga0373937_0000864 3300036401 Bacteria 26035
747 Ga0373937_0001621 3300036401 Bacteria 18907
748 Ga0373937_0008258 3300036401 Bacteria 9038
749 Ga0373937_0014163 3300036401 Bacteria 7033
750 Ga0373937_0089986 3300036401 Bacteria 2842
751 Ga0373937_0342507 3300036401 Bacteria 1416
752 Ga0373925_0000639 3300037068 Bacteria 32946
753 Ga0373925_0021865 3300037068 Bacteria 4662
754 Ga0373925_0282705 3300037068 Bacteria 1336
755 Ga0373925_0433040 3300037068 Bacteria 1076
756 Ga0395899_0003310 3300037312 Bacteria 12769
757 Ga0395899_0010414 3300037312 Bacteria 7126
758 Ga0395900_0002147 3300037418 Bacteria 22057
759 Ga0395900_0010578 3300037418 Bacteria 9434
760 Ga0395898_0013547 3300037466 Bacteria 8394
761 Ga0395898_0015323 3300037466 Bacteria 7863
762 Ga0395901_0006050 3300038443 Bacteria 12259
763 Ga0395901_0008240 3300038443 Bacteria 10531
764 Ga0395901_0243431 3300038443 Bacteria 1875
765 Ga0436365_0476069 3300039437 Bacteria 19942
766 Ga0436361_0166397 3300039447 Bacteria 45243
767 Ga0451853_2535465 3300041512 Bacteria 1139
768 Ga0439448_0009871 3300042005 Bacteria 2820
769 Ga0466963_0051924 3300044694 Bacteria 2719
770 Ga0466963_0198923 3300044694 Bacteria 1401
771 Ga0466963_0211403 3300044694 Bacteria 1357
772 Ga0466963_0280349 3300044694 Bacteria 1171
773 Ga0466963_0319115 3300044694 Bacteria 1093
774 Ga0453684_0543985 3300044712 Bacteria 1280
775 Ga0466971_0007301 3300044719 Bacteria 4812
776 Ga0466971_0156615 3300044719 Bacteria 1065
777 Ga0466957_0024459 3300044842 Bacteria 3574
778 Ga0466957_0053779 3300044842 Bacteria 2456
779 Ga0451576_0003863 3300045051 Bacteria 20091
780 Ga0451576_0644855 3300045051 Bacteria 1113
781 Ga0466958_0044559 3300045836 Bacteria 2674
782 Ga0466958_0130907 3300045836 Bacteria 1575
783 Ga0466958_0355932 3300045836 Bacteria 943
784 Ga0466967_0004231 3300045976 Bacteria 9630
785 Ga0466967_0032121 3300045976 Bacteria 4429
786 Ga0466967_0283894 3300045976 Bacteria 1589
787 Ga0495592_0000348 3300046454 Bacteria 37669
788 Ga0495592_0000507 3300046454 Bacteria 28370
789 Ga0495592_0001602 3300046454 Bacteria 15841
790 Ga0495592_0025827 3300046454 Bacteria 4458
791 Ga0495592_0086790 3300046454 Bacteria 2252
792 Ga0495592_0145967 3300046454 Bacteria 1640
793 Ga0495592_0165449 3300046454 Bacteria 1518
794 Ga0495603_0017210 3300046455 Bacteria 4375
795 Ga0495603_0018541 3300046455 Bacteria 4209
796 Ga0495603_0029474 3300046455 Bacteria 3308
797 Ga0495603_0077764 3300046455 Bacteria 1946
798 Ga0495629_0000107 3300046459 Bacteria 74043
799 Ga0495629_0000318 3300046459 Bacteria 41154
800 Ga0495629_0020542 3300046459 Bacteria 4716
801 Ga0495629_0050912 3300046459 Bacteria 2899
802 Ga0495629_0052427 3300046459 Bacteria 2854
803 Ga0495629_0057506 3300046459 Bacteria 2719
804 Ga0495629_0075114 3300046459 Bacteria 2360
805 Ga0495629_0090176 3300046459 Bacteria 2139
806 Ga0495629_0156072 3300046459 Bacteria 1586
807 Ga0495638_0032977 3300046460 Bacteria 3314
808 Ga0495638_0048301 3300046460 Bacteria 2664
809 Ga0495641_0005661 3300046461 Bacteria 8337
810 Ga0495641_0035588 3300046461 Bacteria 2345
811 Ga0495641_0048346 3300046461 Bacteria 1951
812 Ga0495651_0000529 3300046462 Bacteria 29571
813 Ga0495651_0000617 3300046462 Bacteria 27648
814 Ga0495651_0013471 3300046462 Bacteria 6324
815 Ga0495651_0015568 3300046462 Bacteria 5885
816 Ga0495651_0020419 3300046462 Bacteria 5143
817 Ga0495651_0062159 3300046462 Bacteria 2857
818 Ga0495651_0437984 3300046462 Bacteria 847
819 Ga0495653_0000030 3300046463 Bacteria 142668
820 Ga0495653_0002510 3300046463 Bacteria 14613
821 Ga0495653_0003035 3300046463 Bacteria 13461
822 Ga0495653_0005220 3300046463 Bacteria 10562
823 Ga0495653_0183181 3300046463 Bacteria 1435
824 Ga0495580_0001533 3300046472 Bacteria 20325
825 Ga0495580_0138088 3300046472 Bacteria 1690
826 Ga0495582_0001909 3300046473 Bacteria 11716
827 Ga0495582_0010007 3300046473 Bacteria 5219
828 Ga0495582_0024470 3300046473 Bacteria 3304
829 Ga0495582_0079933 3300046473 Bacteria 1815
830 Ga0495639_0016223 3300046475 Bacteria 3232
831 Ga0495639_0061445 3300046475 Bacteria 1723
832 Ga0495662_0000621 3300046476 Bacteria 16471
833 Ga0495662_0029966 3300046476 Bacteria 2627
834 Ga0495664_0000003 3300046477 Bacteria 551602
835 Ga0495664_0008486 3300046477 Bacteria 5731
836 Ga0495664_0020131 3300046477 Bacteria 3844
837 Ga0495664_0068309 3300046477 Bacteria 2120
838 Ga0495664_0073669 3300046477 Bacteria 2042
839 Ga0495664_0147746 3300046477 Bacteria 1426
840 Ga0495585_0082270 3300046492 Bacteria 1743
841 Ga0495594_0003322 3300046499 Bacteria 8320
842 Ga0495594_0278971 3300046499 Bacteria 952
843 Ga0495607_0043916 3300046501 Bacteria 2639
844 Ga0495608_0000011 3300046511 Bacteria 248514
845 Ga0495608_0002492 3300046511 Bacteria 13201
846 Ga0495608_0007440 3300046511 Bacteria 7737
847 Ga0495608_0010318 3300046511 Bacteria 6518
848 Ga0495608_0069090 3300046511 Bacteria 2309
849 Ga0495608_0194482 3300046511 Bacteria 1280
850 Ga0495618_0000025 3300046514 Bacteria 116027
851 Ga0495618_0075618 3300046514 Bacteria 2145
852 Ga0495618_0111633 3300046514 Bacteria 1750
853 Ga0495628_0000001 3300046516 Bacteria 917742
854 Ga0495628_0003426 3300046516 Bacteria 14196
855 Ga0495628_0101479 3300046516 Bacteria 2220
856 Ga0495630_0000286 3300046517 Bacteria 40823
857 Ga0495630_0022078 3300046517 Bacteria 4702
858 Ga0495630_0104057 3300046517 Bacteria 2148
859 Ga0495630_0192170 3300046517 Bacteria 1557
860 Ga0495630_0269842 3300046517 Bacteria 1300
861 Ga0495648_0022351 3300046524 Bacteria 4358
862 Ga0495666_0000591 3300046526 Bacteria 16217
863 Ga0495666_0068946 3300046526 Bacteria 1683
864 Ga0495652_0000002 3300046529 Bacteria 946606
865 Ga0495652_0002788 3300046529 Bacteria 17644
866 Ga0495652_0005630 3300046529 Bacteria 11736
867 Ga0495652_0018534 3300046529 Bacteria 6206
868 Ga0495652_0126708 3300046529 Bacteria 2027
869 Ga0495652_0171116 3300046529 Bacteria 1676
870 Ga0495665_0000336 3300046531 Bacteria 23763
871 Ga0495665_0023457 3300046531 Bacteria 3314
872 Ga0495640_0000002 3300046533 Bacteria 646434
873 Ga0495640_0006838 3300046533 Bacteria 8988
874 Ga0495640_0066410 3300046533 Bacteria 2433
875 Ga0495640_0256270 3300046533 Bacteria 1094
876 Ga0495586_0003307 3300046535 Bacteria 8645
877 Ga0495587_0000001 3300046536 Bacteria 724132
878 Ga0495587_0008854 3300046536 Bacteria 6459
879 Ga0495587_0013020 3300046536 Bacteria 5231
880 Ga0495598_0010258 3300046537 Bacteria 2240
881 Ga0495598_0038376 3300046537 Bacteria 1387
882 Ga0495609_0036676 3300046538 Bacteria 2213
883 Ga0495621_0079131 3300046539 Bacteria 1223
884 Ga0495645_0000276 3300046543 Bacteria 37763
885 Ga0495645_0008693 3300046543 Bacteria 7092
886 Ga0495645_0020142 3300046543 Bacteria 4809
887 Ga0495622_0037360 3300046557 Bacteria 2262
888 Ga0495633_0008197 3300046558 Bacteria 5917
889 Ga0495633_0024998 3300046558 Bacteria 2946
890 Ga0495667_0000004 3300046559 Bacteria 295297
891 Ga0495667_0002448 3300046559 Bacteria 12395
892 Ga0495667_0002926 3300046559 Bacteria 11463
893 Ga0495667_0005696 3300046559 Bacteria 8435
894 Ga0495667_0008390 3300046559 Bacteria 7008
895 Ga0495667_0087500 3300046559 Bacteria 2020
896 Ga0495656_0013754 3300046615 Bacteria 3018
897 Ga0495634_0001327 3300046642 Bacteria 22545
898 Ga0495634_0043559 3300046642 Bacteria 3041
899 Ga0495634_0060532 3300046642 Bacteria 2519
900 Ga0495634_0079556 3300046642 Bacteria 2146
901 Ga0495634_0137146 3300046642 Bacteria 1556
902 Ga0495634_0156980 3300046642 Bacteria 1436
903 Ga0495611_0147867 3300046648 Bacteria 1097
904 Ga0495635_0000001 3300046663 Bacteria 704901
905 Ga0495635_0000677 3300046663 Bacteria 21942
906 Ga0495635_0008814 3300046663 Bacteria 7043
907 Ga0495635_0020091 3300046663 Bacteria 4655
908 Ga0495635_0052506 3300046663 Bacteria 2808
909 Ga0495661_0025055 3300046665 Bacteria 3860
910 Ga0495661_0150829 3300046665 Bacteria 1256
911 Ga0495588_0004745 3300046674 Bacteria 6008
912 Ga0495588_0053170 3300046674 Bacteria 2088
913 Ga0495588_0089477 3300046674 Bacteria 1612
914 Ga0495588_0175684 3300046674 Bacteria 1132
915 Ga0495657_0000190 3300046675 Bacteria 55153
916 Ga0495657_0002217 3300046675 Bacteria 16443
917 Ga0495657_0028524 3300046675 Bacteria 3925
918 Ga0495657_0080100 3300046675 Bacteria 2114
919 Ga0495599_0000212 3300046678 Bacteria 37642
920 Ga0495599_0017767 3300046678 Bacteria 4426
921 Ga0495599_0021527 3300046678 Bacteria 4023
922 Ga0495599_0043661 3300046678 Bacteria 2813
923 Ga0495623_0001914 3300046679 Bacteria 13972
924 Ga0495623_0004877 3300046679 Bacteria 8799
925 Ga0495623_0028747 3300046679 Bacteria 3577
926 Ga0495623_0055409 3300046679 Bacteria 2499
927 Ga0495646_0000009 3300046680 Bacteria 200698
928 Ga0495646_0005225 3300046680 Bacteria 8182
929 Ga0495646_0033048 3300046680 Bacteria 3217
930 Ga0495646_0110395 3300046680 Bacteria 1567
931 Ga0495647_0000542 3300046681 Bacteria 11081
932 Ga0495647_0011950 3300046681 Bacteria 2983
933 Ga0495658_0016142 3300046683 Bacteria 3842
934 Ga0495658_0045946 3300046683 Bacteria 2453
935 Ga0495613_0008263 3300046689 Bacteria 7725
936 Ga0495613_0020437 3300046689 Bacteria 4936
937 Ga0495613_0022253 3300046689 Bacteria 4725
938 Ga0495613_0128003 3300046689 Bacteria 1820
939 Ga0495624_0004828 3300046690 Bacteria 9803
940 Ga0495624_0034363 3300046690 Bacteria 3279
941 Ga0495624_0037456 3300046690 Bacteria 3120
942 Ga0495624_0118515 3300046690 Bacteria 1626
943 Ga0495670_0013865 3300046691 Bacteria 3963
944 Ga0495671_0137294 3300046692 Bacteria 1192
945 Ga0495600_0002696 3300046809 Bacteria 10263
946 Ga0495600_0010015 3300046809 Bacteria 5875
947 Ga0495600_0010920 3300046809 Bacteria 5648
948 Ga0495600_0043987 3300046809 Bacteria 2913
949 Ga0495600_0060771 3300046809 Bacteria 2468
950 Ga0495581_0003207 3300047315 Bacteria 9368
951 Ga0495581_0036271 3300047315 Bacteria 2853
952 Ga0495581_0198289 3300047315 Bacteria 1174
953 Ga0495604_0000008 3300047317 Bacteria 341160
954 Ga0495604_0001378 3300047317 Bacteria 19921
955 Ga0495604_0036466 3300047317 Bacteria 3876
956 Ga0495604_0078768 3300047317 Bacteria 2472
957 Ga0495604_0322079 3300047317 Bacteria 1033
958 Ga0495674_0000016 3300047319 Bacteria 216763
959 Ga0495674_0016566 3300047319 Bacteria 6879
960 Ga0495674_0024317 3300047319 Bacteria 5567
961 Ga0495674_0041625 3300047319 Bacteria 4102
962 Ga0495674_0051448 3300047319 Bacteria 3631
963 Ga0495676_0025024 3300047321 Bacteria 5157
964 Ga0495676_0111577 3300047321 Bacteria 2005
965 Ga0495680_0008529 3300047322 Bacteria 9311
966 Ga0495680_0011642 3300047322 Bacteria 7772
967 Ga0495680_0011911 3300047322 Bacteria 7673
968 Ga0495680_0014012 3300047322 Bacteria 6968
969 Ga0495680_0014703 3300047322 Bacteria 6769
970 Ga0495675_0001056 3300047444 Bacteria 16742
971 Ga0495675_0004044 3300047444 Bacteria 8887
972 Ga0495675_0010919 3300047444 Bacteria 5693
973 Ga0495675_0050487 3300047444 Bacteria 2644
974 Ga0495684_0000002 3300047471 Bacteria 341216
975 Ga0495684_0000860 3300047471 Bacteria 24632
976 Ga0495684_0148983 3300047471 Bacteria 1750
977 Ga0495593_0000458 3300047673 Bacteria 22861
978 Ga0495593_0001605 3300047673 Bacteria 13357
979 Ga0495593_0002782 3300047673 Bacteria 10535
980 Ga0495593_0030736 3300047673 Bacteria 2937
981 Ga0495593_0122668 3300047673 Bacteria 1322
982 Ga0495602_0000024 3300048088 Bacteria 151162
983 Ga0495602_0003273 3300048088 Bacteria 16731
984 Ga0495602_0017859 3300048088 Bacteria 7100
985 Ga0495602_0027982 3300048088 Bacteria 5406
986 Ga0495602_0030760 3300048088 Bacteria 5087
987 Ga0495602_0262551 3300048088 Bacteria 1280
988 Ga0495614_0011159 3300048089 Bacteria 3954
989 Ga0495626_0040178 3300048091 Bacteria 2211
990 Ga0496100_0000272 3300048903 Bacteria 26163
991 Ga0496100_0032975 3300048903 Bacteria 3236
992 Ga0496100_0058563 3300048903 Bacteria 2528
993 Ga0496100_0323150 3300048903 Bacteria 1159
994 Ga0496100_0518992 3300048903 Bacteria 919
995 Ga0496101_0002019 3300048904 Bacteria 12322
996 Ga0496101_0008709 3300048904 Bacteria 6635
997 Ga0496101_0013970 3300048904 Bacteria 5392
998 Ga0496101_0240486 3300048904 Bacteria 1409
999 Ga0496102_0002730 3300048905 Bacteria 15043
1000 Ga0496102_0020794 3300048905 Bacteria 5800
1001 Ga0496102_0033680 3300048905 Bacteria 4605
1002 Ga0496102_0048118 3300048905 Bacteria 3877
1003 Ga0496102_0202442 3300048905 Bacteria 1871
1004 Ga0496102_0361567 3300048905 Bacteria 1366
1005 Ga0496102_0363902 3300048905 Bacteria 1362
1006 Ga0496102_0402787 3300048905 Bacteria 1286
1007 Ga0496102_0433503 3300048905 Bacteria 1234
1008 Ga0496103_0001472 3300048906 Bacteria 15759
1009 Ga0496103_0009753 3300048906 Bacteria 5685
1010 Ga0496103_0063499 3300048906 Bacteria 2300
1011 Ga0496103_0106759 3300048906 Bacteria 1776
1012 Ga0496103_0142376 3300048906 Bacteria 1534
1013 Ga0496103_0147094 3300048906 Bacteria 1508
1014 Ga0496103_0234193 3300048906 Bacteria 1181
1015 Ga0496104_0000369 3300048907 Bacteria 39830
1016 Ga0496104_0000515 3300048907 Bacteria 33122
1017 Ga0496104_0004766 3300048907 Bacteria 11811
