F492232
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1254 | 454 | 1235 | 266 |
Family's Representative Sequence
| Representative Sequence | 3300014326|Ga0157380_10317630|Ga0157380_103176301 |
| Length | 240 |
| Sequence | MTTRGRFSLVNLTALTLGLAFLYLPIAILVINSFNDSRLVTVWGGWSLRWYRALMNDEAMLEAASVSFRVAFLSATAATVLGTLAALALTRVARFRGRLLFSGMIYAPLVMPEVITGLSLLLLFVAVAIDRGFWTIVIAHTTVVQARLVTFDRSLEEAALDLGCPPLRTFLTVTLPLIWPAVASGWMLAFALSLDDLVLASFVTGPGATTLPIRIYSEVRLGVKPEINAVCTIMILGARL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 3 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 4 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 5 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 6 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 7 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 8 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 9 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 10 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 11 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 12 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 13 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 14 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 15 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 16 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 17 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 18 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 19 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 20 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 21 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 22 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 23 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 24 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 25 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 26 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 27 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 28 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 29 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 30 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 31 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 32 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 33 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 34 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 35 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 36 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 37 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 38 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 39 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 40 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 41 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 48 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 52 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 54 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 65 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 81 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 82 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 86 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 87 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 89 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 91 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 96 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 97 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 99 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 100 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 101 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 103 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 104 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 105 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 106 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 107 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 108 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 109 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 110 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 111 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 112 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 113 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 114 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 115 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 117 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 118 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 119 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 120 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 121 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 122 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 123 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 125 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 126 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 127 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 128 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 129 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 130 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 131 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 132 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 133 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 134 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 136 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 137 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 138 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 152 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 155 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 156 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 157 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 172 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 173 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 174 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 175 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 176 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 249 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 251 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 255 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 256 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 257 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 258 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 259 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 260 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 261 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 262 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 263 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 264 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 265 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 266 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 267 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 268 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 269 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 270 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 271 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 272 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 273 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 274 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 275 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 276 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 277 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 278 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 279 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 280 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 281 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 282 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 283 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 284 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 285 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 286 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 287 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 288 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 289 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 290 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 291 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 292 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 293 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 294 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 295 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 296 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 297 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 298 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 299 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 300 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 301 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 302 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 303 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 304 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 305 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 306 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 307 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 308 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 309 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 310 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 311 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 312 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 313 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 314 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 376 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 377 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 378 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 379 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 380 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 381 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 382 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 383 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 384 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 385 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 386 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 387 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 388 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 389 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 390 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 391 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 392 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 393 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 394 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 395 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 396 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 397 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 398 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 402 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 403 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 407 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 409 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 414 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 415 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 417 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 418 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 419 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 420 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 421 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 422 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 423 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 424 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 425 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 426 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 427 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 428 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 429 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 430 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 431 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 432 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 437 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 438 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 439 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 440 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 441 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 442 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 443 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 444 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 445 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 446 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 447 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 448 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 449 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 450 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 452 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 453 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 454 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.41 |
| Metatranscriptomes | 0.08 |
| Isolates | 1.52 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.95 |
| Nodule | 0.16 |
| Rhizoplane | 8.93 |
| Rhizosphere | 85.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214544950 | 2209111006 | Bacteria | 6067 |
| 2 | ARSoilYngRDRAFT_c00466 | 3300000042 | Bacteria | 4846 |
| 3 | ARcpr5yngRDRAFT_c000049 | 3300000043 | Bacteria | 18697 |
| 4 | ARSoilOldRDRAFT_c000098 | 3300000044 | Bacteria | 16580 |
| 5 | ARCol0oldRDRAFT_c02080 | 3300000045 | Bacteria | 994 |
| 6 | ARCol0yngRDRAFT_1000072 | 3300000652 | Bacteria | 18771 |
| 7 | JGI24746J21847_1000258 | 3300001977 | Bacteria | 7462 |
| 8 | JGI24747J21853_1000085 | 3300001978 | Bacteria | 4032 |
| 9 | JGI24739J22299_10001196 | 3300001989 | Bacteria | 9713 |
| 10 | JGI24737J22298_10029747 | 3300001990 | Bacteria | 1712 |
| 11 | JGI24750J21931_1000008 | 3300002070 | Bacteria | 23752 |
| 12 | JGI24745J21846_1002238 | 3300002073 | Bacteria | 1958 |
| 13 | JGI24748J21848_1000236 | 3300002074 | Bacteria | 6659 |
| 14 | JGI24738J21930_10006575 | 3300002075 | Bacteria | 2716 |
| 15 | JGI24749J21850_1000740 | 3300002076 | Bacteria | 4714 |
| 16 | JGI24744J21845_10001834 | 3300002077 | Bacteria | 4267 |
| 17 | JGI24035J26624_1000177 | 3300002126 | Bacteria | 5948 |
| 18 | JGI24034J26672_10006134 | 3300002239 | Bacteria | 1731 |
| 19 | JGI25405J52794_10007826 | 3300003911 | Bacteria | 1981 |
| 20 | Ga0065165_1003754 | 3300005262 | Bacteria | 10207 |
| 21 | Ga0065714_10173446 | 3300005288 | Bacteria | 980 |
| 22 | Ga0065712_10068786 | 3300005290 | Bacteria | 9030 |
| 23 | Ga0065715_10093830 | 3300005293 | Bacteria | 4533 |
| 24 | Ga0065715_10141948 | 3300005293 | Bacteria | 1836 |
| 25 | Ga0070658_10013155 | 3300005327 | Bacteria | 6638 |
| 26 | Ga0070658_10020050 | 3300005327 | Bacteria | 5356 |
| 27 | Ga0070658_10039467 | 3300005327 | Bacteria | 3809 |
| 28 | Ga0070658_10459182 | 3300005327 | Bacteria | 1098 |
| 29 | Ga0070676_10000092 | 3300005328 | Bacteria | 31160 |
| 30 | Ga0070676_10050881 | 3300005328 | Bacteria | 2430 |
| 31 | Ga0070683_100000314 | 3300005329 | Bacteria | 33370 |
| 32 | Ga0070683_100131827 | 3300005329 | Bacteria | 2366 |
| 33 | Ga0070683_100200212 | 3300005329 | Bacteria | 1896 |
| 34 | Ga0070690_100001103 | 3300005330 | Bacteria | 13884 |
| 35 | Ga0070690_100107758 | 3300005330 | Bacteria | 1855 |
| 36 | Ga0070690_100203901 | 3300005330 | Bacteria | 1377 |
| 37 | Ga0070670_100007568 | 3300005331 | Bacteria | 9218 |
| 38 | Ga0070670_100008919 | 3300005331 | Bacteria | 8563 |
| 39 | Ga0070670_100101237 | 3300005331 | Bacteria | 2481 |
| 40 | Ga0070670_100310896 | 3300005331 | Bacteria | 1379 |
| 41 | Ga0070677_10003218 | 3300005333 | Bacteria | 5253 |
| 42 | Ga0068869_100103056 | 3300005334 | Bacteria | 2161 |
| 43 | Ga0068869_100454969 | 3300005334 | Bacteria | 1062 |
| 44 | Ga0070666_10015039 | 3300005335 | Bacteria | 4932 |
| 45 | Ga0070680_100000515 | 3300005336 | Bacteria | 26512 |
| 46 | Ga0070680_100023201 | 3300005336 | Bacteria | 4947 |
| 47 | Ga0070680_100035627 | 3300005336 | Bacteria | 4018 |
| 48 | Ga0070680_100120872 | 3300005336 | Bacteria | 2186 |
| 49 | Ga0070682_100000230 | 3300005337 | Bacteria | 40502 |
| 50 | Ga0070682_100099062 | 3300005337 | Bacteria | 1921 |
| 51 | Ga0070682_100143625 | 3300005337 | Bacteria | 1630 |
| 52 | Ga0068868_100002107 | 3300005338 | Bacteria | 13708 |
| 53 | Ga0068868_100043507 | 3300005338 | Bacteria | 3508 |
| 54 | Ga0068868_100049608 | 3300005338 | Bacteria | 3295 |
| 55 | Ga0070660_100000175 | 3300005339 | Bacteria | 42249 |
| 56 | Ga0070660_100018546 | 3300005339 | Bacteria | 5086 |
| 57 | Ga0070660_100019108 | 3300005339 | Bacteria | 5016 |
| 58 | Ga0070660_100041752 | 3300005339 | Bacteria | 3497 |
| 59 | Ga0070660_100204423 | 3300005339 | Bacteria | 1603 |
| 60 | Ga0070689_100000145 | 3300005340 | Bacteria | 40970 |
| 61 | Ga0070689_100003166 | 3300005340 | Bacteria | 10885 |
| 62 | Ga0070689_100018210 | 3300005340 | Bacteria | 5170 |
| 63 | Ga0070689_100080944 | 3300005340 | Bacteria | 2549 |
| 64 | Ga0070691_10000107 | 3300005341 | Bacteria | 24697 |
| 65 | Ga0070691_10013630 | 3300005341 | Bacteria | 3725 |
| 66 | Ga0070691_10075822 | 3300005341 | Bacteria | 1639 |
| 67 | Ga0070687_100001052 | 3300005343 | Bacteria | 9437 |
| 68 | Ga0070687_100003332 | 3300005343 | Bacteria | 6219 |
| 69 | Ga0070687_100017014 | 3300005343 | Bacteria | 3334 |
| 70 | Ga0070687_100030216 | 3300005343 | Bacteria | 2647 |
| 71 | Ga0070687_100119675 | 3300005343 | Bacteria | 1504 |
| 72 | Ga0070661_100000808 | 3300005344 | Bacteria | 22497 |
| 73 | Ga0070661_100063216 | 3300005344 | Bacteria | 2718 |
| 74 | Ga0070661_100138531 | 3300005344 | Bacteria | 1832 |
| 75 | Ga0070661_100311389 | 3300005344 | Bacteria | 1228 |
| 76 | Ga0070692_10009324 | 3300005345 | Bacteria | 4423 |
| 77 | Ga0070692_10045229 | 3300005345 | Bacteria | 2269 |
| 78 | Ga0070668_100001569 | 3300005347 | Bacteria | 16509 |
| 79 | Ga0070668_100167382 | 3300005347 | Bacteria | 1787 |
| 80 | Ga0070669_100000343 | 3300005353 | Bacteria | 36254 |
| 81 | Ga0070669_100024890 | 3300005353 | Bacteria | 4296 |
| 82 | Ga0070675_100000210 | 3300005354 | Bacteria | 37423 |
| 83 | Ga0070675_100017095 | 3300005354 | Bacteria | 5764 |
| 84 | Ga0070675_100159380 | 3300005354 | Bacteria | 1939 |
| 85 | Ga0070671_100000396 | 3300005355 | Bacteria | 29967 |
| 86 | Ga0070671_100017777 | 3300005355 | Bacteria | 5765 |
| 87 | Ga0070671_100056913 | 3300005355 | Bacteria | 3253 |
| 88 | Ga0070674_100164621 | 3300005356 | Bacteria | 1685 |
| 89 | Ga0070673_100000130 | 3300005364 | Bacteria | 35440 |
| 90 | Ga0070673_100028586 | 3300005364 | Bacteria | 4148 |
| 91 | Ga0070673_100048528 | 3300005364 | Bacteria | 3310 |
| 92 | Ga0070673_100529387 | 3300005364 | Bacteria | 1069 |
| 93 | Ga0070688_100003254 | 3300005365 | Bacteria | 8321 |
| 94 | Ga0070688_100006796 | 3300005365 | Bacteria | 6136 |
| 95 | Ga0070688_100022612 | 3300005365 | Bacteria | 3688 |
| 96 | Ga0070688_100345005 | 3300005365 | Bacteria | 1088 |
| 97 | Ga0070659_100000629 | 3300005366 | Bacteria | 25796 |
| 98 | Ga0070659_100093279 | 3300005366 | Bacteria | 2416 |
| 99 | Ga0070659_100129126 | 3300005366 | Bacteria | 2051 |
| 100 | Ga0070659_100166411 | 3300005366 | Bacteria | 1804 |
| 101 | Ga0070659_100468469 | 3300005366 | Bacteria | 1071 |
| 102 | Ga0070667_100002803 | 3300005367 | Bacteria | 15042 |
| 103 | Ga0070667_100057429 | 3300005367 | Bacteria | 3289 |
| 104 | Ga0070667_100147596 | 3300005367 | Bacteria | 2063 |
| 105 | Ga0070667_100340924 | 3300005367 | Bacteria | 1355 |
| 106 | Ga0070703_10005788 | 3300005406 | Bacteria | 3465 |
| 107 | Ga0070709_10005456 | 3300005434 | Bacteria | 6888 |
| 108 | Ga0070709_10099842 | 3300005434 | Bacteria | 1931 |
| 109 | Ga0070709_10215261 | 3300005434 | Bacteria | 1367 |
| 110 | Ga0070714_100112929 | 3300005435 | Bacteria | 2408 |
| 111 | Ga0070714_100648040 | 3300005435 | Bacteria | 1017 |
| 112 | Ga0070714_100648601 | 3300005435 | Bacteria | 1016 |
| 113 | Ga0070713_100001523 | 3300005436 | Bacteria | 14775 |
| 114 | Ga0070713_100004000 | 3300005436 | Bacteria | 9812 |
| 115 | Ga0070713_100024266 | 3300005436 | Bacteria | 4721 |
| 116 | Ga0070713_100027849 | 3300005436 | Bacteria | 4455 |
| 117 | Ga0070713_100088503 | 3300005436 | Bacteria | 2658 |
| 118 | Ga0070713_100206667 | 3300005436 | Bacteria | 1776 |
| 119 | Ga0070710_10040802 | 3300005437 | Bacteria | 2559 |
| 120 | Ga0070710_10124247 | 3300005437 | Bacteria | 1566 |
| 121 | Ga0070710_10145745 | 3300005437 | Bacteria | 1456 |
| 122 | Ga0070701_10000012 | 3300005438 | Bacteria | 46531 |
| 123 | Ga0070701_10132282 | 3300005438 | Bacteria | 1418 |
| 124 | Ga0070711_100035728 | 3300005439 | Bacteria | 3325 |
| 125 | Ga0070711_100044247 | 3300005439 | Bacteria | 3021 |
| 126 | Ga0070711_100060019 | 3300005439 | Bacteria | 2643 |
| 127 | Ga0070711_100075213 | 3300005439 | Bacteria | 2391 |
| 128 | Ga0070711_100077576 | 3300005439 | Bacteria | 2358 |
| 129 | Ga0070711_100129090 | 3300005439 | Bacteria | 1880 |
| 130 | Ga0070711_100406951 | 3300005439 | Bacteria | 1106 |
| 131 | Ga0070705_100000341 | 3300005440 | Bacteria | 27488 |
| 132 | Ga0070705_100213178 | 3300005440 | Bacteria | 1332 |
| 133 | Ga0070705_100213571 | 3300005440 | Bacteria | 1331 |
| 134 | Ga0070700_100001073 | 3300005441 | Bacteria | 13564 |
| 135 | Ga0070700_100001658 | 3300005441 | Bacteria | 11149 |
| 136 | Ga0070700_100010159 | 3300005441 | Bacteria | 5187 |
| 137 | Ga0070694_100003223 | 3300005444 | Bacteria | 9742 |
| 138 | Ga0070694_100025320 | 3300005444 | Bacteria | 3838 |
| 139 | Ga0070663_100000097 | 3300005455 | Bacteria | 39662 |
| 140 | Ga0070663_100026755 | 3300005455 | Bacteria | 3910 |
| 141 | Ga0070663_100030754 | 3300005455 | Bacteria | 3684 |
| 142 | Ga0070678_100000315 | 3300005456 | Bacteria | 22573 |
| 143 | Ga0070678_100014741 | 3300005456 | Bacteria | 4943 |
| 144 | Ga0070678_100395320 | 3300005456 | Bacteria | 1199 |
| 145 | Ga0070662_100000336 | 3300005457 | Bacteria | 28144 |
| 146 | Ga0070662_100022179 | 3300005457 | Bacteria | 4342 |
| 147 | Ga0070662_100263407 | 3300005457 | Bacteria | 1389 |
| 148 | Ga0070681_10005380 | 3300005458 | Bacteria | 12363 |
| 149 | Ga0070681_10008239 | 3300005458 | Bacteria | 10198 |
| 150 | Ga0070681_10111438 | 3300005458 | Bacteria | 2675 |
| 151 | Ga0070681_10213609 | 3300005458 | Bacteria | 1845 |
| 152 | Ga0070681_10214148 | 3300005458 | Bacteria | 1843 |
| 153 | Ga0070681_10349940 | 3300005458 | Bacteria | 1388 |
| 154 | Ga0068867_100000731 | 3300005459 | Bacteria | 22005 |