1018 Ga0496104_0005758 3300048907 Bacteria 10847
1019 Ga0496104_0008157 3300048907 Bacteria 9296
1020 Ga0496104_0011977 3300048907 Bacteria 7781
1021 Ga0496104_0029600 3300048907 Bacteria 5080
1022 Ga0496104_0144938 3300048907 Bacteria 2281
1023 Ga0496104_0210946 3300048907 Bacteria 1853
1024 Ga0496105_0000405 3300048908 Bacteria 28378
1025 Ga0496105_0001722 3300048908 Bacteria 15636
1026 Ga0496105_0004314 3300048908 Bacteria 10708
1027 Ga0496105_0007091 3300048908 Bacteria 8641
1028 Ga0496105_0010305 3300048908 Bacteria 7348
1029 Ga0496105_0024232 3300048908 Bacteria 4930
1030 Ga0496105_0096029 3300048908 Bacteria 2448
1031 Ga0496105_0158797 3300048908 Bacteria 1856
1032 Ga0496106_0002568 3300048909 Bacteria 13513
1033 Ga0496106_0007653 3300048909 Bacteria 7992
1034 Ga0496106_0011101 3300048909 Bacteria 6662
1035 Ga0496106_0017933 3300048909 Bacteria 5235
1036 Ga0496106_0047636 3300048909 Bacteria 3226
1037 Ga0496106_0079634 3300048909 Bacteria 2515
1038 Ga0496106_0087592 3300048909 Bacteria 2399
1039 Ga0496107_0002783 3300048910 Bacteria 11534
1040 Ga0496107_0008620 3300048910 Bacteria 7062
1041 Ga0496107_0011938 3300048910 Bacteria 6065
1042 Ga0496107_0017035 3300048910 Bacteria 5109
1043 Ga0496107_0032107 3300048910 Bacteria 3751
1044 Ga0496108_0000746 3300048911 Bacteria 25332
1045 Ga0496108_0001488 3300048911 Bacteria 18519
1046 Ga0496108_0005878 3300048911 Bacteria 9946
1047 Ga0496108_0022041 3300048911 Bacteria 5237
1048 Ga0496108_0049453 3300048911 Bacteria 3516
1049 Ga0496108_0088713 3300048911 Bacteria 2628
1050 Ga0496109_0001064 3300048912 Bacteria 22726
1051 Ga0496109_0001275 3300048912 Bacteria 20899
1052 Ga0496109_0002498 3300048912 Bacteria 15419
1053 Ga0496109_0002783 3300048912 Bacteria 14656
1054 Ga0496109_0003828 3300048912 Bacteria 12569
1055 Ga0496109_0005286 3300048912 Bacteria 10788
1056 Ga0496109_0032914 3300048912 Bacteria 4664
1057 Ga0496109_0097700 3300048912 Bacteria 2722
1058 Ga0496109_0343865 3300048912 Bacteria 1409
1059 Ga0496110_0004442 3300048913 Bacteria 10873
1060 Ga0496110_0016391 3300048913 Bacteria 6186
1061 Ga0496110_0019993 3300048913 Bacteria 5645
1062 Ga0496110_0041359 3300048913 Bacteria 4021
1063 Ga0496110_0045332 3300048913 Bacteria 3843
1064 Ga0496110_0234443 3300048913 Bacteria 1670
1065 Ga0496110_0254612 3300048913 Bacteria 1598
1066 Ga0496110_0308259 3300048913 Bacteria 1442
1067 Ga0496111_0000317 3300048914 Bacteria 23872
1068 Ga0496111_0001286 3300048914 Bacteria 14053
1069 Ga0496111_0001412 3300048914 Bacteria 13658
1070 Ga0496111_0008225 3300048914 Bacteria 6896
1071 Ga0496111_0011999 3300048914 Bacteria 5857
1072 Ga0496111_0188492 3300048914 Bacteria 1533
1073 Ga0496111_0191506 3300048914 Bacteria 1520
1074 Ga0496112_0002618 3300048915 Bacteria 14532
1075 Ga0496112_0007084 3300048915 Bacteria 9909
1076 Ga0496112_0041124 3300048915 Bacteria 4521
1077 Ga0496112_0053814 3300048915 Bacteria 3954
1078 Ga0496112_0068721 3300048915 Bacteria 3499
1079 Ga0496112_0096675 3300048915 Bacteria 2923
1080 Ga0496112_0200508 3300048915 Bacteria 1955
1081 Ga0496112_0224410 3300048915 Bacteria 1834
1082 Ga0496112_0244164 3300048915 Bacteria 1748
1083 Ga0496113_0001219 3300048916 Bacteria 14112
1084 Ga0496113_0010915 3300048916 Bacteria 6029
1085 Ga0496113_0024381 3300048916 Bacteria 4299
1086 Ga0496113_0069306 3300048916 Bacteria 2678
1087 Ga0496113_0117909 3300048916 Bacteria 2073
1088 Ga0496114_0004353 3300048917 Bacteria 10958
1089 Ga0496114_0011545 3300048917 Bacteria 7058
1090 Ga0496114_0018863 3300048917 Bacteria 5586
1091 Ga0496114_0052882 3300048917 Bacteria 3384
1092 Ga0496114_0144396 3300048917 Bacteria 2062
1093 Ga0496115_0000935 3300048918 Bacteria 21173
1094 Ga0496115_0003791 3300048918 Bacteria 10875
1095 Ga0496115_0004706 3300048918 Bacteria 9893
1096 Ga0496115_0023902 3300048918 Bacteria 4745
1097 Ga0496115_0042634 3300048918 Bacteria 3615
1098 Ga0496115_0121906 3300048918 Bacteria 2146
1099 Ga0496115_0156196 3300048918 Bacteria 1885
1100 Ga0496115_0438697 3300048918 Bacteria 1056
1101 Ga0496118_0065934 3300048921 Bacteria 2646
1102 Ga0496120_0061953 3300048923 Bacteria 2086
1103 Ga0496121_0000001 3300048924 Bacteria 1830318
1104 Ga0496122_0000009 3300048925 Bacteria 584024
1105 Ga0496122_0091780 3300048925 Bacteria 2066
1106 Ga0496123_0000020 3300048926 Bacteria 388748
1107 Ga0496123_0069542 3300048926 Bacteria 2209
1108 Ga0496124_0027813 3300048927 Bacteria 5067
1109 Ga0496124_0208241 3300048927 Bacteria 1482
1110 Ga0496124_0218241 3300048927 Bacteria 1436
1111 Ga0496125_0000001 3300048928 Bacteria 1766138
1112 Ga0501032_0132357 3300049569 Bacteria 1645
1113 Ga0501033_0011532 3300049570 Bacteria 6762
1114 Ga0501034_0133060 3300049571 Bacteria 2469
1115 Ga0501034_0201804 3300049571 Bacteria 1946
1116 Ga0501036_0047994 3300049572 Bacteria 3615
1117 Ga0501036_0427363 3300049572 Bacteria 1104
1118 Ga0501037_0019405 3300049573 Bacteria 5015
1119 Ga0501037_0135322 3300049573 Bacteria 1765
1120 Ga0501038_0039459 3300049574 Bacteria 4130
1121 Ga0501038_0121412 3300049574 Bacteria 2154
1122 Ga0501039_0026191 3300049575 Bacteria 4482
1123 Ga0501043_0167700 3300049579 Bacteria 1714
1124 Ga0501046_0292076 3300049580 Bacteria 1192
1125 Ga0501047_0019246 3300049581 Bacteria 6550
1126 Ga0501047_0120454 3300049581 Bacteria 2506
1127 Ga0501047_0135576 3300049581 Bacteria 2342
1128 Ga0501070_0051457 3300049586 Bacteria 3419
1129 Ga0501070_0228809 3300049586 Bacteria 1524
1130 Ga0501070_0264200 3300049586 Bacteria 1406
1131 Ga0501070_0315084 3300049586 Bacteria 1273
1132 Ga0501072_0344093 3300049588 Bacteria 1184
1133 Ga0501073_0038121 3300049589 Bacteria 3411
1134 Ga0501073_0145374 3300049589 Bacteria 1643
1135 Ga0501077_0024179 3300049593 Bacteria 3856
1136 Ga0501080_0080197 3300049742 Bacteria 3034
1137 Ga0501083_0147934 3300049744 Bacteria 1538
1138 Ga0501083_0320540 3300049744 Bacteria 1008
1139 Ga0501035_0360771 3300049822 Bacteria 1214
1140 Ga0501044_0020447 3300049823 Bacteria 7068
1141 Ga0501044_0175955 3300049823 Bacteria 2109
1142 nmdc:mga03683_62302_c2 3300050489 Bacteria 1111
1143 nmdc:mga03n38_180047_c1 3300050490 Bacteria 1082
1144 nmdc:mga00v17_153005_c1 3300050491 Bacteria 1482
1145 nmdc:mga00v17_384419_c1 3300050491 Bacteria 912
1146 nmdc:mga00v17_547062_c1 3300050491 Bacteria 749
1147 nmdc:mga0yw44_1338_c1 3300050492 Bacteria 7798
1148 nmdc:mga0yw44_144700_c1 3300050492 Bacteria 1547
1149 nmdc:mga0yw44_5247_c1 3300050492 Bacteria 6077
1150 nmdc:mga0yw44_7399_c1 3300050492 Bacteria 5398
1151 nmdc:mga06z11_13124_c1 3300050494 Bacteria 3627
1152 nmdc:mga04h51_10398_c1 3300050495 Bacteria 2554
1153 nmdc:mga07m45_70412_c1 3300050496 Bacteria 1989
1154 nmdc:mga05p37_2740_c1 3300050507 Bacteria 20479
1155 nmdc:mga05p37_30958_c1 3300050507 Bacteria 6533
1156 nmdc:mga05p37_71_c2 3300050507 Bacteria 60785
1157 nmdc:mga09592_36808_c1 3300050508 Bacteria 4101
1158 nmdc:mga0qj67_14_c1 3300050509 Bacteria 124768
1159 nmdc:mga0qj67_1537_c1 3300050509 Bacteria 16193
1160 nmdc:mga0qj67_29600_c1 3300050509 Bacteria 4254
1161 nmdc:mga06r32_27244_c1 3300050510 Bacteria 5337
1162 nmdc:mga06r32_707901_c1 3300050510 Bacteria 972
1163 nmdc:mga06r32_9784_c1 3300050510 Bacteria 8656
1164 nmdc:mga08y16_10837_c1 3300050511 Bacteria 9573
1165 nmdc:mga08y16_650316_c1 3300050511 Bacteria 1058
1166 nmdc:mga08y16_7147_c1 3300050511 Bacteria 11717
1167 nmdc:mga08y16_93914_c1 3300050511 Bacteria 3125
1168 nmdc:mga0n895_1010_c1 3300050512 Bacteria 20432
1169 nmdc:mga0n895_1143_c1 3300050512 Bacteria 19428
1170 nmdc:mga0n895_174250_c1 3300050512 Bacteria 2182
1171 nmdc:mga0n895_37769_c1 3300050512 Bacteria 4674
1172 nmdc:mga0n895_44942_c1 3300050512 Bacteria 4308
1173 nmdc:mga0n895_469506_c1 3300050512 Bacteria 1269
1174 nmdc:mga0n895_473344_c1 3300050512 Bacteria 1264
1175 nmdc:mga0n895_491166_c1 3300050512 Bacteria 1237
1176 nmdc:mga0n895_903937_c1 3300050512 Bacteria 868
1177 nmdc:mga0rr50_123642_c1 3300050513 Bacteria 2063
1178 nmdc:mga0rr50_140365_c1 3300050513 Bacteria 1943
1179 nmdc:mga0rr50_141697_c1 3300050513 Bacteria 1935
1180 nmdc:mga0rr50_192177_c1 3300050513 Bacteria 1673
1181 nmdc:mga0rr50_415998_c1 3300050513 Bacteria 1137
1182 nmdc:mga0rr50_560717_c1 3300050513 Bacteria 973
1183 nmdc:mga08x19_137775_c1 3300050514 Bacteria 1646
1184 nmdc:mga08x19_138165_c1 3300050514 Bacteria 1644
1185 nmdc:mga08x19_166749_c1 3300050514 Bacteria 1498
1186 nmdc:mga08x19_284094_c1 3300050514 Bacteria 1147
1187 nmdc:mga08x19_286610_c1 3300050514 Bacteria 1142
1188 nmdc:mga0a205_14483_c1 3300050515 Bacteria 7357
1189 nmdc:mga0a205_68545_c1 3300050515 Bacteria 3426
1190 Ga0495601_0000001 3300053077 Bacteria 549454
1191 Ga0495601_0000940 3300053077 Bacteria 15849
1192 Ga0495601_0011880 3300053077 Bacteria 5220
1193 Ga0495601_0033424 3300053077 Bacteria 3205
1194 Ga0495601_0039255 3300053077 Bacteria 2964
1195 Ga0495601_0086200 3300053077 Bacteria 2018
1196 Ga0495601_0087248 3300053077 Bacteria 2006
1197 Ga0495601_0199566 3300053077 Bacteria 1307
1198 Ga0495612_0000097 3300053078 Bacteria 37614
1199 Ga0495612_0002006 3300053078 Bacteria 8388
1200 Ga0495612_0011385 3300053078 Bacteria 3586
1201 Ga0495612_0020410 3300053078 Bacteria 2655
1202 Ga0495612_0023041 3300053078 Bacteria 2496
1203 Ga0495595_0000255 3300053084 Bacteria 21213
1204 Ga0495595_0000502 3300053084 Bacteria 14977
1205 Ga0495595_0001242 3300053084 Bacteria 9931
1206 Ga0495595_0003244 3300053084 Bacteria 6462
1207 Ga0495595_0005086 3300053084 Bacteria 5313
1208 Ga0495595_0153701 3300053084 Bacteria 1133
1209 Ga0495619_0000004 3300053085 Bacteria 500068
1210 Ga0495619_0000440 3300053085 Bacteria 28061
1211 Ga0495619_0001092 3300053085 Bacteria 17828
1212 Ga0495619_0001622 3300053085 Bacteria 14801
1213 Ga0495619_0023063 3300053085 Bacteria 3986
1214 Ga0495619_0044421 3300053085 Bacteria 2916
1215 Ga0495619_0114545 3300053085 Bacteria 1845
1216 Ga0500566_0115664 3300053094 Bacteria 1452
1217 Ga0500572_003427 3300053111 Bacteria 3630
1218 Ga0500618_000151 3300053125 Bacteria 57092
1219 Ga0500618_016698 3300053125 Bacteria 1833
1220 Ga0500658_0076030 3300053134 Bacteria 1427
1221 Ga0500559_0000604 3300053136 Bacteria 24436
1222 Ga0500577_0039019 3300053142 Bacteria 1719
1223 Ga0500590_004280 3300053148 Bacteria 6714
1224 Ga0500616_0000443 3300053153 Bacteria 54427
1225 Ga0500634_0027046 3300053161 Bacteria 3126
1226 Ga0500639_019738 3300053163 Bacteria 3555
1227 Ga0500636_0000010 3300053177 Bacteria 145932
1228 Ga0500596_022868 3300053735 Bacteria 946
1229 Ga0500601_005317 3300053737 Bacteria 1409
1230 Ga0501084_0611380 3300054114 Bacteria 921
1231 Ga0501084_0706929 3300054114 Bacteria 850
1232 Ga0501082_0074147 3300060353 Bacteria 2931
1233 Ga0466962_0009869 3300061719 Bacteria 4580
1234 Ga0530510_0205522 3300061734 Bacteria 1463
1235 Ga0530510_0267454 3300061734 Bacteria 1276

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050491 nmdc:mga00v17_547062_c1 nmdc:mga00v17_547062_c1_39_713 220
2 3300048915 Ga0496112_0244164 Ga0496112_0244164_1061_1735 224
3 3300006178 Ga0075367_10015469 Ga0075367_100154694 228
4 3300036401 Ga0373937_0342507 Ga0373937_0342507_316_1119 229
5 3300060353 Ga0501082_0074147 Ga0501082_0074147_14_718 234
6 3300048915 Ga0496112_0002618 Ga0496112_0002618_13758_14498 235
7 3300005336 Ga0070680_100120872 Ga0070680_1001208723 236
8 3300013105 Ga0157369_10423456 Ga0157369_104234562 236
9 3300014326 Ga0157380_10317630 Ga0157380_103176301 237
10 3300009551 Ga0105238_10076969 Ga0105238_100769693 239
11 3300005329 Ga0070683_100131827 Ga0070683_1001318271 240
12 3300005434 Ga0070709_10215261 Ga0070709_102152612 240
13 3300005547 Ga0070693_100013772 Ga0070693_1000137722 240
14 3300005563 Ga0068855_100434933 Ga0068855_1004349332 240
15 3300025915 Ga0207693_10006778 Ga0207693_100067788 240
16 3300025981 Ga0207640_10078245 Ga0207640_100782452 240
17 3300005435 Ga0070714_100112929 Ga0070714_1001129293 241
18 3300035116 Ga0373945_0009702 Ga0373945_0009702_2259_3065 242
19 3300031711 Ga0265314_10048426 Ga0265314_100484264 243
20 3300053737 Ga0500601_005317 Ga0500601_005317_559_1374 245
21 3300025928 Ga0207700_10437444 Ga0207700_104374442 246
22 3300025935 Ga0207709_10079847 Ga0207709_100798472 246
23 3300035086 Ga0373934_0020726 Ga0373934_0020726_661_1467 246
24 3300035111 Ga0373923_0012636 Ga0373923_0012636_2217_3023 246
25 3300035113 Ga0373936_0002617 Ga0373936_0002617_3400_4206 246
26 3300035117 Ga0373953_0001285 Ga0373953_0001285_1607_2413 246
27 3300035118 Ga0373954_0028526 Ga0373954_0028526_1384_2190 246
28 3300035119 Ga0373956_0015303 Ga0373956_0015303_1384_2190 246
29 3300035120 Ga0373957_0008008 Ga0373957_0008008_238_1044 246
30 3300035170 Ga0373943_0007545 Ga0373943_0007545_2416_3222 246
31 3300035172 Ga0373955_0007704 Ga0373955_0007704_2594_3400 246
32 3300035410 Ga0373924_0001495 Ga0373924_0001495_4034_4840 246
33 3300035692 Ga0373935_0002234 Ga0373935_0002234_8792_9598 246
34 3300035695 Ga0373927_0005714 Ga0373927_0005714_5154_5960 246
35 3300035724 Ga0373933_0002450 Ga0373933_0002450_1119_1925 246
36 3300036401 Ga0373937_0000864 Ga0373937_0000864_11411_12217 246
37 3300037068 Ga0373925_0000639 Ga0373925_0000639_11398_12204 246
38 3300046454 Ga0495592_0000348 Ga0495592_0000348_34247_35053 246
39 3300046462 Ga0495651_0000617 Ga0495651_0000617_3476_4282 246
40 3300046463 Ga0495653_0000030 Ga0495653_0000030_60764_61570 246
41 3300046477 Ga0495664_0000003 Ga0495664_0000003_164793_165599 246
42 3300046511 Ga0495608_0000011 Ga0495608_0000011_110797_111603 246
43 3300046514 Ga0495618_0000025 Ga0495618_0000025_81091_81897 246
44 3300046516 Ga0495628_0000001 Ga0495628_0000001_654194_655000 246
45 3300046517 Ga0495630_0000286 Ga0495630_0000286_36483_37289 246
46 3300046529 Ga0495652_0000002 Ga0495652_0000002_868728_869534 246
47 3300046533 Ga0495640_0000002 Ga0495640_0000002_109057_109863 246
48 3300046536 Ga0495587_0000001 Ga0495587_0000001_181463_182269 246
49 3300046543 Ga0495645_0000276 Ga0495645_0000276_2662_3468 246
50 3300046559 Ga0495667_0000004 Ga0495667_0000004_81110_81916 246
51 3300046642 Ga0495634_0001327 Ga0495634_0001327_19106_19912 246
52 3300046663 Ga0495635_0000001 Ga0495635_0000001_167274_168080 246
53 3300046675 Ga0495657_0000190 Ga0495657_0000190_2578_3384 246
54 3300046678 Ga0495599_0000212 Ga0495599_0000212_34260_35066 246
55 3300046680 Ga0495646_0000009 Ga0495646_0000009_182374_183180 246
56 3300046681 Ga0495647_0011950 Ga0495647_0011950_612_1418 246
57 3300046690 Ga0495624_0037456 Ga0495624_0037456_1393_2199 246
58 3300046809 Ga0495600_0002696 Ga0495600_0002696_6842_7648 246
59 3300047317 Ga0495604_0000008 Ga0495604_0000008_337765_338571 246
60 3300047319 Ga0495674_0000016 Ga0495674_0000016_2704_3510 246
61 3300047322 Ga0495680_0014703 Ga0495680_0014703_3414_4220 246
62 3300047444 Ga0495675_0004044 Ga0495675_0004044_5505_6311 246
63 3300047471 Ga0495684_0000002 Ga0495684_0000002_337823_338629 246
64 3300047673 Ga0495593_0000458 Ga0495593_0000458_20466_21272 246
65 3300048088 Ga0495602_0000024 Ga0495602_0000024_34239_35045 246
66 3300053077 Ga0495601_0000001 Ga0495601_0000001_377323_378129 246
67 3300053078 Ga0495612_0000097 Ga0495612_0000097_2580_3386 246
68 3300053084 Ga0495595_0000502 Ga0495595_0000502_2589_3395 246
69 3300053085 Ga0495619_0000004 Ga0495619_0000004_377354_378160 246
70 3300032002 Ga0307416_100231431 Ga0307416_1002314312 247
71 3300027512 Ga0209179_1000585 Ga0209179_10005854 248
72 3300007788 Ga0099795_10022421 Ga0099795_100224212 249
73 3300053111 Ga0500572_003427 Ga0500572_003427_70_882 249
74 3300053136 Ga0500559_0000604 Ga0500559_0000604_91_903 249
75 3300053163 Ga0500639_019738 Ga0500639_019738_1968_2780 249
76 3300053735 Ga0500596_022868 Ga0500596_022868_59_871 249
77 3300006852 Ga0075433_10030679 Ga0075433_100306792 250
78 3300009147 Ga0114129_10006300 Ga0114129_100063006 250
79 3300025928 Ga0207700_10179641 Ga0207700_101796412 250
80 3300025941 Ga0207711_10378042 Ga0207711_103780422 250
81 3300035086 Ga0373934_0002254 Ga0373934_0002254_2243_3061 250
82 3300035111 Ga0373923_0000490 Ga0373923_0000490_5452_6270 250
83 3300035117 Ga0373953_0000111 Ga0373953_0000111_7077_7895 250
84 3300035118 Ga0373954_0000300 Ga0373954_0000300_5925_6743 250
85 3300035119 Ga0373956_0001245 Ga0373956_0001245_7998_8816 250
86 3300035120 Ga0373957_0000236 Ga0373957_0000236_2167_2985 250
87 3300035724 Ga0373933_0010871 Ga0373933_0010871_2612_3430 250
88 3300046454 Ga0495592_0000507 Ga0495592_0000507_17483_18301 250
89 3300046459 Ga0495629_0000318 Ga0495629_0000318_1721_2539 250
90 3300046462 Ga0495651_0062159 Ga0495651_0062159_309_1127 250
91 3300046462 Ga0495651_0437984 Ga0495651_0437984_84_836 250
92 3300046463 Ga0495653_0002510 Ga0495653_0002510_7998_8816 250
93 3300046511 Ga0495608_0010318 Ga0495608_0010318_3427_4245 250
94 3300046516 Ga0495628_0101479 Ga0495628_0101479_1290_2108 250
95 3300046529 Ga0495652_0005630 Ga0495652_0005630_2133_2951 250
96 3300046543 Ga0495645_0020142 Ga0495645_0020142_3894_4712 250
97 3300046559 Ga0495667_0005696 Ga0495667_0005696_3427_4245 250
98 3300046663 Ga0495635_0000677 Ga0495635_0000677_10489_11307 250
99 3300046675 Ga0495657_0002217 Ga0495657_0002217_7646_8464 250
100 3300046678 Ga0495599_0021527 Ga0495599_0021527_208_1026 250
101 3300046679 Ga0495623_0001914 Ga0495623_0001914_9466_10284 250
102 3300046689 Ga0495613_0020437 Ga0495613_0020437_3588_4406 250
103 3300046809 Ga0495600_0010015 Ga0495600_0010015_739_1557 250
104 3300047317 Ga0495604_0001378 Ga0495604_0001378_11115_11933 250
105 3300047319 Ga0495674_0016566 Ga0495674_0016566_1953_2771 250
106 3300047471 Ga0495684_0000860 Ga0495684_0000860_13370_14188 250
107 3300047673 Ga0495593_0001605 Ga0495593_0001605_9587_10405 250
108 3300048088 Ga0495602_0017859 Ga0495602_0017859_2594_3412 250
109 3300050507 nmdc:mga05p37_2740_c1 nmdc:mga05p37_2740_c1_17594_18409 250
110 3300053077 Ga0495601_0033424 Ga0495601_0033424_2279_3097 250
111 3300053084 Ga0495595_0000255 Ga0495595_0000255_11423_12241 250
112 3300053085 Ga0495619_0001092 Ga0495619_0001092_10829_11647 250
113 3300006914 Ga0075436_100123566 Ga0075436_1001235661 251
114 3300009094 Ga0111539_10048215 Ga0111539_100482155 251
115 3300044842 Ga0466957_0053779 Ga0466957_0053779_1247_2062 251
116 3300045976 Ga0466967_0283894 Ga0466967_0283894_621_1436 251
117 3300050514 nmdc:mga08x19_138165_c1 nmdc:mga08x19_138165_c1_239_1048 251
118 3300005937 Ga0081455_10003621 Ga0081455_100036219 252
119 3300021384 Ga0213876_10012177 Ga0213876_100121773 253
120 3300039437 Ga0436365_0476069 Ga0436365_0476069_10824_11630 253
121 3300050514 nmdc:mga08x19_137775_c1 nmdc:mga08x19_137775_c1_217_1032 253
122 3300025939 Ga0207665_10042095 Ga0207665_100420952 254
123 3300049571 Ga0501034_0201804 Ga0501034_0201804_259_1077 255
124 3300049573 Ga0501037_0135322 Ga0501037_0135322_693_1511 255
125 3300049574 Ga0501038_0039459 Ga0501038_0039459_746_1564 255
126 3300049581 Ga0501047_0120454 Ga0501047_0120454_424_1242 255
127 3300049588 Ga0501072_0344093 Ga0501072_0344093_165_983 255
128 3300049589 Ga0501073_0038121 Ga0501073_0038121_2175_2993 255
129 3300050496 nmdc:mga07m45_70412_c1 nmdc:mga07m45_70412_c1_865_1701 255
130 3300009551 Ga0105238_10026829 Ga0105238_100268292 256
131 3300005327 Ga0070658_10039467 Ga0070658_100394671 257
132 3300005436 Ga0070713_100004000 Ga0070713_1000040005 257
133 3300005437 Ga0070710_10145745 Ga0070710_101457452 257
134 3300005439 Ga0070711_100129090 Ga0070711_1001290902 257
135 3300006163 Ga0070715_10174929 Ga0070715_101749291 257
136 3300014968 Ga0157379_10437083 Ga0157379_104370832 257
137 3300025898 Ga0207692_10119990 Ga0207692_101199903 257
138 3300025909 Ga0207705_10084589 Ga0207705_100845891 257
139 3300025916 Ga0207663_10021173 Ga0207663_100211733 257
140 3300025928 Ga0207700_10025593 Ga0207700_100255933 257
141 3300048904 Ga0496101_0002019 Ga0496101_0002019_5422_6198 257
142 3300048905 Ga0496102_0002730 Ga0496102_0002730_10386_11162 257
143 3300048907 Ga0496104_0008157 Ga0496104_0008157_5350_6126 257
144 3300048909 Ga0496106_0002568 Ga0496106_0002568_8859_9635 257
145 3300048910 Ga0496107_0011938 Ga0496107_0011938_850_1626 257
146 3300048911 Ga0496108_0005878 Ga0496108_0005878_2232_3008 257
147 3300048912 Ga0496109_0002498 Ga0496109_0002498_2568_3344 257
148 3300048912 Ga0496109_0002783 Ga0496109_0002783_12131_12937 257
149 3300048913 Ga0496110_0019993 Ga0496110_0019993_3976_4782 257
150 3300048914 Ga0496111_0001286 Ga0496111_0001286_9062_9868 257
151 3300048915 Ga0496112_0007084 Ga0496112_0007084_5378_6154 257
152 3300048916 Ga0496113_0069306 Ga0496113_0069306_1858_2634 257
153 3300002239 JGI24034J26672_10006134 JGI24034J26672_100061342 258
154 3300005328 Ga0070676_10050881 Ga0070676_100508813 258
155 3300005334 Ga0068869_100103056 Ga0068869_1001030562 258
156 3300005338 Ga0068868_100043507 Ga0068868_1000435073 258
157 3300005340 Ga0070689_100003166 Ga0070689_1000031665 258
158 3300005341 Ga0070691_10013630 Ga0070691_100136303 258
159 3300005343 Ga0070687_100003332 Ga0070687_1000033325 258
160 3300005344 Ga0070661_100063216 Ga0070661_1000632163 258
161 3300005353 Ga0070669_100024890 Ga0070669_1000248903 258
162 3300005354 Ga0070675_100017095 Ga0070675_1000170954 258
163 3300005364 Ga0070673_100028586 Ga0070673_1000285863 258
164 3300005365 Ga0070688_100022612 Ga0070688_1000226122 258
165 3300005366 Ga0070659_100129126 Ga0070659_1001291262 258
166 3300005367 Ga0070667_100057429 Ga0070667_1000574292 258
167 3300005436 Ga0070713_100206667 Ga0070713_1002066672 258
168 3300005437 Ga0070710_10124247 Ga0070710_101242472 258
169 3300005439 Ga0070711_100406951 Ga0070711_1004069512 258
170 3300005440 Ga0070705_100213178 Ga0070705_1002131782 258
171 3300005441 Ga0070700_100010159 Ga0070700_1000101594 258
172 3300005455 Ga0070663_100030754 Ga0070663_1000307542 258
173 3300005456 Ga0070678_100395320 Ga0070678_1003953202 258
174 3300005457 Ga0070662_100022179 Ga0070662_1000221794 258
175 3300005535 Ga0070684_100191403 Ga0070684_1001914032 258
176 3300005543 Ga0070672_100007233 Ga0070672_1000072332 258
177 3300005544 Ga0070686_100004524 Ga0070686_1000045245 258
178 3300005548 Ga0070665_100048481 Ga0070665_1000484813 258
179 3300005564 Ga0070664_100224221 Ga0070664_1002242212 258
180 3300005577 Ga0068857_100147581 Ga0068857_1001475812 258
181 3300005578 Ga0068854_100428976 Ga0068854_1004289762 258
182 3300005614 Ga0068856_100140229 Ga0068856_1001402293 258
183 3300005615 Ga0070702_100003968 Ga0070702_1000039682 258
184 3300005616 Ga0068852_100038834 Ga0068852_1000388343 258
185 3300005617 Ga0068859_100051427 Ga0068859_1000514272 258
186 3300005618 Ga0068864_100007988 Ga0068864_1000079885 258
187 3300005718 Ga0068866_10084220 Ga0068866_100842202 258
188 3300005834 Ga0068851_10071417 Ga0068851_100714172 258
189 3300005840 Ga0068870_10000463 Ga0068870_100004638 258
190 3300005841 Ga0068863_100055166 Ga0068863_1000551662 258
191 3300005843 Ga0068860_100038130 Ga0068860_1000381303 258
192 3300005844 Ga0068862_100008130 Ga0068862_1000081303 258
193 3300006038 Ga0075365_10000608 Ga0075365_100006084 258
194 3300006042 Ga0075368_10034121 Ga0075368_100341212 258
195 3300006163 Ga0070715_10004318 Ga0070715_100043183 258
196 3300006175 Ga0070712_100088588 Ga0070712_1000885882 258
197 3300006353 Ga0075370_10183531 Ga0075370_101835312 258
198 3300006881 Ga0068865_100203088 Ga0068865_1002030882 258
199 3300006931 Ga0097620_100051424 Ga0097620_1000514244 258
200 3300009092 Ga0105250_10106047 Ga0105250_101060472 258
201 3300009098 Ga0105245_10010115 Ga0105245_100101155 258
202 3300009101 Ga0105247_10024754 Ga0105247_100247542 258
203 3300009148 Ga0105243_10056240 Ga0105243_100562403 258
204 3300009174 Ga0105241_10130267 Ga0105241_101302672 258
205 3300009176 Ga0105242_10044589 Ga0105242_100445893 258
206 3300009177 Ga0105248_10044136 Ga0105248_100441362 258
207 3300009545 Ga0105237_10032413 Ga0105237_100324134 258
208 3300009551 Ga0105238_10085300 Ga0105238_100853003 258
209 3300009553 Ga0105249_10037064 Ga0105249_100370644 258
210 3300013296 Ga0157374_10046157 Ga0157374_100461573 258
211 3300013297 Ga0157378_10032077 Ga0157378_100320773 258
212 3300013306 Ga0163162_10138593 Ga0163162_101385932 258
213 3300013308 Ga0157375_10017237 Ga0157375_100172375 258
214 3300014325 Ga0163163_10022059 Ga0163163_100220594 258
215 3300014326 Ga0157380_10026333 Ga0157380_100263332 258
216 3300014745 Ga0157377_10002726 Ga0157377_100027263 258
217 3300014969 Ga0157376_10045894 Ga0157376_100458944 258
218 3300017792 Ga0163161_10027218 Ga0163161_100272182 258
219 3300025893 Ga0207682_10043715 Ga0207682_100437152 258
220 3300025900 Ga0207710_10003740 Ga0207710_100037403 258
221 3300025901 Ga0207688_10002001 Ga0207688_100020014 258
222 3300025904 Ga0207647_10016425 Ga0207647_100164253 258
223 3300025905 Ga0207685_10003505 Ga0207685_100035052 258
224 3300025908 Ga0207643_10001337 Ga0207643_100013379 258
225 3300025911 Ga0207654_10042196 Ga0207654_100421962 258
226 3300025914 Ga0207671_10144440 Ga0207671_101444402 258
227 3300025916 Ga0207663_10065805 Ga0207663_100658053 258
228 3300025918 Ga0207662_10001601 Ga0207662_100016015 258
229 3300025919 Ga0207657_10017992 Ga0207657_100179923 258
230 3300025920 Ga0207649_10074201 Ga0207649_100742012 258
231 3300025923 Ga0207681_10038114 Ga0207681_100381143 258
232 3300025924 Ga0207694_10306960 Ga0207694_103069602 258
233 3300025925 Ga0207650_10209043 Ga0207650_102090432 258
234 3300025926 Ga0207659_10009920 Ga0207659_100099205 258
235 3300025927 Ga0207687_10007796 Ga0207687_100077963 258
236 3300025933 Ga0207706_10006968 Ga0207706_100069686 258
237 3300025934 Ga0207686_10106106 Ga0207686_101061062 258
238 3300025935 Ga0207709_10004698 Ga0207709_100046986 258
239 3300025936 Ga0207670_10003900 Ga0207670_100039006 258
240 3300025937 Ga0207669_10002276 Ga0207669_100022766 258
241 3300025938 Ga0207704_10210183 Ga0207704_102101832 258
242 3300025940 Ga0207691_10000439 Ga0207691_1000043932 258