| 155 | Ga0068867_100348852 | 3300005459 | Bacteria | 1234 |
| 156 | Ga0070685_10009628 | 3300005466 | Bacteria | 5000 |
| 157 | Ga0070707_100009211 | 3300005468 | Bacteria | 9162 |
| 158 | Ga0070699_100003057 | 3300005518 | Bacteria | 14839 |
| 159 | Ga0070699_100292960 | 3300005518 | Bacteria | 1459 |
| 160 | Ga0070679_100013447 | 3300005530 | Bacteria | 7837 |
| 161 | Ga0070679_100041270 | 3300005530 | Bacteria | 4592 |
| 162 | Ga0070679_100080514 | 3300005530 | Bacteria | 3246 |
| 163 | Ga0070679_100095294 | 3300005530 | Bacteria | 2964 |
| 164 | Ga0070679_100623633 | 3300005530 | Bacteria | 1021 |
| 165 | Ga0070684_100000157 | 3300005535 | Bacteria | 46152 |
| 166 | Ga0070684_100045060 | 3300005535 | Bacteria | 3818 |
| 167 | Ga0070684_100184479 | 3300005535 | Bacteria | 1897 |
| 168 | Ga0070684_100191403 | 3300005535 | Bacteria | 1861 |
| 169 | Ga0070684_100276642 | 3300005535 | Bacteria | 1537 |
| 170 | Ga0070697_100148569 | 3300005536 | Bacteria | 1974 |
| 171 | Ga0068853_100000843 | 3300005539 | Bacteria | 21412 |
| 172 | Ga0068853_100148947 | 3300005539 | Bacteria | 2105 |
| 173 | Ga0070672_100007233 | 3300005543 | Bacteria | 7520 |
| 174 | Ga0070672_100012387 | 3300005543 | Bacteria | 5985 |
| 175 | Ga0070686_100000127 | 3300005544 | Bacteria | 53295 |
| 176 | Ga0070686_100004524 | 3300005544 | Bacteria | 7668 |
| 177 | Ga0070695_100000496 | 3300005545 | Bacteria | 20629 |
| 178 | Ga0070695_100262472 | 3300005545 | Bacteria | 1262 |
| 179 | Ga0070696_100000219 | 3300005546 | Bacteria | 34543 |
| 180 | Ga0070696_100034495 | 3300005546 | Bacteria | 3481 |
| 181 | Ga0070696_100184382 | 3300005546 | Bacteria | 1550 |
| 182 | Ga0070693_100000414 | 3300005547 | Bacteria | 19333 |
| 183 | Ga0070693_100013772 | 3300005547 | Bacteria | 4126 |
| 184 | Ga0070665_100016548 | 3300005548 | Bacteria | 7394 |
| 185 | Ga0070665_100026572 | 3300005548 | Bacteria | 5829 |
| 186 | Ga0070665_100048481 | 3300005548 | Bacteria | 4264 |
| 187 | Ga0070665_100241968 | 3300005548 | Bacteria | 1805 |
| 188 | Ga0070704_100001560 | 3300005549 | Bacteria | 12358 |
| 189 | Ga0070704_100072507 | 3300005549 | Bacteria | 2505 |
| 190 | Ga0068855_100032556 | 3300005563 | Bacteria | 6224 |
| 191 | Ga0068855_100132818 | 3300005563 | Bacteria | 2842 |
| 192 | Ga0068855_100277219 | 3300005563 | Bacteria | 1863 |
| 193 | Ga0068855_100434933 | 3300005563 | Bacteria | 1434 |
| 194 | Ga0070664_100000326 | 3300005564 | Bacteria | 34609 |
| 195 | Ga0070664_100082783 | 3300005564 | Bacteria | 2768 |
| 196 | Ga0070664_100224221 | 3300005564 | Bacteria | 1682 |
| 197 | Ga0068857_100000063 | 3300005577 | Bacteria | 60089 |
| 198 | Ga0068857_100147581 | 3300005577 | Bacteria | 2129 |
| 199 | Ga0068854_100000220 | 3300005578 | Bacteria | 38637 |
| 200 | Ga0068854_100428976 | 3300005578 | Bacteria | 1100 |
| 201 | Ga0068856_100000815 | 3300005614 | Bacteria | 33600 |
| 202 | Ga0068856_100140229 | 3300005614 | Bacteria | 2424 |
| 203 | Ga0070702_100000350 | 3300005615 | Bacteria | 16109 |
| 204 | Ga0070702_100003968 | 3300005615 | Bacteria | 6711 |
| 205 | Ga0068852_100001377 | 3300005616 | Bacteria | 16326 |
| 206 | Ga0068852_100038834 | 3300005616 | Bacteria | 4004 |
| 207 | Ga0068852_100170832 | 3300005616 | Bacteria | 2038 |
| 208 | Ga0068852_100382741 | 3300005616 | Bacteria | 1380 |
| 209 | Ga0068852_100462036 | 3300005616 | Bacteria | 1258 |
| 210 | Ga0068852_100609751 | 3300005616 | Bacteria | 1096 |
| 211 | Ga0068859_100037236 | 3300005617 | Bacteria | 4883 |
| 212 | Ga0068859_100051427 | 3300005617 | Bacteria | 4141 |
| 213 | Ga0068859_100154924 | 3300005617 | Bacteria | 2368 |
| 214 | Ga0068859_100157297 | 3300005617 | Bacteria | 2350 |
| 215 | Ga0068859_100174553 | 3300005617 | Bacteria | 2231 |
| 216 | Ga0068859_100361366 | 3300005617 | Bacteria | 1547 |
| 217 | Ga0068864_100000380 | 3300005618 | Bacteria | 38785 |
| 218 | Ga0068864_100007988 | 3300005618 | Bacteria | 8724 |
| 219 | Ga0068864_100286937 | 3300005618 | Bacteria | 1538 |
| 220 | Ga0068866_10000193 | 3300005718 | Bacteria | 28522 |
| 221 | Ga0068866_10084220 | 3300005718 | Bacteria | 1715 |
| 222 | Ga0068861_100000101 | 3300005719 | Bacteria | 42384 |
| 223 | Ga0068851_10071417 | 3300005834 | Bacteria | 1796 |
| 224 | Ga0068851_10262417 | 3300005834 | Bacteria | 983 |
| 225 | Ga0068870_10000028 | 3300005840 | Bacteria | 45368 |
| 226 | Ga0068870_10000463 | 3300005840 | Bacteria | 15423 |
| 227 | Ga0068863_100000386 | 3300005841 | Bacteria | 44817 |
| 228 | Ga0068863_100055166 | 3300005841 | Bacteria | 3763 |
| 229 | Ga0068863_100636989 | 3300005841 | Bacteria | 1057 |
| 230 | Ga0068858_100038594 | 3300005842 | Bacteria | 4431 |
| 231 | Ga0068858_100050186 | 3300005842 | Bacteria | 3862 |
| 232 | Ga0068858_100095834 | 3300005842 | Bacteria | 2765 |
| 233 | Ga0068858_100448796 | 3300005842 | Bacteria | 1243 |
| 234 | Ga0068860_100038130 | 3300005843 | Bacteria | 4598 |
| 235 | Ga0068860_100063913 | 3300005843 | Bacteria | 3495 |
| 236 | Ga0068860_100345539 | 3300005843 | Bacteria | 1463 |
| 237 | Ga0068862_100000950 | 3300005844 | Bacteria | 27906 |
| 238 | Ga0068862_100008130 | 3300005844 | Bacteria | 8675 |
| 239 | Ga0081455_10000695 | 3300005937 | Bacteria | 43608 |
| 240 | Ga0081455_10003621 | 3300005937 | Bacteria | 17706 |
| 241 | Ga0081455_10086707 | 3300005937 | Bacteria | 2550 |
| 242 | Ga0081540_1097927 | 3300005983 | Bacteria | 1271 |
| 243 | Ga0070717_10000396 | 3300006028 | Bacteria | 27915 |
| 244 | Ga0070717_10383486 | 3300006028 | Bacteria | 1260 |
| 245 | Ga0075365_10000608 | 3300006038 | Bacteria | 14084 |
| 246 | Ga0075365_10002013 | 3300006038 | Bacteria | 9639 |
| 247 | Ga0075365_10006190 | 3300006038 | Bacteria | 6559 |
| 248 | Ga0075368_10034121 | 3300006042 | Bacteria | 1982 |
| 249 | Ga0075368_10045594 | 3300006042 | Bacteria | 1732 |
| 250 | Ga0070715_10004318 | 3300006163 | Bacteria | 4643 |
| 251 | Ga0070715_10011020 | 3300006163 | Bacteria | 3241 |
| 252 | Ga0070715_10023073 | 3300006163 | Bacteria | 2434 |
| 253 | Ga0070715_10174929 | 3300006163 | Bacteria | 1072 |
| 254 | Ga0070716_100008465 | 3300006173 | Bacteria | 5103 |
| 255 | Ga0070712_100000600 | 3300006175 | Bacteria | 21109 |
| 256 | Ga0070712_100082678 | 3300006175 | Bacteria | 2330 |
| 257 | Ga0070712_100088588 | 3300006175 | Bacteria | 2262 |
| 258 | Ga0075367_10000931 | 3300006178 | Bacteria | 11866 |
| 259 | Ga0075367_10015469 | 3300006178 | Bacteria | 4149 |
| 260 | Ga0075427_10029777 | 3300006194 | Bacteria | 893 |
| 261 | Ga0097621_100000268 | 3300006237 | Bacteria | 35289 |
| 262 | Ga0097621_100053732 | 3300006237 | Bacteria | 3283 |
| 263 | Ga0075370_10030448 | 3300006353 | Bacteria | 3011 |
| 264 | Ga0075370_10183531 | 3300006353 | Bacteria | 1232 |
| 265 | Ga0068871_100000298 | 3300006358 | Bacteria | 34572 |
| 266 | Ga0068871_100080645 | 3300006358 | Bacteria | 2694 |
| 267 | Ga0075428_100010816 | 3300006844 | Bacteria | 10143 |
| 268 | Ga0075428_100164087 | 3300006844 | Bacteria | 2410 |
| 269 | Ga0075430_100002695 | 3300006846 | Bacteria | 14826 |
| 270 | Ga0075430_100010689 | 3300006846 | Bacteria | 7778 |
| 271 | Ga0075431_100006613 | 3300006847 | Bacteria | 11520 |
| 272 | Ga0075431_100013819 | 3300006847 | Bacteria | 8153 |
| 273 | Ga0075431_100826221 | 3300006847 | Bacteria | 899 |
| 274 | Ga0075433_10006195 | 3300006852 | Bacteria | 9435 |
| 275 | Ga0075433_10030679 | 3300006852 | Bacteria | 4588 |
| 276 | Ga0075433_10043077 | 3300006852 | Bacteria | 3918 |
| 277 | Ga0075434_100027307 | 3300006871 | Bacteria | 5603 |
| 278 | Ga0075434_100040249 | 3300006871 | Bacteria | 4629 |
| 279 | Ga0075434_100065948 | 3300006871 | Bacteria | 3606 |
| 280 | Ga0075434_100120511 | 3300006871 | Bacteria | 2638 |
| 281 | Ga0075434_100254532 | 3300006871 | Bacteria | 1775 |
| 282 | Ga0075429_100018597 | 3300006880 | Bacteria | 6018 |
| 283 | Ga0075429_100034156 | 3300006880 | Bacteria | 4418 |
| 284 | Ga0068865_100000125 | 3300006881 | Bacteria | 39482 |
| 285 | Ga0068865_100203088 | 3300006881 | Bacteria | 1540 |
| 286 | Ga0075436_100123566 | 3300006914 | Bacteria | 1813 |
| 287 | Ga0075436_100472708 | 3300006914 | Bacteria | 915 |
| 288 | Ga0097620_100037233 | 3300006931 | Bacteria | 4883 |
| 289 | Ga0097620_100051424 | 3300006931 | Bacteria | 4141 |
| 290 | Ga0097620_100154916 | 3300006931 | Bacteria | 2368 |
| 291 | Ga0097620_100157294 | 3300006931 | Bacteria | 2350 |
| 292 | Ga0097620_100174546 | 3300006931 | Bacteria | 2231 |
| 293 | Ga0097620_100361412 | 3300006931 | Bacteria | 1547 |
| 294 | Ga0075435_100049484 | 3300007076 | Bacteria | 3380 |
| 295 | Ga0075435_100062344 | 3300007076 | Bacteria | 3026 |
| 296 | Ga0075435_100584482 | 3300007076 | Bacteria | 968 |
| 297 | Ga0099794_10000521 | 3300007265 | Bacteria | 12874 |
| 298 | Ga0099795_10005655 | 3300007788 | Bacteria | 3347 |
| 299 | Ga0099795_10022421 | 3300007788 | Bacteria | 2084 |
| 300 | Ga0105251_10052152 | 3300009011 | Bacteria | 1948 |
| 301 | Ga0105251_10060876 | 3300009011 | Bacteria | 1776 |
| 302 | Ga0105250_10044875 | 3300009092 | Bacteria | 1772 |
| 303 | Ga0105250_10106047 | 3300009092 | Bacteria | 1149 |
| 304 | Ga0111539_10000548 | 3300009094 | Bacteria | 47926 |
| 305 | Ga0111539_10000954 | 3300009094 | Bacteria | 37915 |
| 306 | Ga0111539_10001271 | 3300009094 | Bacteria | 33681 |
| 307 | Ga0111539_10037752 | 3300009094 | Bacteria | 5831 |
| 308 | Ga0111539_10048215 | 3300009094 | Bacteria | 5087 |
| 309 | Ga0111539_10208978 | 3300009094 | Bacteria | 2274 |
| 310 | Ga0105245_10000173 | 3300009098 | Bacteria | 61528 |
| 311 | Ga0105245_10006042 | 3300009098 | Bacteria | 10647 |
| 312 | Ga0105245_10010115 | 3300009098 | Bacteria | 8215 |
| 313 | Ga0105245_10060380 | 3300009098 | Bacteria | 3414 |
| 314 | Ga0105245_10565729 | 3300009098 | Bacteria | 1160 |
| 315 | Ga0105247_10003197 | 3300009101 | Bacteria | 10793 |
| 316 | Ga0105247_10024754 | 3300009101 | Bacteria | 3619 |
| 317 | Ga0114129_10003643 | 3300009147 | Bacteria | 21672 |
| 318 | Ga0114129_10006300 | 3300009147 | Bacteria | 16824 |
| 319 | Ga0114129_10012821 | 3300009147 | Bacteria | 11929 |
| 320 | Ga0114129_10165396 | 3300009147 | Bacteria | 3019 |
| 321 | Ga0114129_10572031 | 3300009147 | Bacteria | 1467 |
| 322 | Ga0105243_10000377 | 3300009148 | Bacteria | 47825 |
| 323 | Ga0105243_10017816 | 3300009148 | Bacteria | 5374 |
| 324 | Ga0105243_10056240 | 3300009148 | Bacteria | 3128 |
| 325 | Ga0105243_10082939 | 3300009148 | Bacteria | 2621 |
| 326 | Ga0105243_10118098 | 3300009148 | Bacteria | 2231 |
| 327 | Ga0105243_10140394 | 3300009148 | Bacteria | 2060 |
| 328 | Ga0105241_10003995 | 3300009174 | Bacteria | 10903 |
| 329 | Ga0105241_10062924 | 3300009174 | Bacteria | 2861 |
| 330 | Ga0105241_10130267 | 3300009174 | Bacteria | 2036 |
| 331 | Ga0105242_10000419 | 3300009176 | Bacteria | 33812 |
| 332 | Ga0105242_10044589 | 3300009176 | Bacteria | 3592 |
| 333 | Ga0105242_10054201 | 3300009176 | Bacteria | 3277 |
| 334 | Ga0105242_10102030 | 3300009176 | Bacteria | 2432 |
| 335 | Ga0105242_10140060 | 3300009176 | Bacteria | 2098 |
| 336 | Ga0105248_10000643 | 3300009177 | Bacteria | 39655 |
| 337 | Ga0105248_10044136 | 3300009177 | Bacteria | 5000 |
| 338 | Ga0105248_10068597 | 3300009177 | Bacteria | 3981 |
| 339 | Ga0105248_10337537 | 3300009177 | Bacteria | 1697 |
| 340 | Ga0105237_10011622 | 3300009545 | Bacteria | 9318 |
| 341 | Ga0105237_10032413 | 3300009545 | Bacteria | 5291 |
| 342 | Ga0105237_10228040 | 3300009545 | Bacteria | 1863 |
| 343 | Ga0105237_10239725 | 3300009545 | Bacteria | 1815 |
| 344 | Ga0105238_10026829 | 3300009551 | Bacteria | 5872 |
| 345 | Ga0105238_10041417 | 3300009551 | Bacteria | 4664 |
| 346 | Ga0105238_10067253 | 3300009551 | Bacteria | 3585 |
| 347 | Ga0105238_10076969 | 3300009551 | Bacteria | 3328 |
| 348 | Ga0105238_10085300 | 3300009551 | Bacteria | 3146 |
| 349 | Ga0105238_10556288 | 3300009551 | Bacteria | 1152 |
| 350 | Ga0105249_10003200 | 3300009553 | Bacteria | 14176 |
| 351 | Ga0105249_10037064 | 3300009553 | Bacteria | 4425 |
| 352 | Ga0105249_10610394 | 3300009553 | Bacteria | 1146 |
| 353 | Ga0105249_10628843 | 3300009553 | Bacteria | 1130 |
| 354 | Ga0099796_10038869 | 3300010159 | Bacteria | 1599 |
| 355 | Ga0105239_10248612 | 3300010375 | Bacteria | 1997 |
| 356 | Ga0105239_10475101 | 3300010375 | Bacteria | 1420 |
| 357 | Ga0105239_10495638 | 3300010375 | Bacteria | 1389 |
| 358 | Ga0105246_10002148 | 3300011119 | Bacteria | 11887 |
| 359 | Ga0105246_10192305 | 3300011119 | Bacteria | 1580 |
| 360 | Ga0105246_10329946 | 3300011119 | Bacteria | 1243 |
| 361 | Ga0157320_1000682 | 3300012481 | Bacteria | 1480 |
| 362 | Ga0157345_1002916 | 3300012498 | Bacteria | 1228 |
| 363 | Ga0157338_1000069 | 3300012515 | Bacteria | 4445 |
| 364 | Ga0157373_10029938 | 3300013100 | Bacteria | 3919 |
| 365 | Ga0157373_10077885 | 3300013100 | Bacteria | 2339 |
| 366 | Ga0157373_10175604 | 3300013100 | Bacteria | 1508 |
| 367 | Ga0157371_10037695 | 3300013102 | Bacteria | 3459 |
| 368 | Ga0157369_10108963 | 3300013105 | Bacteria | 2945 |
| 369 | Ga0157369_10146548 | 3300013105 | Bacteria | 2496 |
| 370 | Ga0157369_10423456 | 3300013105 | Bacteria | 1380 |
| 371 | Ga0157374_10004172 | 3300013296 | Bacteria | 12134 |
| 372 | Ga0157374_10015034 | 3300013296 | Bacteria | 6785 |
| 373 | Ga0157374_10046157 | 3300013296 | Bacteria | 4034 |
| 374 | Ga0157378_10000993 | 3300013297 | Bacteria | 25998 |
| 375 | Ga0157378_10032077 | 3300013297 | Bacteria | 4641 |
| 376 | Ga0157378_10074855 | 3300013297 | Bacteria | 3047 |
| 377 | Ga0157378_10130755 | 3300013297 | Bacteria | 2323 |
| 378 | Ga0157378_10188256 | 3300013297 | Bacteria | 1945 |
| 379 | Ga0157378_10232184 | 3300013297 | Bacteria | 1758 |
| 380 | Ga0163162_10001671 | 3300013306 | Bacteria | 20815 |
| 381 | Ga0163162_10138593 | 3300013306 | Bacteria | 2544 |
| 382 | Ga0163162_10155852 | 3300013306 | Bacteria | 2404 |
| 383 | Ga0157372_10052105 | 3300013307 | Bacteria | 4556 |
| 384 | Ga0157372_10172693 | 3300013307 | Bacteria | 2501 |
| 385 | Ga0157375_10000283 | 3300013308 | Bacteria | 46225 |
| 386 | Ga0157375_10017237 | 3300013308 | Bacteria | 6512 |
| 387 | Ga0157375_10320450 | 3300013308 | Bacteria | 1715 |
| 388 | Ga0163163_10000757 | 3300014325 | Bacteria | 27476 |
| 389 | Ga0163163_10016749 | 3300014325 | Bacteria | 6819 |
| 390 | Ga0163163_10022059 | 3300014325 | Bacteria | 6022 |
| 391 | Ga0163163_10040155 | 3300014325 | Bacteria | 4568 |
| 392 | Ga0157380_10000095 | 3300014326 | Bacteria | 48588 |
| 393 | Ga0157380_10026333 | 3300014326 | Bacteria | 4416 |
| 394 | Ga0157380_10108259 | 3300014326 | Bacteria | 2329 |
| 395 | Ga0157380_10317630 | 3300014326 | Bacteria | 1443 |
| 396 | Ga0157377_10000295 | 3300014745 | Bacteria | 23523 |
| 397 | Ga0157377_10002726 | 3300014745 | Bacteria | 7857 |
| 398 | Ga0157379_10004769 | 3300014968 | Bacteria | 11651 |
| 399 | Ga0157379_10009736 | 3300014968 | Bacteria | 8373 |
| 400 | Ga0157379_10180199 | 3300014968 | Bacteria | 1909 |
| 401 | Ga0157379_10207550 | 3300014968 | Bacteria | 1773 |
| 402 | Ga0157379_10267708 | 3300014968 | Bacteria | 1553 |
| 403 | Ga0157379_10437083 | 3300014968 | Bacteria | 1206 |
| 404 | Ga0157376_10000634 | 3300014969 | Bacteria | 22779 |
| 405 | Ga0157376_10045894 | 3300014969 | Bacteria | 3600 |
| 406 | Ga0157376_10144570 | 3300014969 | Bacteria | 2138 |
| 407 | Ga0157376_10602366 | 3300014969 | Bacteria | 1094 |
| 408 | Ga0163161_10000542 | 3300017792 | Bacteria | 30658 |
| 409 | Ga0163161_10027218 | 3300017792 | Bacteria | 4056 |
| 410 | Ga0206353_11965552 | 3300020082 | Bacteria | 4204 |
| 411 | Ga0213872_10014346 | 3300021361 | Bacteria | 3697 |
| 412 | Ga0213876_10012177 | 3300021384 | Bacteria | 4581 |
| 413 | Ga0224572_1014624 | 3300024225 | Bacteria | 1500 |
| 414 | Ga0228598_1001606 | 3300024227 | Bacteria | 4944 |
| 415 | Ga0207666_1000045 | 3300025271 | Bacteria | 24475 |
| 416 | Ga0207666_1006280 | 3300025271 | Bacteria | 1536 |
| 417 | Ga0207697_10000551 | 3300025315 | Bacteria | 21235 |
| 418 | Ga0207653_10002740 | 3300025885 | Bacteria | 5602 |
| 419 | Ga0207682_10005256 | 3300025893 | Bacteria | 5294 |
| 420 | Ga0207682_10043715 | 3300025893 | Bacteria | 1834 |
| 421 | Ga0207692_10008266 | 3300025898 | Bacteria | 4304 |
| 422 | Ga0207692_10009761 | 3300025898 | Bacteria | 4020 |
| 423 | Ga0207692_10119990 | 3300025898 | Bacteria | 1471 |
| 424 | Ga0207642_10000259 | 3300025899 | Bacteria | 15837 |
| 425 | Ga0207710_10003740 | 3300025900 | Bacteria | 6736 |
| 426 | Ga0207710_10005879 | 3300025900 | Bacteria | 5263 |
| 427 | Ga0207688_10000039 | 3300025901 | Bacteria | 44849 |
| 428 | Ga0207688_10002001 | 3300025901 | Bacteria | 10935 |
| 429 | Ga0207688_10112678 | 3300025901 | Bacteria | 1580 |
| 430 | Ga0207680_10013194 | 3300025903 | Bacteria | 4236 |
| 431 | Ga0207647_10016425 | 3300025904 | Bacteria | 5053 |
| 432 | Ga0207647_10026190 | 3300025904 | Bacteria | 3818 |
| 433 | Ga0207685_10003505 | 3300025905 | Bacteria | 3827 |
| 434 | Ga0207685_10005689 | 3300025905 | Bacteria | 3319 |
| 435 | Ga0207685_10016945 | 3300025905 | Bacteria | 2343 |
| 436 | Ga0207699_10186566 | 3300025906 | Bacteria | 1397 |
| 437 | Ga0207645_10000080 | 3300025907 | Bacteria | 68968 |
| 438 | Ga0207643_10000135 | 3300025908 | Bacteria | 49853 |
| 439 | Ga0207643_10001337 | 3300025908 | Bacteria | 14257 |
| 440 | Ga0207705_10084589 | 3300025909 | Bacteria | 2316 |
| 441 | Ga0207705_10141766 | 3300025909 | Bacteria | 1795 |
| 442 | Ga0207705_10435285 | 3300025909 | Bacteria | 1016 |
| 443 | Ga0207684_10018056 | 3300025910 | Bacteria | 6046 |
| 444 | Ga0207654_10042196 | 3300025911 | Bacteria | 2580 |
| 445 | Ga0207654_10054733 | 3300025911 | Bacteria | 2307 |
| 446 | Ga0207654_10126318 | 3300025911 | Bacteria | 1613 |
| 447 | Ga0207654_10155953 | 3300025911 | Bacteria | 1470 |
| 448 | Ga0207707_10002095 | 3300025912 | Bacteria | 18045 |
| 449 | Ga0207707_10004353 | 3300025912 | Bacteria | 12528 |
| 450 | Ga0207707_10049919 | 3300025912 | Bacteria | 3645 |
| 451 | Ga0207707_10087772 | 3300025912 | Bacteria | 2717 |
| 452 | Ga0207707_10189089 | 3300025912 | Bacteria | 1796 |
| 453 | Ga0207671_10028827 | 3300025914 | Bacteria | 4147 |
| 454 | Ga0207671_10144440 | 3300025914 | Bacteria | 1835 |
| 455 | Ga0207693_10003570 | 3300025915 | Bacteria | 13292 |
| 456 | Ga0207693_10006700 | 3300025915 | Bacteria | 9510 |
| 457 | Ga0207693_10006778 | 3300025915 | Bacteria | 9458 |
| 458 | Ga0207693_10007806 | 3300025915 | Bacteria | 8783 |
| 459 | Ga0207693_10178729 | 3300025915 | Bacteria | 1670 |
| 460 | Ga0207663_10018450 | 3300025916 | Bacteria | 3910 |
| 461 | Ga0207663_10021173 | 3300025916 | Bacteria | 3698 |
| 462 | Ga0207663_10033349 | 3300025916 | Bacteria | 3067 |
| 463 | Ga0207663_10051331 | 3300025916 | Bacteria | 2567 |
| 464 | Ga0207663_10065805 | 3300025916 | Bacteria | 2318 |
| 465 | Ga0207660_10002445 | 3300025917 | Bacteria | 12199 |
| 466 | Ga0207660_10042093 | 3300025917 | Bacteria | 3204 |
| 467 | Ga0207660_10093076 | 3300025917 | Bacteria | 2238 |
| 468 | Ga0207660_10097784 | 3300025917 | Bacteria | 2188 |
| 469 | Ga0207662_10000336 | 3300025918 | Bacteria | 21233 |
| 470 | Ga0207662_10001601 | 3300025918 | Bacteria | 11088 |
| 471 | Ga0207662_10026989 | 3300025918 | Bacteria | 3315 |
| 472 | Ga0207662_10206364 | 3300025918 | Bacteria | 1274 |
| 473 | Ga0207657_10002336 | 3300025919 | Bacteria | 20569 |
| 474 | Ga0207657_10007357 | 3300025919 | Bacteria | 11295 |
| 475 | Ga0207657_10017992 | 3300025919 | Bacteria | 6762 |
| 476 | Ga0207657_10084548 | 3300025919 | Bacteria | 2659 |
| 477 | Ga0207657_10127407 | 3300025919 | Bacteria | 2090 |
| 478 | Ga0207657_10131101 | 3300025919 | Bacteria | 2054 |
| 479 | Ga0207649_10000571 | 3300025920 | Bacteria | 25261 |
| 480 | Ga0207649_10074201 | 3300025920 | Bacteria | 2182 |
| 481 | Ga0207652_10001096 | 3300025921 | Bacteria | 24512 |
| 482 | Ga0207652_10024326 | 3300025921 | Bacteria | 5024 |
| 483 | Ga0207652_10028056 | 3300025921 | Bacteria | 4694 |
| 484 | Ga0207652_10036717 | 3300025921 | Bacteria | 4143 |
| 485 | Ga0207652_10070802 | 3300025921 | Bacteria | 3029 |
| 486 | Ga0207652_10131671 | 3300025921 | Bacteria | 2231 |
| 487 | Ga0207652_10411903 | 3300025921 | Bacteria | 1219 |
| 488 | Ga0207681_10001995 | 3300025923 | Bacteria | 13117 |
| 489 | Ga0207681_10038114 | 3300025923 | Bacteria | 3182 |
| 490 | Ga0207694_10306960 | 3300025924 | Bacteria | 1307 |
| 491 | Ga0207650_10002486 | 3300025925 | Bacteria | 12815 |
| 492 | Ga0207650_10002540 | 3300025925 | Bacteria | 12659 |
| 493 | Ga0207650_10209043 | 3300025925 | Bacteria | 1567 |
| 494 | Ga0207659_10000127 | 3300025926 | Bacteria | 44761 |
| 495 | Ga0207659_10009920 | 3300025926 | Bacteria | 5959 |
| 496 | Ga0207687_10000334 | 3300025927 | Bacteria | 31485 |
| 497 | Ga0207687_10007796 | 3300025927 | Bacteria | 7023 |
| 498 | Ga0207687_10137937 | 3300025927 | Bacteria | 1847 |
| 499 | Ga0207700_10000379 | 3300025928 | Bacteria | 25793 |
| 500 | Ga0207700_10025593 | 3300025928 | Bacteria | 4100 |
| 501 | Ga0207700_10179641 | 3300025928 | Bacteria | 1771 |
| 502 | Ga0207700_10338193 | 3300025928 | Bacteria | 1308 |
| 503 | Ga0207700_10437444 | 3300025928 | Bacteria | 1151 |
| 504 | Ga0207664_10005567 | 3300025929 | Bacteria | 8627 |
| 505 | Ga0207664_10095660 | 3300025929 | Bacteria | 2444 |
| 506 | Ga0207644_10002918 | 3300025931 | Bacteria | 11013 |
| 507 | Ga0207644_10017238 | 3300025931 | Bacteria | 4873 |
| 508 | Ga0207644_10076800 | 3300025931 | Bacteria | 2458 |
| 509 | Ga0207644_10084280 | 3300025931 | Bacteria | 2356 |
| 510 | Ga0207690_10000571 | 3300025932 | Bacteria | 24086 |
| 511 | Ga0207690_10272513 | 3300025932 | Bacteria | 1315 |
| 512 | Ga0207690_10429338 | 3300025932 | Bacteria | 1058 |
| 513 | Ga0207706_10001765 | 3300025933 | Bacteria | 21233 |
| 514 | Ga0207706_10006968 | 3300025933 | Bacteria | 10448 |
| 515 | Ga0207706_10009390 | 3300025933 | Bacteria | 8978 |
| 516 | Ga0207706_10018247 | 3300025933 | Bacteria | 6314 |
| 517 | Ga0207706_10101056 | 3300025933 | Bacteria | 2537 |
| 518 | Ga0207706_10392640 | 3300025933 | Bacteria | 1203 |
| 519 | Ga0207686_10000297 | 3300025934 | Bacteria | 36292 |
| 520 | Ga0207686_10044357 | 3300025934 | Bacteria | 2729 |
| 521 | Ga0207686_10060158 | 3300025934 | Bacteria | 2403 |
| 522 | Ga0207686_10106106 | 3300025934 | Bacteria | 1885 |
| 523 | Ga0207709_10000257 | 3300025935 | Bacteria | 63623 |
| 524 | Ga0207709_10004698 | 3300025935 | Bacteria | 7855 |
| 525 | Ga0207709_10029892 | 3300025935 | Bacteria | 3165 |
| 526 | Ga0207709_10079847 | 3300025935 | Bacteria | 2105 |
| 527 | Ga0207670_10000371 | 3300025936 | Bacteria | 25929 |
| 528 | Ga0207670_10003900 | 3300025936 | Bacteria | 7959 |
| 529 | Ga0207670_10036616 | 3300025936 | Bacteria | 3192 |
| 530 | Ga0207670_10065705 | 3300025936 | Bacteria | 2490 |
| 531 | Ga0207669_10000089 | 3300025937 | Bacteria | 46184 |