243 3300025941 Ga0207711_10022455 Ga0207711_100224552 258
244 3300025942 Ga0207689_10001936 Ga0207689_100019366 258
245 3300025960 Ga0207651_10034042 Ga0207651_100340422 258
246 3300025961 Ga0207712_10015429 Ga0207712_100154293 258
247 3300025986 Ga0207658_10185640 Ga0207658_101856402 258
248 3300026023 Ga0207677_10034616 Ga0207677_100346163 258
249 3300026067 Ga0207678_10096997 Ga0207678_100969972 258
250 3300026075 Ga0207708_10000624 Ga0207708_1000062415 258
251 3300026078 Ga0207702_10051329 Ga0207702_100513293 258
252 3300026088 Ga0207641_10134558 Ga0207641_101345583 258
253 3300026089 Ga0207648_10001430 Ga0207648_1000143011 258
254 3300026095 Ga0207676_10006351 Ga0207676_100063514 258
255 3300026116 Ga0207674_10144849 Ga0207674_101448492 258
256 3300026118 Ga0207675_100031722 Ga0207675_1000317224 258
257 3300026121 Ga0207683_10016637 Ga0207683_100166372 258
258 3300028379 Ga0268266_10019348 Ga0268266_100193483 258
259 3300028381 Ga0268264_10038041 Ga0268264_100380414 258
260 3300041512 Ga0451853_2535465 Ga0451853_2535465_95_907 258
261 3300046537 Ga0495598_0038376 Ga0495598_0038376_444_1256 258
262 3300046642 Ga0495634_0137146 Ga0495634_0137146_97_888 258
263 3300046665 Ga0495661_0150829 Ga0495661_0150829_370_1182 258
264 3300048903 Ga0496100_0323150 Ga0496100_0323150_335_1147 258
265 3300048904 Ga0496101_0008709 Ga0496101_0008709_5654_6466 258
266 3300048905 Ga0496102_0020794 Ga0496102_0020794_1263_2075 258
267 3300048906 Ga0496103_0001472 Ga0496103_0001472_11435_12247 258
268 3300048907 Ga0496104_0005758 Ga0496104_0005758_3503_4315 258
269 3300048908 Ga0496105_0024232 Ga0496105_0024232_3979_4791 258
270 3300048909 Ga0496106_0017933 Ga0496106_0017933_3268_4080 258
271 3300048910 Ga0496107_0002783 Ga0496107_0002783_4465_5277 258
272 3300048911 Ga0496108_0049453 Ga0496108_0049453_335_1147 258
273 3300048912 Ga0496109_0003828 Ga0496109_0003828_7025_7837 258
274 3300048913 Ga0496110_0016391 Ga0496110_0016391_2616_3428 258
275 3300048914 Ga0496111_0008225 Ga0496111_0008225_5083_5895 258
276 3300048915 Ga0496112_0041124 Ga0496112_0041124_2759_3571 258
277 3300048916 Ga0496113_0010915 Ga0496113_0010915_3731_4543 258
278 3300048917 Ga0496114_0052882 Ga0496114_0052882_1911_2723 258
279 3300048918 Ga0496115_0004706 Ga0496115_0004706_5819_6631 258
280 3300050489 nmdc:mga03683_62302_c2 nmdc:mga03683_62302_c2_156_974 258
281 3300050511 nmdc:mga08y16_93914_c1 nmdc:mga08y16_93914_c1_574_1392 258
282 3300006847 Ga0075431_100013819 Ga0075431_1000138191 259
283 3300006880 Ga0075429_100034156 Ga0075429_1000341562 259
284 3300009147 Ga0114129_10012821 Ga0114129_100128214 259
285 3300050508 nmdc:mga09592_36808_c1 nmdc:mga09592_36808_c1_2065_2880 259
286 3300050509 nmdc:mga0qj67_29600_c1 nmdc:mga0qj67_29600_c1_2244_3059 259
287 3300050510 nmdc:mga06r32_27244_c1 nmdc:mga06r32_27244_c1_560_1375 259
288 3300013297 Ga0157378_10188256 Ga0157378_101882564 261
289 3300037312 Ga0395899_0003310 Ga0395899_0003310_10255_11067 261
290 3300037312 Ga0395899_0010414 Ga0395899_0010414_566_1378 261
291 3300037418 Ga0395900_0002147 Ga0395900_0002147_19818_20630 261
292 3300037418 Ga0395900_0010578 Ga0395900_0010578_6577_7389 261
293 3300037466 Ga0395898_0013547 Ga0395898_0013547_477_1289 261
294 3300037466 Ga0395898_0015323 Ga0395898_0015323_6337_7149 261
295 3300038443 Ga0395901_0006050 Ga0395901_0006050_1483_2295 261
296 3300038443 Ga0395901_0008240 Ga0395901_0008240_5801_6613 261
297 3300005983 Ga0081540_1097927 Ga0081540_10979272 262
298 3300006028 Ga0070717_10383486 Ga0070717_103834862 262
299 3300048904 Ga0496101_0240486 Ga0496101_0240486_45_833 262
300 3300003911 JGI25405J52794_10007826 JGI25405J52794_100078262 263
301 3300005331 Ga0070670_100310896 Ga0070670_1003108962 263
302 3300005335 Ga0070666_10015039 Ga0070666_100150394 263
303 3300005343 Ga0070687_100119675 Ga0070687_1001196752 263
304 3300005344 Ga0070661_100311389 Ga0070661_1003113892 263
305 3300005365 Ga0070688_100345005 Ga0070688_1003450051 263
306 3300005434 Ga0070709_10005456 Ga0070709_100054563 263
307 3300005435 Ga0070714_100648040 Ga0070714_1006480401 263
308 3300005436 Ga0070713_100001523 Ga0070713_1000015235 263
309 3300005437 Ga0070710_10040802 Ga0070710_100408022 263
310 3300005439 Ga0070711_100035728 Ga0070711_1000357283 263
311 3300005456 Ga0070678_100014741 Ga0070678_1000147414 263
312 3300005535 Ga0070684_100184479 Ga0070684_1001844792 263
313 3300005548 Ga0070665_100241968 Ga0070665_1002419682 263
314 3300005617 Ga0068859_100157297 Ga0068859_1001572972 263
315 3300005843 Ga0068860_100345539 Ga0068860_1003455392 263
316 3300005937 Ga0081455_10000695 Ga0081455_100006952 263
317 3300006028 Ga0070717_10000396 Ga0070717_1000039623 263
318 3300006163 Ga0070715_10011020 Ga0070715_100110203 263
319 3300006173 Ga0070716_100008465 Ga0070716_1000084654 263
320 3300006931 Ga0097620_100157294 Ga0097620_1001572942 263
321 3300009011 Ga0105251_10052152 Ga0105251_100521522 263
322 3300009148 Ga0105243_10017816 Ga0105243_100178162 263
323 3300009176 Ga0105242_10140060 Ga0105242_101400602 263
324 3300010375 Ga0105239_10475101 Ga0105239_104751012 263
325 3300011119 Ga0105246_10329946 Ga0105246_103299462 263
326 3300014969 Ga0157376_10144570 Ga0157376_101445702 263
327 3300025898 Ga0207692_10008266 Ga0207692_100082662 263
328 3300025901 Ga0207688_10112678 Ga0207688_101126782 263
329 3300025905 Ga0207685_10016945 Ga0207685_100169452 263
330 3300025915 Ga0207693_10003570 Ga0207693_100035709 263
331 3300025916 Ga0207663_10051331 Ga0207663_100513312 263
332 3300025928 Ga0207700_10000379 Ga0207700_1000037910 263
333 3300025929 Ga0207664_10005567 Ga0207664_100055672 263
334 3300025931 Ga0207644_10017238 Ga0207644_100172384 263
335 3300025932 Ga0207690_10429338 Ga0207690_104293382 263
336 3300025933 Ga0207706_10009390 Ga0207706_100093904 263
337 3300025939 Ga0207665_10000286 Ga0207665_1000028614 263
338 3300025942 Ga0207689_10141671 Ga0207689_101416712 263
339 3300025944 Ga0207661_10060251 Ga0207661_100602512 263
340 3300025960 Ga0207651_10224298 Ga0207651_102242982 263
341 3300026023 Ga0207677_10205908 Ga0207677_102059082 263
342 3300026035 Ga0207703_10074613 Ga0207703_100746132 263
343 3300026067 Ga0207678_10038173 Ga0207678_100381734 263
344 3300026078 Ga0207702_10579059 Ga0207702_105790592 263
345 3300026088 Ga0207641_10237851 Ga0207641_102378512 263
346 3300026121 Ga0207683_10006569 Ga0207683_100065694 263
347 3300026142 Ga0207698_10106294 Ga0207698_101062942 263
348 3300028379 Ga0268266_10251480 Ga0268266_102514802 263
349 3300028381 Ga0268264_10123485 Ga0268264_101234851 263
350 3300048903 Ga0496100_0058563 Ga0496100_0058563_276_1094 263
351 3300048904 Ga0496101_0013970 Ga0496101_0013970_3996_4814 263
352 3300048906 Ga0496103_0234193 Ga0496103_0234193_249_1064 263
353 3300048909 Ga0496106_0047636 Ga0496106_0047636_628_1446 263
354 3300048910 Ga0496107_0032107 Ga0496107_0032107_1886_2704 263
355 3300048915 Ga0496112_0096675 Ga0496112_0096675_1542_2360 263
356 3300048917 Ga0496114_0011545 Ga0496114_0011545_4958_5776 263
357 3300048918 Ga0496115_0023902 Ga0496115_0023902_984_1802 263
358 3300025972 Ga0207668_10233938 Ga0207668_102339382 264
359 3300048903 Ga0496100_0518992 Ga0496100_0518992_112_906 264
360 3300048905 Ga0496102_0363902 Ga0496102_0363902_377_1186 264
361 3300049569 Ga0501032_0132357 Ga0501032_0132357_541_1359 264
362 3300049574 Ga0501038_0121412 Ga0501038_0121412_24_842 264
363 3300049586 Ga0501070_0315084 Ga0501070_0315084_276_1094 264
364 3300049823 Ga0501044_0020447 Ga0501044_0020447_5196_6014 264
365 3300005331 Ga0070670_100007568 Ga0070670_1000075684 265
366 3300005339 Ga0070660_100204423 Ga0070660_1002044232 265
367 3300005355 Ga0070671_100017777 Ga0070671_1000177775 265
368 3300005364 Ga0070673_100048528 Ga0070673_1000485283 265
369 3300005366 Ga0070659_100093279 Ga0070659_1000932792 265
370 3300005434 Ga0070709_10099842 Ga0070709_100998422 265
371 3300005435 Ga0070714_100648601 Ga0070714_1006486012 265
372 3300005436 Ga0070713_100088503 Ga0070713_1000885032 265
373 3300005439 Ga0070711_100044247 Ga0070711_1000442472 265
374 3300005439 Ga0070711_100060019 Ga0070711_1000600193 265
375 3300005548 Ga0070665_100016548 Ga0070665_1000165487 265
376 3300006175 Ga0070712_100000600 Ga0070712_10000060016 265
377 3300009545 Ga0105237_10239725 Ga0105237_102397252 265
378 3300014325 Ga0163163_10040155 Ga0163163_100401556 265
379 3300014968 Ga0157379_10207550 Ga0157379_102075502 265
380 3300024225 Ga0224572_1014624 Ga0224572_10146242 265
381 3300024227 Ga0228598_1001606 Ga0228598_10016064 265
382 3300025906 Ga0207699_10186566 Ga0207699_101865662 265
383 3300025915 Ga0207693_10007806 Ga0207693_100078064 265
384 3300025916 Ga0207663_10033349 Ga0207663_100333492 265
385 3300025925 Ga0207650_10002486 Ga0207650_100024868 265
386 3300025933 Ga0207706_10101056 Ga0207706_101010563 265
387 3300025939 Ga0207665_10102604 Ga0207665_101026042 265
388 3300025960 Ga0207651_10207301 Ga0207651_102073011 265
389 3300035118 Ga0373954_0011115 Ga0373954_0011115_2619_3431 265
390 3300035119 Ga0373956_0062032 Ga0373956_0062032_683_1495 265
391 3300035170 Ga0373943_0061648 Ga0373943_0061648_428_1240 265
392 3300036401 Ga0373937_0089986 Ga0373937_0089986_568_1380 265
393 3300046454 Ga0495592_0086790 Ga0495592_0086790_1125_1937 265
394 3300046459 Ga0495629_0050912 Ga0495629_0050912_553_1365 265
395 3300046462 Ga0495651_0015568 Ga0495651_0015568_875_1687 265
396 3300046476 Ga0495662_0029966 Ga0495662_0029966_770_1582 265
397 3300046477 Ga0495664_0073669 Ga0495664_0073669_873_1685 265
398 3300046529 Ga0495652_0126708 Ga0495652_0126708_867_1679 265
399 3300046559 Ga0495667_0087500 Ga0495667_0087500_571_1383 265
400 3300046675 Ga0495657_0080100 Ga0495657_0080100_620_1432 265
401 3300046679 Ga0495623_0055409 Ga0495623_0055409_613_1425 265
402 3300046680 Ga0495646_0110395 Ga0495646_0110395_252_1052 265
403 3300047444 Ga0495675_0050487 Ga0495675_0050487_1135_1947 265
404 3300047673 Ga0495593_0122668 Ga0495593_0122668_136_948 265
405 3300048088 Ga0495602_0030760 Ga0495602_0030760_3795_4607 265
406 3300048912 Ga0496109_0343865 Ga0496109_0343865_484_1296 265
407 3300048913 Ga0496110_0234443 Ga0496110_0234443_126_938 265
408 3300053077 Ga0495601_0087248 Ga0495601_0087248_189_989 265
409 3300054114 Ga0501084_0706929 Ga0501084_0706929_26_826 265
410 3300061734 Ga0530510_0205522 Ga0530510_0205522_36_836 265
411 3300061734 Ga0530510_0267454 Ga0530510_0267454_227_1027 265
412 iso_pu_bacteria 2510461069 2510839829 265
413 iso_pu_bacteria 2510917026 2511171327 265
414 iso_pu_bacteria 2585427633 2585994399 265
415 iso_pu_bacteria 2585427634 2585998858 265
416 iso_pu_bacteria 2600254933 2600374700 265
417 iso_pu_bacteria 2643221653 2644297635 265
418 iso_pu_bacteria 2643221719 2644655888 265
419 iso_pu_bacteria 2738541317 2738948220 265
420 iso_pu_bacteria 2775507049 2776912091 265
421 iso_pu_bacteria 2818991272 2819243293 265
422 iso_pu_bacteria 2818991461 2819686319 265
423 iso_pu_bacteria 2854896431 2854898266 265
424 iso_pu_bacteria 2854916844 2854920036 265
425 iso_pu_bacteria 2899803654 2899805267 265
426 iso_pu_bacteria 2913308742 2913313439 265
427 iso_pu_bacteria 2929138655 2929138989 265
428 iso_pu_bacteria 2989776772 2989777423 265
429 iso_pu_bacteria 8005246636 8005247386 265
430 iso_pu_bacteria 8005658619 8005660396 265
431 3300048905 Ga0496102_0433503 Ga0496102_0433503_217_1020 266
432 3300048907 Ga0496104_0000369 Ga0496104_0000369_28949_29752 266
433 3300048908 Ga0496105_0001722 Ga0496105_0001722_2035_2838 266
434 3300048908 Ga0496105_0007091 Ga0496105_0007091_1840_2643 266
435 3300048912 Ga0496109_0097700 Ga0496109_0097700_101_904 266
436 3300048915 Ga0496112_0200508 Ga0496112_0200508_837_1640 266
437 3300048917 Ga0496114_0018863 Ga0496114_0018863_958_1761 266
438 3300048918 Ga0496115_0121906 Ga0496115_0121906_27_830 266
439 3300048918 Ga0496115_0156196 Ga0496115_0156196_665_1468 266
440 3300048918 Ga0496115_0438697 Ga0496115_0438697_141_944 266
441 3300053077 Ga0495601_0199566 Ga0495601_0199566_166_969 266
442 3300053085 Ga0495619_0114545 Ga0495619_0114545_372_1175 266
443 3300005329 Ga0070683_100200212 Ga0070683_1002002122 267
444 3300005339 Ga0070660_100041752 Ga0070660_1000417523 267
445 3300005340 Ga0070689_100018210 Ga0070689_1000182102 267
446 3300005343 Ga0070687_100017014 Ga0070687_1000170142 267
447 3300005344 Ga0070661_100138531 Ga0070661_1001385312 267
448 3300005366 Ga0070659_100468469 Ga0070659_1004684691 267
449 3300005535 Ga0070684_100276642 Ga0070684_1002766422 267
450 3300005539 Ga0068853_100148947 Ga0068853_1001489472 267
451 3300005616 Ga0068852_100609751 Ga0068852_1006097512 267
452 3300005617 Ga0068859_100174553 Ga0068859_1001745533 267
453 3300005834 Ga0068851_10262417 Ga0068851_102624172 267
454 3300006178 Ga0075367_10000931 Ga0075367_100009316 267
455 3300006847 Ga0075431_100826221 Ga0075431_1008262211 267
456 3300006931 Ga0097620_100174546 Ga0097620_1001745463 267
457 3300009177 Ga0105248_10337537 Ga0105248_103375372 267
458 3300025912 Ga0207707_10002095 Ga0207707_1000209519 267
459 3300025918 Ga0207662_10206364 Ga0207662_102063641 267
460 3300025919 Ga0207657_10127407 Ga0207657_101274073 267
461 3300025921 Ga0207652_10024326 Ga0207652_100243262 267
462 3300025936 Ga0207670_10065705 Ga0207670_100657052 267
463 3300025949 Ga0207667_10140860 Ga0207667_101408603 267
464 3300026089 Ga0207648_10712812 Ga0207648_107128121 267
465 3300050490 nmdc:mga03n38_180047_c1 nmdc:mga03n38_180047_c1_235_1053 267
466 3300050491 nmdc:mga00v17_153005_c1 nmdc:mga00v17_153005_c1_291_1109 267
467 3300050492 nmdc:mga0yw44_7399_c1 nmdc:mga0yw44_7399_c1_339_1157 267
468 3300005330 Ga0070690_100107758 Ga0070690_1001077583 268
469 3300005338 Ga0068868_100049608 Ga0068868_1000496083 268
470 3300005356 Ga0070674_100164621 Ga0070674_1001646212 268
471 3300005364 Ga0070673_100529387 Ga0070673_1005293871 268
472 3300005530 Ga0070679_100095294 Ga0070679_1000952942 268
473 3300005842 Ga0068858_100050186 Ga0068858_1000501862 268
474 3300006038 Ga0075365_10006190 Ga0075365_100061905 268
475 3300006846 Ga0075430_100002695 Ga0075430_1000026953 268
476 3300009098 Ga0105245_10006042 Ga0105245_100060421 268
477 3300009147 Ga0114129_10572031 Ga0114129_105720313 268
478 3300009553 Ga0105249_10610394 Ga0105249_106103942 268
479 3300013297 Ga0157378_10074855 Ga0157378_100748553 268
480 3300014326 Ga0157380_10108259 Ga0157380_101082592 268
481 3300025921 Ga0207652_10070802 Ga0207652_100708023 268
482 3300025937 Ga0207669_10095076 Ga0207669_100950762 268
483 3300025986 Ga0207658_10537504 Ga0207658_105375041 268
484 3300026023 Ga0207677_10099552 Ga0207677_100995523 268
485 3300026121 Ga0207683_10154405 Ga0207683_101544053 268
486 3300044694 Ga0466963_0051924 Ga0466963_0051924_1273_2079 268
487 3300044694 Ga0466963_0319115 Ga0466963_0319115_243_1049 268
488 3300044719 Ga0466971_0007301 Ga0466971_0007301_2195_3001 268
489 3300045836 Ga0466958_0130907 Ga0466958_0130907_518_1324 268
490 3300050492 nmdc:mga0yw44_5247_c1 nmdc:mga0yw44_5247_c1_4261_5070 268
491 3300050509 nmdc:mga0qj67_14_c1 nmdc:mga0qj67_14_c1_39943_40752 268
492 3300050510 nmdc:mga06r32_707901_c1 nmdc:mga06r32_707901_c1_128_937 268
493 3300061719 Ga0466962_0009869 Ga0466962_0009869_936_1742 268
494 3300005262 Ga0065165_1003754 Ga0065165_100375410 269
495 3300005436 Ga0070713_100027849 Ga0070713_1000278494 269
496 3300005468 Ga0070707_100009211 Ga0070707_1000092115 269
497 3300005518 Ga0070699_100003057 Ga0070699_1000030572 269
498 3300005518 Ga0070699_100292960 Ga0070699_1002929602 269
499 3300005536 Ga0070697_100148569 Ga0070697_1001485692 269
500 3300005548 Ga0070665_100026572 Ga0070665_1000265722 269
501 3300005937 Ga0081455_10086707 Ga0081455_100867072 269
502 3300006038 Ga0075365_10002013 Ga0075365_100020133 269
503 3300006844 Ga0075428_100010816 Ga0075428_1000108164 269
504 3300006871 Ga0075434_100040249 Ga0075434_1000402494 269
505 3300006871 Ga0075434_100120511 Ga0075434_1001205113 269
506 3300007076 Ga0075435_100062344 Ga0075435_1000623442 269
507 3300007265 Ga0099794_10000521 Ga0099794_100005213 269
508 3300007788 Ga0099795_10005655 Ga0099795_100056551 269
509 3300009094 Ga0111539_10037752 Ga0111539_100377523 269
510 3300009147 Ga0114129_10003643 Ga0114129_1000364312 269
511 3300009148 Ga0105243_10118098 Ga0105243_101180981 269
512 3300010159 Ga0099796_10038869 Ga0099796_100388692 269
513 3300011119 Ga0105246_10192305 Ga0105246_101923052 269
514 3300013100 Ga0157373_10029938 Ga0157373_100299383 269
515 3300013306 Ga0163162_10155852 Ga0163162_101558522 269
516 3300021361 Ga0213872_10014346 Ga0213872_100143462 269
517 3300025910 Ga0207684_10018056 Ga0207684_100180565 269
518 3300025915 Ga0207693_10178729 Ga0207693_101787292 269
519 3300025928 Ga0207700_10338193 Ga0207700_103381932 269
520 3300025931 Ga0207644_10084280 Ga0207644_100842802 269
521 3300028379 Ga0268266_10028097 Ga0268266_100280974 269
522 3300035083 Ga0373926_0035679 Ga0373926_0035679_829_1641 269
523 3300035113 Ga0373936_0070849 Ga0373936_0070849_233_1045 269
524 3300035170 Ga0373943_0037247 Ga0373943_0037247_628_1440 269
525 3300035691 Ga0373931_0129083 Ga0373931_0129083_340_1152 269
526 3300035695 Ga0373927_0050433 Ga0373927_0050433_94_906 269
527 3300035695 Ga0373927_0235516 Ga0373927_0235516_291_1103 269
528 3300035725 Ga0373947_0016348 Ga0373947_0016348_758_1570 269
529 3300037068 Ga0373925_0282705 Ga0373925_0282705_407_1219 269
530 3300039447 Ga0436361_0166397 Ga0436361_0166397_17345_18157 269
531 3300044842 Ga0466957_0024459 Ga0466957_0024459_1449_2258 269
532 3300045836 Ga0466958_0355932 Ga0466958_0355932_25_834 269
533 3300046454 Ga0495592_0165449 Ga0495592_0165449_301_1116 269
534 3300046455 Ga0495603_0018541 Ga0495603_0018541_395_1207 269
535 3300046459 Ga0495629_0020542 Ga0495629_0020542_1125_1940 269
536 3300046459 Ga0495629_0075114 Ga0495629_0075114_1221_2033 269
537 3300046459 Ga0495629_0090176 Ga0495629_0090176_844_1656 269
538 3300046459 Ga0495629_0156072 Ga0495629_0156072_746_1555 269
539 3300046460 Ga0495638_0048301 Ga0495638_0048301_484_1299 269
540 3300046461 Ga0495641_0035588 Ga0495641_0035588_355_1167 269
541 3300046461 Ga0495641_0048346 Ga0495641_0048346_339_1151 269
542 3300046472 Ga0495580_0138088 Ga0495580_0138088_668_1480 269
543 3300046473 Ga0495582_0079933 Ga0495582_0079933_931_1743 269
544 3300046475 Ga0495639_0061445 Ga0495639_0061445_469_1284 269
545 3300046477 Ga0495664_0147746 Ga0495664_0147746_297_1112 269
546 3300046499 Ga0495594_0278971 Ga0495594_0278971_62_874 269
547 3300046511 Ga0495608_0069090 Ga0495608_0069090_1091_1900 269
548 3300046511 Ga0495608_0194482 Ga0495608_0194482_378_1190 269
549 3300046517 Ga0495630_0269842 Ga0495630_0269842_340_1152 269
550 3300046524 Ga0495648_0022351 Ga0495648_0022351_1685_2500 269
551 3300046533 Ga0495640_0066410 Ga0495640_0066410_1012_1824 269
552 3300046533 Ga0495640_0256270 Ga0495640_0256270_199_1011 269
553 3300046537 Ga0495598_0010258 Ga0495598_0010258_1249_2061 269
554 3300046539 Ga0495621_0079131 Ga0495621_0079131_391_1203 269
555 3300046557 Ga0495622_0037360 Ga0495622_0037360_1288_2103 269
556 3300046558 Ga0495633_0024998 Ga0495633_0024998_675_1487 269
557 3300046615 Ga0495656_0013754 Ga0495656_0013754_2078_2890 269
558 3300046642 Ga0495634_0060532 Ga0495634_0060532_1465_2280 269
559 3300046642 Ga0495634_0156980 Ga0495634_0156980_401_1213 269
560 3300046648 Ga0495611_0147867 Ga0495611_0147867_199_1011 269
561 3300046663 Ga0495635_0052506 Ga0495635_0052506_1125_1940 269
562 3300046665 Ga0495661_0025055 Ga0495661_0025055_881_1693 269
563 3300046674 Ga0495588_0053170 Ga0495588_0053170_1079_1894 269
564 3300046683 Ga0495658_0045946 Ga0495658_0045946_920_1732 269
565 3300046689 Ga0495613_0128003 Ga0495613_0128003_356_1168 269
566 3300046690 Ga0495624_0118515 Ga0495624_0118515_233_1045 269
567 3300046692 Ga0495671_0137294 Ga0495671_0137294_255_1067 269
568 3300046809 Ga0495600_0043987 Ga0495600_0043987_871_1686 269
569 3300047315 Ga0495581_0198289 Ga0495581_0198289_344_1156 269
570 3300047317 Ga0495604_0322079 Ga0495604_0322079_141_953 269
571 3300048088 Ga0495602_0262551 Ga0495602_0262551_80_895 269
572 3300048091 Ga0495626_0040178 Ga0495626_0040178_1265_2077 269
573 3300048905 Ga0496102_0033680 Ga0496102_0033680_2671_3483 269
574 3300048906 Ga0496103_0106759 Ga0496103_0106759_729_1541 269
575 3300048907 Ga0496104_0004766 Ga0496104_0004766_7035_7847 269
576 3300048908 Ga0496105_0004314 Ga0496105_0004314_2505_3317 269
577 3300048910 Ga0496107_0017035 Ga0496107_0017035_2690_3502 269
578 3300048911 Ga0496108_0000746 Ga0496108_0000746_7335_8147 269
579 3300048912 Ga0496109_0005286 Ga0496109_0005286_8506_9318 269
580 3300048913 Ga0496110_0004442 Ga0496110_0004442_8239_9051 269
581 3300048914 Ga0496111_0000317 Ga0496111_0000317_5024_5842 269
582 3300048914 Ga0496111_0001412 Ga0496111_0001412_8509_9321 269
583 3300048914 Ga0496111_0188492 Ga0496111_0188492_599_1411 269
584 3300048915 Ga0496112_0053814 Ga0496112_0053814_1254_2066 269
585 3300048915 Ga0496112_0068721 Ga0496112_0068721_2355_3167 269
586 3300048916 Ga0496113_0024381 Ga0496113_0024381_1889_2701 269
587 3300048921 Ga0496118_0065934 Ga0496118_0065934_1803_2624 269
588 3300048923 Ga0496120_0061953 Ga0496120_0061953_941_1762 269
589 3300048924 Ga0496121_0000001 Ga0496121_0000001_441894_442715 269
590 3300048925 Ga0496122_0000009 Ga0496122_0000009_518705_519523 269
591 3300048925 Ga0496122_0091780 Ga0496122_0091780_1033_1854 269
592 3300048926 Ga0496123_0000020 Ga0496123_0000020_323263_324081 269
593 3300048926 Ga0496123_0069542 Ga0496123_0069542_379_1200 269
594 3300048927 Ga0496124_0027813 Ga0496124_0027813_4189_5007 269
595 3300048927 Ga0496124_0208241 Ga0496124_0208241_92_910 269
596 3300048927 Ga0496124_0218241 Ga0496124_0218241_226_1047 269
597 3300048928 Ga0496125_0000001 Ga0496125_0000001_553916_554737 269
598 3300049744 Ga0501083_0147934 Ga0501083_0147934_532_1344 269
599 3300049744 Ga0501083_0320540 Ga0501083_0320540_46_864 269
600 3300050491 nmdc:mga00v17_384419_c1 nmdc:mga00v17_384419_c1_53_871 269
601 3300050492 nmdc:mga0yw44_1338_c1 nmdc:mga0yw44_1338_c1_1923_2738 269
602 3300050492 nmdc:mga0yw44_144700_c1 nmdc:mga0yw44_144700_c1_111_923 269
603 3300050507 nmdc:mga05p37_30958_c1 nmdc:mga05p37_30958_c1_2632_3444 269
604 3300050512 nmdc:mga0n895_473344_c1 nmdc:mga0n895_473344_c1_210_1022 269
605 3300050512 nmdc:mga0n895_491166_c1 nmdc:mga0n895_491166_c1_38_847 269
606 3300050513 nmdc:mga0rr50_192177_c1 nmdc:mga0rr50_192177_c1_229_1041 269
607 3300050514 nmdc:mga08x19_284094_c1 nmdc:mga08x19_284094_c1_103_912 269
608 3300053077 Ga0495601_0086200 Ga0495601_0086200_809_1624 269
609 3300053084 Ga0495595_0153701 Ga0495595_0153701_205_1017 269
610 3300053125 Ga0500618_000151 Ga0500618_000151_13054_13872 269
611 3300053125 Ga0500618_016698 Ga0500618_016698_627_1445 269
612 3300053148 Ga0500590_004280 Ga0500590_004280_5030_5845 269
613 3300053153 Ga0500616_0000443 Ga0500616_0000443_13127_13945 269
614 3300053161 Ga0500634_0027046 Ga0500634_0027046_738_1550 269
615 3300053177 Ga0500636_0000010 Ga0500636_0000010_88263_89075 269
616 3300005327 Ga0070658_10013155 Ga0070658_100131553 270
617 3300005327 Ga0070658_10020050 Ga0070658_100200505 270
618 3300005327 Ga0070658_10459182 Ga0070658_104591822 270
619 3300005336 Ga0070680_100023201 Ga0070680_1000232012 270
620 3300005339 Ga0070660_100018546 Ga0070660_1000185463 270
621 3300005530 Ga0070679_100080514 Ga0070679_1000805141 270
622 3300005563 Ga0068855_100132818 Ga0068855_1001328182 270
623 3300005563 Ga0068855_100277219 Ga0068855_1002772192 270
624 3300005616 Ga0068852_100170832 Ga0068852_1001708323 270
625 3300005616 Ga0068852_100382741 Ga0068852_1003827412 270
626 3300005842 Ga0068858_100095834 Ga0068858_1000958341 270
627 3300006871 Ga0075434_100065948 Ga0075434_1000659482 270
628 3300009148 Ga0105243_10082939 Ga0105243_100829392 270
629 3300009545 Ga0105237_10228040 Ga0105237_102280403 270
630 3300009551 Ga0105238_10041417 Ga0105238_100414171 270
631 3300013105 Ga0157369_10108963 Ga0157369_101089633 270
632 3300013296 Ga0157374_10015034 Ga0157374_100150342 270
633 3300013307 Ga0157372_10172693 Ga0157372_101726933 270
634 3300013308 Ga0157375_10320450 Ga0157375_103204502 270
635 3300014969 Ga0157376_10602366 Ga0157376_106023662 270
636 3300020082 Ga0206353_11965552 Ga0206353_119655523 270
637 3300025909 Ga0207705_10141766 Ga0207705_101417662 270
638 3300025909 Ga0207705_10435285 Ga0207705_104352852 270
639 3300025912 Ga0207707_10087772 Ga0207707_100877723 270
640 3300025917 Ga0207660_10093076 Ga0207660_100930763 270
641 3300025917 Ga0207660_10097784 Ga0207660_100977842 270
642 3300025919 Ga0207657_10007357 Ga0207657_100073579 270
643 3300025921 Ga0207652_10036717 Ga0207652_100367173 270
644 3300025921 Ga0207652_10411903 Ga0207652_104119032 270
645 3300025938 Ga0207704_10147497 Ga0207704_101474972 270
646 3300025940 Ga0207691_10432927 Ga0207691_104329272 270
647 3300025949 Ga0207667_10019155 Ga0207667_100191553 270
648 3300025949 Ga0207667_10554410 Ga0207667_105544102 270
649 3300026041 Ga0207639_10093322 Ga0207639_100933223 270
650 3300026041 Ga0207639_10447774 Ga0207639_104477742 270
651 3300026078 Ga0207702_10827603 Ga0207702_108276031 270
652 3300026142 Ga0207698_10311069 Ga0207698_103110691 270
653 3300031235 Ga0265330_10051258 Ga0265330_100512582 270
654 3300031249 Ga0265339_10016485 Ga0265339_100164852 270
655 3300031249 Ga0265339_10122867 Ga0265339_101228672 270
656 3300031456 Ga0307513_10299406 Ga0307513_102994061 270
657 3300031712 Ga0265342_10001643 Ga0265342_1000164311 270
658 3300035117 Ga0373953_0003588 Ga0373953_0003588_2563_3375 270
659 3300035120 Ga0373957_0002366 Ga0373957_0002366_3509_4321 270
660 3300035172 Ga0373955_0009202 Ga0373955_0009202_673_1485 270
661 3300035410 Ga0373924_0042484 Ga0373924_0042484_1006_1818 270
662 3300035691 Ga0373931_0255098 Ga0373931_0255098_161_976 270