| 532 | Ga0207669_10002276 | 3300025937 | Bacteria | 8167 |
| 533 | Ga0207669_10095076 | 3300025937 | Bacteria | 1952 |
| 534 | Ga0207704_10002403 | 3300025938 | Bacteria | 8415 |
| 535 | Ga0207704_10147497 | 3300025938 | Bacteria | 1655 |
| 536 | Ga0207704_10210183 | 3300025938 | Bacteria | 1431 |
| 537 | Ga0207665_10000286 | 3300025939 | Bacteria | 35188 |
| 538 | Ga0207665_10042095 | 3300025939 | Bacteria | 3053 |
| 539 | Ga0207665_10102604 | 3300025939 | Bacteria | 1999 |
| 540 | Ga0207691_10000439 | 3300025940 | Bacteria | 41424 |
| 541 | Ga0207691_10001737 | 3300025940 | Bacteria | 21481 |
| 542 | Ga0207691_10432927 | 3300025940 | Bacteria | 1120 |
| 543 | Ga0207711_10007990 | 3300025941 | Bacteria | 8851 |
| 544 | Ga0207711_10010452 | 3300025941 | Bacteria | 7705 |
| 545 | Ga0207711_10022455 | 3300025941 | Bacteria | 5276 |
| 546 | Ga0207711_10378042 | 3300025941 | Bacteria | 1314 |
| 547 | Ga0207689_10000095 | 3300025942 | Bacteria | 71568 |
| 548 | Ga0207689_10001936 | 3300025942 | Bacteria | 19598 |
| 549 | Ga0207689_10141671 | 3300025942 | Bacteria | 1980 |
| 550 | Ga0207661_10001967 | 3300025944 | Bacteria | 14147 |
| 551 | Ga0207661_10060251 | 3300025944 | Bacteria | 3062 |
| 552 | Ga0207661_10250420 | 3300025944 | Bacteria | 1574 |
| 553 | Ga0207679_10000073 | 3300025945 | Bacteria | 89687 |
| 554 | Ga0207679_10078649 | 3300025945 | Bacteria | 2513 |
| 555 | Ga0207679_10318680 | 3300025945 | Bacteria | 1345 |
| 556 | Ga0207667_10019155 | 3300025949 | Bacteria | 7653 |
| 557 | Ga0207667_10037097 | 3300025949 | Bacteria | 5214 |
| 558 | Ga0207667_10140860 | 3300025949 | Bacteria | 2483 |
| 559 | Ga0207667_10554410 | 3300025949 | Bacteria | 1162 |
| 560 | Ga0207651_10002317 | 3300025960 | Bacteria | 9071 |
| 561 | Ga0207651_10034042 | 3300025960 | Bacteria | 3294 |
| 562 | Ga0207651_10207301 | 3300025960 | Bacteria | 1575 |
| 563 | Ga0207651_10224298 | 3300025960 | Bacteria | 1521 |
| 564 | Ga0207712_10000457 | 3300025961 | Bacteria | 34730 |
| 565 | Ga0207712_10015429 | 3300025961 | Bacteria | 4930 |
| 566 | Ga0207712_10022855 | 3300025961 | Bacteria | 4122 |
| 567 | Ga0207712_10231107 | 3300025961 | Bacteria | 1485 |
| 568 | Ga0207668_10000900 | 3300025972 | Bacteria | 17944 |
| 569 | Ga0207668_10007427 | 3300025972 | Bacteria | 6516 |
| 570 | Ga0207668_10233938 | 3300025972 | Bacteria | 1483 |
| 571 | Ga0207640_10078245 | 3300025981 | Bacteria | 2250 |
| 572 | Ga0207658_10003961 | 3300025986 | Bacteria | 10399 |
| 573 | Ga0207658_10185640 | 3300025986 | Bacteria | 1724 |
| 574 | Ga0207658_10427324 | 3300025986 | Bacteria | 1169 |
| 575 | Ga0207658_10537504 | 3300025986 | Bacteria | 1045 |
| 576 | Ga0207677_10009295 | 3300026023 | Bacteria | 5526 |
| 577 | Ga0207677_10034616 | 3300026023 | Bacteria | 3272 |
| 578 | Ga0207677_10099552 | 3300026023 | Bacteria | 2135 |
| 579 | Ga0207677_10205908 | 3300026023 | Bacteria | 1567 |
| 580 | Ga0207703_10002103 | 3300026035 | Bacteria | 17526 |
| 581 | Ga0207703_10050527 | 3300026035 | Bacteria | 3366 |
| 582 | Ga0207703_10074613 | 3300026035 | Bacteria | 2809 |
| 583 | Ga0207703_10239104 | 3300026035 | Bacteria | 1632 |
| 584 | Ga0207639_10021948 | 3300026041 | Bacteria | 4592 |
| 585 | Ga0207639_10093322 | 3300026041 | Bacteria | 2413 |
| 586 | Ga0207639_10447774 | 3300026041 | Bacteria | 1172 |
| 587 | Ga0207678_10000426 | 3300026067 | Bacteria | 38181 |
| 588 | Ga0207678_10038173 | 3300026067 | Bacteria | 4174 |
| 589 | Ga0207678_10096997 | 3300026067 | Bacteria | 2519 |
| 590 | Ga0207678_10181207 | 3300026067 | Bacteria | 1799 |
| 591 | Ga0207708_10000624 | 3300026075 | Bacteria | 27228 |
| 592 | Ga0207708_10000991 | 3300026075 | Bacteria | 21233 |
| 593 | Ga0207708_10081663 | 3300026075 | Bacteria | 2485 |
| 594 | Ga0207702_10051329 | 3300026078 | Bacteria | 3485 |
| 595 | Ga0207702_10054124 | 3300026078 | Bacteria | 3400 |
| 596 | Ga0207702_10579059 | 3300026078 | Bacteria | 1100 |
| 597 | Ga0207702_10827603 | 3300026078 | Bacteria | 916 |
| 598 | Ga0207641_10001067 | 3300026088 | Bacteria | 27627 |
| 599 | Ga0207641_10134558 | 3300026088 | Bacteria | 2223 |
| 600 | Ga0207641_10237851 | 3300026088 | Bacteria | 1695 |
| 601 | Ga0207641_10525547 | 3300026088 | Bacteria | 1151 |
| 602 | Ga0207648_10000207 | 3300026089 | Bacteria | 62972 |
| 603 | Ga0207648_10001430 | 3300026089 | Bacteria | 26279 |
| 604 | Ga0207648_10712812 | 3300026089 | Bacteria | 930 |
| 605 | Ga0207676_10000875 | 3300026095 | Bacteria | 23361 |
| 606 | Ga0207676_10006351 | 3300026095 | Bacteria | 8349 |
| 607 | Ga0207676_10061987 | 3300026095 | Bacteria | 2964 |
| 608 | Ga0207674_10001021 | 3300026116 | Bacteria | 36545 |
| 609 | Ga0207674_10144849 | 3300026116 | Bacteria | 2334 |
| 610 | Ga0207675_100001849 | 3300026118 | Bacteria | 21247 |
| 611 | Ga0207675_100031722 | 3300026118 | Bacteria | 4923 |
| 612 | Ga0207675_100074493 | 3300026118 | Bacteria | 3177 |
| 613 | Ga0207683_10000096 | 3300026121 | Bacteria | 71829 |
| 614 | Ga0207683_10006569 | 3300026121 | Bacteria | 9957 |
| 615 | Ga0207683_10016637 | 3300026121 | Bacteria | 6258 |
| 616 | Ga0207683_10154405 | 3300026121 | Bacteria | 2073 |
| 617 | Ga0207698_10000956 | 3300026142 | Bacteria | 16770 |
| 618 | Ga0207698_10106294 | 3300026142 | Bacteria | 2340 |
| 619 | Ga0207698_10311069 | 3300026142 | Bacteria | 1471 |
| 620 | Ga0209984_1005880 | 3300027424 | Bacteria | 1489 |
| 621 | Ga0209179_1000585 | 3300027512 | Bacteria | 3830 |
| 622 | Ga0210002_1000525 | 3300027617 | Bacteria | 5168 |
| 623 | Ga0209971_1024519 | 3300027682 | Bacteria | 1441 |
| 624 | Ga0209966_1021922 | 3300027695 | Bacteria | 1246 |
| 625 | Ga0209998_10000428 | 3300027717 | Bacteria | 11824 |
| 626 | Ga0209998_10006934 | 3300027717 | Bacteria | 2349 |
| 627 | Ga0209813_10024258 | 3300027866 | Bacteria | 1733 |
| 628 | Ga0209974_10009241 | 3300027876 | Bacteria | 3347 |
| 629 | Ga0207428_10000160 | 3300027907 | Bacteria | 92379 |
| 630 | Ga0207428_10000200 | 3300027907 | Bacteria | 83533 |
| 631 | Ga0207428_10000370 | 3300027907 | Bacteria | 57548 |
| 632 | Ga0268266_10019348 | 3300028379 | Bacteria | 5798 |
| 633 | Ga0268266_10028097 | 3300028379 | Bacteria | 4783 |
| 634 | Ga0268266_10251480 | 3300028379 | Bacteria | 1635 |
| 635 | Ga0268265_10001781 | 3300028380 | Bacteria | 17271 |
| 636 | Ga0268264_10038041 | 3300028381 | Bacteria | 3970 |
| 637 | Ga0268264_10053121 | 3300028381 | Bacteria | 3380 |
| 638 | Ga0268264_10118074 | 3300028381 | Bacteria | 2334 |
| 639 | Ga0268264_10123485 | 3300028381 | Bacteria | 2285 |
| 640 | Ga0268264_10378008 | 3300028381 | Bacteria | 1356 |
| 641 | Ga0265330_10051258 | 3300031235 | Bacteria | 1809 |
| 642 | Ga0265325_10000004 | 3300031241 | Bacteria | 347347 |
| 643 | Ga0265339_10016485 | 3300031249 | Bacteria | 4402 |
| 644 | Ga0265339_10122867 | 3300031249 | Bacteria | 1333 |
| 645 | Ga0307513_10299406 | 3300031456 | Bacteria | 1376 |
| 646 | Ga0265313_10033885 | 3300031595 | Bacteria | 2589 |
| 647 | Ga0265314_10048426 | 3300031711 | Bacteria | 2983 |
| 648 | Ga0265342_10001643 | 3300031712 | Bacteria | 20603 |
| 649 | Ga0307416_100231431 | 3300032002 | Bacteria | 1782 |
| 650 | Ga0373930_0001208 | 3300034816 | Bacteria | 3801 |
| 651 | Ga0373948_0000334 | 3300034817 | Bacteria | 5758 |
| 652 | Ga0373950_0013126 | 3300034818 | Bacteria | 1377 |
| 653 | Ga0373958_0000505 | 3300034819 | Bacteria | 4839 |
| 654 | Ga0373938_0000033 | 3300034957 | Bacteria | 17806 |
| 655 | Ga0373938_0002272 | 3300034957 | Bacteria | 3086 |
| 656 | Ga0373926_0002095 | 3300035083 | Bacteria | 6285 |
| 657 | Ga0373926_0035679 | 3300035083 | Bacteria | 1765 |
| 658 | Ga0373928_0000751 | 3300035084 | Bacteria | 6339 |
| 659 | Ga0373928_0002785 | 3300035084 | Bacteria | 3373 |
| 660 | Ga0373934_0002254 | 3300035086 | Bacteria | 7086 |
| 661 | Ga0373934_0020726 | 3300035086 | Bacteria | 2528 |
| 662 | Ga0373940_0002344 | 3300035088 | Bacteria | 3662 |
| 663 | Ga0373944_0000846 | 3300035089 | Bacteria | 7513 |
| 664 | Ga0373949_0002920 | 3300035090 | Bacteria | 4213 |
| 665 | Ga0373951_0000151 | 3300035091 | Bacteria | 25256 |
| 666 | Ga0373951_0001138 | 3300035091 | Bacteria | 7054 |
| 667 | Ga0373951_0011387 | 3300035091 | Bacteria | 1996 |
| 668 | Ga0373952_0002453 | 3300035092 | Bacteria | 3345 |
| 669 | Ga0373952_0006520 | 3300035092 | Bacteria | 2159 |
| 670 | Ga0373923_0000300 | 3300035111 | Bacteria | 10987 |
| 671 | Ga0373923_0000490 | 3300035111 | Bacteria | 9506 |
| 672 | Ga0373923_0012636 | 3300035111 | Bacteria | 3127 |
| 673 | Ga0373932_0003086 | 3300035112 | Bacteria | 4060 |
| 674 | Ga0373932_0003580 | 3300035112 | Bacteria | 3717 |
| 675 | Ga0373932_0005273 | 3300035112 | Bacteria | 3040 |
| 676 | Ga0373936_0002617 | 3300035113 | Bacteria | 6737 |
| 677 | Ga0373936_0009185 | 3300035113 | Bacteria | 3726 |
| 678 | Ga0373936_0070849 | 3300035113 | Bacteria | 1437 |
| 679 | Ga0373939_0001391 | 3300035114 | Bacteria | 5857 |
| 680 | Ga0373939_0009034 | 3300035114 | Bacteria | 2460 |
| 681 | Ga0373939_0102342 | 3300035114 | Bacteria | 985 |
| 682 | Ga0373945_0000782 | 3300035116 | Bacteria | 9304 |
| 683 | Ga0373945_0009702 | 3300035116 | Bacteria | 3158 |
| 684 | Ga0373953_0000111 | 3300035117 | Bacteria | 19729 |
| 685 | Ga0373953_0001285 | 3300035117 | Bacteria | 7193 |
| 686 | Ga0373953_0003588 | 3300035117 | Bacteria | 4853 |
| 687 | Ga0373954_0000300 | 3300035118 | Bacteria | 17956 |
| 688 | Ga0373954_0011115 | 3300035118 | Bacteria | 3983 |
| 689 | Ga0373954_0028526 | 3300035118 | Bacteria | 2566 |
| 690 | Ga0373956_0001245 | 3300035119 | Bacteria | 10539 |
| 691 | Ga0373956_0015303 | 3300035119 | Bacteria | 3210 |
| 692 | Ga0373956_0022189 | 3300035119 | Bacteria | 2714 |
| 693 | Ga0373956_0062032 | 3300035119 | Bacteria | 1694 |
| 694 | Ga0373956_0144849 | 3300035119 | Bacteria | 1116 |
| 695 | Ga0373957_0000236 | 3300035120 | Bacteria | 13729 |
| 696 | Ga0373957_0002366 | 3300035120 | Bacteria | 5365 |
| 697 | Ga0373957_0008008 | 3300035120 | Bacteria | 3407 |
| 698 | Ga0373960_0000463 | 3300035121 | Bacteria | 8007 |
| 699 | Ga0373960_0002285 | 3300035121 | Bacteria | 4313 |
| 700 | Ga0373960_0031850 | 3300035121 | Bacteria | 1477 |
| 701 | Ga0373943_0004590 | 3300035170 | Bacteria | 6240 |
| 702 | Ga0373943_0007545 | 3300035170 | Bacteria | 4885 |
| 703 | Ga0373943_0037247 | 3300035170 | Bacteria | 2334 |
| 704 | Ga0373943_0061648 | 3300035170 | Bacteria | 1876 |
| 705 | Ga0373943_0162283 | 3300035170 | Bacteria | 1217 |
| 706 | Ga0373946_0000328 | 3300035171 | Bacteria | 15398 |
| 707 | Ga0373946_0011843 | 3300035171 | Bacteria | 3260 |
| 708 | Ga0373955_0007704 | 3300035172 | Bacteria | 4959 |
| 709 | Ga0373955_0009202 | 3300035172 | Bacteria | 4619 |
| 710 | Ga0373955_0015379 | 3300035172 | Bacteria | 3745 |
| 711 | Ga0373942_0001015 | 3300035207 | Bacteria | 7643 |
| 712 | Ga0373942_0017453 | 3300035207 | Bacteria | 1769 |
| 713 | Ga0373942_0032081 | 3300035207 | Bacteria | 1393 |
| 714 | Ga0373961_0000507 | 3300035241 | Bacteria | 14951 |
| 715 | Ga0373961_0005656 | 3300035241 | Bacteria | 3000 |
| 716 | Ga0373961_0007487 | 3300035241 | Bacteria | 2641 |
| 717 | Ga0373962_0005038 | 3300035242 | Bacteria | 3193 |
| 718 | Ga0373962_0006073 | 3300035242 | Bacteria | 2920 |
| 719 | Ga0373962_0007889 | 3300035242 | Bacteria | 2612 |
| 720 | Ga0373924_0001495 | 3300035410 | Bacteria | 7610 |
| 721 | Ga0373924_0042484 | 3300035410 | Bacteria | 1865 |
| 722 | Ga0373931_0009310 | 3300035691 | Bacteria | 4692 |
| 723 | Ga0373931_0011436 | 3300035691 | Bacteria | 4288 |
| 724 | Ga0373931_0031193 | 3300035691 | Bacteria | 2749 |
| 725 | Ga0373931_0129083 | 3300035691 | Bacteria | 1453 |
| 726 | Ga0373931_0219482 | 3300035691 | Bacteria | 1144 |
| 727 | Ga0373931_0255098 | 3300035691 | Bacteria | 1068 |
| 728 | Ga0373931_0365313 | 3300035691 | Bacteria | 906 |
| 729 | Ga0373935_0002234 | 3300035692 | Bacteria | 11016 |
| 730 | Ga0373935_0002426 | 3300035692 | Bacteria | 10671 |
| 731 | Ga0373935_0013222 | 3300035692 | Bacteria | 4977 |
| 732 | Ga0373935_0054097 | 3300035692 | Bacteria | 2554 |
| 733 | Ga0373935_0302577 | 3300035692 | Bacteria | 1131 |
| 734 | Ga0373927_0005714 | 3300035695 | Bacteria | 8539 |
| 735 | Ga0373927_0014805 | 3300035695 | Bacteria | 5157 |
| 736 | Ga0373927_0030360 | 3300035695 | Bacteria | 3526 |
| 737 | Ga0373927_0050433 | 3300035695 | Bacteria | 2691 |
| 738 | Ga0373927_0235516 | 3300035695 | Bacteria | 1203 |
| 739 | Ga0373933_0002450 | 3300035724 | Bacteria | 10444 |
| 740 | Ga0373933_0003172 | 3300035724 | Bacteria | 9183 |
| 741 | Ga0373933_0004760 | 3300035724 | Bacteria | 7421 |
| 742 | Ga0373933_0010871 | 3300035724 | Bacteria | 4996 |
| 743 | Ga0373947_0008877 | 3300035725 | Bacteria | 5784 |
| 744 | Ga0373947_0011163 | 3300035725 | Bacteria | 5157 |
| 745 | Ga0373947_0016348 | 3300035725 | Bacteria | 4264 |
| 746 | Ga0373937_0000864 | 3300036401 | Bacteria | 26035 |
| 747 | Ga0373937_0001621 | 3300036401 | Bacteria | 18907 |
| 748 | Ga0373937_0008258 | 3300036401 | Bacteria | 9038 |
| 749 | Ga0373937_0014163 | 3300036401 | Bacteria | 7033 |
| 750 | Ga0373937_0089986 | 3300036401 | Bacteria | 2842 |
| 751 | Ga0373937_0342507 | 3300036401 | Bacteria | 1416 |
| 752 | Ga0373925_0000639 | 3300037068 | Bacteria | 32946 |
| 753 | Ga0373925_0021865 | 3300037068 | Bacteria | 4662 |
| 754 | Ga0373925_0282705 | 3300037068 | Bacteria | 1336 |
| 755 | Ga0373925_0433040 | 3300037068 | Bacteria | 1076 |
| 756 | Ga0395899_0003310 | 3300037312 | Bacteria | 12769 |
| 757 | Ga0395899_0010414 | 3300037312 | Bacteria | 7126 |
| 758 | Ga0395900_0002147 | 3300037418 | Bacteria | 22057 |
| 759 | Ga0395900_0010578 | 3300037418 | Bacteria | 9434 |
| 760 | Ga0395898_0013547 | 3300037466 | Bacteria | 8394 |
| 761 | Ga0395898_0015323 | 3300037466 | Bacteria | 7863 |
| 762 | Ga0395901_0006050 | 3300038443 | Bacteria | 12259 |
| 763 | Ga0395901_0008240 | 3300038443 | Bacteria | 10531 |
| 764 | Ga0395901_0243431 | 3300038443 | Bacteria | 1875 |
| 765 | Ga0436365_0476069 | 3300039437 | Bacteria | 19942 |
| 766 | Ga0436361_0166397 | 3300039447 | Bacteria | 45243 |
| 767 | Ga0451853_2535465 | 3300041512 | Bacteria | 1139 |
| 768 | Ga0439448_0009871 | 3300042005 | Bacteria | 2820 |
| 769 | Ga0466963_0051924 | 3300044694 | Bacteria | 2719 |
| 770 | Ga0466963_0198923 | 3300044694 | Bacteria | 1401 |
| 771 | Ga0466963_0211403 | 3300044694 | Bacteria | 1357 |
| 772 | Ga0466963_0280349 | 3300044694 | Bacteria | 1171 |
| 773 | Ga0466963_0319115 | 3300044694 | Bacteria | 1093 |
| 774 | Ga0453684_0543985 | 3300044712 | Bacteria | 1280 |
| 775 | Ga0466971_0007301 | 3300044719 | Bacteria | 4812 |
| 776 | Ga0466971_0156615 | 3300044719 | Bacteria | 1065 |
| 777 | Ga0466957_0024459 | 3300044842 | Bacteria | 3574 |
| 778 | Ga0466957_0053779 | 3300044842 | Bacteria | 2456 |
| 779 | Ga0451576_0003863 | 3300045051 | Bacteria | 20091 |
| 780 | Ga0451576_0644855 | 3300045051 | Bacteria | 1113 |
| 781 | Ga0466958_0044559 | 3300045836 | Bacteria | 2674 |
| 782 | Ga0466958_0130907 | 3300045836 | Bacteria | 1575 |
| 783 | Ga0466958_0355932 | 3300045836 | Bacteria | 943 |
| 784 | Ga0466967_0004231 | 3300045976 | Bacteria | 9630 |
| 785 | Ga0466967_0032121 | 3300045976 | Bacteria | 4429 |
| 786 | Ga0466967_0283894 | 3300045976 | Bacteria | 1589 |
| 787 | Ga0495592_0000348 | 3300046454 | Bacteria | 37669 |
| 788 | Ga0495592_0000507 | 3300046454 | Bacteria | 28370 |
| 789 | Ga0495592_0001602 | 3300046454 | Bacteria | 15841 |
| 790 | Ga0495592_0025827 | 3300046454 | Bacteria | 4458 |
| 791 | Ga0495592_0086790 | 3300046454 | Bacteria | 2252 |
| 792 | Ga0495592_0145967 | 3300046454 | Bacteria | 1640 |
| 793 | Ga0495592_0165449 | 3300046454 | Bacteria | 1518 |
| 794 | Ga0495603_0017210 | 3300046455 | Bacteria | 4375 |
| 795 | Ga0495603_0018541 | 3300046455 | Bacteria | 4209 |
| 796 | Ga0495603_0029474 | 3300046455 | Bacteria | 3308 |
| 797 | Ga0495603_0077764 | 3300046455 | Bacteria | 1946 |
| 798 | Ga0495629_0000107 | 3300046459 | Bacteria | 74043 |
| 799 | Ga0495629_0000318 | 3300046459 | Bacteria | 41154 |
| 800 | Ga0495629_0020542 | 3300046459 | Bacteria | 4716 |
| 801 | Ga0495629_0050912 | 3300046459 | Bacteria | 2899 |
| 802 | Ga0495629_0052427 | 3300046459 | Bacteria | 2854 |
| 803 | Ga0495629_0057506 | 3300046459 | Bacteria | 2719 |
| 804 | Ga0495629_0075114 | 3300046459 | Bacteria | 2360 |
| 805 | Ga0495629_0090176 | 3300046459 | Bacteria | 2139 |
| 806 | Ga0495629_0156072 | 3300046459 | Bacteria | 1586 |
| 807 | Ga0495638_0032977 | 3300046460 | Bacteria | 3314 |
| 808 | Ga0495638_0048301 | 3300046460 | Bacteria | 2664 |
| 809 | Ga0495641_0005661 | 3300046461 | Bacteria | 8337 |
| 810 | Ga0495641_0035588 | 3300046461 | Bacteria | 2345 |
| 811 | Ga0495641_0048346 | 3300046461 | Bacteria | 1951 |
| 812 | Ga0495651_0000529 | 3300046462 | Bacteria | 29571 |
| 813 | Ga0495651_0000617 | 3300046462 | Bacteria | 27648 |
| 814 | Ga0495651_0013471 | 3300046462 | Bacteria | 6324 |
| 815 | Ga0495651_0015568 | 3300046462 | Bacteria | 5885 |
| 816 | Ga0495651_0020419 | 3300046462 | Bacteria | 5143 |
| 817 | Ga0495651_0062159 | 3300046462 | Bacteria | 2857 |
| 818 | Ga0495651_0437984 | 3300046462 | Bacteria | 847 |
| 819 | Ga0495653_0000030 | 3300046463 | Bacteria | 142668 |
| 820 | Ga0495653_0002510 | 3300046463 | Bacteria | 14613 |
| 821 | Ga0495653_0003035 | 3300046463 | Bacteria | 13461 |
| 822 | Ga0495653_0005220 | 3300046463 | Bacteria | 10562 |
| 823 | Ga0495653_0183181 | 3300046463 | Bacteria | 1435 |
| 824 | Ga0495580_0001533 | 3300046472 | Bacteria | 20325 |
| 825 | Ga0495580_0138088 | 3300046472 | Bacteria | 1690 |
| 826 | Ga0495582_0001909 | 3300046473 | Bacteria | 11716 |
| 827 | Ga0495582_0010007 | 3300046473 | Bacteria | 5219 |
| 828 | Ga0495582_0024470 | 3300046473 | Bacteria | 3304 |
| 829 | Ga0495582_0079933 | 3300046473 | Bacteria | 1815 |
| 830 | Ga0495639_0016223 | 3300046475 | Bacteria | 3232 |
| 831 | Ga0495639_0061445 | 3300046475 | Bacteria | 1723 |
| 832 | Ga0495662_0000621 | 3300046476 | Bacteria | 16471 |
| 833 | Ga0495662_0029966 | 3300046476 | Bacteria | 2627 |
| 834 | Ga0495664_0000003 | 3300046477 | Bacteria | 551602 |
| 835 | Ga0495664_0008486 | 3300046477 | Bacteria | 5731 |
| 836 | Ga0495664_0020131 | 3300046477 | Bacteria | 3844 |
| 837 | Ga0495664_0068309 | 3300046477 | Bacteria | 2120 |
| 838 | Ga0495664_0073669 | 3300046477 | Bacteria | 2042 |
| 839 | Ga0495664_0147746 | 3300046477 | Bacteria | 1426 |
| 840 | Ga0495585_0082270 | 3300046492 | Bacteria | 1743 |
| 841 | Ga0495594_0003322 | 3300046499 | Bacteria | 8320 |
| 842 | Ga0495594_0278971 | 3300046499 | Bacteria | 952 |
| 843 | Ga0495607_0043916 | 3300046501 | Bacteria | 2639 |
| 844 | Ga0495608_0000011 | 3300046511 | Bacteria | 248514 |
| 845 | Ga0495608_0002492 | 3300046511 | Bacteria | 13201 |
| 846 | Ga0495608_0007440 | 3300046511 | Bacteria | 7737 |
| 847 | Ga0495608_0010318 | 3300046511 | Bacteria | 6518 |
| 848 | Ga0495608_0069090 | 3300046511 | Bacteria | 2309 |
| 849 | Ga0495608_0194482 | 3300046511 | Bacteria | 1280 |
| 850 | Ga0495618_0000025 | 3300046514 | Bacteria | 116027 |
| 851 | Ga0495618_0075618 | 3300046514 | Bacteria | 2145 |
| 852 | Ga0495618_0111633 | 3300046514 | Bacteria | 1750 |
| 853 | Ga0495628_0000001 | 3300046516 | Bacteria | 917742 |
| 854 | Ga0495628_0003426 | 3300046516 | Bacteria | 14196 |
| 855 | Ga0495628_0101479 | 3300046516 | Bacteria | 2220 |
| 856 | Ga0495630_0000286 | 3300046517 | Bacteria | 40823 |
| 857 | Ga0495630_0022078 | 3300046517 | Bacteria | 4702 |
| 858 | Ga0495630_0104057 | 3300046517 | Bacteria | 2148 |
| 859 | Ga0495630_0192170 | 3300046517 | Bacteria | 1557 |
| 860 | Ga0495630_0269842 | 3300046517 | Bacteria | 1300 |
| 861 | Ga0495648_0022351 | 3300046524 | Bacteria | 4358 |
| 862 | Ga0495666_0000591 | 3300046526 | Bacteria | 16217 |
| 863 | Ga0495666_0068946 | 3300046526 | Bacteria | 1683 |
| 864 | Ga0495652_0000002 | 3300046529 | Bacteria | 946606 |
| 865 | Ga0495652_0002788 | 3300046529 | Bacteria | 17644 |
| 866 | Ga0495652_0005630 | 3300046529 | Bacteria | 11736 |
| 867 | Ga0495652_0018534 | 3300046529 | Bacteria | 6206 |
| 868 | Ga0495652_0126708 | 3300046529 | Bacteria | 2027 |
| 869 | Ga0495652_0171116 | 3300046529 | Bacteria | 1676 |
| 870 | Ga0495665_0000336 | 3300046531 | Bacteria | 23763 |
| 871 | Ga0495665_0023457 | 3300046531 | Bacteria | 3314 |
| 872 | Ga0495640_0000002 | 3300046533 | Bacteria | 646434 |
| 873 | Ga0495640_0006838 | 3300046533 | Bacteria | 8988 |
| 874 | Ga0495640_0066410 | 3300046533 | Bacteria | 2433 |
| 875 | Ga0495640_0256270 | 3300046533 | Bacteria | 1094 |
| 876 | Ga0495586_0003307 | 3300046535 | Bacteria | 8645 |
| 877 | Ga0495587_0000001 | 3300046536 | Bacteria | 724132 |
| 878 | Ga0495587_0008854 | 3300046536 | Bacteria | 6459 |
| 879 | Ga0495587_0013020 | 3300046536 | Bacteria | 5231 |
| 880 | Ga0495598_0010258 | 3300046537 | Bacteria | 2240 |
| 881 | Ga0495598_0038376 | 3300046537 | Bacteria | 1387 |
| 882 | Ga0495609_0036676 | 3300046538 | Bacteria | 2213 |
| 883 | Ga0495621_0079131 | 3300046539 | Bacteria | 1223 |
| 884 | Ga0495645_0000276 | 3300046543 | Bacteria | 37763 |
| 885 | Ga0495645_0008693 | 3300046543 | Bacteria | 7092 |
| 886 | Ga0495645_0020142 | 3300046543 | Bacteria | 4809 |
| 887 | Ga0495622_0037360 | 3300046557 | Bacteria | 2262 |
| 888 | Ga0495633_0008197 | 3300046558 | Bacteria | 5917 |
| 889 | Ga0495633_0024998 | 3300046558 | Bacteria | 2946 |
| 890 | Ga0495667_0000004 | 3300046559 | Bacteria | 295297 |
| 891 | Ga0495667_0002448 | 3300046559 | Bacteria | 12395 |
| 892 | Ga0495667_0002926 | 3300046559 | Bacteria | 11463 |
| 893 | Ga0495667_0005696 | 3300046559 | Bacteria | 8435 |
| 894 | Ga0495667_0008390 | 3300046559 | Bacteria | 7008 |
| 895 | Ga0495667_0087500 | 3300046559 | Bacteria | 2020 |
| 896 | Ga0495656_0013754 | 3300046615 | Bacteria | 3018 |
| 897 | Ga0495634_0001327 | 3300046642 | Bacteria | 22545 |
| 898 | Ga0495634_0043559 | 3300046642 | Bacteria | 3041 |
| 899 | Ga0495634_0060532 | 3300046642 | Bacteria | 2519 |
| 900 | Ga0495634_0079556 | 3300046642 | Bacteria | 2146 |
| 901 | Ga0495634_0137146 | 3300046642 | Bacteria | 1556 |
| 902 | Ga0495634_0156980 | 3300046642 | Bacteria | 1436 |
| 903 | Ga0495611_0147867 | 3300046648 | Bacteria | 1097 |
| 904 | Ga0495635_0000001 | 3300046663 | Bacteria | 704901 |
| 905 | Ga0495635_0000677 | 3300046663 | Bacteria | 21942 |
| 906 | Ga0495635_0008814 | 3300046663 | Bacteria | 7043 |
| 907 | Ga0495635_0020091 | 3300046663 | Bacteria | 4655 |
| 908 | Ga0495635_0052506 | 3300046663 | Bacteria | 2808 |
| 909 | Ga0495661_0025055 | 3300046665 | Bacteria | 3860 |
| 910 | Ga0495661_0150829 | 3300046665 | Bacteria | 1256 |
| 911 | Ga0495588_0004745 | 3300046674 | Bacteria | 6008 |
| 912 | Ga0495588_0053170 | 3300046674 | Bacteria | 2088 |
| 913 | Ga0495588_0089477 | 3300046674 | Bacteria | 1612 |
| 914 | Ga0495588_0175684 | 3300046674 | Bacteria | 1132 |