663 3300035724 Ga0373933_0004760 Ga0373933_0004760_1651_2463 270
664 3300036401 Ga0373937_0014163 Ga0373937_0014163_2768_3580 270
665 3300038443 Ga0395901_0243431 Ga0395901_0243431_784_1596 270
666 3300044694 Ga0466963_0198923 Ga0466963_0198923_378_1190 270
667 3300044694 Ga0466963_0211403 Ga0466963_0211403_58_870 270
668 3300044694 Ga0466963_0280349 Ga0466963_0280349_141_959 270
669 3300044719 Ga0466971_0156615 Ga0466971_0156615_235_1047 270
670 3300045836 Ga0466958_0044559 Ga0466958_0044559_1323_2135 270
671 3300045976 Ga0466967_0004231 Ga0466967_0004231_3541_4353 270
672 3300045976 Ga0466967_0032121 Ga0466967_0032121_34_846 270
673 3300046454 Ga0495592_0025827 Ga0495592_0025827_3443_4255 270
674 3300046460 Ga0495638_0032977 Ga0495638_0032977_2208_3023 270
675 3300046462 Ga0495651_0020419 Ga0495651_0020419_4129_4941 270
676 3300046463 Ga0495653_0003035 Ga0495653_0003035_7658_8470 270
677 3300046477 Ga0495664_0020131 Ga0495664_0020131_688_1500 270
678 3300046511 Ga0495608_0007440 Ga0495608_0007440_2076_2888 270
679 3300046517 Ga0495630_0104057 Ga0495630_0104057_1134_1946 270
680 3300046529 Ga0495652_0171116 Ga0495652_0171116_789_1601 270
681 3300046533 Ga0495640_0006838 Ga0495640_0006838_6589_7401 270
682 3300046536 Ga0495587_0013020 Ga0495587_0013020_3417_4229 270
683 3300046543 Ga0495645_0008693 Ga0495645_0008693_2211_3023 270
684 3300046559 Ga0495667_0002926 Ga0495667_0002926_7878_8690 270
685 3300046663 Ga0495635_0020091 Ga0495635_0020091_1634_2446 270
686 3300046678 Ga0495599_0043661 Ga0495599_0043661_1362_2174 270
687 3300046679 Ga0495623_0004877 Ga0495623_0004877_6224_7036 270
688 3300046680 Ga0495646_0033048 Ga0495646_0033048_1638_2450 270
689 3300046690 Ga0495624_0034363 Ga0495624_0034363_203_1015 270
690 3300046809 Ga0495600_0010920 Ga0495600_0010920_895_1707 270
691 3300047317 Ga0495604_0036466 Ga0495604_0036466_2861_3673 270
692 3300047319 Ga0495674_0051448 Ga0495674_0051448_1098_1910 270
693 3300047322 Ga0495680_0011642 Ga0495680_0011642_5958_6770 270
694 3300047444 Ga0495675_0001056 Ga0495675_0001056_13725_14537 270
695 3300047673 Ga0495593_0030736 Ga0495593_0030736_1201_2013 270
696 3300048088 Ga0495602_0003273 Ga0495602_0003273_523_1335 270
697 3300048907 Ga0496104_0011977 Ga0496104_0011977_2331_3143 270
698 3300049570 Ga0501033_0011532 Ga0501033_0011532_522_1334 270
699 3300049571 Ga0501034_0133060 Ga0501034_0133060_707_1519 270
700 3300049572 Ga0501036_0047994 Ga0501036_0047994_217_1029 270
701 3300049572 Ga0501036_0427363 Ga0501036_0427363_203_1015 270
702 3300049573 Ga0501037_0019405 Ga0501037_0019405_3668_4480 270
703 3300049575 Ga0501039_0026191 Ga0501039_0026191_2819_3631 270
704 3300049579 Ga0501043_0167700 Ga0501043_0167700_139_951 270
705 3300049580 Ga0501046_0292076 Ga0501046_0292076_215_1027 270
706 3300049581 Ga0501047_0019246 Ga0501047_0019246_5040_5852 270
707 3300049581 Ga0501047_0135576 Ga0501047_0135576_294_1106 270
708 3300049586 Ga0501070_0051457 Ga0501070_0051457_2560_3372 270
709 3300049586 Ga0501070_0264200 Ga0501070_0264200_98_910 270
710 3300049589 Ga0501073_0145374 Ga0501073_0145374_461_1273 270
711 3300049822 Ga0501035_0360771 Ga0501035_0360771_29_841 270
712 3300049823 Ga0501044_0175955 Ga0501044_0175955_182_994 270
713 3300050512 nmdc:mga0n895_37769_c1 nmdc:mga0n895_37769_c1_3170_3982 270
714 3300050512 nmdc:mga0n895_903937_c1 nmdc:mga0n895_903937_c1_13_828 270
715 3300053077 Ga0495601_0039255 Ga0495601_0039255_768_1580 270
716 3300053078 Ga0495612_0023041 Ga0495612_0023041_917_1729 270
717 3300053084 Ga0495595_0005086 Ga0495595_0005086_1003_1815 270
718 3300053085 Ga0495619_0044421 Ga0495619_0044421_1337_2149 270
719 3300053134 Ga0500658_0076030 Ga0500658_0076030_25_840 270
720 3300053142 Ga0500577_0039019 Ga0500577_0039019_420_1235 270
721 2209111006 2214544950 2213593747 271
722 3300000042 ARSoilYngRDRAFT_c00466 ARSoilYngRDRAFT_004663 271
723 3300000043 ARcpr5yngRDRAFT_c000049 ARcpr5yngRDRAFT_0000495 271
724 3300000044 ARSoilOldRDRAFT_c000098 ARSoilOldRDRAFT_00009814 271
725 3300000045 ARCol0oldRDRAFT_c02080 ARCol0oldRDRAFT_020801 271
726 3300000652 ARCol0yngRDRAFT_1000072 ARCol0yngRDRAFT_10000725 271
727 3300001977 JGI24746J21847_1000258 JGI24746J21847_10002582 271
728 3300001978 JGI24747J21853_1000085 JGI24747J21853_10000854 271
729 3300001989 JGI24739J22299_10001196 JGI24739J22299_100011963 271
730 3300001990 JGI24737J22298_10029747 JGI24737J22298_100297472 271
731 3300002070 JGI24750J21931_1000008 JGI24750J21931_100000816 271
732 3300002073 JGI24745J21846_1002238 JGI24745J21846_10022382 271
733 3300002074 JGI24748J21848_1000236 JGI24748J21848_10002363 271
734 3300002075 JGI24738J21930_10006575 JGI24738J21930_100065753 271
735 3300002076 JGI24749J21850_1000740 JGI24749J21850_10007403 271
736 3300002077 JGI24744J21845_10001834 JGI24744J21845_100018343 271
737 3300002126 JGI24035J26624_1000177 JGI24035J26624_10001775 271
738 3300005288 Ga0065714_10173446 Ga0065714_101734461 271
739 3300005290 Ga0065712_10068786 Ga0065712_100687862 271
740 3300005293 Ga0065715_10093830 Ga0065715_100938303 271
741 3300005293 Ga0065715_10141948 Ga0065715_101419483 271
742 3300005328 Ga0070676_10000092 Ga0070676_100000928 271
743 3300005329 Ga0070683_100000314 Ga0070683_10000031426 271
744 3300005330 Ga0070690_100001103 Ga0070690_1000011033 271
745 3300005330 Ga0070690_100203901 Ga0070690_1002039012 271
746 3300005331 Ga0070670_100008919 Ga0070670_1000089195 271
747 3300005331 Ga0070670_100101237 Ga0070670_1001012373 271
748 3300005333 Ga0070677_10003218 Ga0070677_100032183 271
749 3300005334 Ga0068869_100454969 Ga0068869_1004549692 271
750 3300005336 Ga0070680_100000515 Ga0070680_10000051516 271
751 3300005336 Ga0070680_100035627 Ga0070680_1000356273 271
752 3300005337 Ga0070682_100000230 Ga0070682_10000023021 271
753 3300005337 Ga0070682_100099062 Ga0070682_1000990622 271
754 3300005337 Ga0070682_100143625 Ga0070682_1001436251 271
755 3300005338 Ga0068868_100002107 Ga0068868_1000021073 271
756 3300005339 Ga0070660_100000175 Ga0070660_10000017538 271
757 3300005339 Ga0070660_100019108 Ga0070660_1000191082 271
758 3300005340 Ga0070689_100000145 Ga0070689_10000014516 271
759 3300005340 Ga0070689_100080944 Ga0070689_1000809443 271
760 3300005341 Ga0070691_10000107 Ga0070691_100001078 271
761 3300005341 Ga0070691_10075822 Ga0070691_100758221 271
762 3300005343 Ga0070687_100001052 Ga0070687_1000010529 271
763 3300005343 Ga0070687_100030216 Ga0070687_1000302163 271
764 3300005344 Ga0070661_100000808 Ga0070661_10000080821 271
765 3300005345 Ga0070692_10009324 Ga0070692_100093243 271
766 3300005345 Ga0070692_10045229 Ga0070692_100452293 271
767 3300005347 Ga0070668_100001569 Ga0070668_1000015694 271
768 3300005347 Ga0070668_100167382 Ga0070668_1001673822 271
769 3300005353 Ga0070669_100000343 Ga0070669_10000034321 271
770 3300005354 Ga0070675_100000210 Ga0070675_10000021021 271
771 3300005354 Ga0070675_100159380 Ga0070675_1001593802 271
772 3300005355 Ga0070671_100000396 Ga0070671_10000039618 271
773 3300005355 Ga0070671_100056913 Ga0070671_1000569133 271
774 3300005364 Ga0070673_100000130 Ga0070673_10000013022 271
775 3300005365 Ga0070688_100003254 Ga0070688_1000032542 271
776 3300005365 Ga0070688_100006796 Ga0070688_1000067962 271
777 3300005366 Ga0070659_100000629 Ga0070659_10000062922 271
778 3300005366 Ga0070659_100166411 Ga0070659_1001664112 271
779 3300005367 Ga0070667_100002803 Ga0070667_10000280313 271
780 3300005367 Ga0070667_100147596 Ga0070667_1001475963 271
781 3300005367 Ga0070667_100340924 Ga0070667_1003409242 271
782 3300005406 Ga0070703_10005788 Ga0070703_100057882 271
783 3300005436 Ga0070713_100024266 Ga0070713_1000242663 271
784 3300005438 Ga0070701_10000012 Ga0070701_1000001221 271
785 3300005438 Ga0070701_10132282 Ga0070701_101322822 271
786 3300005439 Ga0070711_100075213 Ga0070711_1000752133 271
787 3300005439 Ga0070711_100077576 Ga0070711_1000775762 271
788 3300005440 Ga0070705_100000341 Ga0070705_1000003418 271
789 3300005440 Ga0070705_100213571 Ga0070705_1002135712 271
790 3300005441 Ga0070700_100001073 Ga0070700_10000107311 271
791 3300005441 Ga0070700_100001658 Ga0070700_1000016584 271
792 3300005444 Ga0070694_100003223 Ga0070694_1000032234 271
793 3300005444 Ga0070694_100025320 Ga0070694_1000253202 271
794 3300005455 Ga0070663_100000097 Ga0070663_10000009721 271
795 3300005455 Ga0070663_100026755 Ga0070663_1000267552 271
796 3300005456 Ga0070678_100000315 Ga0070678_10000031517 271
797 3300005457 Ga0070662_100000336 Ga0070662_10000033611 271
798 3300005457 Ga0070662_100263407 Ga0070662_1002634072 271
799 3300005458 Ga0070681_10005380 Ga0070681_100053808 271
800 3300005458 Ga0070681_10008239 Ga0070681_100082398 271
801 3300005458 Ga0070681_10111438 Ga0070681_101114382 271
802 3300005458 Ga0070681_10213609 Ga0070681_102136092 271
803 3300005458 Ga0070681_10214148 Ga0070681_102141482 271
804 3300005458 Ga0070681_10349940 Ga0070681_103499401 271
805 3300005459 Ga0068867_100000731 Ga0068867_1000007312 271
806 3300005459 Ga0068867_100348852 Ga0068867_1003488522 271
807 3300005466 Ga0070685_10009628 Ga0070685_100096284 271
808 3300005530 Ga0070679_100013447 Ga0070679_1000134476 271
809 3300005530 Ga0070679_100041270 Ga0070679_1000412703 271
810 3300005530 Ga0070679_100623633 Ga0070679_1006236331 271
811 3300005535 Ga0070684_100000157 Ga0070684_10000015718 271
812 3300005535 Ga0070684_100045060 Ga0070684_1000450604 271
813 3300005539 Ga0068853_100000843 Ga0068853_10000084318 271
814 3300005543 Ga0070672_100012387 Ga0070672_1000123872 271
815 3300005544 Ga0070686_100000127 Ga0070686_10000012726 271
816 3300005545 Ga0070695_100000496 Ga0070695_1000004964 271
817 3300005545 Ga0070695_100262472 Ga0070695_1002624722 271
818 3300005546 Ga0070696_100000219 Ga0070696_1000002198 271
819 3300005546 Ga0070696_100034495 Ga0070696_1000344954 271
820 3300005546 Ga0070696_100184382 Ga0070696_1001843822 271
821 3300005547 Ga0070693_100000414 Ga0070693_10000041414 271
822 3300005549 Ga0070704_100001560 Ga0070704_1000015603 271
823 3300005549 Ga0070704_100072507 Ga0070704_1000725073 271
824 3300005563 Ga0068855_100032556 Ga0068855_1000325564 271
825 3300005564 Ga0070664_100000326 Ga0070664_10000032620 271
826 3300005564 Ga0070664_100082783 Ga0070664_1000827833 271
827 3300005577 Ga0068857_100000063 Ga0068857_10000006320 271
828 3300005578 Ga0068854_100000220 Ga0068854_10000022021 271
829 3300005614 Ga0068856_100000815 Ga0068856_10000081516 271
830 3300005615 Ga0070702_100000350 Ga0070702_1000003503 271
831 3300005616 Ga0068852_100001377 Ga0068852_1000013774 271
832 3300005616 Ga0068852_100462036 Ga0068852_1004620362 271
833 3300005617 Ga0068859_100037236 Ga0068859_1000372365 271
834 3300005617 Ga0068859_100154924 Ga0068859_1001549242 271
835 3300005617 Ga0068859_100361366 Ga0068859_1003613661 271
836 3300005618 Ga0068864_100000380 Ga0068864_10000038014 271
837 3300005618 Ga0068864_100286937 Ga0068864_1002869372 271
838 3300005718 Ga0068866_10000193 Ga0068866_1000019319 271
839 3300005719 Ga0068861_100000101 Ga0068861_10000010123 271
840 3300005840 Ga0068870_10000028 Ga0068870_1000002827 271
841 3300005841 Ga0068863_100000386 Ga0068863_10000038626 271
842 3300005841 Ga0068863_100636989 Ga0068863_1006369892 271
843 3300005842 Ga0068858_100038594 Ga0068858_1000385944 271
844 3300005842 Ga0068858_100448796 Ga0068858_1004487961 271
845 3300005843 Ga0068860_100063913 Ga0068860_1000639133 271
846 3300005844 Ga0068862_100000950 Ga0068862_10000095025 271
847 3300006042 Ga0075368_10045594 Ga0075368_100455943 271
848 3300006163 Ga0070715_10023073 Ga0070715_100230733 271
849 3300006175 Ga0070712_100082678 Ga0070712_1000826782 271
850 3300006194 Ga0075427_10029777 Ga0075427_100297771 271
851 3300006237 Ga0097621_100000268 Ga0097621_1000002685 271
852 3300006237 Ga0097621_100053732 Ga0097621_1000537323 271
853 3300006353 Ga0075370_10030448 Ga0075370_100304482 271
854 3300006358 Ga0068871_100000298 Ga0068871_10000029819 271
855 3300006358 Ga0068871_100080645 Ga0068871_1000806451 271
856 3300006844 Ga0075428_100164087 Ga0075428_1001640872 271
857 3300006846 Ga0075430_100010689 Ga0075430_1000106894 271
858 3300006847 Ga0075431_100006613 Ga0075431_1000066134 271
859 3300006852 Ga0075433_10006195 Ga0075433_100061952 271
860 3300006852 Ga0075433_10043077 Ga0075433_100430773 271
861 3300006871 Ga0075434_100027307 Ga0075434_1000273073 271
862 3300006871 Ga0075434_100254532 Ga0075434_1002545322 271
863 3300006880 Ga0075429_100018597 Ga0075429_1000185972 271
864 3300006881 Ga0068865_100000125 Ga0068865_10000012521 271
865 3300006914 Ga0075436_100472708 Ga0075436_1004727081 271
866 3300006931 Ga0097620_100037233 Ga0097620_1000372335 271
867 3300006931 Ga0097620_100154916 Ga0097620_1001549163 271
868 3300006931 Ga0097620_100361412 Ga0097620_1003614121 271
869 3300007076 Ga0075435_100049484 Ga0075435_1000494843 271
870 3300007076 Ga0075435_100584482 Ga0075435_1005844822 271
871 3300009011 Ga0105251_10060876 Ga0105251_100608762 271
872 3300009092 Ga0105250_10044875 Ga0105250_100448752 271
873 3300009094 Ga0111539_10000548 Ga0111539_1000054830 271
874 3300009094 Ga0111539_10000954 Ga0111539_100009543 271
875 3300009094 Ga0111539_10001271 Ga0111539_100012715 271
876 3300009094 Ga0111539_10208978 Ga0111539_102089783 271
877 3300009098 Ga0105245_10000173 Ga0105245_1000017315 271
878 3300009098 Ga0105245_10060380 Ga0105245_100603802 271
879 3300009098 Ga0105245_10565729 Ga0105245_105657291 271
880 3300009101 Ga0105247_10003197 Ga0105247_100031978 271
881 3300009147 Ga0114129_10165396 Ga0114129_101653963 271
882 3300009148 Ga0105243_10000377 Ga0105243_1000037723 271
883 3300009148 Ga0105243_10140394 Ga0105243_101403942 271
884 3300009174 Ga0105241_10003995 Ga0105241_100039958 271
885 3300009174 Ga0105241_10062924 Ga0105241_100629242 271
886 3300009176 Ga0105242_10000419 Ga0105242_1000041912 271
887 3300009176 Ga0105242_10054201 Ga0105242_100542013 271
888 3300009176 Ga0105242_10102030 Ga0105242_101020302 271
889 3300009177 Ga0105248_10000643 Ga0105248_1000064326 271
890 3300009177 Ga0105248_10068597 Ga0105248_100685973 271
891 3300009545 Ga0105237_10011622 Ga0105237_100116224 271
892 3300009551 Ga0105238_10067253 Ga0105238_100672534 271
893 3300009551 Ga0105238_10556288 Ga0105238_105562882 271
894 3300009553 Ga0105249_10003200 Ga0105249_100032002 271
895 3300009553 Ga0105249_10628843 Ga0105249_106288431 271
896 3300010375 Ga0105239_10248612 Ga0105239_102486122 271
897 3300010375 Ga0105239_10495638 Ga0105239_104956382 271
898 3300011119 Ga0105246_10002148 Ga0105246_100021488 271
899 3300012481 Ga0157320_1000682 Ga0157320_10006823 271
900 3300012498 Ga0157345_1002916 Ga0157345_10029161 271
901 3300012515 Ga0157338_1000069 Ga0157338_10000693 271
902 3300013100 Ga0157373_10077885 Ga0157373_100778852 271
903 3300013100 Ga0157373_10175604 Ga0157373_101756042 271
904 3300013102 Ga0157371_10037695 Ga0157371_100376952 271
905 3300013105 Ga0157369_10146548 Ga0157369_101465482 271
906 3300013296 Ga0157374_10004172 Ga0157374_100041725 271
907 3300013297 Ga0157378_10000993 Ga0157378_1000099322 271
908 3300013297 Ga0157378_10130755 Ga0157378_101307553 271
909 3300013297 Ga0157378_10232184 Ga0157378_102321842 271
910 3300013306 Ga0163162_10001671 Ga0163162_1000167118 271
911 3300013307 Ga0157372_10052105 Ga0157372_100521053 271
912 3300013308 Ga0157375_10000283 Ga0157375_1000028319 271
913 3300014325 Ga0163163_10000757 Ga0163163_1000075719 271
914 3300014325 Ga0163163_10016749 Ga0163163_100167495 271
915 3300014326 Ga0157380_10000095 Ga0157380_1000009530 271
916 3300014745 Ga0157377_10000295 Ga0157377_1000029519 271
917 3300014968 Ga0157379_10004769 Ga0157379_100047693 271
918 3300014968 Ga0157379_10009736 Ga0157379_100097368 271
919 3300014968 Ga0157379_10180199 Ga0157379_101801993 271
920 3300014968 Ga0157379_10267708 Ga0157379_102677082 271
921 3300014969 Ga0157376_10000634 Ga0157376_1000063412 271
922 3300017792 Ga0163161_10000542 Ga0163161_100005425 271
923 3300025271 Ga0207666_1000045 Ga0207666_10000455 271
924 3300025271 Ga0207666_1006280 Ga0207666_10062801 271
925 3300025315 Ga0207697_10000551 Ga0207697_1000055120 271
926 3300025885 Ga0207653_10002740 Ga0207653_100027405 271
927 3300025893 Ga0207682_10005256 Ga0207682_100052564 271
928 3300025898 Ga0207692_10009761 Ga0207692_100097613 271
929 3300025899 Ga0207642_10000259 Ga0207642_1000025914 271
930 3300025900 Ga0207710_10005879 Ga0207710_100058795 271
931 3300025901 Ga0207688_10000039 Ga0207688_1000003920 271
932 3300025903 Ga0207680_10013194 Ga0207680_100131944 271
933 3300025904 Ga0207647_10026190 Ga0207647_100261903 271
934 3300025905 Ga0207685_10005689 Ga0207685_100056893 271
935 3300025907 Ga0207645_10000080 Ga0207645_1000008052 271
936 3300025908 Ga0207643_10000135 Ga0207643_1000013525 271
937 3300025911 Ga0207654_10054733 Ga0207654_100547333 271
938 3300025911 Ga0207654_10126318 Ga0207654_101263182 271
939 3300025911 Ga0207654_10155953 Ga0207654_101559531 271
940 3300025912 Ga0207707_10004353 Ga0207707_100043538 271
941 3300025912 Ga0207707_10049919 Ga0207707_100499192 271
942 3300025912 Ga0207707_10189089 Ga0207707_101890892 271
943 3300025914 Ga0207671_10028827 Ga0207671_100288274 271
944 3300025915 Ga0207693_10006700 Ga0207693_100067007 271
945 3300025916 Ga0207663_10018450 Ga0207663_100184503 271
946 3300025917 Ga0207660_10002445 Ga0207660_100024454 271
947 3300025917 Ga0207660_10042093 Ga0207660_100420932 271
948 3300025918 Ga0207662_10000336 Ga0207662_100003362 271
949 3300025918 Ga0207662_10026989 Ga0207662_100269894 271
950 3300025919 Ga0207657_10002336 Ga0207657_1000233619 271
951 3300025919 Ga0207657_10084548 Ga0207657_100845483 271
952 3300025919 Ga0207657_10131101 Ga0207657_101311013 271
953 3300025920 Ga0207649_10000571 Ga0207649_100005713 271
954 3300025921 Ga0207652_10001096 Ga0207652_100010968 271
955 3300025921 Ga0207652_10028056 Ga0207652_100280563 271
956 3300025921 Ga0207652_10131671 Ga0207652_101316712 271
957 3300025923 Ga0207681_10001995 Ga0207681_1000199511 271
958 3300025925 Ga0207650_10002540 Ga0207650_100025405 271
959 3300025926 Ga0207659_10000127 Ga0207659_1000012720 271
960 3300025927 Ga0207687_10000334 Ga0207687_100003348 271
961 3300025927 Ga0207687_10137937 Ga0207687_101379372 271
962 3300025929 Ga0207664_10095660 Ga0207664_100956603 271
963 3300025931 Ga0207644_10002918 Ga0207644_100029188 271
964 3300025931 Ga0207644_10076800 Ga0207644_100768002 271
965 3300025932 Ga0207690_10000571 Ga0207690_1000057119 271
966 3300025932 Ga0207690_10272513 Ga0207690_102725131 271
967 3300025933 Ga0207706_10001765 Ga0207706_1000176520 271
968 3300025933 Ga0207706_10018247 Ga0207706_100182475 271
969 3300025933 Ga0207706_10392640 Ga0207706_103926402 271
970 3300025934 Ga0207686_10000297 Ga0207686_1000029720 271
971 3300025934 Ga0207686_10044357 Ga0207686_100443572 271
972 3300025934 Ga0207686_10060158 Ga0207686_100601582 271
973 3300025935 Ga0207709_10000257 Ga0207709_1000025742 271
974 3300025935 Ga0207709_10029892 Ga0207709_100298923 271
975 3300025936 Ga0207670_10000371 Ga0207670_100003715 271
976 3300025936 Ga0207670_10036616 Ga0207670_100366162 271
977 3300025937 Ga0207669_10000089 Ga0207669_1000008922 271
978 3300025938 Ga0207704_10002403 Ga0207704_100024032 271
979 3300025940 Ga0207691_10001737 Ga0207691_100017372 271
980 3300025941 Ga0207711_10007990 Ga0207711_100079905 271
981 3300025941 Ga0207711_10010452 Ga0207711_100104525 271
982 3300025942 Ga0207689_10000095 Ga0207689_1000009523 271
983 3300025944 Ga0207661_10001967 Ga0207661_1000196712 271
984 3300025944 Ga0207661_10250420 Ga0207661_102504202 271
985 3300025945 Ga0207679_10000073 Ga0207679_1000007370 271
986 3300025945 Ga0207679_10078649 Ga0207679_100786493 271
987 3300025945 Ga0207679_10318680 Ga0207679_103186802 271
988 3300025949 Ga0207667_10037097 Ga0207667_100370974 271
989 3300025960 Ga0207651_10002317 Ga0207651_100023172 271
990 3300025961 Ga0207712_10000457 Ga0207712_1000045717 271
991 3300025961 Ga0207712_10022855 Ga0207712_100228552 271
992 3300025961 Ga0207712_10231107 Ga0207712_102311072 271
993 3300025972 Ga0207668_10000900 Ga0207668_100009002 271
994 3300025972 Ga0207668_10007427 Ga0207668_100074272 271
995 3300025986 Ga0207658_10003961 Ga0207658_100039613 271
996 3300025986 Ga0207658_10427324 Ga0207658_104273242 271
997 3300026023 Ga0207677_10009295 Ga0207677_100092952 271
998 3300026035 Ga0207703_10002103 Ga0207703_1000210317 271
999 3300026035 Ga0207703_10050527 Ga0207703_100505272 271
1000 3300026035 Ga0207703_10239104 Ga0207703_102391042 271
1001 3300026041 Ga0207639_10021948 Ga0207639_100219484 271
1002 3300026067 Ga0207678_10000426 Ga0207678_1000042617 271
1003 3300026067 Ga0207678_10181207 Ga0207678_101812072 271
1004 3300026075 Ga0207708_10000991 Ga0207708_1000099120 271
1005 3300026075 Ga0207708_10081663 Ga0207708_100816633 271
1006 3300026078 Ga0207702_10054124 Ga0207702_100541244 271
1007 3300026088 Ga0207641_10001067 Ga0207641_100010678 271
1008 3300026088 Ga0207641_10525547 Ga0207641_105255472 271
1009 3300026089 Ga0207648_10000207 Ga0207648_1000020734 271
1010 3300026095 Ga0207676_10000875 Ga0207676_1000087514 271
1011 3300026095 Ga0207676_10061987 Ga0207676_100619872 271
1012 3300026116 Ga0207674_10001021 Ga0207674_100010212 271
1013 3300026118 Ga0207675_100001849 Ga0207675_1000018492 271
1014 3300026118 Ga0207675_100074493 Ga0207675_1000744934 271
1015 3300026121 Ga0207683_10000096 Ga0207683_1000009645 271
1016 3300026142 Ga0207698_10000956 Ga0207698_100009564 271
1017 3300027424 Ga0209984_1005880 Ga0209984_10058802 271
1018 3300027617 Ga0210002_1000525 Ga0210002_10005252 271
1019 3300027682 Ga0209971_1024519 Ga0209971_10245192 271
1020 3300027695 Ga0209966_1021922 Ga0209966_10219221 271
1021 3300027717 Ga0209998_10000428 Ga0209998_100004289 271
1022 3300027717 Ga0209998_10006934 Ga0209998_100069342 271
1023 3300027866 Ga0209813_10024258 Ga0209813_100242583 271
1024 3300027876 Ga0209974_10009241 Ga0209974_100092412 271
1025 3300027907 Ga0207428_10000160 Ga0207428_1000016041 271
1026 3300027907 Ga0207428_10000200 Ga0207428_1000020073 271
1027 3300027907 Ga0207428_10000370 Ga0207428_1000037047 271
1028 3300028380 Ga0268265_10001781 Ga0268265_100017812 271
1029 3300028381 Ga0268264_10053121 Ga0268264_100531214 271
1030 3300028381 Ga0268264_10118074 Ga0268264_101180743 271
1031 3300028381 Ga0268264_10378008 Ga0268264_103780082 271
1032 3300031241 Ga0265325_10000004 Ga0265325_10000004205 271
1033 3300031595 Ga0265313_10033885 Ga0265313_100338853 271
1034 3300034816 Ga0373930_0001208 Ga0373930_0001208_155_970 271
1035 3300034817 Ga0373948_0000334 Ga0373948_0000334_71_886 271
1036 3300034818 Ga0373950_0013126 Ga0373950_0013126_191_1006 271
1037 3300034819 Ga0373958_0000505 Ga0373958_0000505_2362_3177 271
1038 3300034957 Ga0373938_0000033 Ga0373938_0000033_16007_16822 271
1039 3300034957 Ga0373938_0002272 Ga0373938_0002272_1594_2409 271
1040 3300035083 Ga0373926_0002095 Ga0373926_0002095_2419_3234 271
1041 3300035084 Ga0373928_0000751 Ga0373928_0000751_4031_4846 271
1042 3300035084 Ga0373928_0002785 Ga0373928_0002785_686_1501 271
1043 3300035088 Ga0373940_0002344 Ga0373940_0002344_775_1590 271
1044 3300035089 Ga0373944_0000846 Ga0373944_0000846_4416_5231 271
1045 3300035090 Ga0373949_0002920 Ga0373949_0002920_2799_3614 271
1046 3300035091 Ga0373951_0000151 Ga0373951_0000151_23563_24378 271
1047 3300035091 Ga0373951_0001138 Ga0373951_0001138_140_955 271
1048 3300035091 Ga0373951_0011387 Ga0373951_0011387_1020_1835 271
1049 3300035092 Ga0373952_0002453 Ga0373952_0002453_2124_2939 271
1050 3300035092 Ga0373952_0006520 Ga0373952_0006520_597_1412 271
1051 3300035111 Ga0373923_0000300 Ga0373923_0000300_4242_5057 271
1052 3300035112 Ga0373932_0003086 Ga0373932_0003086_132_947 271
1053 3300035112 Ga0373932_0003580 Ga0373932_0003580_1456_2271 271
1054 3300035112 Ga0373932_0005273 Ga0373932_0005273_1382_2197 271
1055 3300035113 Ga0373936_0009185 Ga0373936_0009185_431_1246 271
1056 3300035114 Ga0373939_0001391 Ga0373939_0001391_2924_3739 271
1057 3300035114 Ga0373939_0009034 Ga0373939_0009034_151_966 271
1058 3300035114 Ga0373939_0102342 Ga0373939_0102342_128_943 271
1059 3300035116 Ga0373945_0000782 Ga0373945_0000782_2088_2903 271
1060 3300035119 Ga0373956_0022189 Ga0373956_0022189_95_910 271
1061 3300035119 Ga0373956_0144849 Ga0373956_0144849_201_1016 271
1062 3300035121 Ga0373960_0000463 Ga0373960_0000463_5041_5856 271
1063 3300035121 Ga0373960_0002285 Ga0373960_0002285_3229_4044 271
1064 3300035121 Ga0373960_0031850 Ga0373960_0031850_28_843 271
1065 3300035170 Ga0373943_0004590 Ga0373943_0004590_3792_4607 271
1066 3300035170 Ga0373943_0162283 Ga0373943_0162283_271_1086 271
1067 3300035171 Ga0373946_0000328 Ga0373946_0000328_11681_12496 271
1068 3300035171 Ga0373946_0011843 Ga0373946_0011843_893_1708 271
1069 3300035172 Ga0373955_0015379 Ga0373955_0015379_2794_3609 271
1070 3300035207 Ga0373942_0001015 Ga0373942_0001015_986_1801 271
1071 3300035207 Ga0373942_0017453 Ga0373942_0017453_167_982 271
1072 3300035207 Ga0373942_0032081 Ga0373942_0032081_363_1178 271
1073 3300035241 Ga0373961_0000507 Ga0373961_0000507_1954_2769 271
1074 3300035241 Ga0373961_0005656 Ga0373961_0005656_931_1746 271
1075 3300035241 Ga0373961_0007487 Ga0373961_0007487_496_1311 271
1076 3300035242 Ga0373962_0005038 Ga0373962_0005038_2325_3140 271
1077 3300035242 Ga0373962_0006073 Ga0373962_0006073_1419_2243 271
1078 3300035242 Ga0373962_0007889 Ga0373962_0007889_762_1577 271
1079 3300035691 Ga0373931_0009310 Ga0373931_0009310_537_1352 271
1080 3300035691 Ga0373931_0011436 Ga0373931_0011436_2136_2951 271
1081 3300035691 Ga0373931_0031193 Ga0373931_0031193_1421_2236 271
1082 3300035691 Ga0373931_0219482 Ga0373931_0219482_255_1070 271
1083 3300035691 Ga0373931_0365313 Ga0373931_0365313_24_839 271
1084 3300035692 Ga0373935_0002426 Ga0373935_0002426_7120_7935 271
1085 3300035692 Ga0373935_0013222 Ga0373935_0013222_3442_4257 271