| 915 | Ga0495657_0000190 | 3300046675 | Bacteria | 55153 |
| 916 | Ga0495657_0002217 | 3300046675 | Bacteria | 16443 |
| 917 | Ga0495657_0028524 | 3300046675 | Bacteria | 3925 |
| 918 | Ga0495657_0080100 | 3300046675 | Bacteria | 2114 |
| 919 | Ga0495599_0000212 | 3300046678 | Bacteria | 37642 |
| 920 | Ga0495599_0017767 | 3300046678 | Bacteria | 4426 |
| 921 | Ga0495599_0021527 | 3300046678 | Bacteria | 4023 |
| 922 | Ga0495599_0043661 | 3300046678 | Bacteria | 2813 |
| 923 | Ga0495623_0001914 | 3300046679 | Bacteria | 13972 |
| 924 | Ga0495623_0004877 | 3300046679 | Bacteria | 8799 |
| 925 | Ga0495623_0028747 | 3300046679 | Bacteria | 3577 |
| 926 | Ga0495623_0055409 | 3300046679 | Bacteria | 2499 |
| 927 | Ga0495646_0000009 | 3300046680 | Bacteria | 200698 |
| 928 | Ga0495646_0005225 | 3300046680 | Bacteria | 8182 |
| 929 | Ga0495646_0033048 | 3300046680 | Bacteria | 3217 |
| 930 | Ga0495646_0110395 | 3300046680 | Bacteria | 1567 |
| 931 | Ga0495647_0000542 | 3300046681 | Bacteria | 11081 |
| 932 | Ga0495647_0011950 | 3300046681 | Bacteria | 2983 |
| 933 | Ga0495658_0016142 | 3300046683 | Bacteria | 3842 |
| 934 | Ga0495658_0045946 | 3300046683 | Bacteria | 2453 |
| 935 | Ga0495613_0008263 | 3300046689 | Bacteria | 7725 |
| 936 | Ga0495613_0020437 | 3300046689 | Bacteria | 4936 |
| 937 | Ga0495613_0022253 | 3300046689 | Bacteria | 4725 |
| 938 | Ga0495613_0128003 | 3300046689 | Bacteria | 1820 |
| 939 | Ga0495624_0004828 | 3300046690 | Bacteria | 9803 |
| 940 | Ga0495624_0034363 | 3300046690 | Bacteria | 3279 |
| 941 | Ga0495624_0037456 | 3300046690 | Bacteria | 3120 |
| 942 | Ga0495624_0118515 | 3300046690 | Bacteria | 1626 |
| 943 | Ga0495670_0013865 | 3300046691 | Bacteria | 3963 |
| 944 | Ga0495671_0137294 | 3300046692 | Bacteria | 1192 |
| 945 | Ga0495600_0002696 | 3300046809 | Bacteria | 10263 |
| 946 | Ga0495600_0010015 | 3300046809 | Bacteria | 5875 |
| 947 | Ga0495600_0010920 | 3300046809 | Bacteria | 5648 |
| 948 | Ga0495600_0043987 | 3300046809 | Bacteria | 2913 |
| 949 | Ga0495600_0060771 | 3300046809 | Bacteria | 2468 |
| 950 | Ga0495581_0003207 | 3300047315 | Bacteria | 9368 |
| 951 | Ga0495581_0036271 | 3300047315 | Bacteria | 2853 |
| 952 | Ga0495581_0198289 | 3300047315 | Bacteria | 1174 |
| 953 | Ga0495604_0000008 | 3300047317 | Bacteria | 341160 |
| 954 | Ga0495604_0001378 | 3300047317 | Bacteria | 19921 |
| 955 | Ga0495604_0036466 | 3300047317 | Bacteria | 3876 |
| 956 | Ga0495604_0078768 | 3300047317 | Bacteria | 2472 |
| 957 | Ga0495604_0322079 | 3300047317 | Bacteria | 1033 |
| 958 | Ga0495674_0000016 | 3300047319 | Bacteria | 216763 |
| 959 | Ga0495674_0016566 | 3300047319 | Bacteria | 6879 |
| 960 | Ga0495674_0024317 | 3300047319 | Bacteria | 5567 |
| 961 | Ga0495674_0041625 | 3300047319 | Bacteria | 4102 |
| 962 | Ga0495674_0051448 | 3300047319 | Bacteria | 3631 |
| 963 | Ga0495676_0025024 | 3300047321 | Bacteria | 5157 |
| 964 | Ga0495676_0111577 | 3300047321 | Bacteria | 2005 |
| 965 | Ga0495680_0008529 | 3300047322 | Bacteria | 9311 |
| 966 | Ga0495680_0011642 | 3300047322 | Bacteria | 7772 |
| 967 | Ga0495680_0011911 | 3300047322 | Bacteria | 7673 |
| 968 | Ga0495680_0014012 | 3300047322 | Bacteria | 6968 |
| 969 | Ga0495680_0014703 | 3300047322 | Bacteria | 6769 |
| 970 | Ga0495675_0001056 | 3300047444 | Bacteria | 16742 |
| 971 | Ga0495675_0004044 | 3300047444 | Bacteria | 8887 |
| 972 | Ga0495675_0010919 | 3300047444 | Bacteria | 5693 |
| 973 | Ga0495675_0050487 | 3300047444 | Bacteria | 2644 |
| 974 | Ga0495684_0000002 | 3300047471 | Bacteria | 341216 |
| 975 | Ga0495684_0000860 | 3300047471 | Bacteria | 24632 |
| 976 | Ga0495684_0148983 | 3300047471 | Bacteria | 1750 |
| 977 | Ga0495593_0000458 | 3300047673 | Bacteria | 22861 |
| 978 | Ga0495593_0001605 | 3300047673 | Bacteria | 13357 |
| 979 | Ga0495593_0002782 | 3300047673 | Bacteria | 10535 |
| 980 | Ga0495593_0030736 | 3300047673 | Bacteria | 2937 |
| 981 | Ga0495593_0122668 | 3300047673 | Bacteria | 1322 |
| 982 | Ga0495602_0000024 | 3300048088 | Bacteria | 151162 |
| 983 | Ga0495602_0003273 | 3300048088 | Bacteria | 16731 |
| 984 | Ga0495602_0017859 | 3300048088 | Bacteria | 7100 |
| 985 | Ga0495602_0027982 | 3300048088 | Bacteria | 5406 |
| 986 | Ga0495602_0030760 | 3300048088 | Bacteria | 5087 |
| 987 | Ga0495602_0262551 | 3300048088 | Bacteria | 1280 |
| 988 | Ga0495614_0011159 | 3300048089 | Bacteria | 3954 |
| 989 | Ga0495626_0040178 | 3300048091 | Bacteria | 2211 |
| 990 | Ga0496100_0000272 | 3300048903 | Bacteria | 26163 |
| 991 | Ga0496100_0032975 | 3300048903 | Bacteria | 3236 |
| 992 | Ga0496100_0058563 | 3300048903 | Bacteria | 2528 |
| 993 | Ga0496100_0323150 | 3300048903 | Bacteria | 1159 |
| 994 | Ga0496100_0518992 | 3300048903 | Bacteria | 919 |
| 995 | Ga0496101_0002019 | 3300048904 | Bacteria | 12322 |
| 996 | Ga0496101_0008709 | 3300048904 | Bacteria | 6635 |
| 997 | Ga0496101_0013970 | 3300048904 | Bacteria | 5392 |
| 998 | Ga0496101_0240486 | 3300048904 | Bacteria | 1409 |
| 999 | Ga0496102_0002730 | 3300048905 | Bacteria | 15043 |
| 1000 | Ga0496102_0020794 | 3300048905 | Bacteria | 5800 |
| 1001 | Ga0496102_0033680 | 3300048905 | Bacteria | 4605 |
| 1002 | Ga0496102_0048118 | 3300048905 | Bacteria | 3877 |
| 1003 | Ga0496102_0202442 | 3300048905 | Bacteria | 1871 |
| 1004 | Ga0496102_0361567 | 3300048905 | Bacteria | 1366 |
| 1005 | Ga0496102_0363902 | 3300048905 | Bacteria | 1362 |
| 1006 | Ga0496102_0402787 | 3300048905 | Bacteria | 1286 |
| 1007 | Ga0496102_0433503 | 3300048905 | Bacteria | 1234 |
| 1008 | Ga0496103_0001472 | 3300048906 | Bacteria | 15759 |
| 1009 | Ga0496103_0009753 | 3300048906 | Bacteria | 5685 |
| 1010 | Ga0496103_0063499 | 3300048906 | Bacteria | 2300 |
| 1011 | Ga0496103_0106759 | 3300048906 | Bacteria | 1776 |
| 1012 | Ga0496103_0142376 | 3300048906 | Bacteria | 1534 |
| 1013 | Ga0496103_0147094 | 3300048906 | Bacteria | 1508 |
| 1014 | Ga0496103_0234193 | 3300048906 | Bacteria | 1181 |
| 1015 | Ga0496104_0000369 | 3300048907 | Bacteria | 39830 |
| 1016 | Ga0496104_0000515 | 3300048907 | Bacteria | 33122 |
| 1017 | Ga0496104_0004766 | 3300048907 | Bacteria | 11811 |
| 1018 | Ga0496104_0005758 | 3300048907 | Bacteria | 10847 |
| 1019 | Ga0496104_0008157 | 3300048907 | Bacteria | 9296 |
| 1020 | Ga0496104_0011977 | 3300048907 | Bacteria | 7781 |
| 1021 | Ga0496104_0029600 | 3300048907 | Bacteria | 5080 |
| 1022 | Ga0496104_0144938 | 3300048907 | Bacteria | 2281 |
| 1023 | Ga0496104_0210946 | 3300048907 | Bacteria | 1853 |
| 1024 | Ga0496105_0000405 | 3300048908 | Bacteria | 28378 |
| 1025 | Ga0496105_0001722 | 3300048908 | Bacteria | 15636 |
| 1026 | Ga0496105_0004314 | 3300048908 | Bacteria | 10708 |
| 1027 | Ga0496105_0007091 | 3300048908 | Bacteria | 8641 |
| 1028 | Ga0496105_0010305 | 3300048908 | Bacteria | 7348 |
| 1029 | Ga0496105_0024232 | 3300048908 | Bacteria | 4930 |
| 1030 | Ga0496105_0096029 | 3300048908 | Bacteria | 2448 |
| 1031 | Ga0496105_0158797 | 3300048908 | Bacteria | 1856 |
| 1032 | Ga0496106_0002568 | 3300048909 | Bacteria | 13513 |
| 1033 | Ga0496106_0007653 | 3300048909 | Bacteria | 7992 |
| 1034 | Ga0496106_0011101 | 3300048909 | Bacteria | 6662 |
| 1035 | Ga0496106_0017933 | 3300048909 | Bacteria | 5235 |
| 1036 | Ga0496106_0047636 | 3300048909 | Bacteria | 3226 |
| 1037 | Ga0496106_0079634 | 3300048909 | Bacteria | 2515 |
| 1038 | Ga0496106_0087592 | 3300048909 | Bacteria | 2399 |
| 1039 | Ga0496107_0002783 | 3300048910 | Bacteria | 11534 |
| 1040 | Ga0496107_0008620 | 3300048910 | Bacteria | 7062 |
| 1041 | Ga0496107_0011938 | 3300048910 | Bacteria | 6065 |
| 1042 | Ga0496107_0017035 | 3300048910 | Bacteria | 5109 |
| 1043 | Ga0496107_0032107 | 3300048910 | Bacteria | 3751 |
| 1044 | Ga0496108_0000746 | 3300048911 | Bacteria | 25332 |
| 1045 | Ga0496108_0001488 | 3300048911 | Bacteria | 18519 |
| 1046 | Ga0496108_0005878 | 3300048911 | Bacteria | 9946 |
| 1047 | Ga0496108_0022041 | 3300048911 | Bacteria | 5237 |
| 1048 | Ga0496108_0049453 | 3300048911 | Bacteria | 3516 |
| 1049 | Ga0496108_0088713 | 3300048911 | Bacteria | 2628 |
| 1050 | Ga0496109_0001064 | 3300048912 | Bacteria | 22726 |
| 1051 | Ga0496109_0001275 | 3300048912 | Bacteria | 20899 |
| 1052 | Ga0496109_0002498 | 3300048912 | Bacteria | 15419 |
| 1053 | Ga0496109_0002783 | 3300048912 | Bacteria | 14656 |
| 1054 | Ga0496109_0003828 | 3300048912 | Bacteria | 12569 |
| 1055 | Ga0496109_0005286 | 3300048912 | Bacteria | 10788 |
| 1056 | Ga0496109_0032914 | 3300048912 | Bacteria | 4664 |
| 1057 | Ga0496109_0097700 | 3300048912 | Bacteria | 2722 |
| 1058 | Ga0496109_0343865 | 3300048912 | Bacteria | 1409 |
| 1059 | Ga0496110_0004442 | 3300048913 | Bacteria | 10873 |
| 1060 | Ga0496110_0016391 | 3300048913 | Bacteria | 6186 |
| 1061 | Ga0496110_0019993 | 3300048913 | Bacteria | 5645 |
| 1062 | Ga0496110_0041359 | 3300048913 | Bacteria | 4021 |
| 1063 | Ga0496110_0045332 | 3300048913 | Bacteria | 3843 |
| 1064 | Ga0496110_0234443 | 3300048913 | Bacteria | 1670 |
| 1065 | Ga0496110_0254612 | 3300048913 | Bacteria | 1598 |
| 1066 | Ga0496110_0308259 | 3300048913 | Bacteria | 1442 |
| 1067 | Ga0496111_0000317 | 3300048914 | Bacteria | 23872 |
| 1068 | Ga0496111_0001286 | 3300048914 | Bacteria | 14053 |
| 1069 | Ga0496111_0001412 | 3300048914 | Bacteria | 13658 |
| 1070 | Ga0496111_0008225 | 3300048914 | Bacteria | 6896 |
| 1071 | Ga0496111_0011999 | 3300048914 | Bacteria | 5857 |
| 1072 | Ga0496111_0188492 | 3300048914 | Bacteria | 1533 |
| 1073 | Ga0496111_0191506 | 3300048914 | Bacteria | 1520 |
| 1074 | Ga0496112_0002618 | 3300048915 | Bacteria | 14532 |
| 1075 | Ga0496112_0007084 | 3300048915 | Bacteria | 9909 |
| 1076 | Ga0496112_0041124 | 3300048915 | Bacteria | 4521 |
| 1077 | Ga0496112_0053814 | 3300048915 | Bacteria | 3954 |
| 1078 | Ga0496112_0068721 | 3300048915 | Bacteria | 3499 |
| 1079 | Ga0496112_0096675 | 3300048915 | Bacteria | 2923 |
| 1080 | Ga0496112_0200508 | 3300048915 | Bacteria | 1955 |
| 1081 | Ga0496112_0224410 | 3300048915 | Bacteria | 1834 |
| 1082 | Ga0496112_0244164 | 3300048915 | Bacteria | 1748 |
| 1083 | Ga0496113_0001219 | 3300048916 | Bacteria | 14112 |
| 1084 | Ga0496113_0010915 | 3300048916 | Bacteria | 6029 |
| 1085 | Ga0496113_0024381 | 3300048916 | Bacteria | 4299 |
| 1086 | Ga0496113_0069306 | 3300048916 | Bacteria | 2678 |
| 1087 | Ga0496113_0117909 | 3300048916 | Bacteria | 2073 |
| 1088 | Ga0496114_0004353 | 3300048917 | Bacteria | 10958 |
| 1089 | Ga0496114_0011545 | 3300048917 | Bacteria | 7058 |
| 1090 | Ga0496114_0018863 | 3300048917 | Bacteria | 5586 |
| 1091 | Ga0496114_0052882 | 3300048917 | Bacteria | 3384 |
| 1092 | Ga0496114_0144396 | 3300048917 | Bacteria | 2062 |
| 1093 | Ga0496115_0000935 | 3300048918 | Bacteria | 21173 |
| 1094 | Ga0496115_0003791 | 3300048918 | Bacteria | 10875 |
| 1095 | Ga0496115_0004706 | 3300048918 | Bacteria | 9893 |
| 1096 | Ga0496115_0023902 | 3300048918 | Bacteria | 4745 |
| 1097 | Ga0496115_0042634 | 3300048918 | Bacteria | 3615 |
| 1098 | Ga0496115_0121906 | 3300048918 | Bacteria | 2146 |
| 1099 | Ga0496115_0156196 | 3300048918 | Bacteria | 1885 |
| 1100 | Ga0496115_0438697 | 3300048918 | Bacteria | 1056 |
| 1101 | Ga0496118_0065934 | 3300048921 | Bacteria | 2646 |
| 1102 | Ga0496120_0061953 | 3300048923 | Bacteria | 2086 |
| 1103 | Ga0496121_0000001 | 3300048924 | Bacteria | 1830318 |
| 1104 | Ga0496122_0000009 | 3300048925 | Bacteria | 584024 |
| 1105 | Ga0496122_0091780 | 3300048925 | Bacteria | 2066 |
| 1106 | Ga0496123_0000020 | 3300048926 | Bacteria | 388748 |
| 1107 | Ga0496123_0069542 | 3300048926 | Bacteria | 2209 |
| 1108 | Ga0496124_0027813 | 3300048927 | Bacteria | 5067 |
| 1109 | Ga0496124_0208241 | 3300048927 | Bacteria | 1482 |
| 1110 | Ga0496124_0218241 | 3300048927 | Bacteria | 1436 |
| 1111 | Ga0496125_0000001 | 3300048928 | Bacteria | 1766138 |
| 1112 | Ga0501032_0132357 | 3300049569 | Bacteria | 1645 |
| 1113 | Ga0501033_0011532 | 3300049570 | Bacteria | 6762 |
| 1114 | Ga0501034_0133060 | 3300049571 | Bacteria | 2469 |
| 1115 | Ga0501034_0201804 | 3300049571 | Bacteria | 1946 |
| 1116 | Ga0501036_0047994 | 3300049572 | Bacteria | 3615 |
| 1117 | Ga0501036_0427363 | 3300049572 | Bacteria | 1104 |
| 1118 | Ga0501037_0019405 | 3300049573 | Bacteria | 5015 |
| 1119 | Ga0501037_0135322 | 3300049573 | Bacteria | 1765 |
| 1120 | Ga0501038_0039459 | 3300049574 | Bacteria | 4130 |
| 1121 | Ga0501038_0121412 | 3300049574 | Bacteria | 2154 |
| 1122 | Ga0501039_0026191 | 3300049575 | Bacteria | 4482 |
| 1123 | Ga0501043_0167700 | 3300049579 | Bacteria | 1714 |
| 1124 | Ga0501046_0292076 | 3300049580 | Bacteria | 1192 |
| 1125 | Ga0501047_0019246 | 3300049581 | Bacteria | 6550 |
| 1126 | Ga0501047_0120454 | 3300049581 | Bacteria | 2506 |
| 1127 | Ga0501047_0135576 | 3300049581 | Bacteria | 2342 |
| 1128 | Ga0501070_0051457 | 3300049586 | Bacteria | 3419 |
| 1129 | Ga0501070_0228809 | 3300049586 | Bacteria | 1524 |
| 1130 | Ga0501070_0264200 | 3300049586 | Bacteria | 1406 |
| 1131 | Ga0501070_0315084 | 3300049586 | Bacteria | 1273 |
| 1132 | Ga0501072_0344093 | 3300049588 | Bacteria | 1184 |
| 1133 | Ga0501073_0038121 | 3300049589 | Bacteria | 3411 |
| 1134 | Ga0501073_0145374 | 3300049589 | Bacteria | 1643 |
| 1135 | Ga0501077_0024179 | 3300049593 | Bacteria | 3856 |
| 1136 | Ga0501080_0080197 | 3300049742 | Bacteria | 3034 |
| 1137 | Ga0501083_0147934 | 3300049744 | Bacteria | 1538 |
| 1138 | Ga0501083_0320540 | 3300049744 | Bacteria | 1008 |
| 1139 | Ga0501035_0360771 | 3300049822 | Bacteria | 1214 |
| 1140 | Ga0501044_0020447 | 3300049823 | Bacteria | 7068 |
| 1141 | Ga0501044_0175955 | 3300049823 | Bacteria | 2109 |
| 1142 | nmdc:mga03683_62302_c2 | 3300050489 | Bacteria | 1111 |
| 1143 | nmdc:mga03n38_180047_c1 | 3300050490 | Bacteria | 1082 |
| 1144 | nmdc:mga00v17_153005_c1 | 3300050491 | Bacteria | 1482 |
| 1145 | nmdc:mga00v17_384419_c1 | 3300050491 | Bacteria | 912 |
| 1146 | nmdc:mga00v17_547062_c1 | 3300050491 | Bacteria | 749 |
| 1147 | nmdc:mga0yw44_1338_c1 | 3300050492 | Bacteria | 7798 |
| 1148 | nmdc:mga0yw44_144700_c1 | 3300050492 | Bacteria | 1547 |
| 1149 | nmdc:mga0yw44_5247_c1 | 3300050492 | Bacteria | 6077 |
| 1150 | nmdc:mga0yw44_7399_c1 | 3300050492 | Bacteria | 5398 |
| 1151 | nmdc:mga06z11_13124_c1 | 3300050494 | Bacteria | 3627 |
| 1152 | nmdc:mga04h51_10398_c1 | 3300050495 | Bacteria | 2554 |
| 1153 | nmdc:mga07m45_70412_c1 | 3300050496 | Bacteria | 1989 |
| 1154 | nmdc:mga05p37_2740_c1 | 3300050507 | Bacteria | 20479 |
| 1155 | nmdc:mga05p37_30958_c1 | 3300050507 | Bacteria | 6533 |
| 1156 | nmdc:mga05p37_71_c2 | 3300050507 | Bacteria | 60785 |
| 1157 | nmdc:mga09592_36808_c1 | 3300050508 | Bacteria | 4101 |
| 1158 | nmdc:mga0qj67_14_c1 | 3300050509 | Bacteria | 124768 |
| 1159 | nmdc:mga0qj67_1537_c1 | 3300050509 | Bacteria | 16193 |
| 1160 | nmdc:mga0qj67_29600_c1 | 3300050509 | Bacteria | 4254 |
| 1161 | nmdc:mga06r32_27244_c1 | 3300050510 | Bacteria | 5337 |
| 1162 | nmdc:mga06r32_707901_c1 | 3300050510 | Bacteria | 972 |
| 1163 | nmdc:mga06r32_9784_c1 | 3300050510 | Bacteria | 8656 |
| 1164 | nmdc:mga08y16_10837_c1 | 3300050511 | Bacteria | 9573 |
| 1165 | nmdc:mga08y16_650316_c1 | 3300050511 | Bacteria | 1058 |
| 1166 | nmdc:mga08y16_7147_c1 | 3300050511 | Bacteria | 11717 |
| 1167 | nmdc:mga08y16_93914_c1 | 3300050511 | Bacteria | 3125 |
| 1168 | nmdc:mga0n895_1010_c1 | 3300050512 | Bacteria | 20432 |
| 1169 | nmdc:mga0n895_1143_c1 | 3300050512 | Bacteria | 19428 |
| 1170 | nmdc:mga0n895_174250_c1 | 3300050512 | Bacteria | 2182 |
| 1171 | nmdc:mga0n895_37769_c1 | 3300050512 | Bacteria | 4674 |
| 1172 | nmdc:mga0n895_44942_c1 | 3300050512 | Bacteria | 4308 |
| 1173 | nmdc:mga0n895_469506_c1 | 3300050512 | Bacteria | 1269 |
| 1174 | nmdc:mga0n895_473344_c1 | 3300050512 | Bacteria | 1264 |
| 1175 | nmdc:mga0n895_491166_c1 | 3300050512 | Bacteria | 1237 |
| 1176 | nmdc:mga0n895_903937_c1 | 3300050512 | Bacteria | 868 |
| 1177 | nmdc:mga0rr50_123642_c1 | 3300050513 | Bacteria | 2063 |
| 1178 | nmdc:mga0rr50_140365_c1 | 3300050513 | Bacteria | 1943 |
| 1179 | nmdc:mga0rr50_141697_c1 | 3300050513 | Bacteria | 1935 |
| 1180 | nmdc:mga0rr50_192177_c1 | 3300050513 | Bacteria | 1673 |
| 1181 | nmdc:mga0rr50_415998_c1 | 3300050513 | Bacteria | 1137 |
| 1182 | nmdc:mga0rr50_560717_c1 | 3300050513 | Bacteria | 973 |
| 1183 | nmdc:mga08x19_137775_c1 | 3300050514 | Bacteria | 1646 |
| 1184 | nmdc:mga08x19_138165_c1 | 3300050514 | Bacteria | 1644 |
| 1185 | nmdc:mga08x19_166749_c1 | 3300050514 | Bacteria | 1498 |
| 1186 | nmdc:mga08x19_284094_c1 | 3300050514 | Bacteria | 1147 |
| 1187 | nmdc:mga08x19_286610_c1 | 3300050514 | Bacteria | 1142 |
| 1188 | nmdc:mga0a205_14483_c1 | 3300050515 | Bacteria | 7357 |
| 1189 | nmdc:mga0a205_68545_c1 | 3300050515 | Bacteria | 3426 |
| 1190 | Ga0495601_0000001 | 3300053077 | Bacteria | 549454 |
| 1191 | Ga0495601_0000940 | 3300053077 | Bacteria | 15849 |
| 1192 | Ga0495601_0011880 | 3300053077 | Bacteria | 5220 |
| 1193 | Ga0495601_0033424 | 3300053077 | Bacteria | 3205 |
| 1194 | Ga0495601_0039255 | 3300053077 | Bacteria | 2964 |
| 1195 | Ga0495601_0086200 | 3300053077 | Bacteria | 2018 |
| 1196 | Ga0495601_0087248 | 3300053077 | Bacteria | 2006 |
| 1197 | Ga0495601_0199566 | 3300053077 | Bacteria | 1307 |
| 1198 | Ga0495612_0000097 | 3300053078 | Bacteria | 37614 |
| 1199 | Ga0495612_0002006 | 3300053078 | Bacteria | 8388 |
| 1200 | Ga0495612_0011385 | 3300053078 | Bacteria | 3586 |
| 1201 | Ga0495612_0020410 | 3300053078 | Bacteria | 2655 |
| 1202 | Ga0495612_0023041 | 3300053078 | Bacteria | 2496 |
| 1203 | Ga0495595_0000255 | 3300053084 | Bacteria | 21213 |
| 1204 | Ga0495595_0000502 | 3300053084 | Bacteria | 14977 |
| 1205 | Ga0495595_0001242 | 3300053084 | Bacteria | 9931 |
| 1206 | Ga0495595_0003244 | 3300053084 | Bacteria | 6462 |
| 1207 | Ga0495595_0005086 | 3300053084 | Bacteria | 5313 |
| 1208 | Ga0495595_0153701 | 3300053084 | Bacteria | 1133 |
| 1209 | Ga0495619_0000004 | 3300053085 | Bacteria | 500068 |
| 1210 | Ga0495619_0000440 | 3300053085 | Bacteria | 28061 |
| 1211 | Ga0495619_0001092 | 3300053085 | Bacteria | 17828 |
| 1212 | Ga0495619_0001622 | 3300053085 | Bacteria | 14801 |
| 1213 | Ga0495619_0023063 | 3300053085 | Bacteria | 3986 |
| 1214 | Ga0495619_0044421 | 3300053085 | Bacteria | 2916 |
| 1215 | Ga0495619_0114545 | 3300053085 | Bacteria | 1845 |
| 1216 | Ga0500566_0115664 | 3300053094 | Bacteria | 1452 |
| 1217 | Ga0500572_003427 | 3300053111 | Bacteria | 3630 |
| 1218 | Ga0500618_000151 | 3300053125 | Bacteria | 57092 |
| 1219 | Ga0500618_016698 | 3300053125 | Bacteria | 1833 |
| 1220 | Ga0500658_0076030 | 3300053134 | Bacteria | 1427 |
| 1221 | Ga0500559_0000604 | 3300053136 | Bacteria | 24436 |
| 1222 | Ga0500577_0039019 | 3300053142 | Bacteria | 1719 |
| 1223 | Ga0500590_004280 | 3300053148 | Bacteria | 6714 |
| 1224 | Ga0500616_0000443 | 3300053153 | Bacteria | 54427 |
| 1225 | Ga0500634_0027046 | 3300053161 | Bacteria | 3126 |
| 1226 | Ga0500639_019738 | 3300053163 | Bacteria | 3555 |
| 1227 | Ga0500636_0000010 | 3300053177 | Bacteria | 145932 |
| 1228 | Ga0500596_022868 | 3300053735 | Bacteria | 946 |
| 1229 | Ga0500601_005317 | 3300053737 | Bacteria | 1409 |
| 1230 | Ga0501084_0611380 | 3300054114 | Bacteria | 921 |
| 1231 | Ga0501084_0706929 | 3300054114 | Bacteria | 850 |
| 1232 | Ga0501082_0074147 | 3300060353 | Bacteria | 2931 |
| 1233 | Ga0466962_0009869 | 3300061719 | Bacteria | 4580 |
| 1234 | Ga0530510_0205522 | 3300061734 | Bacteria | 1463 |
| 1235 | Ga0530510_0267454 | 3300061734 | Bacteria | 1276 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050491 | nmdc:mga00v17_547062_c1 | nmdc:mga00v17_547062_c1_39_713 | 220 |
| 2 | 3300048915 | Ga0496112_0244164 | Ga0496112_0244164_1061_1735 | 224 |
| 3 | 3300006178 | Ga0075367_10015469 | Ga0075367_100154694 | 228 |
| 4 | 3300036401 | Ga0373937_0342507 | Ga0373937_0342507_316_1119 | 229 |
| 5 | 3300060353 | Ga0501082_0074147 | Ga0501082_0074147_14_718 | 234 |
| 6 | 3300048915 | Ga0496112_0002618 | Ga0496112_0002618_13758_14498 | 235 |
| 7 | 3300005336 | Ga0070680_100120872 | Ga0070680_1001208723 | 236 |
| 8 | 3300013105 | Ga0157369_10423456 | Ga0157369_104234562 | 236 |
| 9 | 3300014326 | Ga0157380_10317630 | Ga0157380_103176301 | 237 |
| 10 | 3300009551 | Ga0105238_10076969 | Ga0105238_100769693 | 239 |
| 11 | 3300005329 | Ga0070683_100131827 | Ga0070683_1001318271 | 240 |
| 12 | 3300005434 | Ga0070709_10215261 | Ga0070709_102152612 | 240 |
| 13 | 3300005547 | Ga0070693_100013772 | Ga0070693_1000137722 | 240 |
| 14 | 3300005563 | Ga0068855_100434933 | Ga0068855_1004349332 | 240 |
| 15 | 3300025915 | Ga0207693_10006778 | Ga0207693_100067788 | 240 |
| 16 | 3300025981 | Ga0207640_10078245 | Ga0207640_100782452 | 240 |
| 17 | 3300005435 | Ga0070714_100112929 | Ga0070714_1001129293 | 241 |
| 18 | 3300035116 | Ga0373945_0009702 | Ga0373945_0009702_2259_3065 | 242 |
| 19 | 3300031711 | Ga0265314_10048426 | Ga0265314_100484264 | 243 |
| 20 | 3300053737 | Ga0500601_005317 | Ga0500601_005317_559_1374 | 245 |
| 21 | 3300025928 | Ga0207700_10437444 | Ga0207700_104374442 | 246 |
| 22 | 3300025935 | Ga0207709_10079847 | Ga0207709_100798472 | 246 |
| 23 | 3300035086 | Ga0373934_0020726 | Ga0373934_0020726_661_1467 | 246 |
| 24 | 3300035111 | Ga0373923_0012636 | Ga0373923_0012636_2217_3023 | 246 |
| 25 | 3300035113 | Ga0373936_0002617 | Ga0373936_0002617_3400_4206 | 246 |
| 26 | 3300035117 | Ga0373953_0001285 | Ga0373953_0001285_1607_2413 | 246 |
| 27 | 3300035118 | Ga0373954_0028526 | Ga0373954_0028526_1384_2190 | 246 |
| 28 | 3300035119 | Ga0373956_0015303 | Ga0373956_0015303_1384_2190 | 246 |
| 29 | 3300035120 | Ga0373957_0008008 | Ga0373957_0008008_238_1044 | 246 |
| 30 | 3300035170 | Ga0373943_0007545 | Ga0373943_0007545_2416_3222 | 246 |
| 31 | 3300035172 | Ga0373955_0007704 | Ga0373955_0007704_2594_3400 | 246 |
| 32 | 3300035410 | Ga0373924_0001495 | Ga0373924_0001495_4034_4840 | 246 |
| 33 | 3300035692 | Ga0373935_0002234 | Ga0373935_0002234_8792_9598 | 246 |
| 34 | 3300035695 | Ga0373927_0005714 | Ga0373927_0005714_5154_5960 | 246 |
| 35 | 3300035724 | Ga0373933_0002450 | Ga0373933_0002450_1119_1925 | 246 |
| 36 | 3300036401 | Ga0373937_0000864 | Ga0373937_0000864_11411_12217 | 246 |
| 37 | 3300037068 | Ga0373925_0000639 | Ga0373925_0000639_11398_12204 | 246 |
| 38 | 3300046454 | Ga0495592_0000348 | Ga0495592_0000348_34247_35053 | 246 |
| 39 | 3300046462 | Ga0495651_0000617 | Ga0495651_0000617_3476_4282 | 246 |
| 40 | 3300046463 | Ga0495653_0000030 | Ga0495653_0000030_60764_61570 | 246 |
| 41 | 3300046477 | Ga0495664_0000003 | Ga0495664_0000003_164793_165599 | 246 |
| 42 | 3300046511 | Ga0495608_0000011 | Ga0495608_0000011_110797_111603 | 246 |
| 43 | 3300046514 | Ga0495618_0000025 | Ga0495618_0000025_81091_81897 | 246 |
| 44 | 3300046516 | Ga0495628_0000001 | Ga0495628_0000001_654194_655000 | 246 |