1086 3300035692 Ga0373935_0054097 Ga0373935_0054097_1171_1986 271
1087 3300035692 Ga0373935_0302577 Ga0373935_0302577_64_879 271
1088 3300035695 Ga0373927_0014805 Ga0373927_0014805_1440_2255 271
1089 3300035695 Ga0373927_0030360 Ga0373927_0030360_2280_3095 271
1090 3300035724 Ga0373933_0003172 Ga0373933_0003172_5392_6207 271
1091 3300035725 Ga0373947_0008877 Ga0373947_0008877_2927_3742 271
1092 3300035725 Ga0373947_0011163 Ga0373947_0011163_1440_2255 271
1093 3300036401 Ga0373937_0001621 Ga0373937_0001621_4086_4901 271
1094 3300036401 Ga0373937_0008258 Ga0373937_0008258_4135_4950 271
1095 3300037068 Ga0373925_0021865 Ga0373925_0021865_1312_2127 271
1096 3300037068 Ga0373925_0433040 Ga0373925_0433040_76_891 271
1097 3300042005 Ga0439448_0009871 Ga0439448_0009871_1231_2046 271
1098 3300044712 Ga0453684_0543985 Ga0453684_0543985_438_1253 271
1099 3300045051 Ga0451576_0003863 Ga0451576_0003863_15256_16071 271
1100 3300045051 Ga0451576_0644855 Ga0451576_0644855_57_872 271
1101 3300046454 Ga0495592_0001602 Ga0495592_0001602_12596_13411 271
1102 3300046454 Ga0495592_0145967 Ga0495592_0145967_666_1481 271
1103 3300046455 Ga0495603_0017210 Ga0495603_0017210_2894_3709 271
1104 3300046455 Ga0495603_0029474 Ga0495603_0029474_132_947 271
1105 3300046455 Ga0495603_0077764 Ga0495603_0077764_1034_1849 271
1106 3300046459 Ga0495629_0000107 Ga0495629_0000107_24866_25681 271
1107 3300046459 Ga0495629_0052427 Ga0495629_0052427_1969_2784 271
1108 3300046459 Ga0495629_0057506 Ga0495629_0057506_689_1504 271
1109 3300046461 Ga0495641_0005661 Ga0495641_0005661_3979_4794 271
1110 3300046462 Ga0495651_0000529 Ga0495651_0000529_24901_25716 271
1111 3300046462 Ga0495651_0013471 Ga0495651_0013471_1012_1827 271
1112 3300046463 Ga0495653_0005220 Ga0495653_0005220_3820_4635 271
1113 3300046463 Ga0495653_0183181 Ga0495653_0183181_175_990 271
1114 3300046472 Ga0495580_0001533 Ga0495580_0001533_6164_6979 271
1115 3300046473 Ga0495582_0001909 Ga0495582_0001909_5948_6763 271
1116 3300046473 Ga0495582_0010007 Ga0495582_0010007_2221_3036 271
1117 3300046473 Ga0495582_0024470 Ga0495582_0024470_2290_3105 271
1118 3300046475 Ga0495639_0016223 Ga0495639_0016223_978_1793 271
1119 3300046476 Ga0495662_0000621 Ga0495662_0000621_1634_2449 271
1120 3300046477 Ga0495664_0008486 Ga0495664_0008486_4846_5661 271
1121 3300046477 Ga0495664_0068309 Ga0495664_0068309_352_1167 271
1122 3300046492 Ga0495585_0082270 Ga0495585_0082270_859_1674 271
1123 3300046499 Ga0495594_0003322 Ga0495594_0003322_3544_4359 271
1124 3300046501 Ga0495607_0043916 Ga0495607_0043916_884_1699 271
1125 3300046511 Ga0495608_0002492 Ga0495608_0002492_8185_9000 271
1126 3300046514 Ga0495618_0075618 Ga0495618_0075618_885_1700 271
1127 3300046514 Ga0495618_0111633 Ga0495618_0111633_865_1680 271
1128 3300046516 Ga0495628_0003426 Ga0495628_0003426_4850_5665 271
1129 3300046517 Ga0495630_0022078 Ga0495630_0022078_3817_4632 271
1130 3300046517 Ga0495630_0192170 Ga0495630_0192170_445_1260 271
1131 3300046526 Ga0495666_0000591 Ga0495666_0000591_5517_6332 271
1132 3300046526 Ga0495666_0068946 Ga0495666_0068946_655_1470 271
1133 3300046529 Ga0495652_0002788 Ga0495652_0002788_12741_13556 271
1134 3300046529 Ga0495652_0018534 Ga0495652_0018534_896_1711 271
1135 3300046531 Ga0495665_0000336 Ga0495665_0000336_20856_21671 271
1136 3300046531 Ga0495665_0023457 Ga0495665_0023457_2098_2913 271
1137 3300046535 Ga0495586_0003307 Ga0495586_0003307_6332_7147 271
1138 3300046536 Ga0495587_0008854 Ga0495587_0008854_2959_3774 271
1139 3300046538 Ga0495609_0036676 Ga0495609_0036676_1239_2054 271
1140 3300046558 Ga0495633_0008197 Ga0495633_0008197_4640_5455 271
1141 3300046559 Ga0495667_0002448 Ga0495667_0002448_3578_4393 271
1142 3300046559 Ga0495667_0008390 Ga0495667_0008390_1794_2609 271
1143 3300046642 Ga0495634_0043559 Ga0495634_0043559_1506_2321 271
1144 3300046642 Ga0495634_0079556 Ga0495634_0079556_995_1810 271
1145 3300046663 Ga0495635_0008814 Ga0495635_0008814_6158_6973 271
1146 3300046674 Ga0495588_0004745 Ga0495588_0004745_4089_4904 271
1147 3300046674 Ga0495588_0089477 Ga0495588_0089477_774_1589 271
1148 3300046674 Ga0495588_0175684 Ga0495588_0175684_233_1048 271
1149 3300046675 Ga0495657_0028524 Ga0495657_0028524_990_1805 271
1150 3300046678 Ga0495599_0017767 Ga0495599_0017767_1555_2370 271
1151 3300046679 Ga0495623_0028747 Ga0495623_0028747_2032_2847 271
1152 3300046680 Ga0495646_0005225 Ga0495646_0005225_4077_4892 271
1153 3300046681 Ga0495647_0000542 Ga0495647_0000542_6449_7264 271
1154 3300046683 Ga0495658_0016142 Ga0495658_0016142_978_1793 271
1155 3300046689 Ga0495613_0008263 Ga0495613_0008263_978_1793 271
1156 3300046689 Ga0495613_0022253 Ga0495613_0022253_3225_4040 271
1157 3300046690 Ga0495624_0004828 Ga0495624_0004828_5679_6494 271
1158 3300046691 Ga0495670_0013865 Ga0495670_0013865_403_1218 271
1159 3300046809 Ga0495600_0060771 Ga0495600_0060771_719_1534 271
1160 3300047315 Ga0495581_0003207 Ga0495581_0003207_5010_5825 271
1161 3300047315 Ga0495581_0036271 Ga0495581_0036271_156_971 271
1162 3300047317 Ga0495604_0078768 Ga0495604_0078768_24_839 271
1163 3300047319 Ga0495674_0024317 Ga0495674_0024317_1722_2537 271
1164 3300047319 Ga0495674_0041625 Ga0495674_0041625_2030_2845 271
1165 3300047321 Ga0495676_0025024 Ga0495676_0025024_3031_3846 271
1166 3300047321 Ga0495676_0111577 Ga0495676_0111577_11_826 271
1167 3300047322 Ga0495680_0008529 Ga0495680_0008529_5380_6195 271
1168 3300047322 Ga0495680_0011911 Ga0495680_0011911_393_1208 271
1169 3300047322 Ga0495680_0014012 Ga0495680_0014012_5722_6537 271
1170 3300047444 Ga0495675_0010919 Ga0495675_0010919_3534_4349 271
1171 3300047471 Ga0495684_0148983 Ga0495684_0148983_71_886 271
1172 3300047673 Ga0495593_0002782 Ga0495593_0002782_8372_9187 271
1173 3300048088 Ga0495602_0027982 Ga0495602_0027982_138_953 271
1174 3300048089 Ga0495614_0011159 Ga0495614_0011159_1871_2686 271
1175 3300048903 Ga0496100_0000272 Ga0496100_0000272_22642_23457 271
1176 3300048903 Ga0496100_0032975 Ga0496100_0032975_1563_2378 271
1177 3300048905 Ga0496102_0048118 Ga0496102_0048118_1439_2254 271
1178 3300048905 Ga0496102_0202442 Ga0496102_0202442_910_1725 271
1179 3300048905 Ga0496102_0361567 Ga0496102_0361567_424_1239 271
1180 3300048905 Ga0496102_0402787 Ga0496102_0402787_41_856 271
1181 3300048906 Ga0496103_0009753 Ga0496103_0009753_1228_2043 271
1182 3300048906 Ga0496103_0063499 Ga0496103_0063499_763_1578 271
1183 3300048906 Ga0496103_0142376 Ga0496103_0142376_393_1208 271
1184 3300048906 Ga0496103_0147094 Ga0496103_0147094_208_1023 271
1185 3300048907 Ga0496104_0000515 Ga0496104_0000515_6570_7385 271
1186 3300048907 Ga0496104_0029600 Ga0496104_0029600_2575_3390 271
1187 3300048907 Ga0496104_0144938 Ga0496104_0144938_292_1107 271
1188 3300048907 Ga0496104_0210946 Ga0496104_0210946_472_1287 271
1189 3300048908 Ga0496105_0000405 Ga0496105_0000405_18552_19367 271
1190 3300048908 Ga0496105_0010305 Ga0496105_0010305_4858_5673 271
1191 3300048908 Ga0496105_0096029 Ga0496105_0096029_144_959 271
1192 3300048908 Ga0496105_0158797 Ga0496105_0158797_567_1382 271
1193 3300048909 Ga0496106_0007653 Ga0496106_0007653_635_1450 271
1194 3300048909 Ga0496106_0011101 Ga0496106_0011101_844_1659 271
1195 3300048909 Ga0496106_0079634 Ga0496106_0079634_1587_2402 271
1196 3300048909 Ga0496106_0087592 Ga0496106_0087592_863_1678 271
1197 3300048910 Ga0496107_0008620 Ga0496107_0008620_3161_3976 271
1198 3300048911 Ga0496108_0001488 Ga0496108_0001488_17517_18332 271
1199 3300048911 Ga0496108_0022041 Ga0496108_0022041_2643_3458 271
1200 3300048911 Ga0496108_0088713 Ga0496108_0088713_870_1685 271
1201 3300048912 Ga0496109_0001064 Ga0496109_0001064_15826_16641 271
1202 3300048912 Ga0496109_0001275 Ga0496109_0001275_6774_7589 271
1203 3300048912 Ga0496109_0032914 Ga0496109_0032914_1003_1818 271
1204 3300048913 Ga0496110_0041359 Ga0496110_0041359_23_838 271
1205 3300048913 Ga0496110_0045332 Ga0496110_0045332_2082_2897 271
1206 3300048913 Ga0496110_0254612 Ga0496110_0254612_457_1272 271
1207 3300048913 Ga0496110_0308259 Ga0496110_0308259_308_1123 271
1208 3300048914 Ga0496111_0011999 Ga0496111_0011999_3282_4097 271
1209 3300048914 Ga0496111_0191506 Ga0496111_0191506_239_1054 271
1210 3300048915 Ga0496112_0224410 Ga0496112_0224410_567_1382 271
1211 3300048916 Ga0496113_0001219 Ga0496113_0001219_4129_4944 271
1212 3300048916 Ga0496113_0117909 Ga0496113_0117909_1069_1884 271
1213 3300048917 Ga0496114_0004353 Ga0496114_0004353_1027_1842 271
1214 3300048917 Ga0496114_0144396 Ga0496114_0144396_1157_1972 271
1215 3300048918 Ga0496115_0000935 Ga0496115_0000935_3582_4397 271
1216 3300048918 Ga0496115_0003791 Ga0496115_0003791_9536_10351 271
1217 3300048918 Ga0496115_0042634 Ga0496115_0042634_755_1570 271
1218 3300049586 Ga0501070_0228809 Ga0501070_0228809_679_1494 271
1219 3300049593 Ga0501077_0024179 Ga0501077_0024179_3004_3819 271
1220 3300049742 Ga0501080_0080197 Ga0501080_0080197_330_1145 271
1221 3300050494 nmdc:mga06z11_13124_c1 nmdc:mga06z11_13124_c1_894_1709 271
1222 3300050495 nmdc:mga04h51_10398_c1 nmdc:mga04h51_10398_c1_208_1023 271
1223 3300050507 nmdc:mga05p37_71_c2 nmdc:mga05p37_71_c2_44085_44900 271
1224 3300050509 nmdc:mga0qj67_1537_c1 nmdc:mga0qj67_1537_c1_14186_15001 271
1225 3300050510 nmdc:mga06r32_9784_c1 nmdc:mga06r32_9784_c1_3029_3844 271
1226 3300050511 nmdc:mga08y16_10837_c1 nmdc:mga08y16_10837_c1_5828_6643 271
1227 3300050511 nmdc:mga08y16_650316_c1 nmdc:mga08y16_650316_c1_178_996 271
1228 3300050511 nmdc:mga08y16_7147_c1 nmdc:mga08y16_7147_c1_8467_9282 271
1229 3300050512 nmdc:mga0n895_1010_c1 nmdc:mga0n895_1010_c1_795_1610 271
1230 3300050512 nmdc:mga0n895_1143_c1 nmdc:mga0n895_1143_c1_8988_9803 271
1231 3300050512 nmdc:mga0n895_174250_c1 nmdc:mga0n895_174250_c1_87_902 271
1232 3300050512 nmdc:mga0n895_44942_c1 nmdc:mga0n895_44942_c1_1550_2365 271
1233 3300050512 nmdc:mga0n895_469506_c1 nmdc:mga0n895_469506_c1_406_1221 271
1234 3300050513 nmdc:mga0rr50_123642_c1 nmdc:mga0rr50_123642_c1_816_1631 271
1235 3300050513 nmdc:mga0rr50_140365_c1 nmdc:mga0rr50_140365_c1_251_1066 271
1236 3300050513 nmdc:mga0rr50_141697_c1 nmdc:mga0rr50_141697_c1_824_1639 271
1237 3300050513 nmdc:mga0rr50_415998_c1 nmdc:mga0rr50_415998_c1_71_886 271
1238 3300050513 nmdc:mga0rr50_560717_c1 nmdc:mga0rr50_560717_c1_90_905 271
1239 3300050514 nmdc:mga08x19_166749_c1 nmdc:mga08x19_166749_c1_416_1231 271
1240 3300050514 nmdc:mga08x19_286610_c1 nmdc:mga08x19_286610_c1_126_941 271
1241 3300050515 nmdc:mga0a205_14483_c1 nmdc:mga0a205_14483_c1_783_1598 271
1242 3300050515 nmdc:mga0a205_68545_c1 nmdc:mga0a205_68545_c1_1781_2596 271
1243 3300053077 Ga0495601_0000940 Ga0495601_0000940_5627_6442 271
1244 3300053077 Ga0495601_0011880 Ga0495601_0011880_1401_2216 271
1245 3300053078 Ga0495612_0002006 Ga0495612_0002006_152_967 271
1246 3300053078 Ga0495612_0011385 Ga0495612_0011385_722_1537 271
1247 3300053078 Ga0495612_0020410 Ga0495612_0020410_393_1208 271
1248 3300053084 Ga0495595_0001242 Ga0495595_0001242_1440_2255 271
1249 3300053084 Ga0495595_0003244 Ga0495595_0003244_351_1166 271
1250 3300053085 Ga0495619_0000440 Ga0495619_0000440_3210_4025 271
1251 3300053085 Ga0495619_0001622 Ga0495619_0001622_3567_4382 271
1252 3300053085 Ga0495619_0023063 Ga0495619_0023063_1337_2152 271
1253 3300053094 Ga0500566_0115664 Ga0500566_0115664_627_1442 271
1254 3300054114 Ga0501084_0611380 Ga0501084_0611380_14_829 271

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

78

238

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ahh-assembly1.cif.gz_B opua inhibited inward-facing, sbd docked 0.6787 65 256
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.6663 46 257
8hps-assembly1.cif.gz_A lpqy-sugabc in state 5 0.6559 46 256
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.6435 46 257
7mc0-assembly1.cif.gz_B inward facing conformation of the metni methionine abc transporter 0.6326 58 257
ID Description Score Start End Superfamily
af_Q2G088_14_207_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7033 58 256 1.10.3720.10
af_P0AER3_18_239_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6875 58 258 1.10.3720.10
af_Q2G088_14_207_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6852 58 256 1.10.3720.10
af_P0AEU3_9_230_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6816 64 259 1.10.3720.10
af_P0AFT2_3_219_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6798 51 262 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A6B8MDS5-F1-model_v4 ABC transporter permease subunit 0.7315 31 261 GO:0005886
GO:0055085
AF-A0A434TCK0-F1-model_v4 ABC transporter permease 0.7261 45 264 GO:0005886
GO:0055085
AF-A0A441XKP3-F1-model_v4 ABC transporter permease 0.7233 45 259 GO:0005886
GO:0055085
AF-A0A6B8MDS5-F1-model_v4 ABC transporter permease subunit 0.7206 31 261 GO:0005886
GO:0055085
AF-A0A7X8YBN8-F1-model_v4 ABC transporter permease 0.7204 46 257 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
76.84 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map