| 45 | 3300046517 | Ga0495630_0000286 | Ga0495630_0000286_36483_37289 | 246 |
| 46 | 3300046529 | Ga0495652_0000002 | Ga0495652_0000002_868728_869534 | 246 |
| 47 | 3300046533 | Ga0495640_0000002 | Ga0495640_0000002_109057_109863 | 246 |
| 48 | 3300046536 | Ga0495587_0000001 | Ga0495587_0000001_181463_182269 | 246 |
| 49 | 3300046543 | Ga0495645_0000276 | Ga0495645_0000276_2662_3468 | 246 |
| 50 | 3300046559 | Ga0495667_0000004 | Ga0495667_0000004_81110_81916 | 246 |
| 51 | 3300046642 | Ga0495634_0001327 | Ga0495634_0001327_19106_19912 | 246 |
| 52 | 3300046663 | Ga0495635_0000001 | Ga0495635_0000001_167274_168080 | 246 |
| 53 | 3300046675 | Ga0495657_0000190 | Ga0495657_0000190_2578_3384 | 246 |
| 54 | 3300046678 | Ga0495599_0000212 | Ga0495599_0000212_34260_35066 | 246 |
| 55 | 3300046680 | Ga0495646_0000009 | Ga0495646_0000009_182374_183180 | 246 |
| 56 | 3300046681 | Ga0495647_0011950 | Ga0495647_0011950_612_1418 | 246 |
| 57 | 3300046690 | Ga0495624_0037456 | Ga0495624_0037456_1393_2199 | 246 |
| 58 | 3300046809 | Ga0495600_0002696 | Ga0495600_0002696_6842_7648 | 246 |
| 59 | 3300047317 | Ga0495604_0000008 | Ga0495604_0000008_337765_338571 | 246 |
| 60 | 3300047319 | Ga0495674_0000016 | Ga0495674_0000016_2704_3510 | 246 |
| 61 | 3300047322 | Ga0495680_0014703 | Ga0495680_0014703_3414_4220 | 246 |
| 62 | 3300047444 | Ga0495675_0004044 | Ga0495675_0004044_5505_6311 | 246 |
| 63 | 3300047471 | Ga0495684_0000002 | Ga0495684_0000002_337823_338629 | 246 |
| 64 | 3300047673 | Ga0495593_0000458 | Ga0495593_0000458_20466_21272 | 246 |
| 65 | 3300048088 | Ga0495602_0000024 | Ga0495602_0000024_34239_35045 | 246 |
| 66 | 3300053077 | Ga0495601_0000001 | Ga0495601_0000001_377323_378129 | 246 |
| 67 | 3300053078 | Ga0495612_0000097 | Ga0495612_0000097_2580_3386 | 246 |
| 68 | 3300053084 | Ga0495595_0000502 | Ga0495595_0000502_2589_3395 | 246 |
| 69 | 3300053085 | Ga0495619_0000004 | Ga0495619_0000004_377354_378160 | 246 |
| 70 | 3300032002 | Ga0307416_100231431 | Ga0307416_1002314312 | 247 |
| 71 | 3300027512 | Ga0209179_1000585 | Ga0209179_10005854 | 248 |
| 72 | 3300007788 | Ga0099795_10022421 | Ga0099795_100224212 | 249 |
| 73 | 3300053111 | Ga0500572_003427 | Ga0500572_003427_70_882 | 249 |
| 74 | 3300053136 | Ga0500559_0000604 | Ga0500559_0000604_91_903 | 249 |
| 75 | 3300053163 | Ga0500639_019738 | Ga0500639_019738_1968_2780 | 249 |
| 76 | 3300053735 | Ga0500596_022868 | Ga0500596_022868_59_871 | 249 |
| 77 | 3300006852 | Ga0075433_10030679 | Ga0075433_100306792 | 250 |
| 78 | 3300009147 | Ga0114129_10006300 | Ga0114129_100063006 | 250 |
| 79 | 3300025928 | Ga0207700_10179641 | Ga0207700_101796412 | 250 |
| 80 | 3300025941 | Ga0207711_10378042 | Ga0207711_103780422 | 250 |
| 81 | 3300035086 | Ga0373934_0002254 | Ga0373934_0002254_2243_3061 | 250 |
| 82 | 3300035111 | Ga0373923_0000490 | Ga0373923_0000490_5452_6270 | 250 |
| 83 | 3300035117 | Ga0373953_0000111 | Ga0373953_0000111_7077_7895 | 250 |
| 84 | 3300035118 | Ga0373954_0000300 | Ga0373954_0000300_5925_6743 | 250 |
| 85 | 3300035119 | Ga0373956_0001245 | Ga0373956_0001245_7998_8816 | 250 |
| 86 | 3300035120 | Ga0373957_0000236 | Ga0373957_0000236_2167_2985 | 250 |
| 87 | 3300035724 | Ga0373933_0010871 | Ga0373933_0010871_2612_3430 | 250 |
| 88 | 3300046454 | Ga0495592_0000507 | Ga0495592_0000507_17483_18301 | 250 |
| 89 | 3300046459 | Ga0495629_0000318 | Ga0495629_0000318_1721_2539 | 250 |
| 90 | 3300046462 | Ga0495651_0062159 | Ga0495651_0062159_309_1127 | 250 |
| 91 | 3300046462 | Ga0495651_0437984 | Ga0495651_0437984_84_836 | 250 |
| 92 | 3300046463 | Ga0495653_0002510 | Ga0495653_0002510_7998_8816 | 250 |
| 93 | 3300046511 | Ga0495608_0010318 | Ga0495608_0010318_3427_4245 | 250 |
| 94 | 3300046516 | Ga0495628_0101479 | Ga0495628_0101479_1290_2108 | 250 |
| 95 | 3300046529 | Ga0495652_0005630 | Ga0495652_0005630_2133_2951 | 250 |
| 96 | 3300046543 | Ga0495645_0020142 | Ga0495645_0020142_3894_4712 | 250 |
| 97 | 3300046559 | Ga0495667_0005696 | Ga0495667_0005696_3427_4245 | 250 |
| 98 | 3300046663 | Ga0495635_0000677 | Ga0495635_0000677_10489_11307 | 250 |
| 99 | 3300046675 | Ga0495657_0002217 | Ga0495657_0002217_7646_8464 | 250 |
| 100 | 3300046678 | Ga0495599_0021527 | Ga0495599_0021527_208_1026 | 250 |
| 101 | 3300046679 | Ga0495623_0001914 | Ga0495623_0001914_9466_10284 | 250 |
| 102 | 3300046689 | Ga0495613_0020437 | Ga0495613_0020437_3588_4406 | 250 |
| 103 | 3300046809 | Ga0495600_0010015 | Ga0495600_0010015_739_1557 | 250 |
| 104 | 3300047317 | Ga0495604_0001378 | Ga0495604_0001378_11115_11933 | 250 |
| 105 | 3300047319 | Ga0495674_0016566 | Ga0495674_0016566_1953_2771 | 250 |
| 106 | 3300047471 | Ga0495684_0000860 | Ga0495684_0000860_13370_14188 | 250 |
| 107 | 3300047673 | Ga0495593_0001605 | Ga0495593_0001605_9587_10405 | 250 |
| 108 | 3300048088 | Ga0495602_0017859 | Ga0495602_0017859_2594_3412 | 250 |
| 109 | 3300050507 | nmdc:mga05p37_2740_c1 | nmdc:mga05p37_2740_c1_17594_18409 | 250 |
| 110 | 3300053077 | Ga0495601_0033424 | Ga0495601_0033424_2279_3097 | 250 |
| 111 | 3300053084 | Ga0495595_0000255 | Ga0495595_0000255_11423_12241 | 250 |
| 112 | 3300053085 | Ga0495619_0001092 | Ga0495619_0001092_10829_11647 | 250 |
| 113 | 3300006914 | Ga0075436_100123566 | Ga0075436_1001235661 | 251 |
| 114 | 3300009094 | Ga0111539_10048215 | Ga0111539_100482155 | 251 |
| 115 | 3300044842 | Ga0466957_0053779 | Ga0466957_0053779_1247_2062 | 251 |
| 116 | 3300045976 | Ga0466967_0283894 | Ga0466967_0283894_621_1436 | 251 |
| 117 | 3300050514 | nmdc:mga08x19_138165_c1 | nmdc:mga08x19_138165_c1_239_1048 | 251 |
| 118 | 3300005937 | Ga0081455_10003621 | Ga0081455_100036219 | 252 |
| 119 | 3300021384 | Ga0213876_10012177 | Ga0213876_100121773 | 253 |
| 120 | 3300039437 | Ga0436365_0476069 | Ga0436365_0476069_10824_11630 | 253 |
| 121 | 3300050514 | nmdc:mga08x19_137775_c1 | nmdc:mga08x19_137775_c1_217_1032 | 253 |
| 122 | 3300025939 | Ga0207665_10042095 | Ga0207665_100420952 | 254 |
| 123 | 3300049571 | Ga0501034_0201804 | Ga0501034_0201804_259_1077 | 255 |
| 124 | 3300049573 | Ga0501037_0135322 | Ga0501037_0135322_693_1511 | 255 |
| 125 | 3300049574 | Ga0501038_0039459 | Ga0501038_0039459_746_1564 | 255 |
| 126 | 3300049581 | Ga0501047_0120454 | Ga0501047_0120454_424_1242 | 255 |
| 127 | 3300049588 | Ga0501072_0344093 | Ga0501072_0344093_165_983 | 255 |
| 128 | 3300049589 | Ga0501073_0038121 | Ga0501073_0038121_2175_2993 | 255 |
| 129 | 3300050496 | nmdc:mga07m45_70412_c1 | nmdc:mga07m45_70412_c1_865_1701 | 255 |
| 130 | 3300009551 | Ga0105238_10026829 | Ga0105238_100268292 | 256 |
| 131 | 3300005327 | Ga0070658_10039467 | Ga0070658_100394671 | 257 |
| 132 | 3300005436 | Ga0070713_100004000 | Ga0070713_1000040005 | 257 |
| 133 | 3300005437 | Ga0070710_10145745 | Ga0070710_101457452 | 257 |
| 134 | 3300005439 | Ga0070711_100129090 | Ga0070711_1001290902 | 257 |
| 135 | 3300006163 | Ga0070715_10174929 | Ga0070715_101749291 | 257 |
| 136 | 3300014968 | Ga0157379_10437083 | Ga0157379_104370832 | 257 |
| 137 | 3300025898 | Ga0207692_10119990 | Ga0207692_101199903 | 257 |
| 138 | 3300025909 | Ga0207705_10084589 | Ga0207705_100845891 | 257 |
| 139 | 3300025916 | Ga0207663_10021173 | Ga0207663_100211733 | 257 |
| 140 | 3300025928 | Ga0207700_10025593 | Ga0207700_100255933 | 257 |
| 141 | 3300048904 | Ga0496101_0002019 | Ga0496101_0002019_5422_6198 | 257 |
| 142 | 3300048905 | Ga0496102_0002730 | Ga0496102_0002730_10386_11162 | 257 |
| 143 | 3300048907 | Ga0496104_0008157 | Ga0496104_0008157_5350_6126 | 257 |
| 144 | 3300048909 | Ga0496106_0002568 | Ga0496106_0002568_8859_9635 | 257 |
| 145 | 3300048910 | Ga0496107_0011938 | Ga0496107_0011938_850_1626 | 257 |
| 146 | 3300048911 | Ga0496108_0005878 | Ga0496108_0005878_2232_3008 | 257 |
| 147 | 3300048912 | Ga0496109_0002498 | Ga0496109_0002498_2568_3344 | 257 |
| 148 | 3300048912 | Ga0496109_0002783 | Ga0496109_0002783_12131_12937 | 257 |
| 149 | 3300048913 | Ga0496110_0019993 | Ga0496110_0019993_3976_4782 | 257 |
| 150 | 3300048914 | Ga0496111_0001286 | Ga0496111_0001286_9062_9868 | 257 |
| 151 | 3300048915 | Ga0496112_0007084 | Ga0496112_0007084_5378_6154 | 257 |
| 152 | 3300048916 | Ga0496113_0069306 | Ga0496113_0069306_1858_2634 | 257 |
| 153 | 3300002239 | JGI24034J26672_10006134 | JGI24034J26672_100061342 | 258 |
| 154 | 3300005328 | Ga0070676_10050881 | Ga0070676_100508813 | 258 |
| 155 | 3300005334 | Ga0068869_100103056 | Ga0068869_1001030562 | 258 |
| 156 | 3300005338 | Ga0068868_100043507 | Ga0068868_1000435073 | 258 |
| 157 | 3300005340 | Ga0070689_100003166 | Ga0070689_1000031665 | 258 |
| 158 | 3300005341 | Ga0070691_10013630 | Ga0070691_100136303 | 258 |
| 159 | 3300005343 | Ga0070687_100003332 | Ga0070687_1000033325 | 258 |
| 160 | 3300005344 | Ga0070661_100063216 | Ga0070661_1000632163 | 258 |
| 161 | 3300005353 | Ga0070669_100024890 | Ga0070669_1000248903 | 258 |
| 162 | 3300005354 | Ga0070675_100017095 | Ga0070675_1000170954 | 258 |
| 163 | 3300005364 | Ga0070673_100028586 | Ga0070673_1000285863 | 258 |
| 164 | 3300005365 | Ga0070688_100022612 | Ga0070688_1000226122 | 258 |
| 165 | 3300005366 | Ga0070659_100129126 | Ga0070659_1001291262 | 258 |
| 166 | 3300005367 | Ga0070667_100057429 | Ga0070667_1000574292 | 258 |
| 167 | 3300005436 | Ga0070713_100206667 | Ga0070713_1002066672 | 258 |
| 168 | 3300005437 | Ga0070710_10124247 | Ga0070710_101242472 | 258 |
| 169 | 3300005439 | Ga0070711_100406951 | Ga0070711_1004069512 | 258 |
| 170 | 3300005440 | Ga0070705_100213178 | Ga0070705_1002131782 | 258 |
| 171 | 3300005441 | Ga0070700_100010159 | Ga0070700_1000101594 | 258 |
| 172 | 3300005455 | Ga0070663_100030754 | Ga0070663_1000307542 | 258 |
| 173 | 3300005456 | Ga0070678_100395320 | Ga0070678_1003953202 | 258 |
| 174 | 3300005457 | Ga0070662_100022179 | Ga0070662_1000221794 | 258 |
| 175 | 3300005535 | Ga0070684_100191403 | Ga0070684_1001914032 | 258 |
| 176 | 3300005543 | Ga0070672_100007233 | Ga0070672_1000072332 | 258 |
| 177 | 3300005544 | Ga0070686_100004524 | Ga0070686_1000045245 | 258 |
| 178 | 3300005548 | Ga0070665_100048481 | Ga0070665_1000484813 | 258 |
| 179 | 3300005564 | Ga0070664_100224221 | Ga0070664_1002242212 | 258 |
| 180 | 3300005577 | Ga0068857_100147581 | Ga0068857_1001475812 | 258 |
| 181 | 3300005578 | Ga0068854_100428976 | Ga0068854_1004289762 | 258 |
| 182 | 3300005614 | Ga0068856_100140229 | Ga0068856_1001402293 | 258 |
| 183 | 3300005615 | Ga0070702_100003968 | Ga0070702_1000039682 | 258 |
| 184 | 3300005616 | Ga0068852_100038834 | Ga0068852_1000388343 | 258 |
| 185 | 3300005617 | Ga0068859_100051427 | Ga0068859_1000514272 | 258 |
| 186 | 3300005618 | Ga0068864_100007988 | Ga0068864_1000079885 | 258 |
| 187 | 3300005718 | Ga0068866_10084220 | Ga0068866_100842202 | 258 |
| 188 | 3300005834 | Ga0068851_10071417 | Ga0068851_100714172 | 258 |
| 189 | 3300005840 | Ga0068870_10000463 | Ga0068870_100004638 | 258 |
| 190 | 3300005841 | Ga0068863_100055166 | Ga0068863_1000551662 | 258 |
| 191 | 3300005843 | Ga0068860_100038130 | Ga0068860_1000381303 | 258 |
| 192 | 3300005844 | Ga0068862_100008130 | Ga0068862_1000081303 | 258 |
| 193 | 3300006038 | Ga0075365_10000608 | Ga0075365_100006084 | 258 |
| 194 | 3300006042 | Ga0075368_10034121 | Ga0075368_100341212 | 258 |
| 195 | 3300006163 | Ga0070715_10004318 | Ga0070715_100043183 | 258 |
| 196 | 3300006175 | Ga0070712_100088588 | Ga0070712_1000885882 | 258 |
| 197 | 3300006353 | Ga0075370_10183531 | Ga0075370_101835312 | 258 |
| 198 | 3300006881 | Ga0068865_100203088 | Ga0068865_1002030882 | 258 |
| 199 | 3300006931 | Ga0097620_100051424 | Ga0097620_1000514244 | 258 |
| 200 | 3300009092 | Ga0105250_10106047 | Ga0105250_101060472 | 258 |
| 201 | 3300009098 | Ga0105245_10010115 | Ga0105245_100101155 | 258 |
| 202 | 3300009101 | Ga0105247_10024754 | Ga0105247_100247542 | 258 |
| 203 | 3300009148 | Ga0105243_10056240 | Ga0105243_100562403 | 258 |
| 204 | 3300009174 | Ga0105241_10130267 | Ga0105241_101302672 | 258 |
| 205 | 3300009176 | Ga0105242_10044589 | Ga0105242_100445893 | 258 |
| 206 | 3300009177 | Ga0105248_10044136 | Ga0105248_100441362 | 258 |
| 207 | 3300009545 | Ga0105237_10032413 | Ga0105237_100324134 | 258 |
| 208 | 3300009551 | Ga0105238_10085300 | Ga0105238_100853003 | 258 |
| 209 | 3300009553 | Ga0105249_10037064 | Ga0105249_100370644 | 258 |
| 210 | 3300013296 | Ga0157374_10046157 | Ga0157374_100461573 | 258 |
| 211 | 3300013297 | Ga0157378_10032077 | Ga0157378_100320773 | 258 |
| 212 | 3300013306 | Ga0163162_10138593 | Ga0163162_101385932 | 258 |
| 213 | 3300013308 | Ga0157375_10017237 | Ga0157375_100172375 | 258 |
| 214 | 3300014325 | Ga0163163_10022059 | Ga0163163_100220594 | 258 |
| 215 | 3300014326 | Ga0157380_10026333 | Ga0157380_100263332 | 258 |
| 216 | 3300014745 | Ga0157377_10002726 | Ga0157377_100027263 | 258 |
| 217 | 3300014969 | Ga0157376_10045894 | Ga0157376_100458944 | 258 |
| 218 | 3300017792 | Ga0163161_10027218 | Ga0163161_100272182 | 258 |
| 219 | 3300025893 | Ga0207682_10043715 | Ga0207682_100437152 | 258 |
| 220 | 3300025900 | Ga0207710_10003740 | Ga0207710_100037403 | 258 |
| 221 | 3300025901 | Ga0207688_10002001 | Ga0207688_100020014 | 258 |
| 222 | 3300025904 | Ga0207647_10016425 | Ga0207647_100164253 | 258 |
| 223 | 3300025905 | Ga0207685_10003505 | Ga0207685_100035052 | 258 |
| 224 | 3300025908 | Ga0207643_10001337 | Ga0207643_100013379 | 258 |
| 225 | 3300025911 | Ga0207654_10042196 | Ga0207654_100421962 | 258 |
| 226 | 3300025914 | Ga0207671_10144440 | Ga0207671_101444402 | 258 |
| 227 | 3300025916 | Ga0207663_10065805 | Ga0207663_100658053 | 258 |
| 228 | 3300025918 | Ga0207662_10001601 | Ga0207662_100016015 | 258 |
| 229 | 3300025919 | Ga0207657_10017992 | Ga0207657_100179923 | 258 |
| 230 | 3300025920 | Ga0207649_10074201 | Ga0207649_100742012 | 258 |
| 231 | 3300025923 | Ga0207681_10038114 | Ga0207681_100381143 | 258 |
| 232 | 3300025924 | Ga0207694_10306960 | Ga0207694_103069602 | 258 |
| 233 | 3300025925 | Ga0207650_10209043 | Ga0207650_102090432 | 258 |
| 234 | 3300025926 | Ga0207659_10009920 | Ga0207659_100099205 | 258 |
| 235 | 3300025927 | Ga0207687_10007796 | Ga0207687_100077963 | 258 |
| 236 | 3300025933 | Ga0207706_10006968 | Ga0207706_100069686 | 258 |
| 237 | 3300025934 | Ga0207686_10106106 | Ga0207686_101061062 | 258 |
| 238 | 3300025935 | Ga0207709_10004698 | Ga0207709_100046986 | 258 |
| 239 | 3300025936 | Ga0207670_10003900 | Ga0207670_100039006 | 258 |
| 240 | 3300025937 | Ga0207669_10002276 | Ga0207669_100022766 | 258 |
| 241 | 3300025938 | Ga0207704_10210183 | Ga0207704_102101832 | 258 |
| 242 | 3300025940 | Ga0207691_10000439 | Ga0207691_1000043932 | 258 |
| 243 | 3300025941 | Ga0207711_10022455 | Ga0207711_100224552 | 258 |
| 244 | 3300025942 | Ga0207689_10001936 | Ga0207689_100019366 | 258 |
| 245 | 3300025960 | Ga0207651_10034042 | Ga0207651_100340422 | 258 |
| 246 | 3300025961 | Ga0207712_10015429 | Ga0207712_100154293 | 258 |
| 247 | 3300025986 | Ga0207658_10185640 | Ga0207658_101856402 | 258 |
| 248 | 3300026023 | Ga0207677_10034616 | Ga0207677_100346163 | 258 |
| 249 | 3300026067 | Ga0207678_10096997 | Ga0207678_100969972 | 258 |
| 250 | 3300026075 | Ga0207708_10000624 | Ga0207708_1000062415 | 258 |
| 251 | 3300026078 | Ga0207702_10051329 | Ga0207702_100513293 | 258 |
| 252 | 3300026088 | Ga0207641_10134558 | Ga0207641_101345583 | 258 |
| 253 | 3300026089 | Ga0207648_10001430 | Ga0207648_1000143011 | 258 |
| 254 | 3300026095 | Ga0207676_10006351 | Ga0207676_100063514 | 258 |
| 255 | 3300026116 | Ga0207674_10144849 | Ga0207674_101448492 | 258 |
| 256 | 3300026118 | Ga0207675_100031722 | Ga0207675_1000317224 | 258 |
| 257 | 3300026121 | Ga0207683_10016637 | Ga0207683_100166372 | 258 |
| 258 | 3300028379 | Ga0268266_10019348 | Ga0268266_100193483 | 258 |
| 259 | 3300028381 | Ga0268264_10038041 | Ga0268264_100380414 | 258 |
| 260 | 3300041512 | Ga0451853_2535465 | Ga0451853_2535465_95_907 | 258 |
| 261 | 3300046537 | Ga0495598_0038376 | Ga0495598_0038376_444_1256 | 258 |
| 262 | 3300046642 | Ga0495634_0137146 | Ga0495634_0137146_97_888 | 258 |
| 263 | 3300046665 | Ga0495661_0150829 | Ga0495661_0150829_370_1182 | 258 |
| 264 | 3300048903 | Ga0496100_0323150 | Ga0496100_0323150_335_1147 | 258 |
| 265 | 3300048904 | Ga0496101_0008709 | Ga0496101_0008709_5654_6466 | 258 |
| 266 | 3300048905 | Ga0496102_0020794 | Ga0496102_0020794_1263_2075 | 258 |
| 267 | 3300048906 | Ga0496103_0001472 | Ga0496103_0001472_11435_12247 | 258 |
| 268 | 3300048907 | Ga0496104_0005758 | Ga0496104_0005758_3503_4315 | 258 |
| 269 | 3300048908 | Ga0496105_0024232 | Ga0496105_0024232_3979_4791 | 258 |
| 270 | 3300048909 | Ga0496106_0017933 | Ga0496106_0017933_3268_4080 | 258 |
| 271 | 3300048910 | Ga0496107_0002783 | Ga0496107_0002783_4465_5277 | 258 |
| 272 | 3300048911 | Ga0496108_0049453 | Ga0496108_0049453_335_1147 | 258 |
| 273 | 3300048912 | Ga0496109_0003828 | Ga0496109_0003828_7025_7837 | 258 |
| 274 | 3300048913 | Ga0496110_0016391 | Ga0496110_0016391_2616_3428 | 258 |
| 275 | 3300048914 | Ga0496111_0008225 | Ga0496111_0008225_5083_5895 | 258 |
| 276 | 3300048915 | Ga0496112_0041124 | Ga0496112_0041124_2759_3571 | 258 |
| 277 | 3300048916 | Ga0496113_0010915 | Ga0496113_0010915_3731_4543 | 258 |
| 278 | 3300048917 | Ga0496114_0052882 | Ga0496114_0052882_1911_2723 | 258 |
| 279 | 3300048918 | Ga0496115_0004706 | Ga0496115_0004706_5819_6631 | 258 |
| 280 | 3300050489 | nmdc:mga03683_62302_c2 | nmdc:mga03683_62302_c2_156_974 | 258 |
| 281 | 3300050511 | nmdc:mga08y16_93914_c1 | nmdc:mga08y16_93914_c1_574_1392 | 258 |
| 282 | 3300006847 | Ga0075431_100013819 | Ga0075431_1000138191 | 259 |
| 283 | 3300006880 | Ga0075429_100034156 | Ga0075429_1000341562 | 259 |
| 284 | 3300009147 | Ga0114129_10012821 | Ga0114129_100128214 | 259 |
| 285 | 3300050508 | nmdc:mga09592_36808_c1 | nmdc:mga09592_36808_c1_2065_2880 | 259 |
| 286 | 3300050509 | nmdc:mga0qj67_29600_c1 | nmdc:mga0qj67_29600_c1_2244_3059 | 259 |
| 287 | 3300050510 | nmdc:mga06r32_27244_c1 | nmdc:mga06r32_27244_c1_560_1375 | 259 |
| 288 | 3300013297 | Ga0157378_10188256 | Ga0157378_101882564 | 261 |
| 289 | 3300037312 | Ga0395899_0003310 | Ga0395899_0003310_10255_11067 | 261 |
| 290 | 3300037312 | Ga0395899_0010414 | Ga0395899_0010414_566_1378 | 261 |
| 291 | 3300037418 | Ga0395900_0002147 | Ga0395900_0002147_19818_20630 | 261 |
| 292 | 3300037418 | Ga0395900_0010578 | Ga0395900_0010578_6577_7389 | 261 |
| 293 | 3300037466 | Ga0395898_0013547 | Ga0395898_0013547_477_1289 | 261 |
| 294 | 3300037466 | Ga0395898_0015323 | Ga0395898_0015323_6337_7149 | 261 |
| 295 | 3300038443 | Ga0395901_0006050 | Ga0395901_0006050_1483_2295 | 261 |
| 296 | 3300038443 | Ga0395901_0008240 | Ga0395901_0008240_5801_6613 | 261 |
| 297 | 3300005983 | Ga0081540_1097927 | Ga0081540_10979272 | 262 |
| 298 | 3300006028 | Ga0070717_10383486 | Ga0070717_103834862 | 262 |
| 299 | 3300048904 | Ga0496101_0240486 | Ga0496101_0240486_45_833 | 262 |
| 300 | 3300003911 | JGI25405J52794_10007826 | JGI25405J52794_100078262 | 263 |
| 301 | 3300005331 | Ga0070670_100310896 | Ga0070670_1003108962 | 263 |
| 302 | 3300005335 | Ga0070666_10015039 | Ga0070666_100150394 | 263 |
| 303 | 3300005343 | Ga0070687_100119675 | Ga0070687_1001196752 | 263 |
| 304 | 3300005344 | Ga0070661_100311389 | Ga0070661_1003113892 | 263 |
| 305 | 3300005365 | Ga0070688_100345005 | Ga0070688_1003450051 | 263 |
| 306 | 3300005434 | Ga0070709_10005456 | Ga0070709_100054563 | 263 |
| 307 | 3300005435 | Ga0070714_100648040 | Ga0070714_1006480401 | 263 |
| 308 | 3300005436 | Ga0070713_100001523 | Ga0070713_1000015235 | 263 |
| 309 | 3300005437 | Ga0070710_10040802 | Ga0070710_100408022 | 263 |
| 310 | 3300005439 | Ga0070711_100035728 | Ga0070711_1000357283 | 263 |
| 311 | 3300005456 | Ga0070678_100014741 | Ga0070678_1000147414 | 263 |
| 312 | 3300005535 | Ga0070684_100184479 | Ga0070684_1001844792 | 263 |
| 313 | 3300005548 | Ga0070665_100241968 | Ga0070665_1002419682 | 263 |
| 314 | 3300005617 | Ga0068859_100157297 | Ga0068859_1001572972 | 263 |
| 315 | 3300005843 | Ga0068860_100345539 | Ga0068860_1003455392 | 263 |
| 316 | 3300005937 | Ga0081455_10000695 | Ga0081455_100006952 | 263 |
| 317 | 3300006028 | Ga0070717_10000396 | Ga0070717_1000039623 | 263 |
| 318 | 3300006163 | Ga0070715_10011020 | Ga0070715_100110203 | 263 |
| 319 | 3300006173 | Ga0070716_100008465 | Ga0070716_1000084654 | 263 |
| 320 | 3300006931 | Ga0097620_100157294 | Ga0097620_1001572942 | 263 |
| 321 | 3300009011 | Ga0105251_10052152 | Ga0105251_100521522 | 263 |
| 322 | 3300009148 | Ga0105243_10017816 | Ga0105243_100178162 | 263 |
| 323 | 3300009176 | Ga0105242_10140060 | Ga0105242_101400602 | 263 |
| 324 | 3300010375 | Ga0105239_10475101 | Ga0105239_104751012 | 263 |
| 325 | 3300011119 | Ga0105246_10329946 | Ga0105246_103299462 | 263 |
| 326 | 3300014969 | Ga0157376_10144570 | Ga0157376_101445702 | 263 |
| 327 | 3300025898 | Ga0207692_10008266 | Ga0207692_100082662 | 263 |
| 328 | 3300025901 | Ga0207688_10112678 | Ga0207688_101126782 | 263 |
| 329 | 3300025905 | Ga0207685_10016945 | Ga0207685_100169452 | 263 |
| 330 | 3300025915 | Ga0207693_10003570 | Ga0207693_100035709 | 263 |
| 331 | 3300025916 | Ga0207663_10051331 | Ga0207663_100513312 | 263 |
| 332 | 3300025928 | Ga0207700_10000379 | Ga0207700_1000037910 | 263 |
| 333 | 3300025929 | Ga0207664_10005567 | Ga0207664_100055672 | 263 |
| 334 | 3300025931 | Ga0207644_10017238 | Ga0207644_100172384 | 263 |
| 335 | 3300025932 | Ga0207690_10429338 | Ga0207690_104293382 | 263 |
| 336 | 3300025933 | Ga0207706_10009390 | Ga0207706_100093904 | 263 |
| 337 | 3300025939 | Ga0207665_10000286 | Ga0207665_1000028614 | 263 |
| 338 | 3300025942 | Ga0207689_10141671 | Ga0207689_101416712 | 263 |
| 339 | 3300025944 | Ga0207661_10060251 | Ga0207661_100602512 | 263 |
| 340 | 3300025960 | Ga0207651_10224298 | Ga0207651_102242982 | 263 |
| 341 | 3300026023 | Ga0207677_10205908 | Ga0207677_102059082 | 263 |
| 342 | 3300026035 | Ga0207703_10074613 | Ga0207703_100746132 | 263 |
| 343 | 3300026067 | Ga0207678_10038173 | Ga0207678_100381734 | 263 |
| 344 | 3300026078 | Ga0207702_10579059 | Ga0207702_105790592 | 263 |
| 345 | 3300026088 | Ga0207641_10237851 | Ga0207641_102378512 | 263 |
| 346 | 3300026121 | Ga0207683_10006569 | Ga0207683_100065694 | 263 |
| 347 | 3300026142 | Ga0207698_10106294 | Ga0207698_101062942 | 263 |
| 348 | 3300028379 | Ga0268266_10251480 | Ga0268266_102514802 | 263 |
| 349 | 3300028381 | Ga0268264_10123485 | Ga0268264_101234851 | 263 |
| 350 | 3300048903 | Ga0496100_0058563 | Ga0496100_0058563_276_1094 | 263 |
| 351 | 3300048904 | Ga0496101_0013970 | Ga0496101_0013970_3996_4814 | 263 |
| 352 | 3300048906 | Ga0496103_0234193 | Ga0496103_0234193_249_1064 | 263 |
| 353 | 3300048909 | Ga0496106_0047636 | Ga0496106_0047636_628_1446 | 263 |
| 354 | 3300048910 | Ga0496107_0032107 | Ga0496107_0032107_1886_2704 | 263 |
| 355 | 3300048915 | Ga0496112_0096675 | Ga0496112_0096675_1542_2360 | 263 |
| 356 | 3300048917 | Ga0496114_0011545 | Ga0496114_0011545_4958_5776 | 263 |
| 357 | 3300048918 | Ga0496115_0023902 | Ga0496115_0023902_984_1802 | 263 |
| 358 | 3300025972 | Ga0207668_10233938 | Ga0207668_102339382 | 264 |
| 359 | 3300048903 | Ga0496100_0518992 | Ga0496100_0518992_112_906 | 264 |
| 360 | 3300048905 | Ga0496102_0363902 | Ga0496102_0363902_377_1186 | 264 |
| 361 | 3300049569 | Ga0501032_0132357 | Ga0501032_0132357_541_1359 | 264 |
| 362 | 3300049574 | Ga0501038_0121412 | Ga0501038_0121412_24_842 | 264 |
| 363 | 3300049586 | Ga0501070_0315084 | Ga0501070_0315084_276_1094 | 264 |
| 364 | 3300049823 | Ga0501044_0020447 | Ga0501044_0020447_5196_6014 | 264 |
| 365 | 3300005331 | Ga0070670_100007568 | Ga0070670_1000075684 | 265 |
| 366 | 3300005339 | Ga0070660_100204423 | Ga0070660_1002044232 | 265 |
| 367 | 3300005355 | Ga0070671_100017777 | Ga0070671_1000177775 | 265 |
| 368 | 3300005364 | Ga0070673_100048528 | Ga0070673_1000485283 | 265 |
| 369 | 3300005366 | Ga0070659_100093279 | Ga0070659_1000932792 | 265 |
| 370 | 3300005434 | Ga0070709_10099842 | Ga0070709_100998422 | 265 |
| 371 | 3300005435 | Ga0070714_100648601 | Ga0070714_1006486012 | 265 |
| 372 | 3300005436 | Ga0070713_100088503 | Ga0070713_1000885032 | 265 |
| 373 | 3300005439 | Ga0070711_100044247 | Ga0070711_1000442472 | 265 |
| 374 | 3300005439 | Ga0070711_100060019 | Ga0070711_1000600193 | 265 |
| 375 | 3300005548 | Ga0070665_100016548 | Ga0070665_1000165487 | 265 |
| 376 | 3300006175 | Ga0070712_100000600 | Ga0070712_10000060016 | 265 |
| 377 | 3300009545 | Ga0105237_10239725 | Ga0105237_102397252 | 265 |
| 378 | 3300014325 | Ga0163163_10040155 | Ga0163163_100401556 | 265 |
| 379 | 3300014968 | Ga0157379_10207550 | Ga0157379_102075502 | 265 |
| 380 | 3300024225 | Ga0224572_1014624 | Ga0224572_10146242 | 265 |
| 381 | 3300024227 | Ga0228598_1001606 | Ga0228598_10016064 | 265 |
| 382 | 3300025906 | Ga0207699_10186566 | Ga0207699_101865662 | 265 |
| 383 | 3300025915 | Ga0207693_10007806 | Ga0207693_100078064 | 265 |
| 384 | 3300025916 | Ga0207663_10033349 | Ga0207663_100333492 | 265 |
| 385 | 3300025925 | Ga0207650_10002486 | Ga0207650_100024868 | 265 |
| 386 | 3300025933 | Ga0207706_10101056 | Ga0207706_101010563 | 265 |
| 387 | 3300025939 | Ga0207665_10102604 | Ga0207665_101026042 | 265 |
| 388 | 3300025960 | Ga0207651_10207301 | Ga0207651_102073011 | 265 |
| 389 | 3300035118 | Ga0373954_0011115 | Ga0373954_0011115_2619_3431 | 265 |
| 390 | 3300035119 | Ga0373956_0062032 | Ga0373956_0062032_683_1495 | 265 |
| 391 | 3300035170 | Ga0373943_0061648 | Ga0373943_0061648_428_1240 | 265 |
| 392 | 3300036401 | Ga0373937_0089986 | Ga0373937_0089986_568_1380 | 265 |
| 393 | 3300046454 | Ga0495592_0086790 | Ga0495592_0086790_1125_1937 | 265 |
| 394 | 3300046459 | Ga0495629_0050912 | Ga0495629_0050912_553_1365 | 265 |
| 395 | 3300046462 | Ga0495651_0015568 | Ga0495651_0015568_875_1687 | 265 |
| 396 | 3300046476 | Ga0495662_0029966 | Ga0495662_0029966_770_1582 | 265 |
| 397 | 3300046477 | Ga0495664_0073669 | Ga0495664_0073669_873_1685 | 265 |
| 398 | 3300046529 | Ga0495652_0126708 | Ga0495652_0126708_867_1679 | 265 |
| 399 | 3300046559 | Ga0495667_0087500 | Ga0495667_0087500_571_1383 | 265 |
| 400 | 3300046675 | Ga0495657_0080100 | Ga0495657_0080100_620_1432 | 265 |
| 401 | 3300046679 | Ga0495623_0055409 | Ga0495623_0055409_613_1425 | 265 |
| 402 | 3300046680 | Ga0495646_0110395 | Ga0495646_0110395_252_1052 | 265 |
| 403 | 3300047444 | Ga0495675_0050487 | Ga0495675_0050487_1135_1947 | 265 |
| 404 | 3300047673 | Ga0495593_0122668 | Ga0495593_0122668_136_948 | 265 |
| 405 | 3300048088 | Ga0495602_0030760 | Ga0495602_0030760_3795_4607 | 265 |
| 406 | 3300048912 | Ga0496109_0343865 | Ga0496109_0343865_484_1296 | 265 |
| 407 | 3300048913 | Ga0496110_0234443 | Ga0496110_0234443_126_938 | 265 |
| 408 | 3300053077 | Ga0495601_0087248 | Ga0495601_0087248_189_989 | 265 |
| 409 | 3300054114 | Ga0501084_0706929 | Ga0501084_0706929_26_826 | 265 |
| 410 | 3300061734 | Ga0530510_0205522 | Ga0530510_0205522_36_836 | 265 |
| 411 | 3300061734 | Ga0530510_0267454 | Ga0530510_0267454_227_1027 | 265 |
| 412 | iso_pu_bacteria | 2510461069 | 2510839829 | 265 |
| 413 | iso_pu_bacteria | 2510917026 | 2511171327 | 265 |
| 414 | iso_pu_bacteria | 2585427633 | 2585994399 | 265 |
| 415 | iso_pu_bacteria | 2585427634 | 2585998858 | 265 |
| 416 | iso_pu_bacteria | 2600254933 | 2600374700 | 265 |
| 417 | iso_pu_bacteria | 2643221653 | 2644297635 | 265 |
| 418 | iso_pu_bacteria | 2643221719 | 2644655888 | 265 |
| 419 | iso_pu_bacteria | 2738541317 | 2738948220 | 265 |
| 420 | iso_pu_bacteria | 2775507049 | 2776912091 | 265 |
| 421 | iso_pu_bacteria | 2818991272 | 2819243293 | 265 |
| 422 | iso_pu_bacteria | 2818991461 | 2819686319 | 265 |
| 423 | iso_pu_bacteria | 2854896431 | 2854898266 | 265 |
| 424 | iso_pu_bacteria | 2854916844 | 2854920036 | 265 |
| 425 | iso_pu_bacteria | 2899803654 | 2899805267 | 265 |
| 426 | iso_pu_bacteria | 2913308742 | 2913313439 | 265 |
| 427 | iso_pu_bacteria | 2929138655 | 2929138989 | 265 |
| 428 | iso_pu_bacteria | 2989776772 | 2989777423 | 265 |
| 429 | iso_pu_bacteria | 8005246636 | 8005247386 | 265 |
| 430 | iso_pu_bacteria | 8005658619 | 8005660396 | 265 |
| 431 | 3300048905 | Ga0496102_0433503 | Ga0496102_0433503_217_1020 | 266 |
| 432 | 3300048907 | Ga0496104_0000369 | Ga0496104_0000369_28949_29752 | 266 |
| 433 | 3300048908 | Ga0496105_0001722 | Ga0496105_0001722_2035_2838 | 266 |
| 434 | 3300048908 | Ga0496105_0007091 | Ga0496105_0007091_1840_2643 | 266 |
| 435 | 3300048912 | Ga0496109_0097700 | Ga0496109_0097700_101_904 | 266 |
| 436 | 3300048915 | Ga0496112_0200508 | Ga0496112_0200508_837_1640 | 266 |
| 437 | 3300048917 | Ga0496114_0018863 | Ga0496114_0018863_958_1761 | 266 |
| 438 | 3300048918 | Ga0496115_0121906 | Ga0496115_0121906_27_830 | 266 |
| 439 | 3300048918 | Ga0496115_0156196 | Ga0496115_0156196_665_1468 | 266 |
| 440 | 3300048918 | Ga0496115_0438697 | Ga0496115_0438697_141_944 | 266 |
| 441 | 3300053077 | Ga0495601_0199566 | Ga0495601_0199566_166_969 | 266 |
| 442 | 3300053085 | Ga0495619_0114545 | Ga0495619_0114545_372_1175 | 266 |
| 443 | 3300005329 | Ga0070683_100200212 | Ga0070683_1002002122 | 267 |
| 444 | 3300005339 | Ga0070660_100041752 | Ga0070660_1000417523 | 267 |
| 445 | 3300005340 | Ga0070689_100018210 | Ga0070689_1000182102 | 267 |
| 446 | 3300005343 | Ga0070687_100017014 | Ga0070687_1000170142 | 267 |
| 447 | 3300005344 | Ga0070661_100138531 | Ga0070661_1001385312 | 267 |
| 448 | 3300005366 | Ga0070659_100468469 | Ga0070659_1004684691 | 267 |
| 449 | 3300005535 | Ga0070684_100276642 | Ga0070684_1002766422 | 267 |
| 450 | 3300005539 | Ga0068853_100148947 | Ga0068853_1001489472 | 267 |
| 451 | 3300005616 | Ga0068852_100609751 | Ga0068852_1006097512 | 267 |
| 452 | 3300005617 | Ga0068859_100174553 | Ga0068859_1001745533 | 267 |
| 453 | 3300005834 | Ga0068851_10262417 | Ga0068851_102624172 | 267 |
| 454 | 3300006178 | Ga0075367_10000931 | Ga0075367_100009316 | 267 |
| 455 | 3300006847 | Ga0075431_100826221 | Ga0075431_1008262211 | 267 |
| 456 | 3300006931 | Ga0097620_100174546 | Ga0097620_1001745463 | 267 |
| 457 | 3300009177 | Ga0105248_10337537 | Ga0105248_103375372 | 267 |
| 458 | 3300025912 | Ga0207707_10002095 | Ga0207707_1000209519 | 267 |
| 459 | 3300025918 | Ga0207662_10206364 | Ga0207662_102063641 | 267 |
| 460 | 3300025919 | Ga0207657_10127407 | Ga0207657_101274073 | 267 |
| 461 | 3300025921 | Ga0207652_10024326 | Ga0207652_100243262 | 267 |
| 462 | 3300025936 | Ga0207670_10065705 | Ga0207670_100657052 | 267 |
| 463 | 3300025949 | Ga0207667_10140860 | Ga0207667_101408603 | 267 |
| 464 | 3300026089 | Ga0207648_10712812 | Ga0207648_107128121 | 267 |
| 465 | 3300050490 | nmdc:mga03n38_180047_c1 | nmdc:mga03n38_180047_c1_235_1053 | 267 |
| 466 | 3300050491 | nmdc:mga00v17_153005_c1 | nmdc:mga00v17_153005_c1_291_1109 | 267 |
| 467 | 3300050492 | nmdc:mga0yw44_7399_c1 | nmdc:mga0yw44_7399_c1_339_1157 | 267 |
| 468 | 3300005330 | Ga0070690_100107758 | Ga0070690_1001077583 | 268 |
| 469 | 3300005338 | Ga0068868_100049608 | Ga0068868_1000496083 | 268 |
| 470 | 3300005356 | Ga0070674_100164621 | Ga0070674_1001646212 | 268 |
| 471 | 3300005364 | Ga0070673_100529387 | Ga0070673_1005293871 | 268 |
| 472 | 3300005530 | Ga0070679_100095294 | Ga0070679_1000952942 | 268 |
| 473 | 3300005842 | Ga0068858_100050186 | Ga0068858_1000501862 | 268 |
| 474 | 3300006038 | Ga0075365_10006190 | Ga0075365_100061905 | 268 |
| 475 | 3300006846 | Ga0075430_100002695 | Ga0075430_1000026953 | 268 |
| 476 | 3300009098 | Ga0105245_10006042 | Ga0105245_100060421 | 268 |
| 477 | 3300009147 | Ga0114129_10572031 | Ga0114129_105720313 | 268 |
| 478 | 3300009553 | Ga0105249_10610394 | Ga0105249_106103942 | 268 |
| 479 | 3300013297 | Ga0157378_10074855 | Ga0157378_100748553 | 268 |
| 480 | 3300014326 | Ga0157380_10108259 | Ga0157380_101082592 | 268 |
| 481 | 3300025921 | Ga0207652_10070802 | Ga0207652_100708023 | 268 |
| 482 | 3300025937 | Ga0207669_10095076 | Ga0207669_100950762 | 268 |
| 483 | 3300025986 | Ga0207658_10537504 | Ga0207658_105375041 | 268 |
| 484 | 3300026023 | Ga0207677_10099552 | Ga0207677_100995523 | 268 |
| 485 | 3300026121 | Ga0207683_10154405 | Ga0207683_101544053 | 268 |
| 486 | 3300044694 | Ga0466963_0051924 | Ga0466963_0051924_1273_2079 | 268 |
| 487 | 3300044694 | Ga0466963_0319115 | Ga0466963_0319115_243_1049 | 268 |
| 488 | 3300044719 | Ga0466971_0007301 | Ga0466971_0007301_2195_3001 | 268 |
| 489 | 3300045836 | Ga0466958_0130907 | Ga0466958_0130907_518_1324 | 268 |
| 490 | 3300050492 | nmdc:mga0yw44_5247_c1 | nmdc:mga0yw44_5247_c1_4261_5070 | 268 |
| 491 | 3300050509 | nmdc:mga0qj67_14_c1 | nmdc:mga0qj67_14_c1_39943_40752 | 268 |
| 492 | 3300050510 | nmdc:mga06r32_707901_c1 | nmdc:mga06r32_707901_c1_128_937 | 268 |
| 493 | 3300061719 | Ga0466962_0009869 | Ga0466962_0009869_936_1742 | 268 |
| 494 | 3300005262 | Ga0065165_1003754 | Ga0065165_100375410 | 269 |
| 495 | 3300005436 | Ga0070713_100027849 | Ga0070713_1000278494 | 269 |
| 496 | 3300005468 | Ga0070707_100009211 | Ga0070707_1000092115 | 269 |
| 497 | 3300005518 | Ga0070699_100003057 | Ga0070699_1000030572 | 269 |
| 498 | 3300005518 | Ga0070699_100292960 | Ga0070699_1002929602 | 269 |
| 499 | 3300005536 | Ga0070697_100148569 | Ga0070697_1001485692 | 269 |
| 500 | 3300005548 | Ga0070665_100026572 | Ga0070665_1000265722 | 269 |
| 501 | 3300005937 | Ga0081455_10086707 | Ga0081455_100867072 | 269 |
| 502 | 3300006038 | Ga0075365_10002013 | Ga0075365_100020133 | 269 |
| 503 | 3300006844 | Ga0075428_100010816 | Ga0075428_1000108164 | 269 |
| 504 | 3300006871 | Ga0075434_100040249 | Ga0075434_1000402494 | 269 |
| 505 | 3300006871 | Ga0075434_100120511 | Ga0075434_1001205113 | 269 |
| 506 | 3300007076 | Ga0075435_100062344 | Ga0075435_1000623442 | 269 |
| 507 | 3300007265 | Ga0099794_10000521 | Ga0099794_100005213 | 269 |
| 508 | 3300007788 | Ga0099795_10005655 | Ga0099795_100056551 | 269 |
| 509 | 3300009094 | Ga0111539_10037752 | Ga0111539_100377523 | 269 |
| 510 | 3300009147 | Ga0114129_10003643 | Ga0114129_1000364312 | 269 |
| 511 | 3300009148 | Ga0105243_10118098 | Ga0105243_101180981 | 269 |
| 512 | 3300010159 | Ga0099796_10038869 | Ga0099796_100388692 | 269 |
| 513 | 3300011119 | Ga0105246_10192305 | Ga0105246_101923052 | 269 |
| 514 | 3300013100 | Ga0157373_10029938 | Ga0157373_100299383 | 269 |
| 515 | 3300013306 | Ga0163162_10155852 | Ga0163162_101558522 | 269 |
| 516 | 3300021361 | Ga0213872_10014346 | Ga0213872_100143462 | 269 |
| 517 | 3300025910 | Ga0207684_10018056 | Ga0207684_100180565 | 269 |
| 518 | 3300025915 | Ga0207693_10178729 | Ga0207693_101787292 | 269 |
| 519 | 3300025928 | Ga0207700_10338193 | Ga0207700_103381932 | 269 |
| 520 | 3300025931 | Ga0207644_10084280 | Ga0207644_100842802 | 269 |
| 521 | 3300028379 | Ga0268266_10028097 | Ga0268266_100280974 | 269 |
| 522 | 3300035083 | Ga0373926_0035679 | Ga0373926_0035679_829_1641 | 269 |
| 523 | 3300035113 | Ga0373936_0070849 | Ga0373936_0070849_233_1045 | 269 |
| 524 | 3300035170 | Ga0373943_0037247 | Ga0373943_0037247_628_1440 | 269 |
| 525 | 3300035691 | Ga0373931_0129083 | Ga0373931_0129083_340_1152 | 269 |
| 526 | 3300035695 | Ga0373927_0050433 | Ga0373927_0050433_94_906 | 269 |
| 527 | 3300035695 | Ga0373927_0235516 | Ga0373927_0235516_291_1103 | 269 |
| 528 | 3300035725 | Ga0373947_0016348 | Ga0373947_0016348_758_1570 | 269 |
| 529 | 3300037068 | Ga0373925_0282705 | Ga0373925_0282705_407_1219 | 269 |
| 530 | 3300039447 | Ga0436361_0166397 | Ga0436361_0166397_17345_18157 | 269 |
| 531 | 3300044842 | Ga0466957_0024459 | Ga0466957_0024459_1449_2258 | 269 |
| 532 | 3300045836 | Ga0466958_0355932 | Ga0466958_0355932_25_834 | 269 |
| 533 | 3300046454 | Ga0495592_0165449 | Ga0495592_0165449_301_1116 | 269 |
| 534 | 3300046455 | Ga0495603_0018541 | Ga0495603_0018541_395_1207 | 269 |
| 535 | 3300046459 | Ga0495629_0020542 | Ga0495629_0020542_1125_1940 | 269 |
| 536 | 3300046459 | Ga0495629_0075114 | Ga0495629_0075114_1221_2033 | 269 |
| 537 | 3300046459 | Ga0495629_0090176 | Ga0495629_0090176_844_1656 | 269 |
| 538 | 3300046459 | Ga0495629_0156072 | Ga0495629_0156072_746_1555 | 269 |
| 539 | 3300046460 | Ga0495638_0048301 | Ga0495638_0048301_484_1299 | 269 |
| 540 | 3300046461 | Ga0495641_0035588 | Ga0495641_0035588_355_1167 | 269 |
| 541 | 3300046461 | Ga0495641_0048346 | Ga0495641_0048346_339_1151 | 269 |
| 542 | 3300046472 | Ga0495580_0138088 | Ga0495580_0138088_668_1480 | 269 |
| 543 | 3300046473 | Ga0495582_0079933 | Ga0495582_0079933_931_1743 | 269 |
| 544 | 3300046475 | Ga0495639_0061445 | Ga0495639_0061445_469_1284 | 269 |
| 545 | 3300046477 | Ga0495664_0147746 | Ga0495664_0147746_297_1112 | 269 |
| 546 | 3300046499 | Ga0495594_0278971 | Ga0495594_0278971_62_874 | 269 |
| 547 | 3300046511 | Ga0495608_0069090 | Ga0495608_0069090_1091_1900 | 269 |
| 548 | 3300046511 | Ga0495608_0194482 | Ga0495608_0194482_378_1190 | 269 |
| 549 | 3300046517 | Ga0495630_0269842 | Ga0495630_0269842_340_1152 | 269 |
| 550 | 3300046524 | Ga0495648_0022351 | Ga0495648_0022351_1685_2500 | 269 |
| 551 | 3300046533 | Ga0495640_0066410 | Ga0495640_0066410_1012_1824 | 269 |
| 552 | 3300046533 | Ga0495640_0256270 | Ga0495640_0256270_199_1011 | 269 |
| 553 | 3300046537 | Ga0495598_0010258 | Ga0495598_0010258_1249_2061 | 269 |
| 554 | 3300046539 | Ga0495621_0079131 | Ga0495621_0079131_391_1203 | 269 |
| 555 | 3300046557 | Ga0495622_0037360 | Ga0495622_0037360_1288_2103 | 269 |
| 556 | 3300046558 | Ga0495633_0024998 | Ga0495633_0024998_675_1487 | 269 |
| 557 | 3300046615 | Ga0495656_0013754 | Ga0495656_0013754_2078_2890 | 269 |
| 558 | 3300046642 | Ga0495634_0060532 | Ga0495634_0060532_1465_2280 | 269 |
| 559 | 3300046642 | Ga0495634_0156980 | Ga0495634_0156980_401_1213 | 269 |
| 560 | 3300046648 | Ga0495611_0147867 | Ga0495611_0147867_199_1011 | 269 |
| 561 | 3300046663 | Ga0495635_0052506 | Ga0495635_0052506_1125_1940 | 269 |
| 562 | 3300046665 | Ga0495661_0025055 | Ga0495661_0025055_881_1693 | 269 |
| 563 | 3300046674 | Ga0495588_0053170 | Ga0495588_0053170_1079_1894 | 269 |
| 564 | 3300046683 | Ga0495658_0045946 | Ga0495658_0045946_920_1732 | 269 |
| 565 | 3300046689 | Ga0495613_0128003 | Ga0495613_0128003_356_1168 | 269 |
| 566 | 3300046690 | Ga0495624_0118515 | Ga0495624_0118515_233_1045 | 269 |
| 567 | 3300046692 | Ga0495671_0137294 | Ga0495671_0137294_255_1067 | 269 |
| 568 | 3300046809 | Ga0495600_0043987 | Ga0495600_0043987_871_1686 | 269 |
| 569 | 3300047315 | Ga0495581_0198289 | Ga0495581_0198289_344_1156 | 269 |
| 570 | 3300047317 | Ga0495604_0322079 | Ga0495604_0322079_141_953 | 269 |
| 571 | 3300048088 | Ga0495602_0262551 | Ga0495602_0262551_80_895 | 269 |
| 572 | 3300048091 | Ga0495626_0040178 | Ga0495626_0040178_1265_2077 | 269 |
| 573 | 3300048905 | Ga0496102_0033680 | Ga0496102_0033680_2671_3483 | 269 |
| 574 | 3300048906 | Ga0496103_0106759 | Ga0496103_0106759_729_1541 | 269 |
| 575 | 3300048907 | Ga0496104_0004766 | Ga0496104_0004766_7035_7847 | 269 |
| 576 | 3300048908 | Ga0496105_0004314 | Ga0496105_0004314_2505_3317 | 269 |
| 577 | 3300048910 | Ga0496107_0017035 | Ga0496107_0017035_2690_3502 | 269 |
| 578 | 3300048911 | Ga0496108_0000746 | Ga0496108_0000746_7335_8147 | 269 |
| 579 | 3300048912 | Ga0496109_0005286 | Ga0496109_0005286_8506_9318 | 269 |
| 580 | 3300048913 | Ga0496110_0004442 | Ga0496110_0004442_8239_9051 | 269 |
| 581 | 3300048914 | Ga0496111_0000317 | Ga0496111_0000317_5024_5842 | 269 |
| 582 | 3300048914 | Ga0496111_0001412 | Ga0496111_0001412_8509_9321 | 269 |
| 583 | 3300048914 | Ga0496111_0188492 | Ga0496111_0188492_599_1411 | 269 |
| 584 | 3300048915 | Ga0496112_0053814 | Ga0496112_0053814_1254_2066 | 269 |
| 585 | 3300048915 | Ga0496112_0068721 | Ga0496112_0068721_2355_3167 | 269 |
| 586 | 3300048916 | Ga0496113_0024381 | Ga0496113_0024381_1889_2701 | 269 |
| 587 | 3300048921 | Ga0496118_0065934 | Ga0496118_0065934_1803_2624 | 269 |
| 588 | 3300048923 | Ga0496120_0061953 | Ga0496120_0061953_941_1762 | 269 |
| 589 | 3300048924 | Ga0496121_0000001 | Ga0496121_0000001_441894_442715 | 269 |
| 590 | 3300048925 | Ga0496122_0000009 | Ga0496122_0000009_518705_519523 | 269 |
| 591 | 3300048925 | Ga0496122_0091780 | Ga0496122_0091780_1033_1854 | 269 |
| 592 | 3300048926 | Ga0496123_0000020 | Ga0496123_0000020_323263_324081 | 269 |
| 593 | 3300048926 | Ga0496123_0069542 | Ga0496123_0069542_379_1200 | 269 |
| 594 | 3300048927 | Ga0496124_0027813 | Ga0496124_0027813_4189_5007 | 269 |
| 595 | 3300048927 | Ga0496124_0208241 | Ga0496124_0208241_92_910 | 269 |
| 596 | 3300048927 | Ga0496124_0218241 | Ga0496124_0218241_226_1047 | 269 |
| 597 | 3300048928 | Ga0496125_0000001 | Ga0496125_0000001_553916_554737 | 269 |
| 598 | 3300049744 | Ga0501083_0147934 | Ga0501083_0147934_532_1344 | 269 |
| 599 | 3300049744 | Ga0501083_0320540 | Ga0501083_0320540_46_864 | 269 |
| 600 | 3300050491 | nmdc:mga00v17_384419_c1 | nmdc:mga00v17_384419_c1_53_871 | 269 |
| 601 | 3300050492 | nmdc:mga0yw44_1338_c1 | nmdc:mga0yw44_1338_c1_1923_2738 | 269 |
| 602 | 3300050492 | nmdc:mga0yw44_144700_c1 | nmdc:mga0yw44_144700_c1_111_923 | 269 |
| 603 | 3300050507 | nmdc:mga05p37_30958_c1 | nmdc:mga05p37_30958_c1_2632_3444 | 269 |
| 604 | 3300050512 | nmdc:mga0n895_473344_c1 | nmdc:mga0n895_473344_c1_210_1022 | 269 |
| 605 | 3300050512 | nmdc:mga0n895_491166_c1 | nmdc:mga0n895_491166_c1_38_847 | 269 |
| 606 | 3300050513 | nmdc:mga0rr50_192177_c1 | nmdc:mga0rr50_192177_c1_229_1041 | 269 |
| 607 | 3300050514 | nmdc:mga08x19_284094_c1 | nmdc:mga08x19_284094_c1_103_912 | 269 |
| 608 | 3300053077 | Ga0495601_0086200 | Ga0495601_0086200_809_1624 | 269 |
| 609 | 3300053084 | Ga0495595_0153701 | Ga0495595_0153701_205_1017 | 269 |
| 610 | 3300053125 | Ga0500618_000151 | Ga0500618_000151_13054_13872 | 269 |
| 611 | 3300053125 | Ga0500618_016698 | Ga0500618_016698_627_1445 | 269 |
| 612 | 3300053148 | Ga0500590_004280 | Ga0500590_004280_5030_5845 | 269 |
| 613 | 3300053153 | Ga0500616_0000443 | Ga0500616_0000443_13127_13945 | 269 |
| 614 | 3300053161 | Ga0500634_0027046 | Ga0500634_0027046_738_1550 | 269 |
| 615 | 3300053177 | Ga0500636_0000010 | Ga0500636_0000010_88263_89075 | 269 |
| 616 | 3300005327 | Ga0070658_10013155 | Ga0070658_100131553 | 270 |
| 617 | 3300005327 | Ga0070658_10020050 | Ga0070658_100200505 | 270 |
| 618 | 3300005327 | Ga0070658_10459182 | Ga0070658_104591822 | 270 |
| 619 | 3300005336 | Ga0070680_100023201 | Ga0070680_1000232012 | 270 |
| 620 | 3300005339 | Ga0070660_100018546 | Ga0070660_1000185463 | 270 |
| 621 | 3300005530 | Ga0070679_100080514 | Ga0070679_1000805141 | 270 |
| 622 | 3300005563 | Ga0068855_100132818 | Ga0068855_1001328182 | 270 |
| 623 | 3300005563 | Ga0068855_100277219 | Ga0068855_1002772192 | 270 |
| 624 | 3300005616 | Ga0068852_100170832 | Ga0068852_1001708323 | 270 |
| 625 | 3300005616 | Ga0068852_100382741 | Ga0068852_1003827412 | 270 |
| 626 | 3300005842 | Ga0068858_100095834 | Ga0068858_1000958341 | 270 |
| 627 | 3300006871 | Ga0075434_100065948 | Ga0075434_1000659482 | 270 |
| 628 | 3300009148 | Ga0105243_10082939 | Ga0105243_100829392 | 270 |
| 629 | 3300009545 | Ga0105237_10228040 | Ga0105237_102280403 | 270 |
| 630 | 3300009551 | Ga0105238_10041417 | Ga0105238_100414171 | 270 |
| 631 | 3300013105 | Ga0157369_10108963 | Ga0157369_101089633 | 270 |
| 632 | 3300013296 | Ga0157374_10015034 | Ga0157374_100150342 | 270 |
| 633 | 3300013307 | Ga0157372_10172693 | Ga0157372_101726933 | 270 |
| 634 | 3300013308 | Ga0157375_10320450 | Ga0157375_103204502 | 270 |
| 635 | 3300014969 | Ga0157376_10602366 | Ga0157376_106023662 | 270 |
| 636 | 3300020082 | Ga0206353_11965552 | Ga0206353_119655523 | 270 |
| 637 | 3300025909 | Ga0207705_10141766 | Ga0207705_101417662 | 270 |
| 638 | 3300025909 | Ga0207705_10435285 | Ga0207705_104352852 | 270 |
| 639 | 3300025912 | Ga0207707_10087772 | Ga0207707_100877723 | 270 |
| 640 | 3300025917 | Ga0207660_10093076 | Ga0207660_100930763 | 270 |
| 641 | 3300025917 | Ga0207660_10097784 | Ga0207660_100977842 | 270 |
| 642 | 3300025919 | Ga0207657_10007357 | Ga0207657_100073579 | 270 |
| 643 | 3300025921 | Ga0207652_10036717 | Ga0207652_100367173 | 270 |
| 644 | 3300025921 | Ga0207652_10411903 | Ga0207652_104119032 | 270 |
| 645 | 3300025938 | Ga0207704_10147497 | Ga0207704_101474972 | 270 |
| 646 | 3300025940 | Ga0207691_10432927 | Ga0207691_104329272 | 270 |
| 647 | 3300025949 | Ga0207667_10019155 | Ga0207667_100191553 | 270 |
| 648 | 3300025949 | Ga0207667_10554410 | Ga0207667_105544102 | 270 |
| 649 | 3300026041 | Ga0207639_10093322 | Ga0207639_100933223 | 270 |
| 650 | 3300026041 | Ga0207639_10447774 | Ga0207639_104477742 | 270 |
| 651 | 3300026078 | Ga0207702_10827603 | Ga0207702_108276031 | 270 |
| 652 | 3300026142 | Ga0207698_10311069 | Ga0207698_103110691 | 270 |
| 653 | 3300031235 | Ga0265330_10051258 | Ga0265330_100512582 | 270 |
| 654 | 3300031249 | Ga0265339_10016485 | Ga0265339_100164852 | 270 |
| 655 | 3300031249 | Ga0265339_10122867 | Ga0265339_101228672 | 270 |
| 656 | 3300031456 | Ga0307513_10299406 | Ga0307513_102994061 | 270 |
| 657 | 3300031712 | Ga0265342_10001643 | Ga0265342_1000164311 | 270 |
| 658 | 3300035117 | Ga0373953_0003588 | Ga0373953_0003588_2563_3375 | 270 |
| 659 | 3300035120 | Ga0373957_0002366 | Ga0373957_0002366_3509_4321 | 270 |
| 660 | 3300035172 | Ga0373955_0009202 | Ga0373955_0009202_673_1485 | 270 |
| 661 | 3300035410 | Ga0373924_0042484 | Ga0373924_0042484_1006_1818 | 270 |
| 662 | 3300035691 | Ga0373931_0255098 | Ga0373931_0255098_161_976 | 270 |
| 663 | 3300035724 | Ga0373933_0004760 | Ga0373933_0004760_1651_2463 | 270 |
| 664 | 3300036401 | Ga0373937_0014163 | Ga0373937_0014163_2768_3580 | 270 |
| 665 | 3300038443 | Ga0395901_0243431 | Ga0395901_0243431_784_1596 | 270 |
| 666 | 3300044694 | Ga0466963_0198923 | Ga0466963_0198923_378_1190 | 270 |
| 667 | 3300044694 | Ga0466963_0211403 | Ga0466963_0211403_58_870 | 270 |
| 668 | 3300044694 | Ga0466963_0280349 | Ga0466963_0280349_141_959 | 270 |
| 669 | 3300044719 | Ga0466971_0156615 | Ga0466971_0156615_235_1047 | 270 |
| 670 | 3300045836 | Ga0466958_0044559 | Ga0466958_0044559_1323_2135 | 270 |
| 671 | 3300045976 | Ga0466967_0004231 | Ga0466967_0004231_3541_4353 | 270 |
| 672 | 3300045976 | Ga0466967_0032121 | Ga0466967_0032121_34_846 | 270 |
| 673 | 3300046454 | Ga0495592_0025827 | Ga0495592_0025827_3443_4255 | 270 |
| 674 | 3300046460 | Ga0495638_0032977 | Ga0495638_0032977_2208_3023 | 270 |
| 675 | 3300046462 | Ga0495651_0020419 | Ga0495651_0020419_4129_4941 | 270 |
| 676 | 3300046463 | Ga0495653_0003035 | Ga0495653_0003035_7658_8470 | 270 |
| 677 | 3300046477 | Ga0495664_0020131 | Ga0495664_0020131_688_1500 | 270 |
| 678 | 3300046511 | Ga0495608_0007440 | Ga0495608_0007440_2076_2888 | 270 |
| 679 | 3300046517 | Ga0495630_0104057 | Ga0495630_0104057_1134_1946 | 270 |
| 680 | 3300046529 | Ga0495652_0171116 | Ga0495652_0171116_789_1601 | 270 |
| 681 | 3300046533 | Ga0495640_0006838 | Ga0495640_0006838_6589_7401 | 270 |
| 682 | 3300046536 | Ga0495587_0013020 | Ga0495587_0013020_3417_4229 | 270 |
| 683 | 3300046543 | Ga0495645_0008693 | Ga0495645_0008693_2211_3023 | 270 |
| 684 | 3300046559 | Ga0495667_0002926 | Ga0495667_0002926_7878_8690 | 270 |
| 685 | 3300046663 | Ga0495635_0020091 | Ga0495635_0020091_1634_2446 | 270 |
| 686 | 3300046678 | Ga0495599_0043661 | Ga0495599_0043661_1362_2174 | 270 |
| 687 | 3300046679 | Ga0495623_0004877 | Ga0495623_0004877_6224_7036 | 270 |
| 688 | 3300046680 | Ga0495646_0033048 | Ga0495646_0033048_1638_2450 | 270 |
| 689 | 3300046690 | Ga0495624_0034363 | Ga0495624_0034363_203_1015 | 270 |
| 690 | 3300046809 | Ga0495600_0010920 | Ga0495600_0010920_895_1707 | 270 |
| 691 | 3300047317 | Ga0495604_0036466 | Ga0495604_0036466_2861_3673 | 270 |
| 692 | 3300047319 | Ga0495674_0051448 | Ga0495674_0051448_1098_1910 | 270 |
| 693 | 3300047322 | Ga0495680_0011642 | Ga0495680_0011642_5958_6770 | 270 |
| 694 | 3300047444 | Ga0495675_0001056 | Ga0495675_0001056_13725_14537 | 270 |
| 695 | 3300047673 | Ga0495593_0030736 | Ga0495593_0030736_1201_2013 | 270 |
| 696 | 3300048088 | Ga0495602_0003273 | Ga0495602_0003273_523_1335 | 270 |
| 697 | 3300048907 | Ga0496104_0011977 | Ga0496104_0011977_2331_3143 | 270 |
| 698 | 3300049570 | Ga0501033_0011532 | Ga0501033_0011532_522_1334 | 270 |
| 699 | 3300049571 | Ga0501034_0133060 | Ga0501034_0133060_707_1519 | 270 |
| 700 | 3300049572 | Ga0501036_0047994 | Ga0501036_0047994_217_1029 | 270 |
| 701 | 3300049572 | Ga0501036_0427363 | Ga0501036_0427363_203_1015 | 270 |
| 702 | 3300049573 | Ga0501037_0019405 | Ga0501037_0019405_3668_4480 | 270 |
| 703 | 3300049575 | Ga0501039_0026191 | Ga0501039_0026191_2819_3631 | 270 |
| 704 | 3300049579 | Ga0501043_0167700 | Ga0501043_0167700_139_951 | 270 |
| 705 | 3300049580 | Ga0501046_0292076 | Ga0501046_0292076_215_1027 | 270 |
| 706 | 3300049581 | Ga0501047_0019246 | Ga0501047_0019246_5040_5852 | 270 |
| 707 | 3300049581 | Ga0501047_0135576 | Ga0501047_0135576_294_1106 | 270 |
| 708 | 3300049586 | Ga0501070_0051457 | Ga0501070_0051457_2560_3372 | 270 |
| 709 | 3300049586 | Ga0501070_0264200 | Ga0501070_0264200_98_910 | 270 |
| 710 | 3300049589 | Ga0501073_0145374 | Ga0501073_0145374_461_1273 | 270 |
| 711 | 3300049822 | Ga0501035_0360771 | Ga0501035_0360771_29_841 | 270 |
| 712 | 3300049823 | Ga0501044_0175955 | Ga0501044_0175955_182_994 | 270 |
| 713 | 3300050512 | nmdc:mga0n895_37769_c1 | nmdc:mga0n895_37769_c1_3170_3982 | 270 |
| 714 | 3300050512 | nmdc:mga0n895_903937_c1 | nmdc:mga0n895_903937_c1_13_828 | 270 |
| 715 | 3300053077 | Ga0495601_0039255 | Ga0495601_0039255_768_1580 | 270 |
| 716 | 3300053078 | Ga0495612_0023041 | Ga0495612_0023041_917_1729 | 270 |
| 717 | 3300053084 | Ga0495595_0005086 | Ga0495595_0005086_1003_1815 | 270 |
| 718 | 3300053085 | Ga0495619_0044421 | Ga0495619_0044421_1337_2149 | 270 |
| 719 | 3300053134 | Ga0500658_0076030 | Ga0500658_0076030_25_840 | 270 |
| 720 | 3300053142 | Ga0500577_0039019 | Ga0500577_0039019_420_1235 | 270 |
| 721 | 2209111006 | 2214544950 | 2213593747 | 271 |
| 722 | 3300000042 | ARSoilYngRDRAFT_c00466 | ARSoilYngRDRAFT_004663 | 271 |
| 723 | 3300000043 | ARcpr5yngRDRAFT_c000049 | ARcpr5yngRDRAFT_0000495 | 271 |
| 724 | 3300000044 | ARSoilOldRDRAFT_c000098 | ARSoilOldRDRAFT_00009814 | 271 |
| 725 | 3300000045 | ARCol0oldRDRAFT_c02080 | ARCol0oldRDRAFT_020801 | 271 |
| 726 | 3300000652 | ARCol0yngRDRAFT_1000072 | ARCol0yngRDRAFT_10000725 | 271 |
| 727 | 3300001977 | JGI24746J21847_1000258 | JGI24746J21847_10002582 | 271 |
| 728 | 3300001978 | JGI24747J21853_1000085 | JGI24747J21853_10000854 | 271 |
| 729 | 3300001989 | JGI24739J22299_10001196 | JGI24739J22299_100011963 | 271 |
| 730 | 3300001990 | JGI24737J22298_10029747 | JGI24737J22298_100297472 | 271 |
| 731 | 3300002070 | JGI24750J21931_1000008 | JGI24750J21931_100000816 | 271 |
| 732 | 3300002073 | JGI24745J21846_1002238 | JGI24745J21846_10022382 | 271 |
| 733 | 3300002074 | JGI24748J21848_1000236 | JGI24748J21848_10002363 | 271 |
| 734 | 3300002075 | JGI24738J21930_10006575 | JGI24738J21930_100065753 | 271 |
| 735 | 3300002076 | JGI24749J21850_1000740 | JGI24749J21850_10007403 | 271 |
| 736 | 3300002077 | JGI24744J21845_10001834 | JGI24744J21845_100018343 | 271 |
| 737 | 3300002126 | JGI24035J26624_1000177 | JGI24035J26624_10001775 | 271 |
| 738 | 3300005288 | Ga0065714_10173446 | Ga0065714_101734461 | 271 |
| 739 | 3300005290 | Ga0065712_10068786 | Ga0065712_100687862 | 271 |
| 740 | 3300005293 | Ga0065715_10093830 | Ga0065715_100938303 | 271 |
| 741 | 3300005293 | Ga0065715_10141948 | Ga0065715_101419483 | 271 |
| 742 | 3300005328 | Ga0070676_10000092 | Ga0070676_100000928 | 271 |
| 743 | 3300005329 | Ga0070683_100000314 | Ga0070683_10000031426 | 271 |
| 744 | 3300005330 | Ga0070690_100001103 | Ga0070690_1000011033 | 271 |
| 745 | 3300005330 | Ga0070690_100203901 | Ga0070690_1002039012 | 271 |
| 746 | 3300005331 | Ga0070670_100008919 | Ga0070670_1000089195 | 271 |
| 747 | 3300005331 | Ga0070670_100101237 | Ga0070670_1001012373 | 271 |
| 748 | 3300005333 | Ga0070677_10003218 | Ga0070677_100032183 | 271 |
| 749 | 3300005334 | Ga0068869_100454969 | Ga0068869_1004549692 | 271 |
| 750 | 3300005336 | Ga0070680_100000515 | Ga0070680_10000051516 | 271 |
| 751 | 3300005336 | Ga0070680_100035627 | Ga0070680_1000356273 | 271 |
| 752 | 3300005337 | Ga0070682_100000230 | Ga0070682_10000023021 | 271 |
| 753 | 3300005337 | Ga0070682_100099062 | Ga0070682_1000990622 | 271 |
| 754 | 3300005337 | Ga0070682_100143625 | Ga0070682_1001436251 | 271 |
| 755 | 3300005338 | Ga0068868_100002107 | Ga0068868_1000021073 | 271 |
| 756 | 3300005339 | Ga0070660_100000175 | Ga0070660_10000017538 | 271 |
| 757 | 3300005339 | Ga0070660_100019108 | Ga0070660_1000191082 | 271 |
| 758 | 3300005340 | Ga0070689_100000145 | Ga0070689_10000014516 | 271 |
| 759 | 3300005340 | Ga0070689_100080944 | Ga0070689_1000809443 | 271 |
| 760 | 3300005341 | Ga0070691_10000107 | Ga0070691_100001078 | 271 |
| 761 | 3300005341 | Ga0070691_10075822 | Ga0070691_100758221 | 271 |
| 762 | 3300005343 | Ga0070687_100001052 | Ga0070687_1000010529 | 271 |
| 763 | 3300005343 | Ga0070687_100030216 | Ga0070687_1000302163 | 271 |
| 764 | 3300005344 | Ga0070661_100000808 | Ga0070661_10000080821 | 271 |
| 765 | 3300005345 | Ga0070692_10009324 | Ga0070692_100093243 | 271 |
| 766 | 3300005345 | Ga0070692_10045229 | Ga0070692_100452293 | 271 |
| 767 | 3300005347 | Ga0070668_100001569 | Ga0070668_1000015694 | 271 |
| 768 | 3300005347 | Ga0070668_100167382 | Ga0070668_1001673822 | 271 |
| 769 | 3300005353 | Ga0070669_100000343 | Ga0070669_10000034321 | 271 |
| 770 | 3300005354 | Ga0070675_100000210 | Ga0070675_10000021021 | 271 |
| 771 | 3300005354 | Ga0070675_100159380 | Ga0070675_1001593802 | 271 |
| 772 | 3300005355 | Ga0070671_100000396 | Ga0070671_10000039618 | 271 |
| 773 | 3300005355 | Ga0070671_100056913 | Ga0070671_1000569133 | 271 |
| 774 | 3300005364 | Ga0070673_100000130 | Ga0070673_10000013022 | 271 |
| 775 | 3300005365 | Ga0070688_100003254 | Ga0070688_1000032542 | 271 |
| 776 | 3300005365 | Ga0070688_100006796 | Ga0070688_1000067962 | 271 |
| 777 | 3300005366 | Ga0070659_100000629 | Ga0070659_10000062922 | 271 |
| 778 | 3300005366 | Ga0070659_100166411 | Ga0070659_1001664112 | 271 |
| 779 | 3300005367 | Ga0070667_100002803 | Ga0070667_10000280313 | 271 |
| 780 | 3300005367 | Ga0070667_100147596 | Ga0070667_1001475963 | 271 |
| 781 | 3300005367 | Ga0070667_100340924 | Ga0070667_1003409242 | 271 |
| 782 | 3300005406 | Ga0070703_10005788 | Ga0070703_100057882 | 271 |
| 783 | 3300005436 | Ga0070713_100024266 | Ga0070713_1000242663 | 271 |
| 784 | 3300005438 | Ga0070701_10000012 | Ga0070701_1000001221 | 271 |
| 785 | 3300005438 | Ga0070701_10132282 | Ga0070701_101322822 | 271 |
| 786 | 3300005439 | Ga0070711_100075213 | Ga0070711_1000752133 | 271 |
| 787 | 3300005439 | Ga0070711_100077576 | Ga0070711_1000775762 | 271 |
| 788 | 3300005440 | Ga0070705_100000341 | Ga0070705_1000003418 | 271 |
| 789 | 3300005440 | Ga0070705_100213571 | Ga0070705_1002135712 | 271 |
| 790 | 3300005441 | Ga0070700_100001073 | Ga0070700_10000107311 | 271 |
| 791 | 3300005441 | Ga0070700_100001658 | Ga0070700_1000016584 | 271 |
| 792 | 3300005444 | Ga0070694_100003223 | Ga0070694_1000032234 | 271 |
| 793 | 3300005444 | Ga0070694_100025320 | Ga0070694_1000253202 | 271 |
| 794 | 3300005455 | Ga0070663_100000097 | Ga0070663_10000009721 | 271 |
| 795 | 3300005455 | Ga0070663_100026755 | Ga0070663_1000267552 | 271 |
| 796 | 3300005456 | Ga0070678_100000315 | Ga0070678_10000031517 | 271 |
| 797 | 3300005457 | Ga0070662_100000336 | Ga0070662_10000033611 | 271 |
| 798 | 3300005457 | Ga0070662_100263407 | Ga0070662_1002634072 | 271 |
| 799 | 3300005458 | Ga0070681_10005380 | Ga0070681_100053808 | 271 |
| 800 | 3300005458 | Ga0070681_10008239 | Ga0070681_100082398 | 271 |
| 801 | 3300005458 | Ga0070681_10111438 | Ga0070681_101114382 | 271 |
| 802 | 3300005458 | Ga0070681_10213609 | Ga0070681_102136092 | 271 |
| 803 | 3300005458 | Ga0070681_10214148 | Ga0070681_102141482 | 271 |
| 804 | 3300005458 | Ga0070681_10349940 | Ga0070681_103499401 | 271 |
| 805 | 3300005459 | Ga0068867_100000731 | Ga0068867_1000007312 | 271 |
| 806 | 3300005459 | Ga0068867_100348852 | Ga0068867_1003488522 | 271 |
| 807 | 3300005466 | Ga0070685_10009628 | Ga0070685_100096284 | 271 |
| 808 | 3300005530 | Ga0070679_100013447 | Ga0070679_1000134476 | 271 |
| 809 | 3300005530 | Ga0070679_100041270 | Ga0070679_1000412703 | 271 |
| 810 | 3300005530 | Ga0070679_100623633 | Ga0070679_1006236331 | 271 |
| 811 | 3300005535 | Ga0070684_100000157 | Ga0070684_10000015718 | 271 |
| 812 | 3300005535 | Ga0070684_100045060 | Ga0070684_1000450604 | 271 |
| 813 | 3300005539 | Ga0068853_100000843 | Ga0068853_10000084318 | 271 |
| 814 | 3300005543 | Ga0070672_100012387 | Ga0070672_1000123872 | 271 |
| 815 | 3300005544 | Ga0070686_100000127 | Ga0070686_10000012726 | 271 |
| 816 | 3300005545 | Ga0070695_100000496 | Ga0070695_1000004964 | 271 |
| 817 | 3300005545 | Ga0070695_100262472 | Ga0070695_1002624722 | 271 |
| 818 | 3300005546 | Ga0070696_100000219 | Ga0070696_1000002198 | 271 |
| 819 | 3300005546 | Ga0070696_100034495 | Ga0070696_1000344954 | 271 |
| 820 | 3300005546 | Ga0070696_100184382 | Ga0070696_1001843822 | 271 |
| 821 | 3300005547 | Ga0070693_100000414 | Ga0070693_10000041414 | 271 |
| 822 | 3300005549 | Ga0070704_100001560 | Ga0070704_1000015603 | 271 |
| 823 | 3300005549 | Ga0070704_100072507 | Ga0070704_1000725073 | 271 |
| 824 | 3300005563 | Ga0068855_100032556 | Ga0068855_1000325564 | 271 |
| 825 | 3300005564 | Ga0070664_100000326 | Ga0070664_10000032620 | 271 |
| 826 | 3300005564 | Ga0070664_100082783 | Ga0070664_1000827833 | 271 |
| 827 | 3300005577 | Ga0068857_100000063 | Ga0068857_10000006320 | 271 |
| 828 | 3300005578 | Ga0068854_100000220 | Ga0068854_10000022021 | 271 |
| 829 | 3300005614 | Ga0068856_100000815 | Ga0068856_10000081516 | 271 |
| 830 | 3300005615 | Ga0070702_100000350 | Ga0070702_1000003503 | 271 |
| 831 | 3300005616 | Ga0068852_100001377 | Ga0068852_1000013774 | 271 |
| 832 | 3300005616 | Ga0068852_100462036 | Ga0068852_1004620362 | 271 |
| 833 | 3300005617 | Ga0068859_100037236 | Ga0068859_1000372365 | 271 |
| 834 | 3300005617 | Ga0068859_100154924 | Ga0068859_1001549242 | 271 |
| 835 | 3300005617 | Ga0068859_100361366 | Ga0068859_1003613661 | 271 |
| 836 | 3300005618 | Ga0068864_100000380 | Ga0068864_10000038014 | 271 |
| 837 | 3300005618 | Ga0068864_100286937 | Ga0068864_1002869372 | 271 |
| 838 | 3300005718 | Ga0068866_10000193 | Ga0068866_1000019319 | 271 |
| 839 | 3300005719 | Ga0068861_100000101 | Ga0068861_10000010123 | 271 |
| 840 | 3300005840 | Ga0068870_10000028 | Ga0068870_1000002827 | 271 |
| 841 | 3300005841 | Ga0068863_100000386 | Ga0068863_10000038626 | 271 |
| 842 | 3300005841 | Ga0068863_100636989 | Ga0068863_1006369892 | 271 |
| 843 | 3300005842 | Ga0068858_100038594 | Ga0068858_1000385944 | 271 |
| 844 | 3300005842 | Ga0068858_100448796 | Ga0068858_1004487961 | 271 |
| 845 | 3300005843 | Ga0068860_100063913 | Ga0068860_1000639133 | 271 |
| 846 | 3300005844 | Ga0068862_100000950 | Ga0068862_10000095025 | 271 |
| 847 | 3300006042 | Ga0075368_10045594 | Ga0075368_100455943 | 271 |
| 848 | 3300006163 | Ga0070715_10023073 | Ga0070715_100230733 | 271 |
| 849 | 3300006175 | Ga0070712_100082678 | Ga0070712_1000826782 | 271 |
| 850 | 3300006194 | Ga0075427_10029777 | Ga0075427_100297771 | 271 |
| 851 | 3300006237 | Ga0097621_100000268 | Ga0097621_1000002685 | 271 |
| 852 | 3300006237 | Ga0097621_100053732 | Ga0097621_1000537323 | 271 |
| 853 | 3300006353 | Ga0075370_10030448 | Ga0075370_100304482 | 271 |
| 854 | 3300006358 | Ga0068871_100000298 | Ga0068871_10000029819 | 271 |
| 855 | 3300006358 | Ga0068871_100080645 | Ga0068871_1000806451 | 271 |
| 856 | 3300006844 | Ga0075428_100164087 | Ga0075428_1001640872 | 271 |
| 857 | 3300006846 | Ga0075430_100010689 | Ga0075430_1000106894 | 271 |
| 858 | 3300006847 | Ga0075431_100006613 | Ga0075431_1000066134 | 271 |
| 859 | 3300006852 | Ga0075433_10006195 | Ga0075433_100061952 | 271 |
| 860 | 3300006852 | Ga0075433_10043077 | Ga0075433_100430773 | 271 |
| 861 | 3300006871 | Ga0075434_100027307 | Ga0075434_1000273073 | 271 |
| 862 | 3300006871 | Ga0075434_100254532 | Ga0075434_1002545322 | 271 |
| 863 | 3300006880 | Ga0075429_100018597 | Ga0075429_1000185972 | 271 |
| 864 | 3300006881 | Ga0068865_100000125 | Ga0068865_10000012521 | 271 |
| 865 | 3300006914 | Ga0075436_100472708 | Ga0075436_1004727081 | 271 |
| 866 | 3300006931 | Ga0097620_100037233 | Ga0097620_1000372335 | 271 |
| 867 | 3300006931 | Ga0097620_100154916 | Ga0097620_1001549163 | 271 |
| 868 | 3300006931 | Ga0097620_100361412 | Ga0097620_1003614121 | 271 |
| 869 | 3300007076 | Ga0075435_100049484 | Ga0075435_1000494843 | 271 |
| 870 | 3300007076 | Ga0075435_100584482 | Ga0075435_1005844822 | 271 |
| 871 | 3300009011 | Ga0105251_10060876 | Ga0105251_100608762 | 271 |
| 872 | 3300009092 | Ga0105250_10044875 | Ga0105250_100448752 | 271 |
| 873 | 3300009094 | Ga0111539_10000548 | Ga0111539_1000054830 | 271 |
| 874 | 3300009094 | Ga0111539_10000954 | Ga0111539_100009543 | 271 |
| 875 | 3300009094 | Ga0111539_10001271 | Ga0111539_100012715 | 271 |
| 876 | 3300009094 | Ga0111539_10208978 | Ga0111539_102089783 | 271 |
| 877 | 3300009098 | Ga0105245_10000173 | Ga0105245_1000017315 | 271 |
| 878 | 3300009098 | Ga0105245_10060380 | Ga0105245_100603802 | 271 |
| 879 | 3300009098 | Ga0105245_10565729 | Ga0105245_105657291 | 271 |
| 880 | 3300009101 | Ga0105247_10003197 | Ga0105247_100031978 | 271 |
| 881 | 3300009147 | Ga0114129_10165396 | Ga0114129_101653963 | 271 |
| 882 | 3300009148 | Ga0105243_10000377 | Ga0105243_1000037723 | 271 |
| 883 | 3300009148 | Ga0105243_10140394 | Ga0105243_101403942 | 271 |
| 884 | 3300009174 | Ga0105241_10003995 | Ga0105241_100039958 | 271 |
| 885 | 3300009174 | Ga0105241_10062924 | Ga0105241_100629242 | 271 |
| 886 | 3300009176 | Ga0105242_10000419 | Ga0105242_1000041912 | 271 |
| 887 | 3300009176 | Ga0105242_10054201 | Ga0105242_100542013 | 271 |
| 888 | 3300009176 | Ga0105242_10102030 | Ga0105242_101020302 | 271 |
| 889 | 3300009177 | Ga0105248_10000643 | Ga0105248_1000064326 | 271 |
| 890 | 3300009177 | Ga0105248_10068597 | Ga0105248_100685973 | 271 |
| 891 | 3300009545 | Ga0105237_10011622 | Ga0105237_100116224 | 271 |
| 892 | 3300009551 | Ga0105238_10067253 | Ga0105238_100672534 | 271 |
| 893 | 3300009551 | Ga0105238_10556288 | Ga0105238_105562882 | 271 |
| 894 | 3300009553 | Ga0105249_10003200 | Ga0105249_100032002 | 271 |
| 895 | 3300009553 | Ga0105249_10628843 | Ga0105249_106288431 | 271 |
| 896 | 3300010375 | Ga0105239_10248612 | Ga0105239_102486122 | 271 |
| 897 | 3300010375 | Ga0105239_10495638 | Ga0105239_104956382 | 271 |
| 898 | 3300011119 | Ga0105246_10002148 | Ga0105246_100021488 | 271 |
| 899 | 3300012481 | Ga0157320_1000682 | Ga0157320_10006823 | 271 |
| 900 | 3300012498 | Ga0157345_1002916 | Ga0157345_10029161 | 271 |
| 901 | 3300012515 | Ga0157338_1000069 | Ga0157338_10000693 | 271 |
| 902 | 3300013100 | Ga0157373_10077885 | Ga0157373_100778852 | 271 |
| 903 | 3300013100 | Ga0157373_10175604 | Ga0157373_101756042 | 271 |
| 904 | 3300013102 | Ga0157371_10037695 | Ga0157371_100376952 | 271 |
| 905 | 3300013105 | Ga0157369_10146548 | Ga0157369_101465482 | 271 |
| 906 | 3300013296 | Ga0157374_10004172 | Ga0157374_100041725 | 271 |
| 907 | 3300013297 | Ga0157378_10000993 | Ga0157378_1000099322 | 271 |
| 908 | 3300013297 | Ga0157378_10130755 | Ga0157378_101307553 | 271 |
| 909 | 3300013297 | Ga0157378_10232184 | Ga0157378_102321842 | 271 |
| 910 | 3300013306 | Ga0163162_10001671 | Ga0163162_1000167118 | 271 |
| 911 | 3300013307 | Ga0157372_10052105 | Ga0157372_100521053 | 271 |
| 912 | 3300013308 | Ga0157375_10000283 | Ga0157375_1000028319 | 271 |
| 913 | 3300014325 | Ga0163163_10000757 | Ga0163163_1000075719 | 271 |
| 914 | 3300014325 | Ga0163163_10016749 | Ga0163163_100167495 | 271 |
| 915 | 3300014326 | Ga0157380_10000095 | Ga0157380_1000009530 | 271 |
| 916 | 3300014745 | Ga0157377_10000295 | Ga0157377_1000029519 | 271 |
| 917 | 3300014968 | Ga0157379_10004769 | Ga0157379_100047693 | 271 |
| 918 | 3300014968 | Ga0157379_10009736 | Ga0157379_100097368 | 271 |
| 919 | 3300014968 | Ga0157379_10180199 | Ga0157379_101801993 | 271 |
| 920 | 3300014968 | Ga0157379_10267708 | Ga0157379_102677082 | 271 |
| 921 | 3300014969 | Ga0157376_10000634 | Ga0157376_1000063412 | 271 |
| 922 | 3300017792 | Ga0163161_10000542 | Ga0163161_100005425 | 271 |
| 923 | 3300025271 | Ga0207666_1000045 | Ga0207666_10000455 | 271 |
| 924 | 3300025271 | Ga0207666_1006280 | Ga0207666_10062801 | 271 |
| 925 | 3300025315 | Ga0207697_10000551 | Ga0207697_1000055120 | 271 |
| 926 | 3300025885 | Ga0207653_10002740 | Ga0207653_100027405 | 271 |
| 927 | 3300025893 | Ga0207682_10005256 | Ga0207682_100052564 | 271 |
| 928 | 3300025898 | Ga0207692_10009761 | Ga0207692_100097613 | 271 |
| 929 | 3300025899 | Ga0207642_10000259 | Ga0207642_1000025914 | 271 |
| 930 | 3300025900 | Ga0207710_10005879 | Ga0207710_100058795 | 271 |
| 931 | 3300025901 | Ga0207688_10000039 | Ga0207688_1000003920 | 271 |
| 932 | 3300025903 | Ga0207680_10013194 | Ga0207680_100131944 | 271 |
| 933 | 3300025904 | Ga0207647_10026190 | Ga0207647_100261903 | 271 |
| 934 | 3300025905 | Ga0207685_10005689 | Ga0207685_100056893 | 271 |
| 935 | 3300025907 | Ga0207645_10000080 | Ga0207645_1000008052 | 271 |
| 936 | 3300025908 | Ga0207643_10000135 | Ga0207643_1000013525 | 271 |
| 937 | 3300025911 | Ga0207654_10054733 | Ga0207654_100547333 | 271 |
| 938 | 3300025911 | Ga0207654_10126318 | Ga0207654_101263182 | 271 |
| 939 | 3300025911 | Ga0207654_10155953 | Ga0207654_101559531 | 271 |
| 940 | 3300025912 | Ga0207707_10004353 | Ga0207707_100043538 | 271 |
| 941 | 3300025912 | Ga0207707_10049919 | Ga0207707_100499192 | 271 |
| 942 | 3300025912 | Ga0207707_10189089 | Ga0207707_101890892 | 271 |
| 943 | 3300025914 | Ga0207671_10028827 | Ga0207671_100288274 | 271 |
| 944 | 3300025915 | Ga0207693_10006700 | Ga0207693_100067007 | 271 |
| 945 | 3300025916 | Ga0207663_10018450 | Ga0207663_100184503 | 271 |
| 946 | 3300025917 | Ga0207660_10002445 | Ga0207660_100024454 | 271 |
| 947 | 3300025917 | Ga0207660_10042093 | Ga0207660_100420932 | 271 |
| 948 | 3300025918 | Ga0207662_10000336 | Ga0207662_100003362 | 271 |
| 949 | 3300025918 | Ga0207662_10026989 | Ga0207662_100269894 | 271 |
| 950 | 3300025919 | Ga0207657_10002336 | Ga0207657_1000233619 | 271 |
| 951 | 3300025919 | Ga0207657_10084548 | Ga0207657_100845483 | 271 |
| 952 | 3300025919 | Ga0207657_10131101 | Ga0207657_101311013 | 271 |
| 953 | 3300025920 | Ga0207649_10000571 | Ga0207649_100005713 | 271 |
| 954 | 3300025921 | Ga0207652_10001096 | Ga0207652_100010968 | 271 |
| 955 | 3300025921 | Ga0207652_10028056 | Ga0207652_100280563 | 271 |
| 956 | 3300025921 | Ga0207652_10131671 | Ga0207652_101316712 | 271 |
| 957 | 3300025923 | Ga0207681_10001995 | Ga0207681_1000199511 | 271 |
| 958 | 3300025925 | Ga0207650_10002540 | Ga0207650_100025405 | 271 |
| 959 | 3300025926 | Ga0207659_10000127 | Ga0207659_1000012720 | 271 |
| 960 | 3300025927 | Ga0207687_10000334 | Ga0207687_100003348 | 271 |
| 961 | 3300025927 | Ga0207687_10137937 | Ga0207687_101379372 | 271 |
| 962 | 3300025929 | Ga0207664_10095660 | Ga0207664_100956603 | 271 |
| 963 | 3300025931 | Ga0207644_10002918 | Ga0207644_100029188 | 271 |
| 964 | 3300025931 | Ga0207644_10076800 | Ga0207644_100768002 | 271 |
| 965 | 3300025932 | Ga0207690_10000571 | Ga0207690_1000057119 | 271 |
| 966 | 3300025932 | Ga0207690_10272513 | Ga0207690_102725131 | 271 |
| 967 | 3300025933 | Ga0207706_10001765 | Ga0207706_1000176520 | 271 |
| 968 | 3300025933 | Ga0207706_10018247 | Ga0207706_100182475 | 271 |
| 969 | 3300025933 | Ga0207706_10392640 | Ga0207706_103926402 | 271 |
| 970 | 3300025934 | Ga0207686_10000297 | Ga0207686_1000029720 | 271 |
| 971 | 3300025934 | Ga0207686_10044357 | Ga0207686_100443572 | 271 |
| 972 | 3300025934 | Ga0207686_10060158 | Ga0207686_100601582 | 271 |
| 973 | 3300025935 | Ga0207709_10000257 | Ga0207709_1000025742 | 271 |
| 974 | 3300025935 | Ga0207709_10029892 | Ga0207709_100298923 | 271 |
| 975 | 3300025936 | Ga0207670_10000371 | Ga0207670_100003715 | 271 |
| 976 | 3300025936 | Ga0207670_10036616 | Ga0207670_100366162 | 271 |
| 977 | 3300025937 | Ga0207669_10000089 | Ga0207669_1000008922 | 271 |
| 978 | 3300025938 | Ga0207704_10002403 | Ga0207704_100024032 | 271 |
| 979 | 3300025940 | Ga0207691_10001737 | Ga0207691_100017372 | 271 |
| 980 | 3300025941 | Ga0207711_10007990 | Ga0207711_100079905 | 271 |
| 981 | 3300025941 | Ga0207711_10010452 | Ga0207711_100104525 | 271 |
| 982 | 3300025942 | Ga0207689_10000095 | Ga0207689_1000009523 | 271 |
| 983 | 3300025944 | Ga0207661_10001967 | Ga0207661_1000196712 | 271 |
| 984 | 3300025944 | Ga0207661_10250420 | Ga0207661_102504202 | 271 |
| 985 | 3300025945 | Ga0207679_10000073 | Ga0207679_1000007370 | 271 |
| 986 | 3300025945 | Ga0207679_10078649 | Ga0207679_100786493 | 271 |
| 987 | 3300025945 | Ga0207679_10318680 | Ga0207679_103186802 | 271 |
| 988 | 3300025949 | Ga0207667_10037097 | Ga0207667_100370974 | 271 |
| 989 | 3300025960 | Ga0207651_10002317 | Ga0207651_100023172 | 271 |
| 990 | 3300025961 | Ga0207712_10000457 | Ga0207712_1000045717 | 271 |
| 991 | 3300025961 | Ga0207712_10022855 | Ga0207712_100228552 | 271 |
| 992 | 3300025961 | Ga0207712_10231107 | Ga0207712_102311072 | 271 |
| 993 | 3300025972 | Ga0207668_10000900 | Ga0207668_100009002 | 271 |
| 994 | 3300025972 | Ga0207668_10007427 | Ga0207668_100074272 | 271 |
| 995 | 3300025986 | Ga0207658_10003961 | Ga0207658_100039613 | 271 |
| 996 | 3300025986 | Ga0207658_10427324 | Ga0207658_104273242 | 271 |
| 997 | 3300026023 | Ga0207677_10009295 | Ga0207677_100092952 | 271 |
| 998 | 3300026035 | Ga0207703_10002103 | Ga0207703_1000210317 | 271 |
| 999 | 3300026035 | Ga0207703_10050527 | Ga0207703_100505272 | 271 |
| 1000 | 3300026035 | Ga0207703_10239104 | Ga0207703_102391042 | 271 |
| 1001 | 3300026041 | Ga0207639_10021948 | Ga0207639_100219484 | 271 |
| 1002 | 3300026067 | Ga0207678_10000426 | Ga0207678_1000042617 | 271 |
| 1003 | 3300026067 | Ga0207678_10181207 | Ga0207678_101812072 | 271 |
| 1004 | 3300026075 | Ga0207708_10000991 | Ga0207708_1000099120 | 271 |
| 1005 | 3300026075 | Ga0207708_10081663 | Ga0207708_100816633 | 271 |
| 1006 | 3300026078 | Ga0207702_10054124 | Ga0207702_100541244 | 271 |
| 1007 | 3300026088 | Ga0207641_10001067 | Ga0207641_100010678 | 271 |
| 1008 | 3300026088 | Ga0207641_10525547 | Ga0207641_105255472 | 271 |
| 1009 | 3300026089 | Ga0207648_10000207 | Ga0207648_1000020734 | 271 |
| 1010 | 3300026095 | Ga0207676_10000875 | Ga0207676_1000087514 | 271 |
| 1011 | 3300026095 | Ga0207676_10061987 | Ga0207676_100619872 | 271 |
| 1012 | 3300026116 | Ga0207674_10001021 | Ga0207674_100010212 | 271 |
| 1013 | 3300026118 | Ga0207675_100001849 | Ga0207675_1000018492 | 271 |
| 1014 | 3300026118 | Ga0207675_100074493 | Ga0207675_1000744934 | 271 |
| 1015 | 3300026121 | Ga0207683_10000096 | Ga0207683_1000009645 | 271 |
| 1016 | 3300026142 | Ga0207698_10000956 | Ga0207698_100009564 | 271 |
| 1017 | 3300027424 | Ga0209984_1005880 | Ga0209984_10058802 | 271 |
| 1018 | 3300027617 | Ga0210002_1000525 | Ga0210002_10005252 | 271 |
| 1019 | 3300027682 | Ga0209971_1024519 | Ga0209971_10245192 | 271 |
| 1020 | 3300027695 | Ga0209966_1021922 | Ga0209966_10219221 | 271 |
| 1021 | 3300027717 | Ga0209998_10000428 | Ga0209998_100004289 | 271 |
| 1022 | 3300027717 | Ga0209998_10006934 | Ga0209998_100069342 | 271 |
| 1023 | 3300027866 | Ga0209813_10024258 | Ga0209813_100242583 | 271 |
| 1024 | 3300027876 | Ga0209974_10009241 | Ga0209974_100092412 | 271 |
| 1025 | 3300027907 | Ga0207428_10000160 | Ga0207428_1000016041 | 271 |
| 1026 | 3300027907 | Ga0207428_10000200 | Ga0207428_1000020073 | 271 |
| 1027 | 3300027907 | Ga0207428_10000370 | Ga0207428_1000037047 | 271 |
| 1028 | 3300028380 | Ga0268265_10001781 | Ga0268265_100017812 | 271 |
| 1029 | 3300028381 | Ga0268264_10053121 | Ga0268264_100531214 | 271 |
| 1030 | 3300028381 | Ga0268264_10118074 | Ga0268264_101180743 | 271 |
| 1031 | 3300028381 | Ga0268264_10378008 | Ga0268264_103780082 | 271 |
| 1032 | 3300031241 | Ga0265325_10000004 | Ga0265325_10000004205 | 271 |
| 1033 | 3300031595 | Ga0265313_10033885 | Ga0265313_100338853 | 271 |
| 1034 | 3300034816 | Ga0373930_0001208 | Ga0373930_0001208_155_970 | 271 |
| 1035 | 3300034817 | Ga0373948_0000334 | Ga0373948_0000334_71_886 | 271 |
| 1036 | 3300034818 | Ga0373950_0013126 | Ga0373950_0013126_191_1006 | 271 |
| 1037 | 3300034819 | Ga0373958_0000505 | Ga0373958_0000505_2362_3177 | 271 |
| 1038 | 3300034957 | Ga0373938_0000033 | Ga0373938_0000033_16007_16822 | 271 |
| 1039 | 3300034957 | Ga0373938_0002272 | Ga0373938_0002272_1594_2409 | 271 |
| 1040 | 3300035083 | Ga0373926_0002095 | Ga0373926_0002095_2419_3234 | 271 |
| 1041 | 3300035084 | Ga0373928_0000751 | Ga0373928_0000751_4031_4846 | 271 |
| 1042 | 3300035084 | Ga0373928_0002785 | Ga0373928_0002785_686_1501 | 271 |
| 1043 | 3300035088 | Ga0373940_0002344 | Ga0373940_0002344_775_1590 | 271 |
| 1044 | 3300035089 | Ga0373944_0000846 | Ga0373944_0000846_4416_5231 | 271 |
| 1045 | 3300035090 | Ga0373949_0002920 | Ga0373949_0002920_2799_3614 | 271 |
| 1046 | 3300035091 | Ga0373951_0000151 | Ga0373951_0000151_23563_24378 | 271 |
| 1047 | 3300035091 | Ga0373951_0001138 | Ga0373951_0001138_140_955 | 271 |
| 1048 | 3300035091 | Ga0373951_0011387 | Ga0373951_0011387_1020_1835 | 271 |
| 1049 | 3300035092 | Ga0373952_0002453 | Ga0373952_0002453_2124_2939 | 271 |
| 1050 | 3300035092 | Ga0373952_0006520 | Ga0373952_0006520_597_1412 | 271 |
| 1051 | 3300035111 | Ga0373923_0000300 | Ga0373923_0000300_4242_5057 | 271 |
| 1052 | 3300035112 | Ga0373932_0003086 | Ga0373932_0003086_132_947 | 271 |
| 1053 | 3300035112 | Ga0373932_0003580 | Ga0373932_0003580_1456_2271 | 271 |
| 1054 | 3300035112 | Ga0373932_0005273 | Ga0373932_0005273_1382_2197 | 271 |
| 1055 | 3300035113 | Ga0373936_0009185 | Ga0373936_0009185_431_1246 | 271 |
| 1056 | 3300035114 | Ga0373939_0001391 | Ga0373939_0001391_2924_3739 | 271 |
| 1057 | 3300035114 | Ga0373939_0009034 | Ga0373939_0009034_151_966 | 271 |
| 1058 | 3300035114 | Ga0373939_0102342 | Ga0373939_0102342_128_943 | 271 |
| 1059 | 3300035116 | Ga0373945_0000782 | Ga0373945_0000782_2088_2903 | 271 |
| 1060 | 3300035119 | Ga0373956_0022189 | Ga0373956_0022189_95_910 | 271 |
| 1061 | 3300035119 | Ga0373956_0144849 | Ga0373956_0144849_201_1016 | 271 |
| 1062 | 3300035121 | Ga0373960_0000463 | Ga0373960_0000463_5041_5856 | 271 |
| 1063 | 3300035121 | Ga0373960_0002285 | Ga0373960_0002285_3229_4044 | 271 |
| 1064 | 3300035121 | Ga0373960_0031850 | Ga0373960_0031850_28_843 | 271 |
| 1065 | 3300035170 | Ga0373943_0004590 | Ga0373943_0004590_3792_4607 | 271 |
| 1066 | 3300035170 | Ga0373943_0162283 | Ga0373943_0162283_271_1086 | 271 |
| 1067 | 3300035171 | Ga0373946_0000328 | Ga0373946_0000328_11681_12496 | 271 |
| 1068 | 3300035171 | Ga0373946_0011843 | Ga0373946_0011843_893_1708 | 271 |
| 1069 | 3300035172 | Ga0373955_0015379 | Ga0373955_0015379_2794_3609 | 271 |
| 1070 | 3300035207 | Ga0373942_0001015 | Ga0373942_0001015_986_1801 | 271 |
| 1071 | 3300035207 | Ga0373942_0017453 | Ga0373942_0017453_167_982 | 271 |
| 1072 | 3300035207 | Ga0373942_0032081 | Ga0373942_0032081_363_1178 | 271 |
| 1073 | 3300035241 | Ga0373961_0000507 | Ga0373961_0000507_1954_2769 | 271 |
| 1074 | 3300035241 | Ga0373961_0005656 | Ga0373961_0005656_931_1746 | 271 |
| 1075 | 3300035241 | Ga0373961_0007487 | Ga0373961_0007487_496_1311 | 271 |
| 1076 | 3300035242 | Ga0373962_0005038 | Ga0373962_0005038_2325_3140 | 271 |
| 1077 | 3300035242 | Ga0373962_0006073 | Ga0373962_0006073_1419_2243 | 271 |
| 1078 | 3300035242 | Ga0373962_0007889 | Ga0373962_0007889_762_1577 | 271 |
| 1079 | 3300035691 | Ga0373931_0009310 | Ga0373931_0009310_537_1352 | 271 |
| 1080 | 3300035691 | Ga0373931_0011436 | Ga0373931_0011436_2136_2951 | 271 |
| 1081 | 3300035691 | Ga0373931_0031193 | Ga0373931_0031193_1421_2236 | 271 |
| 1082 | 3300035691 | Ga0373931_0219482 | Ga0373931_0219482_255_1070 | 271 |
| 1083 | 3300035691 | Ga0373931_0365313 | Ga0373931_0365313_24_839 | 271 |
| 1084 | 3300035692 | Ga0373935_0002426 | Ga0373935_0002426_7120_7935 | 271 |
| 1085 | 3300035692 | Ga0373935_0013222 | Ga0373935_0013222_3442_4257 | 271 |
| 1086 | 3300035692 | Ga0373935_0054097 | Ga0373935_0054097_1171_1986 | 271 |
| 1087 | 3300035692 | Ga0373935_0302577 | Ga0373935_0302577_64_879 | 271 |
| 1088 | 3300035695 | Ga0373927_0014805 | Ga0373927_0014805_1440_2255 | 271 |
| 1089 | 3300035695 | Ga0373927_0030360 | Ga0373927_0030360_2280_3095 | 271 |
| 1090 | 3300035724 | Ga0373933_0003172 | Ga0373933_0003172_5392_6207 | 271 |
| 1091 | 3300035725 | Ga0373947_0008877 | Ga0373947_0008877_2927_3742 | 271 |
| 1092 | 3300035725 | Ga0373947_0011163 | Ga0373947_0011163_1440_2255 | 271 |
| 1093 | 3300036401 | Ga0373937_0001621 | Ga0373937_0001621_4086_4901 | 271 |
| 1094 | 3300036401 | Ga0373937_0008258 | Ga0373937_0008258_4135_4950 | 271 |
| 1095 | 3300037068 | Ga0373925_0021865 | Ga0373925_0021865_1312_2127 | 271 |
| 1096 | 3300037068 | Ga0373925_0433040 | Ga0373925_0433040_76_891 | 271 |
| 1097 | 3300042005 | Ga0439448_0009871 | Ga0439448_0009871_1231_2046 | 271 |
| 1098 | 3300044712 | Ga0453684_0543985 | Ga0453684_0543985_438_1253 | 271 |
| 1099 | 3300045051 | Ga0451576_0003863 | Ga0451576_0003863_15256_16071 | 271 |
| 1100 | 3300045051 | Ga0451576_0644855 | Ga0451576_0644855_57_872 | 271 |
| 1101 | 3300046454 | Ga0495592_0001602 | Ga0495592_0001602_12596_13411 | 271 |
| 1102 | 3300046454 | Ga0495592_0145967 | Ga0495592_0145967_666_1481 | 271 |
| 1103 | 3300046455 | Ga0495603_0017210 | Ga0495603_0017210_2894_3709 | 271 |
| 1104 | 3300046455 | Ga0495603_0029474 | Ga0495603_0029474_132_947 | 271 |
| 1105 | 3300046455 | Ga0495603_0077764 | Ga0495603_0077764_1034_1849 | 271 |
| 1106 | 3300046459 | Ga0495629_0000107 | Ga0495629_0000107_24866_25681 | 271 |
| 1107 | 3300046459 | Ga0495629_0052427 | Ga0495629_0052427_1969_2784 | 271 |
| 1108 | 3300046459 | Ga0495629_0057506 | Ga0495629_0057506_689_1504 | 271 |
| 1109 | 3300046461 | Ga0495641_0005661 | Ga0495641_0005661_3979_4794 | 271 |
| 1110 | 3300046462 | Ga0495651_0000529 | Ga0495651_0000529_24901_25716 | 271 |
| 1111 | 3300046462 | Ga0495651_0013471 | Ga0495651_0013471_1012_1827 | 271 |
| 1112 | 3300046463 | Ga0495653_0005220 | Ga0495653_0005220_3820_4635 | 271 |
| 1113 | 3300046463 | Ga0495653_0183181 | Ga0495653_0183181_175_990 | 271 |
| 1114 | 3300046472 | Ga0495580_0001533 | Ga0495580_0001533_6164_6979 | 271 |
| 1115 | 3300046473 | Ga0495582_0001909 | Ga0495582_0001909_5948_6763 | 271 |
| 1116 | 3300046473 | Ga0495582_0010007 | Ga0495582_0010007_2221_3036 | 271 |
| 1117 | 3300046473 | Ga0495582_0024470 | Ga0495582_0024470_2290_3105 | 271 |
| 1118 | 3300046475 | Ga0495639_0016223 | Ga0495639_0016223_978_1793 | 271 |
| 1119 | 3300046476 | Ga0495662_0000621 | Ga0495662_0000621_1634_2449 | 271 |
| 1120 | 3300046477 | Ga0495664_0008486 | Ga0495664_0008486_4846_5661 | 271 |
| 1121 | 3300046477 | Ga0495664_0068309 | Ga0495664_0068309_352_1167 | 271 |
| 1122 | 3300046492 | Ga0495585_0082270 | Ga0495585_0082270_859_1674 | 271 |
| 1123 | 3300046499 | Ga0495594_0003322 | Ga0495594_0003322_3544_4359 | 271 |
| 1124 | 3300046501 | Ga0495607_0043916 | Ga0495607_0043916_884_1699 | 271 |
| 1125 | 3300046511 | Ga0495608_0002492 | Ga0495608_0002492_8185_9000 | 271 |
| 1126 | 3300046514 | Ga0495618_0075618 | Ga0495618_0075618_885_1700 | 271 |
| 1127 | 3300046514 | Ga0495618_0111633 | Ga0495618_0111633_865_1680 | 271 |
| 1128 | 3300046516 | Ga0495628_0003426 | Ga0495628_0003426_4850_5665 | 271 |
| 1129 | 3300046517 | Ga0495630_0022078 | Ga0495630_0022078_3817_4632 | 271 |
| 1130 | 3300046517 | Ga0495630_0192170 | Ga0495630_0192170_445_1260 | 271 |
| 1131 | 3300046526 | Ga0495666_0000591 | Ga0495666_0000591_5517_6332 | 271 |
| 1132 | 3300046526 | Ga0495666_0068946 | Ga0495666_0068946_655_1470 | 271 |
| 1133 | 3300046529 | Ga0495652_0002788 | Ga0495652_0002788_12741_13556 | 271 |
| 1134 | 3300046529 | Ga0495652_0018534 | Ga0495652_0018534_896_1711 | 271 |
| 1135 | 3300046531 | Ga0495665_0000336 | Ga0495665_0000336_20856_21671 | 271 |
| 1136 | 3300046531 | Ga0495665_0023457 | Ga0495665_0023457_2098_2913 | 271 |
| 1137 | 3300046535 | Ga0495586_0003307 | Ga0495586_0003307_6332_7147 | 271 |
| 1138 | 3300046536 | Ga0495587_0008854 | Ga0495587_0008854_2959_3774 | 271 |
| 1139 | 3300046538 | Ga0495609_0036676 | Ga0495609_0036676_1239_2054 | 271 |
| 1140 | 3300046558 | Ga0495633_0008197 | Ga0495633_0008197_4640_5455 | 271 |
| 1141 | 3300046559 | Ga0495667_0002448 | Ga0495667_0002448_3578_4393 | 271 |
| 1142 | 3300046559 | Ga0495667_0008390 | Ga0495667_0008390_1794_2609 | 271 |
| 1143 | 3300046642 | Ga0495634_0043559 | Ga0495634_0043559_1506_2321 | 271 |
| 1144 | 3300046642 | Ga0495634_0079556 | Ga0495634_0079556_995_1810 | 271 |
| 1145 | 3300046663 | Ga0495635_0008814 | Ga0495635_0008814_6158_6973 | 271 |
| 1146 | 3300046674 | Ga0495588_0004745 | Ga0495588_0004745_4089_4904 | 271 |
| 1147 | 3300046674 | Ga0495588_0089477 | Ga0495588_0089477_774_1589 | 271 |
| 1148 | 3300046674 | Ga0495588_0175684 | Ga0495588_0175684_233_1048 | 271 |
| 1149 | 3300046675 | Ga0495657_0028524 | Ga0495657_0028524_990_1805 | 271 |
| 1150 | 3300046678 | Ga0495599_0017767 | Ga0495599_0017767_1555_2370 | 271 |
| 1151 | 3300046679 | Ga0495623_0028747 | Ga0495623_0028747_2032_2847 | 271 |
| 1152 | 3300046680 | Ga0495646_0005225 | Ga0495646_0005225_4077_4892 | 271 |
| 1153 | 3300046681 | Ga0495647_0000542 | Ga0495647_0000542_6449_7264 | 271 |
| 1154 | 3300046683 | Ga0495658_0016142 | Ga0495658_0016142_978_1793 | 271 |
| 1155 | 3300046689 | Ga0495613_0008263 | Ga0495613_0008263_978_1793 | 271 |
| 1156 | 3300046689 | Ga0495613_0022253 | Ga0495613_0022253_3225_4040 | 271 |
| 1157 | 3300046690 | Ga0495624_0004828 | Ga0495624_0004828_5679_6494 | 271 |
| 1158 | 3300046691 | Ga0495670_0013865 | Ga0495670_0013865_403_1218 | 271 |
| 1159 | 3300046809 | Ga0495600_0060771 | Ga0495600_0060771_719_1534 | 271 |
| 1160 | 3300047315 | Ga0495581_0003207 | Ga0495581_0003207_5010_5825 | 271 |
| 1161 | 3300047315 | Ga0495581_0036271 | Ga0495581_0036271_156_971 | 271 |
| 1162 | 3300047317 | Ga0495604_0078768 | Ga0495604_0078768_24_839 | 271 |
| 1163 | 3300047319 | Ga0495674_0024317 | Ga0495674_0024317_1722_2537 | 271 |
| 1164 | 3300047319 | Ga0495674_0041625 | Ga0495674_0041625_2030_2845 | 271 |
| 1165 | 3300047321 | Ga0495676_0025024 | Ga0495676_0025024_3031_3846 | 271 |
| 1166 | 3300047321 | Ga0495676_0111577 | Ga0495676_0111577_11_826 | 271 |
| 1167 | 3300047322 | Ga0495680_0008529 | Ga0495680_0008529_5380_6195 | 271 |
| 1168 | 3300047322 | Ga0495680_0011911 | Ga0495680_0011911_393_1208 | 271 |
| 1169 | 3300047322 | Ga0495680_0014012 | Ga0495680_0014012_5722_6537 | 271 |
| 1170 | 3300047444 | Ga0495675_0010919 | Ga0495675_0010919_3534_4349 | 271 |
| 1171 | 3300047471 | Ga0495684_0148983 | Ga0495684_0148983_71_886 | 271 |
| 1172 | 3300047673 | Ga0495593_0002782 | Ga0495593_0002782_8372_9187 | 271 |
| 1173 | 3300048088 | Ga0495602_0027982 | Ga0495602_0027982_138_953 | 271 |
| 1174 | 3300048089 | Ga0495614_0011159 | Ga0495614_0011159_1871_2686 | 271 |
| 1175 | 3300048903 | Ga0496100_0000272 | Ga0496100_0000272_22642_23457 | 271 |
| 1176 | 3300048903 | Ga0496100_0032975 | Ga0496100_0032975_1563_2378 | 271 |
| 1177 | 3300048905 | Ga0496102_0048118 | Ga0496102_0048118_1439_2254 | 271 |
| 1178 | 3300048905 | Ga0496102_0202442 | Ga0496102_0202442_910_1725 | 271 |
| 1179 | 3300048905 | Ga0496102_0361567 | Ga0496102_0361567_424_1239 | 271 |
| 1180 | 3300048905 | Ga0496102_0402787 | Ga0496102_0402787_41_856 | 271 |
| 1181 | 3300048906 | Ga0496103_0009753 | Ga0496103_0009753_1228_2043 | 271 |
| 1182 | 3300048906 | Ga0496103_0063499 | Ga0496103_0063499_763_1578 | 271 |
| 1183 | 3300048906 | Ga0496103_0142376 | Ga0496103_0142376_393_1208 | 271 |
| 1184 | 3300048906 | Ga0496103_0147094 | Ga0496103_0147094_208_1023 | 271 |
| 1185 | 3300048907 | Ga0496104_0000515 | Ga0496104_0000515_6570_7385 | 271 |
| 1186 | 3300048907 | Ga0496104_0029600 | Ga0496104_0029600_2575_3390 | 271 |
| 1187 | 3300048907 | Ga0496104_0144938 | Ga0496104_0144938_292_1107 | 271 |
| 1188 | 3300048907 | Ga0496104_0210946 | Ga0496104_0210946_472_1287 | 271 |
| 1189 | 3300048908 | Ga0496105_0000405 | Ga0496105_0000405_18552_19367 | 271 |
| 1190 | 3300048908 | Ga0496105_0010305 | Ga0496105_0010305_4858_5673 | 271 |
| 1191 | 3300048908 | Ga0496105_0096029 | Ga0496105_0096029_144_959 | 271 |
| 1192 | 3300048908 | Ga0496105_0158797 | Ga0496105_0158797_567_1382 | 271 |
| 1193 | 3300048909 | Ga0496106_0007653 | Ga0496106_0007653_635_1450 | 271 |
| 1194 | 3300048909 | Ga0496106_0011101 | Ga0496106_0011101_844_1659 | 271 |
| 1195 | 3300048909 | Ga0496106_0079634 | Ga0496106_0079634_1587_2402 | 271 |
| 1196 | 3300048909 | Ga0496106_0087592 | Ga0496106_0087592_863_1678 | 271 |
| 1197 | 3300048910 | Ga0496107_0008620 | Ga0496107_0008620_3161_3976 | 271 |
| 1198 | 3300048911 | Ga0496108_0001488 | Ga0496108_0001488_17517_18332 | 271 |
| 1199 | 3300048911 | Ga0496108_0022041 | Ga0496108_0022041_2643_3458 | 271 |
| 1200 | 3300048911 | Ga0496108_0088713 | Ga0496108_0088713_870_1685 | 271 |
| 1201 | 3300048912 | Ga0496109_0001064 | Ga0496109_0001064_15826_16641 | 271 |
| 1202 | 3300048912 | Ga0496109_0001275 | Ga0496109_0001275_6774_7589 | 271 |
| 1203 | 3300048912 | Ga0496109_0032914 | Ga0496109_0032914_1003_1818 | 271 |
| 1204 | 3300048913 | Ga0496110_0041359 | Ga0496110_0041359_23_838 | 271 |
| 1205 | 3300048913 | Ga0496110_0045332 | Ga0496110_0045332_2082_2897 | 271 |
| 1206 | 3300048913 | Ga0496110_0254612 | Ga0496110_0254612_457_1272 | 271 |
| 1207 | 3300048913 | Ga0496110_0308259 | Ga0496110_0308259_308_1123 | 271 |
| 1208 | 3300048914 | Ga0496111_0011999 | Ga0496111_0011999_3282_4097 | 271 |
| 1209 | 3300048914 | Ga0496111_0191506 | Ga0496111_0191506_239_1054 | 271 |
| 1210 | 3300048915 | Ga0496112_0224410 | Ga0496112_0224410_567_1382 | 271 |
| 1211 | 3300048916 | Ga0496113_0001219 | Ga0496113_0001219_4129_4944 | 271 |
| 1212 | 3300048916 | Ga0496113_0117909 | Ga0496113_0117909_1069_1884 | 271 |
| 1213 | 3300048917 | Ga0496114_0004353 | Ga0496114_0004353_1027_1842 | 271 |
| 1214 | 3300048917 | Ga0496114_0144396 | Ga0496114_0144396_1157_1972 | 271 |
| 1215 | 3300048918 | Ga0496115_0000935 | Ga0496115_0000935_3582_4397 | 271 |
| 1216 | 3300048918 | Ga0496115_0003791 | Ga0496115_0003791_9536_10351 | 271 |
| 1217 | 3300048918 | Ga0496115_0042634 | Ga0496115_0042634_755_1570 | 271 |
| 1218 | 3300049586 | Ga0501070_0228809 | Ga0501070_0228809_679_1494 | 271 |
| 1219 | 3300049593 | Ga0501077_0024179 | Ga0501077_0024179_3004_3819 | 271 |
| 1220 | 3300049742 | Ga0501080_0080197 | Ga0501080_0080197_330_1145 | 271 |
| 1221 | 3300050494 | nmdc:mga06z11_13124_c1 | nmdc:mga06z11_13124_c1_894_1709 | 271 |
| 1222 | 3300050495 | nmdc:mga04h51_10398_c1 | nmdc:mga04h51_10398_c1_208_1023 | 271 |
| 1223 | 3300050507 | nmdc:mga05p37_71_c2 | nmdc:mga05p37_71_c2_44085_44900 | 271 |
| 1224 | 3300050509 | nmdc:mga0qj67_1537_c1 | nmdc:mga0qj67_1537_c1_14186_15001 | 271 |
| 1225 | 3300050510 | nmdc:mga06r32_9784_c1 | nmdc:mga06r32_9784_c1_3029_3844 | 271 |
| 1226 | 3300050511 | nmdc:mga08y16_10837_c1 | nmdc:mga08y16_10837_c1_5828_6643 | 271 |
| 1227 | 3300050511 | nmdc:mga08y16_650316_c1 | nmdc:mga08y16_650316_c1_178_996 | 271 |
| 1228 | 3300050511 | nmdc:mga08y16_7147_c1 | nmdc:mga08y16_7147_c1_8467_9282 | 271 |
| 1229 | 3300050512 | nmdc:mga0n895_1010_c1 | nmdc:mga0n895_1010_c1_795_1610 | 271 |
| 1230 | 3300050512 | nmdc:mga0n895_1143_c1 | nmdc:mga0n895_1143_c1_8988_9803 | 271 |
| 1231 | 3300050512 | nmdc:mga0n895_174250_c1 | nmdc:mga0n895_174250_c1_87_902 | 271 |
| 1232 | 3300050512 | nmdc:mga0n895_44942_c1 | nmdc:mga0n895_44942_c1_1550_2365 | 271 |
| 1233 | 3300050512 | nmdc:mga0n895_469506_c1 | nmdc:mga0n895_469506_c1_406_1221 | 271 |
| 1234 | 3300050513 | nmdc:mga0rr50_123642_c1 | nmdc:mga0rr50_123642_c1_816_1631 | 271 |
| 1235 | 3300050513 | nmdc:mga0rr50_140365_c1 | nmdc:mga0rr50_140365_c1_251_1066 | 271 |
| 1236 | 3300050513 | nmdc:mga0rr50_141697_c1 | nmdc:mga0rr50_141697_c1_824_1639 | 271 |
| 1237 | 3300050513 | nmdc:mga0rr50_415998_c1 | nmdc:mga0rr50_415998_c1_71_886 | 271 |
| 1238 | 3300050513 | nmdc:mga0rr50_560717_c1 | nmdc:mga0rr50_560717_c1_90_905 | 271 |
| 1239 | 3300050514 | nmdc:mga08x19_166749_c1 | nmdc:mga08x19_166749_c1_416_1231 | 271 |
| 1240 | 3300050514 | nmdc:mga08x19_286610_c1 | nmdc:mga08x19_286610_c1_126_941 | 271 |
| 1241 | 3300050515 | nmdc:mga0a205_14483_c1 | nmdc:mga0a205_14483_c1_783_1598 | 271 |
| 1242 | 3300050515 | nmdc:mga0a205_68545_c1 | nmdc:mga0a205_68545_c1_1781_2596 | 271 |
| 1243 | 3300053077 | Ga0495601_0000940 | Ga0495601_0000940_5627_6442 | 271 |
| 1244 | 3300053077 | Ga0495601_0011880 | Ga0495601_0011880_1401_2216 | 271 |
| 1245 | 3300053078 | Ga0495612_0002006 | Ga0495612_0002006_152_967 | 271 |
| 1246 | 3300053078 | Ga0495612_0011385 | Ga0495612_0011385_722_1537 | 271 |
| 1247 | 3300053078 | Ga0495612_0020410 | Ga0495612_0020410_393_1208 | 271 |
| 1248 | 3300053084 | Ga0495595_0001242 | Ga0495595_0001242_1440_2255 | 271 |
| 1249 | 3300053084 | Ga0495595_0003244 | Ga0495595_0003244_351_1166 | 271 |
| 1250 | 3300053085 | Ga0495619_0000440 | Ga0495619_0000440_3210_4025 | 271 |
| 1251 | 3300053085 | Ga0495619_0001622 | Ga0495619_0001622_3567_4382 | 271 |
| 1252 | 3300053085 | Ga0495619_0023063 | Ga0495619_0023063_1337_2152 | 271 |
| 1253 | 3300053094 | Ga0500566_0115664 | Ga0500566_0115664_627_1442 | 271 |
| 1254 | 3300054114 | Ga0501084_0611380 | Ga0501084_0611380_14_829 | 271 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
78
238
0.79
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7ahh-assembly1.cif.gz_B | opua inhibited inward-facing, sbd docked | 0.6787 | 65 | 256 |
| 4ymu-assembly1.cif.gz_C | crystal structure of an amino acid abc transporter complex with arginines and atps | 0.6663 | 46 | 257 |
| 8hps-assembly1.cif.gz_A | lpqy-sugabc in state 5 | 0.6559 | 46 | 256 |
| 4ymu-assembly1.cif.gz_C | crystal structure of an amino acid abc transporter complex with arginines and atps | 0.6435 | 46 | 257 |
| 7mc0-assembly1.cif.gz_B | inward facing conformation of the metni methionine abc transporter | 0.6326 | 58 | 257 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G088_14_207_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7033 | 58 | 256 | 1.10.3720.10 |
| af_P0AER3_18_239_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.6875 | 58 | 258 | 1.10.3720.10 |
| af_Q2G088_14_207_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.6852 | 58 | 256 | 1.10.3720.10 |
| af_P0AEU3_9_230_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.6816 | 64 | 259 | 1.10.3720.10 |
| af_P0AFT2_3_219_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.6798 | 51 | 262 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6B8MDS5-F1-model_v4 | ABC transporter permease subunit | 0.7315 | 31 | 261 |
GO:0005886
GO:0055085 |
| AF-A0A434TCK0-F1-model_v4 | ABC transporter permease | 0.7261 | 45 | 264 |
GO:0005886
GO:0055085 |
| AF-A0A441XKP3-F1-model_v4 | ABC transporter permease | 0.7233 | 45 | 259 |
GO:0005886
GO:0055085 |
| AF-A0A6B8MDS5-F1-model_v4 | ABC transporter permease subunit | 0.7206 | 31 | 261 |
GO:0005886
GO:0055085 |
| AF-A0A7X8YBN8-F1-model_v4 | ABC transporter permease | 0.7204 | 46 | 257 |
GO:0005886
GO:0055085 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar