F492193

General Info

Members Datasets Scaffolds Average Seq Length
1250 560 2500 101

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0093204|Ga0496126_0093204_854_1177
Length 107
Sequence MPNDPRFNDARELPPSSHDGLARFLGGSPLAVALRLVLLSILVGVVLAAIGFDPYNILRSIQLLFQRLWDLGFDAVNWLWRYFLLGAVIVIPIWFLSRLFGGAPRGR

Samples

Sample ID Description Type Environment
1 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
11 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
12 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
78 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
79 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
80 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
93 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
94 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
95 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
121 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
126 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
127 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
128 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
129 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
134 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
138 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
139 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
194 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
198 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
199 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
200 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
202 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
203 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
204 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
205 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
206 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
207 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
208 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
209 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
210 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
211 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
212 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
213 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
214 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
215 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
216 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
217 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
218 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
219 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
220 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
221 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
222 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
223 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
224 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
225 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
226 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
227 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
228 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
229 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
230 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
231 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
232 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
233 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
234 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
235 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
236 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
237 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
238 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
239 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
240 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
241 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
242 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
243 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
244 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
245 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
246 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
247 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
248 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
249 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
250 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
251 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
252 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
253 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
254 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
255 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
256 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
257 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
258 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
259 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
260 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
261 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
262 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
263 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
264 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
265 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
266 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
267 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
268 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
269 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
270 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
271 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
272 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
273 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
274 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
275 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
276 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
277 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
278 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
279 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
280 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
281 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
282 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
283 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
284 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
285 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
286 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
287 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
288 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
289 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
290 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
291 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
292 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
293 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
294 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
295 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
296 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
297 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
298 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
299 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
300 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
301 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
302 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
303 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
304 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
305 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
306 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
307 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
308 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
309 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
310 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
311 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
312 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
313 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
314 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
315 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
316 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
317 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
318 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
319 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
320 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
321 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
322 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
323 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
324 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
325 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
326 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
327 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
328 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
329 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
330 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
331 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
332 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
333 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
334 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
335 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
336 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
337 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
338 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
339 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
340 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
341 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
342 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
343 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
344 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
345 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
346 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
347 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
348 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
349 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
350 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
351 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
352 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
353 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
354 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
355 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
356 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
357 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
358 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
359 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
360 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
361 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
362 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
363 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
364 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
365 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
366 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
367 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
368 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
369 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
370 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
371 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
372 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
373 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
374 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
375 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
376 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
377 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
378 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
379 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
380 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
381 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
382 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
383 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
384 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
385 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
386 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
387 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
388 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
389 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
390 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
391 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
392 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
393 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
394 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
395 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
396 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
397 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
398 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
399 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
400 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
401 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
402 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
403 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
404 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
405 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
406 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
407 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
408 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
409 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
410 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
411 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
412 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
413 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
414 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
415 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
416 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
417 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
418 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
419 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
420 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
421 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
422 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
423 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
424 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
425 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
426 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
427 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
428 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
429 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
430 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
431 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
432 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
433 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
434 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
435 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
436 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
437 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
438 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
439 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
440 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
441 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
442 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
443 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
444 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
445 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
446 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
447 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
448 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
449 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
450 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
451 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
452 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
453 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
454 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
455 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
456 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
457 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
458 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
459 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
460 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
461 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
462 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
463 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
464 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
465 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
466 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
467 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
468 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
469 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
470 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
471 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
472 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
473 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
474 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
475 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
476 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
477 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
478 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
479 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
480 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
481 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
482 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
483 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
484 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
485 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
486 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
487 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
488 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
489 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
490 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
491 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
492 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
493 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
494 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
495 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
496 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
497 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
498 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
499 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
500 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
501 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
502 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
503 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
504 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
505 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
506 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
507 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
508 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
509 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
510 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
511 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
512 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
513 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
514 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
515 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
516 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
517 2922368715
518 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
519 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
520 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
521 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
522 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
523 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
524 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
525 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
526 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
527 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
528 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
529 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
530 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
531 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
532 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
533 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
534 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
535 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
536 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
537 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
538 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
539 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
540 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
541 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
542 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
543 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
544 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
545 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
546 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
547 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
548 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
549 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
550 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
551 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
552 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
553 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
554 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
555 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
556 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
557 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
558 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
559 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
560 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.35
Metatranscriptomes 0.56
Isolates 6.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.96
Nodule 4.88
Rhizoplane 6.24
Rhizosphere 72.48
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496126_0093204 3300048929 Bacteria 2645
2 JGI24740J21852_10040614 3300001979 Bacteria 1409
3 JGI24740J21852_10100766 3300001979 Bacteria 735
4 JGI24739J22299_10018096 3300001989 Bacteria 2535
5 JGI24737J22298_10035570 3300001990 Bacteria 1540
6 JGI24735J21928_10030238 3300002067 Bacteria 1610
7 JGI24738J21930_10096468 3300002075 Bacteria 629
8 JGI25165J46597_1007530 3300003214 Bacteria 1797
9 JGI25153J46596_10002724 3300003215 Bacteria 10071
10 JGI25153J46596_10006859 3300003215 Bacteria 5690
11 JGI25153J46596_10014488 3300003215 Bacteria 3275
12 JGI25160J50197_1002595 3300003354 Bacteria 8347
13 JGI25160J50197_1013590 3300003354 Bacteria 2767
14 JGI25404J52841_10003219 3300003659 Bacteria 3201
15 JGI25404J52841_10005710 3300003659 Bacteria 2574
16 JGI25404J52841_10025523 3300003659 Bacteria 1272
17 JGI25404J52841_10111207 3300003659 Bacteria 576
18 JGI25404J52841_10121062 3300003659 Bacteria 551
19 JGI25404J52841_10129328 3300003659 Bacteria 534
20 JGI25404J52841_10140125 3300003659 Bacteria 513
21 Ga0055539_1011455 3300003752 Bacteria 1091
22 Ga0055543_1001923 3300004625 Bacteria 7446
23 Ga0065165_1001543 3300005262 Bacteria 24050
24 Ga0065165_1004042 3300005262 Bacteria 9532
25 Ga0065715_10239338 3300005293 Bacteria 1205
26 Ga0070683_100031957 3300005329 Bacteria 4790
27 Ga0070683_100547266 3300005329 Bacteria 1107
28 Ga0070683_101367249 3300005329 Bacteria 681
29 Ga0070690_100149207 3300005330 Bacteria 1594
30 Ga0070670_100367474 3300005331 Bacteria 1266
31 Ga0070670_101722591 3300005331 Bacteria 577
32 Ga0068869_100069180 3300005334 Bacteria 2609
33 Ga0068869_100172885 3300005334 Bacteria 1689
34 Ga0070666_10241331 3300005335 Bacteria 1278
35 Ga0070680_100307419 3300005336 Bacteria 1345
36 Ga0070680_101138019 3300005336 Bacteria 675
37 Ga0070680_101896680 3300005336 Bacteria 516
38 Ga0070682_100071496 3300005337 Bacteria 2221
39 Ga0070682_100379289 3300005337 Bacteria 1063
40 Ga0070682_100560656 3300005337 Bacteria 896
41 Ga0070682_100615341 3300005337 Bacteria 860
42 Ga0070682_101273408 3300005337 Bacteria 623
43 Ga0070682_101938668 3300005337 Bacteria 517
44 Ga0068868_100286918 3300005338 Bacteria 1394
45 Ga0068868_100830954 3300005338 Bacteria 835
46 Ga0070689_100359098 3300005340 Bacteria 1224
47 Ga0070691_10139385 3300005341 Bacteria 1235
48 Ga0070661_100019593 3300005344 Bacteria 4822
49 Ga0070661_100055569 3300005344 Bacteria 2899
50 Ga0070661_100994375 3300005344 Bacteria 696
51 Ga0070661_101879465 3300005344 Bacteria 509
52 Ga0070692_11016861 3300005345 Bacteria 580
53 Ga0070668_100042894 3300005347 Bacteria 3467
54 Ga0070668_100571802 3300005347 Bacteria 986
55 Ga0070668_101213960 3300005347 Bacteria 683
56 Ga0070669_100550689 3300005353 Bacteria 962
57 Ga0070675_101082660 3300005354 Bacteria 737
58 Ga0070671_100085250 3300005355 Bacteria 2642
59 Ga0070671_100152494 3300005355 Bacteria 1952
60 Ga0070671_100308929 3300005355 Bacteria 1347
61 Ga0070673_101160772 3300005364 Bacteria 723
62 Ga0070688_100704014 3300005365 Bacteria 782
63 Ga0070688_101288106 3300005365 Bacteria 589
64 Ga0070667_100554409 3300005367 Bacteria 1056
65 Ga0070709_10157291 3300005434 Bacteria 1577
66 Ga0070709_10473753 3300005434 Bacteria 947
67 Ga0070709_11454503 3300005434 Bacteria 556
68 Ga0070714_100029988 3300005435 Bacteria 4525
69 Ga0070714_100087283 3300005435 Bacteria 2728
70 Ga0070714_102077640 3300005435 Bacteria 554
71 Ga0070713_100024907 3300005436 Bacteria 4670
72 Ga0070713_100052082 3300005436 Bacteria 3388
73 Ga0070713_100157708 3300005436 Bacteria 2024
74 Ga0070713_100215803 3300005436 Bacteria 1739
75 Ga0070713_100223729 3300005436 Bacteria 1708
76 Ga0070713_100753528 3300005436 Bacteria 932
77 Ga0070713_100793763 3300005436 Bacteria 907
78 Ga0070713_101826671 3300005436 Bacteria 590
79 Ga0070710_10057595 3300005437 Bacteria 2203
80 Ga0070710_10169670 3300005437 Bacteria 1359
81 Ga0070710_10604326 3300005437 Bacteria 764
82 Ga0070710_11294962 3300005437 Bacteria 542
83 Ga0070710_11436279 3300005437 Bacteria 517
84 Ga0070711_100043340 3300005439 Bacteria 3047
85 Ga0070711_100347004 3300005439 Bacteria 1193
86 Ga0070711_100809903 3300005439 Bacteria 795
87 Ga0070700_100736280 3300005441 Bacteria 787
88 Ga0070663_100090328 3300005455 Bacteria 2268
89 Ga0070663_100114379 3300005455 Bacteria 2032
90 Ga0070663_100137801 3300005455 Bacteria 1860
91 Ga0070663_100287099 3300005455 Bacteria 1313
92 Ga0070663_100289594 3300005455 Bacteria 1307
93 Ga0070663_100573844 3300005455 Bacteria 945
94 Ga0070663_100628560 3300005455 Bacteria 906
95 Ga0070663_101282564 3300005455 Bacteria 646
96 Ga0070678_102177391 3300005456 Bacteria 526
97 Ga0070662_100252298 3300005457 Bacteria 1419
98 Ga0070662_101273569 3300005457 Bacteria 632
99 Ga0070681_10072573 3300005458 Bacteria 3405
100 Ga0070681_10694972 3300005458 Bacteria 933
101 Ga0070681_11134686 3300005458 Bacteria 703
102 Ga0068867_101436807 3300005459 Bacteria 641
103 Ga0070706_100069420 3300005467 Bacteria 3259
104 Ga0070707_100171097 3300005468 Bacteria 2117
105 Ga0070698_100049630 3300005471 Bacteria 4282
106 Ga0070698_100610121 3300005471 Bacteria 1032
107 Ga0070698_101757010 3300005471 Bacteria 573
108 Ga0070679_100076441 3300005530 Bacteria 3338
109 Ga0070679_100172660 3300005530 Bacteria 2135
110 Ga0070679_100314036 3300005530 Bacteria 1517
111 Ga0070684_100040027 3300005535 Bacteria 4033
112 Ga0070697_101222492 3300005536 Bacteria 670
113 Ga0068853_100024444 3300005539 Bacteria 5065
114 Ga0068853_100027664 3300005539 Bacteria 4765
115 Ga0068853_100084290 3300005539 Bacteria 2784
116 Ga0068853_100228164 3300005539 Bacteria 1703
117 Ga0068853_100304177 3300005539 Bacteria 1475
118 Ga0068853_100595171 3300005539 Bacteria 1050
119 Ga0068853_100798688 3300005539 Bacteria 904
120 Ga0068853_101030539 3300005539 Bacteria 793
121 Ga0068853_101096187 3300005539 Bacteria 768
122 Ga0068853_101910414 3300005539 Bacteria 576
123 Ga0070672_101106862 3300005543 Bacteria 704
124 Ga0070686_100452254 3300005544 Bacteria 988
125 Ga0070686_101036394 3300005544 Bacteria 675
126 Ga0070693_100181272 3300005547 Bacteria 1356
127 Ga0070693_100901114 3300005547 Bacteria 663
128 Ga0070665_100086930 3300005548 Bacteria 3132
129 Ga0070665_100160756 3300005548 Bacteria 2248
130 Ga0070665_100271889 3300005548 Bacteria 1696
131 Ga0070665_100635545 3300005548 Bacteria 1080
132 Ga0070665_100724062 3300005548 Bacteria 1008
133 Ga0070665_100916929 3300005548 Bacteria 889
134 Ga0070665_101047453 3300005548 Bacteria 828
135 Ga0070665_101891907 3300005548 Bacteria 603
136 Ga0070704_100756419 3300005549 Bacteria 865
137 Ga0068855_100055564 3300005563 Bacteria 4649
138 Ga0068855_100201635 3300005563 Bacteria 2239
139 Ga0068855_100602453 3300005563 Bacteria 1185
140 Ga0068855_100803523 3300005563 Bacteria 999
141 Ga0068855_100809056 3300005563 Bacteria 995
142 Ga0068855_100964270 3300005563 Bacteria 898
143 Ga0068855_101778643 3300005563 Bacteria 627
144 Ga0068855_102064694 3300005563 Bacteria 575
145 Ga0068855_102605036 3300005563 Bacteria 502
146 Ga0070664_100165043 3300005564 Bacteria 1962
147 Ga0070664_100660711 3300005564 Bacteria 972
148 Ga0070664_100765455 3300005564 Bacteria 902
149 Ga0070664_101460507 3300005564 Bacteria 647
150 Ga0068857_100003131 3300005577 Bacteria 13690
151 Ga0068857_100031174 3300005577 Bacteria 4711
152 Ga0068857_100132504 3300005577 Bacteria 2248
153 Ga0068857_100799322 3300005577 Bacteria 901
154 Ga0068854_100008309 3300005578 Bacteria 6666
155 Ga0068854_100522690 3300005578 Bacteria 1003
156 Ga0068854_100878325 3300005578 Bacteria 787
157 Ga0068856_100073867 3300005614 Bacteria 3376
158 Ga0068856_100100242 3300005614 Bacteria 2888
159 Ga0068856_100162266 3300005614 Bacteria 2246
160 Ga0068856_100363125 3300005614 Bacteria 1467
161 Ga0068856_101489134 3300005614 Bacteria 691
162 Ga0068856_101748870 3300005614 Bacteria 634
163 Ga0068856_102486254 3300005614 Bacteria 525
164 Ga0070702_100896953 3300005615 Bacteria 694
165 Ga0070702_101145875 3300005615 Bacteria 624
166 Ga0070702_101537333 3300005615 Bacteria 548
167 Ga0068852_100136236 3300005616 Bacteria 2267
168 Ga0068852_100465641 3300005616 Bacteria 1254
169 Ga0068852_101369889 3300005616 Bacteria 729
170 Ga0068852_102294111 3300005616 Bacteria 561
171 Ga0068859_100113160 3300005617 Bacteria 2777
172 Ga0068859_100325970 3300005617 Bacteria 1630
173 Ga0068859_100465838 3300005617 Bacteria 1359
174 Ga0068859_101595023 3300005617 Bacteria 721
175 Ga0068866_10745753 3300005718 Bacteria 676
176 Ga0068861_100261871 3300005719 Bacteria 1481
177 Ga0068861_100804464 3300005719 Bacteria 882
178 Ga0068861_101529580 3300005719 Bacteria 655
179 Ga0068851_10001649 3300005834 Bacteria 9784
180 Ga0068851_10027032 3300005834 Bacteria 2825
181 Ga0068851_10220891 3300005834 Bacteria 1064
182 Ga0068870_11323214 3300005840 Bacteria 526
183 Ga0068863_100385662 3300005841 Bacteria 1369
184 Ga0068863_100407934 3300005841 Bacteria 1330
185 Ga0068858_100120255 3300005842 Bacteria 2456
186 Ga0068858_101204374 3300005842 Bacteria 744
187 Ga0068862_101106662 3300005844 Bacteria 787
188 Ga0081455_10036986 3300005937 Bacteria 4340
189 Ga0081455_10047126 3300005937 Bacteria 3735
190 Ga0081455_10950013 3300005937 Bacteria 533
191 Ga0081455_11028642 3300005937 Bacteria 509
192 Ga0081538_10033090 3300005981 Bacteria 3448
193 Ga0081538_10088138 3300005981 Bacteria 1616
194 Ga0081540_1002008 3300005983 Bacteria 16982
195 Ga0081540_1002669 3300005983 Bacteria 14510
196 Ga0081540_1004358 3300005983 Bacteria 10825
197 Ga0081540_1013548 3300005983 Bacteria 5294
198 Ga0081540_1016623 3300005983 Bacteria 4594
199 Ga0081540_1017941 3300005983 Bacteria 4361
200 Ga0081540_1058758 3300005983 Bacteria 1850
201 Ga0081540_1156007 3300005983 Bacteria 893
202 Ga0081540_1227991 3300005983 Bacteria 659
203 Ga0081540_1256499 3300005983 Bacteria 609
204 Ga0081540_1280575 3300005983 Bacteria 575
205 Ga0081540_1331912 3300005983 Bacteria 521
206 Ga0081539_10000902 3300005985 Bacteria 56412
207 Ga0081539_10012998 3300005985 Bacteria 6323
208 Ga0081539_10264041 3300005985 Bacteria 758
209 Ga0081539_10360055 3300005985 Bacteria 610
210 Ga0070717_10029119 3300006028 Bacteria 4428
211 Ga0070717_10127050 3300006028 Bacteria 2189
212 Ga0070717_10339663 3300006028 Bacteria 1341
213 Ga0070717_11377629 3300006028 Bacteria 641
214 Ga0075365_10025042 3300006038 Bacteria 3773
215 Ga0075365_10234247 3300006038 Bacteria 1289
216 Ga0075368_10002408 3300006042 Bacteria 6098
217 Ga0075368_10095576 3300006042 Bacteria 1218
218 Ga0075363_100000457 3300006048 Bacteria 12805
219 Ga0075363_100273791 3300006048 Bacteria 975
220 Ga0075363_100589058 3300006048 Bacteria 666
221 Ga0075364_10089293 3300006051 Bacteria 2044
222 Ga0070716_100401581 3300006173 Bacteria 986
223 Ga0070712_100238466 3300006175 Bacteria 1448
224 Ga0070712_100281435 3300006175 Bacteria 1340
225 Ga0075362_10014331 3300006177 Bacteria 3196
226 Ga0075362_10084138 3300006177 Bacteria 1469
227 Ga0075367_10017461 3300006178 Bacteria 3939
228 Ga0075367_10079893 3300006178 Bacteria 1977
229 Ga0075367_10227306 3300006178 Bacteria 1168
230 Ga0075366_10067485 3300006195 Bacteria 2129
231 Ga0075366_10074999 3300006195 Bacteria 2017
232 Ga0097621_100550989 3300006237 Bacteria 1050
233 Ga0097621_100662267 3300006237 Bacteria 959
234 Ga0075370_10043541 3300006353 Bacteria 2537
235 Ga0075370_10082365 3300006353 Bacteria 1850
236 Ga0075370_10177373 3300006353 Bacteria 1253
237 Ga0075370_10244088 3300006353 Bacteria 1063
238 Ga0075370_10368466 3300006353 Bacteria 860
239 Ga0075370_11043211 3300006353 Bacteria 501
240 Ga0068871_100693171 3300006358 Bacteria 933
241 Ga0068871_100891808 3300006358 Bacteria 824
242 Ga0075434_100016914 3300006871 Bacteria 7015
243 Ga0075434_100590644 3300006871 Bacteria 1130
244 Ga0075436_100306510 3300006914 Bacteria 1139
245 Ga0097620_100113159 3300006931 Bacteria 2777
246 Ga0097620_100325970 3300006931 Bacteria 1630
247 Ga0097620_100465853 3300006931 Bacteria 1359
248 Ga0097620_101595137 3300006931 Bacteria 721
249 Ga0099794_10093466 3300007265 Bacteria 1495
250 Ga0099795_10235221 3300007788 Bacteria 785
251 Ga0105251_10415890 3300009011 Bacteria 619
252 Ga0105250_10071694 3300009092 Bacteria 1399
253 Ga0105240_10014949 3300009093 Bacteria 10574
254 Ga0105240_10019882 3300009093 Bacteria 8969
255 Ga0105240_10143012 3300009093 Bacteria 2858
256 Ga0105240_10164801 3300009093 Bacteria 2629
257 Ga0105240_10226359 3300009093 Bacteria 2176
258 Ga0105240_10328349 3300009093 Bacteria 1741
259 Ga0105240_11027213 3300009093 Bacteria 880
260 Ga0105245_10233828 3300009098 Bacteria 1779
261 Ga0105245_10499909 3300009098 Bacteria 1232
262 Ga0105245_10908103 3300009098 Bacteria 922
263 Ga0105245_11376847 3300009098 Bacteria 755
264 Ga0105245_11602851 3300009098 Bacteria 703
265 Ga0105247_10122301 3300009101 Bacteria 1688
266 Ga0105247_10181027 3300009101 Bacteria 1407
267 Ga0105247_10194459 3300009101 Bacteria 1360
268 Ga0105247_11372860 3300009101 Bacteria 571
269 Ga0105243_10160026 3300009148 Bacteria 1940
270 Ga0105243_10319802 3300009148 Bacteria 1413
271 Ga0105243_11095100 3300009148 Bacteria 805
272 Ga0105243_11429303 3300009148 Bacteria 713
273 Ga0105241_10394480 3300009174 Bacteria 1212
274 Ga0105241_10487179 3300009174 Bacteria 1097
275 Ga0105241_10560917 3300009174 Bacteria 1027
276 Ga0105242_10138692 3300009176 Bacteria 2108
277 Ga0105242_10401226 3300009176 Bacteria 1280
278 Ga0105242_13116887 3300009176 Bacteria 514
279 Ga0105248_10070400 3300009177 Bacteria 3928
280 Ga0105248_10123366 3300009177 Bacteria 2922
281 Ga0105248_10520449 3300009177 Bacteria 1341
282 Ga0105248_12598562 3300009177 Bacteria 577
283 Ga0105248_12788544 3300009177 Bacteria 557
284 Ga0105237_10028929 3300009545 Bacteria 5639
285 Ga0105237_10048231 3300009545 Bacteria 4281
286 Ga0105237_10108333 3300009545 Bacteria 2770
287 Ga0105237_10401055 3300009545 Bacteria 1376
288 Ga0105237_10859994 3300009545 Bacteria 914
289 Ga0105237_11556942 3300009545 Bacteria 668
290 Ga0105237_11581436 3300009545 Bacteria 662
291 Ga0105237_12783856 3300009545 Bacteria 500
292 Ga0105238_10105864 3300009551 Bacteria 2794
293 Ga0105238_10212171 3300009551 Bacteria 1912
294 Ga0105238_10990799 3300009551 Bacteria 861
295 Ga0105249_10027700 3300009553 Bacteria 5114
296 Ga0105249_10693850 3300009553 Bacteria 1078
297 Ga0099796_10086991 3300010159 Bacteria 1156
298 Ga0105239_10052448 3300010375 Bacteria 4473
299 Ga0105239_10230018 3300010375 Bacteria 2080
300 Ga0105239_10302257 3300010375 Bacteria 1802
301 Ga0105239_10771620 3300010375 Bacteria 1101
302 Ga0105239_12164931 3300010375 Bacteria 646
303 Ga0105239_12548433 3300010375 Bacteria 596
304 Ga0105239_13040845 3300010375 Bacteria 547
305 Ga0105246_10159510 3300011119 Bacteria 1717
306 Ga0105246_10354015 3300011119 Bacteria 1204
307 Ga0105246_10956650 3300011119 Bacteria 772
308 Ga0105246_11534297 3300011119 Bacteria 627
309 Ga0105246_12424393 3300011119 Bacteria 515
310 Ga0157373_10366731 3300013100 Bacteria 1029
311 Ga0157373_11218541 3300013100 Bacteria 568
312 Ga0157371_10254843 3300013102 Bacteria 1264
313 Ga0157370_10160110 3300013104 Bacteria 2095
314 Ga0157370_10232227 3300013104 Bacteria 1707
315 Ga0157370_10626551 3300013104 Bacteria 984
316 Ga0157369_10004460 3300013105 Bacteria 16494
317 Ga0157369_10018976 3300013105 Bacteria 7703
318 Ga0157369_12148914 3300013105 Bacteria 566
319 Ga0157374_10110734 3300013296 Bacteria 2641
320 Ga0157374_10164047 3300013296 Bacteria 2165
321 Ga0163162_10110973 3300013306 Bacteria 2840
322 Ga0163162_10858613 3300013306 Bacteria 1022
323 Ga0163162_10887786 3300013306 Bacteria 1005
324 Ga0163162_12055559 3300013306 Bacteria 655
325 Ga0157372_10045484 3300013307 Bacteria 4870
326 Ga0157372_10481603 3300013307 Bacteria 1447
327 Ga0157372_11680354 3300013307 Bacteria 731
328 Ga0157375_10067779 3300013308 Bacteria 3566
329 Ga0157375_10120122 3300013308 Bacteria 2736
330 Ga0157375_12745228 3300013308 Bacteria 589
331 Ga0163163_10315548 3300014325 Bacteria 1617
332 Ga0163163_11983504 3300014325 Bacteria 642
333 Ga0157379_10059342 3300014968 Bacteria 3420
334 Ga0157379_10331322 3300014968 Bacteria 1391
335 Ga0157379_10371414 3300014968 Bacteria 1311
336 Ga0157379_10580625 3300014968 Bacteria 1045
337 Ga0157379_11409749 3300014968 Bacteria 675
338 Ga0157376_10624820 3300014969 Bacteria 1075
339 Ga0182006_1104364 3300015261 Bacteria 1002
340 Ga0182007_10159157 3300015262 Bacteria 771
341 Ga0163161_11398692 3300017792 Bacteria 611
342 Ga0163161_11472570 3300017792 Bacteria 597
343 Ga0206354_10622256 3300020081 Bacteria 1937
344 Ga0154015_1445201 3300020610 Bacteria 538
345 Ga0213872_10034797 3300021361 Bacteria 2305
346 Ga0213876_10176160 3300021384 Bacteria 1138
347 Ga0213875_10065765 3300021388 Bacteria 1694
348 Ga0213871_10194272 3300021441 Bacteria 631
349 Ga0224712_10268563 3300022467 Bacteria 792
350 Ga0224712_10589203 3300022467 Bacteria 542
351 Ga0209563_103179 3300025230 Bacteria 3462
352 Ga0209677_100434 3300025253 Bacteria 24570
353 Ga0209677_102685 3300025253 Bacteria 6419
354 Ga0209148_1009199 3300025254 Bacteria 1941
355 Ga0209233_1001815 3300025261 Bacteria 8212
356 Ga0209233_1008918 3300025261 Bacteria 3073
357 Ga0209455_1002067 3300025272 Bacteria 8110
358 Ga0209673_1056243 3300025273 Bacteria 1008
359 Ga0209564_1010640 3300025295 Bacteria 4210
360 Ga0209758_1000389 3300025297 Bacteria 75919
361 Ga0209758_1001056 3300025297 Bacteria 36006
362 Ga0209758_1004662 3300025297 Bacteria 11214
363 Ga0209758_1011597 3300025297 Bacteria 5077
364 Ga0209758_1047353 3300025297 Bacteria 1539
365 Ga0207426_1000380 3300025302 Bacteria 76046
366 Ga0207426_1001551 3300025302 Bacteria 18658
367 Ga0207426_1022964 3300025302 Bacteria 2134
368 Ga0207426_1080914 3300025302 Bacteria 881
369 Ga0209257_1009836 3300025304 Bacteria 5003
370 Ga0209257_1125441 3300025304 Bacteria 595
371 Ga0207656_10007457 3300025321 Bacteria 3983
372 Ga0207656_10115012 3300025321 Bacteria 1247
373 Ga0207692_10049368 3300025898 Bacteria 2123
374 Ga0207692_10188672 3300025898 Bacteria 1205
375 Ga0207710_10127075 3300025900 Bacteria 1222
376 Ga0207710_10305729 3300025900 Bacteria 804
377 Ga0207710_10617178 3300025900 Bacteria 567
378 Ga0207688_10102200 3300025901 Bacteria 1656
379 Ga0207688_10120678 3300025901 Bacteria 1529
380 Ga0207680_10311187 3300025903 Bacteria 1099
381 Ga0207647_10002061 3300025904 Bacteria 15362
382 Ga0207685_10062660 3300025905 Bacteria 1478
383 Ga0207685_10272466 3300025905 Bacteria 827
384 Ga0207699_10085566 3300025906 Bacteria 1967
385 Ga0207699_10168045 3300025906 Bacteria 1465
386 Ga0207699_10238682 3300025906 Bacteria 1248
387 Ga0207699_10268474 3300025906 Bacteria 1182
388 Ga0207699_10312261 3300025906 Bacteria 1100
389 Ga0207699_10385406 3300025906 Bacteria 996
390 Ga0207684_10109834 3300025910 Bacteria 2361
391 Ga0207654_10001581 3300025911 Bacteria 11962
392 Ga0207654_10103926 3300025911 Bacteria 1755
393 Ga0207654_10171867 3300025911 Bacteria 1408
394 Ga0207654_10413381 3300025911 Bacteria 940
395 Ga0207654_10484612 3300025911 Bacteria 871
396 Ga0207707_10001012 3300025912 Bacteria 26958
397 Ga0207707_10061491 3300025912 Bacteria 3267
398 Ga0207707_10638807 3300025912 Bacteria 898
399 Ga0207707_10944032 3300025912 Bacteria 711
400 Ga0207695_10000463 3300025913 Bacteria 88316
401 Ga0207695_10037987 3300025913 Bacteria 5191
402 Ga0207695_10106934 3300025913 Bacteria 2783
403 Ga0207695_10120623 3300025913 Bacteria 2591
404 Ga0207695_10162848 3300025913 Bacteria 2161
405 Ga0207695_10212399 3300025913 Bacteria 1845
406 Ga0207695_10431082 3300025913 Bacteria 1202
407 Ga0207695_10886801 3300025913 Bacteria 772
408 Ga0207671_10259805 3300025914 Bacteria 1367
409 Ga0207671_10270361 3300025914 Bacteria 1339
410 Ga0207671_10360105 3300025914 Bacteria 1154
411 Ga0207671_10521249 3300025914 Bacteria 948
412 Ga0207671_10636540 3300025914 Bacteria 849
413 Ga0207671_11329701 3300025914 Bacteria 559
414 Ga0207693_10012775 3300025915 Bacteria 6777
415 Ga0207693_10019974 3300025915 Bacteria 5328
416 Ga0207693_10247808 3300025915 Bacteria 1398
417 Ga0207693_10762965 3300025915 Bacteria 747
418 Ga0207693_10879327 3300025915 Bacteria 688
419 Ga0207663_10017436 3300025916 Bacteria 4001
420 Ga0207663_11637220 3300025916 Bacteria 518
421 Ga0207660_11550959 3300025917 Bacteria 534
422 Ga0207657_11106517 3300025919 Bacteria 605
423 Ga0207649_10019765 3300025920 Bacteria 3855
424 Ga0207649_10985907 3300025920 Bacteria 663
425 Ga0207652_10061396 3300025921 Bacteria 3245
426 Ga0207652_10095839 3300025921 Bacteria 2614
427 Ga0207652_10440252 3300025921 Bacteria 1175
428 Ga0207681_10685696 3300025923 Bacteria 851
429 Ga0207694_10000234 3300025924 Bacteria 53453
430 Ga0207694_10047684 3300025924 Bacteria 3314
431 Ga0207659_11047880 3300025926 Bacteria 702
432 Ga0207687_10700519 3300025927 Bacteria 860
433 Ga0207687_11962058 3300025927 Bacteria 500
434 Ga0207700_10069972 3300025928 Bacteria 2696
435 Ga0207700_10436320 3300025928 Bacteria 1152
436 Ga0207700_10449344 3300025928 Bacteria 1136
437 Ga0207700_11377137 3300025928 Bacteria 627
438 Ga0207664_10003852 3300025929 Bacteria 10076
439 Ga0207664_10172179 3300025929 Bacteria 1853
440 Ga0207664_10665798 3300025929 Bacteria 936
441 Ga0207664_10781728 3300025929 Bacteria 859
442 Ga0207644_10201791 3300025931 Bacteria 1569
443 Ga0207644_10262314 3300025931 Bacteria 1382
444 Ga0207644_10484076 3300025931 Bacteria 1019
445 Ga0207706_10077413 3300025933 Bacteria 2925
446 Ga0207706_10139948 3300025933 Bacteria 2129
447 Ga0207686_10117452 3300025934 Bacteria 1805
448 Ga0207686_10656639 3300025934 Bacteria 830
449 Ga0207686_10771396 3300025934 Bacteria 769
450 Ga0207709_10903713 3300025935 Bacteria 718
451 Ga0207665_10062967 3300025939 Bacteria 2518
452 Ga0207665_10482214 3300025939 Bacteria 956
453 Ga0207665_10621423 3300025939 Bacteria 845
454 Ga0207665_10950211 3300025939 Bacteria 683
455 Ga0207691_10799695 3300025940 Bacteria 793
456 Ga0207711_10131544 3300025941 Bacteria 2244
457 Ga0207711_10718864 3300025941 Bacteria 931
458 Ga0207711_10931330 3300025941 Bacteria 807
459 Ga0207689_10054191 3300025942 Bacteria 3304
460 Ga0207689_10535687 3300025942 Bacteria 983
461 Ga0207661_10000462 3300025944 Bacteria 26255
462 Ga0207661_10335806 3300025944 Bacteria 1361
463 Ga0207679_10153261 3300025945 Bacteria 1879
464 Ga0207679_10170338 3300025945 Bacteria 1792
465 Ga0207679_10661490 3300025945 Bacteria 945
466 Ga0207679_10942325 3300025945 Bacteria 791
467 Ga0207679_11177024 3300025945 Bacteria 703
468 Ga0207667_10023472 3300025949 Bacteria 6791
469 Ga0207667_10038547 3300025949 Bacteria 5102
470 Ga0207667_10235722 3300025949 Bacteria 1873
471 Ga0207667_11126230 3300025949 Bacteria 767
472 Ga0207651_10317449 3300025960 Bacteria 1301
473 Ga0207712_10161390 3300025961 Bacteria 1742
474 Ga0207712_10436746 3300025961 Bacteria 1107
475 Ga0207668_10334560 3300025972 Bacteria 1261
476 Ga0207668_10401230 3300025972 Bacteria 1159
477 Ga0207668_10950417 3300025972 Bacteria 766
478 Ga0207640_10030135 3300025981 Bacteria 3338
479 Ga0207640_10032190 3300025981 Bacteria 3250
480 Ga0207640_10655852 3300025981 Bacteria 895
481 Ga0207658_10971840 3300025986 Bacteria 774
482 Ga0207677_10858545 3300026023 Bacteria 816
483 Ga0207677_11051160 3300026023 Bacteria 740
484 Ga0207703_10690523 3300026035 Bacteria 970
485 Ga0207703_10916321 3300026035 Bacteria 839
486 Ga0207703_11324014 3300026035 Bacteria 693
487 Ga0207639_10019196 3300026041 Bacteria 4871
488 Ga0207639_10061167 3300026041 Bacteria 2907
489 Ga0207639_10074797 3300026041 Bacteria 2661
490 Ga0207639_10179934 3300026041 Bacteria 1798
491 Ga0207639_10239216 3300026041 Bacteria 1577
492 Ga0207639_10603696 3300026041 Bacteria 1012
493 Ga0207639_10629173 3300026041 Bacteria 991
494 Ga0207639_10939872 3300026041 Bacteria 809
495 Ga0207639_11269419 3300026041 Bacteria 691
496 Ga0207678_10062471 3300026067 Bacteria 3201
497 Ga0207678_10116704 3300026067 Bacteria 2277
498 Ga0207678_10151381 3300026067 Bacteria 1981
499 Ga0207678_10199725 3300026067 Bacteria 1709
500 Ga0207678_10236470 3300026067 Bacteria 1564
501 Ga0207678_10274484 3300026067 Bacteria 1446
502 Ga0207678_10554337 3300026067 Bacteria 1005
503 Ga0207678_10894801 3300026067 Bacteria 785
504 Ga0207708_10656041 3300026075 Bacteria 893
505 Ga0207702_10000098 3300026078 Bacteria 101326
506 Ga0207702_10067998 3300026078 Bacteria 3060
507 Ga0207702_10078592 3300026078 Bacteria 2857
508 Ga0207702_10311802 3300026078 Bacteria 1496
509 Ga0207702_11069453 3300026078 Bacteria 801
510 Ga0207641_10485376 3300026088 Bacteria 1198
511 Ga0207641_10693575 3300026088 Bacteria 1002
512 Ga0207676_10084335 3300026095 Bacteria 2590
513 Ga0207674_10006546 3300026116 Bacteria 13700
514 Ga0207674_10010216 3300026116 Bacteria 10662
515 Ga0207674_10382318 3300026116 Bacteria 1361
516 Ga0207674_10451188 3300026116 Bacteria 1243
517 Ga0207675_100349508 3300026118 Bacteria 1449
518 Ga0207675_101247532 3300026118 Bacteria 764
519 Ga0207675_102397169 3300026118 Bacteria 540
520 Ga0207683_10296226 3300026121 Bacteria 1480
521 Ga0207683_11156838 3300026121 Bacteria 717
522 Ga0207698_10020893 3300026142 Bacteria 4517
523 Ga0207698_10127697 3300026142 Bacteria 2166
524 Ga0207698_10128172 3300026142 Bacteria 2163
525 Ga0207698_10993614 3300026142 Bacteria 850
526 Ga0207698_11520989 3300026142 Bacteria 685
527 Ga0207698_11606195 3300026142 Bacteria 666
528 Ga0207698_12640910 3300026142 Bacteria 511
529 Ga0209813_10064721 3300027866 Bacteria 1175
530 Ga0209813_10289579 3300027866 Bacteria 633
531 Ga0268266_10005154 3300028379 Bacteria 12306
532 Ga0268266_10044078 3300028379 Bacteria 3812
533 Ga0268266_10167694 3300028379 Bacteria 1991
534 Ga0268266_10203230 3300028379 Bacteria 1814
535 Ga0268266_10571024 3300028379 Bacteria 1085
536 Ga0268266_10826124 3300028379 Bacteria 895
537 Ga0268266_11022832 3300028379 Bacteria 799
538 Ga0268266_11409228 3300028379 Bacteria 672
539 Ga0268266_12023254 3300028379 Bacteria 549
540 Ga0268265_10316227 3300028380 Bacteria 1412
541 Ga0268264_10000049 3300028381 Bacteria 329992
542 Ga0307517_10002508 3300028786 Bacteria 29345
543 Ga0307517_10462843 3300028786 Bacteria 654
544 Ga0307515_10156128 3300028794 Bacteria 2354
545 Ga0307511_10069798 3300030521 Bacteria 2579
546 Ga0265763_1028713 3300030763 Bacteria 622
547 Ga0265330_10006850 3300031235 Bacteria 5606
548 Ga0265330_10042819 3300031235 Bacteria 2005
549 Ga0265330_10083921 3300031235 Bacteria 1371
550 Ga0265332_10030851 3300031238 Bacteria 2340
551 Ga0265332_10199405 3300031238 Bacteria 832
552 Ga0265328_10272053 3300031239 Bacteria 651
553 Ga0265325_10016079 3300031241 Bacteria 4186
554 Ga0265340_10027608 3300031247 Bacteria 2860
555 Ga0265339_10450771 3300031249 Bacteria 597
556 Ga0265331_10057754 3300031250 Bacteria 1839
557 Ga0307513_10376775 3300031456 Bacteria 1159
558 Ga0307509_10182179 3300031507 Bacteria 1963
559 Ga0307408_100057784 3300031548 Bacteria 2818
560 Ga0265313_10319021 3300031595 Bacteria 621
561 Ga0307508_10024306 3300031616 Bacteria 5498
562 Ga0307508_10081289 3300031616 Bacteria 2821
563 Ga0307508_10438571 3300031616 Bacteria 898
564 Ga0307508_10813008 3300031616 Bacteria 553
565 Ga0265314_10104734 3300031711 Bacteria 1811
566 Ga0265314_10126984 3300031711 Bacteria 1596
567 Ga0265342_10054940 3300031712 Bacteria 2365
568 Ga0265342_10061237 3300031712 Bacteria 2218
569 Ga0307516_10003810 3300031730 Bacteria 19133
570 Ga0307516_10010832 3300031730 Bacteria 9978
571 Ga0307516_10154306 3300031730 Bacteria 2053
572 Ga0307516_10178608 3300031730 Bacteria 1858
573 Ga0307516_10254553 3300031730 Bacteria 1449
574 Ga0307516_10294857 3300031730 Bacteria 1299
575 Ga0307405_10344762 3300031731 Bacteria 1147
576 Ga0307413_10066462 3300031824 Bacteria 2250
577 Ga0307413_11046270 3300031824 Bacteria 702
578 Ga0307410_10979388 3300031852 Bacteria 728
579 Ga0307406_10292448 3300031901 Bacteria 1248
580 Ga0307412_10057874 3300031911 Bacteria 2590
581 Ga0307412_10808725 3300031911 Bacteria 814
582 Ga0307409_100373739 3300031995 Bacteria 1352
583 Ga0307409_102323776 3300031995 Bacteria 565
584 Ga0307416_102606953 3300032002 Bacteria 603
585 Ga0307414_11942616 3300032004 Bacteria 549
586 Ga0307411_10078628 3300032005 Bacteria 2262
587 Ga0307415_100239612 3300032126 Bacteria 1466
588 Ga0307507_10093687 3300033179 Bacteria 2557
589 Ga0307507_10633385 3300033179 Bacteria 546
590 Ga0307510_10034452 3300033180 Bacteria 5669
591 Ga0307510_10318437 3300033180 Bacteria 1013
592 Ga0307510_10363639 3300033180 Bacteria 895
593 Ga0316215_1002595 3300033544 Bacteria 1710
594 Ga0373930_0050144 3300034816 Bacteria 910
595 Ga0373930_0067039 3300034816 Bacteria 810
596 Ga0373938_0176331 3300034957 Bacteria 581
597 Ga0373926_0006082 3300035083 Bacteria 3997
598 Ga0373926_0057714 3300035083 Bacteria 1410
599 Ga0373934_0141563 3300035086 Bacteria 984
600 Ga0373940_0004014 3300035088 Bacteria 3073
601 Ga0373944_0065077 3300035089 Bacteria 1177
602 Ga0373949_0079259 3300035090 Bacteria 873
603 Ga0373951_0233827 3300035091 Bacteria 547
604 Ga0373923_0003386 3300035111 Bacteria 5103
605 Ga0373923_0192455 3300035111 Bacteria 940
606 Ga0373936_0017983 3300035113 Bacteria 2726
607 Ga0373941_0106617 3300035115 Bacteria 982
608 Ga0373941_0241482 3300035115 Bacteria 702
609 Ga0373945_0202285 3300035116 Bacteria 825
610 Ga0373953_0045342 3300035117 Bacteria 1761
611 Ga0373953_0054526 3300035117 Bacteria 1622
612 Ga0373954_0003000 3300035118 Bacteria 7119
613 Ga0373954_0013614 3300035118 Bacteria 3626
614 Ga0373954_0014129 3300035118 Bacteria 3559
615 Ga0373954_0201346 3300035118 Bacteria 978
616 Ga0373957_0008180 3300035120 Bacteria 3378
617 Ga0373957_0027291 3300035120 Bacteria 2074
618 Ga0373960_0034486 3300035121 Bacteria 1432
619 Ga0373943_0273222 3300035170 Bacteria 954
620 Ga0373946_0027752 3300035171 Bacteria 2241
621 Ga0373946_0290066 3300035171 Bacteria 807
622 Ga0373946_0294653 3300035171 Bacteria 801
623 Ga0373955_0037568 3300035172 Bacteria 2575
624 Ga0373955_0059806 3300035172 Bacteria 2099
625 Ga0373955_0118939 3300035172 Bacteria 1534
626 Ga0373955_0168392 3300035172 Bacteria 1296
627 Ga0373942_0068148 3300035207 Bacteria 1033
628 Ga0373942_0331847 3300035207 Bacteria 534
629 Ga0373961_0156535 3300035241 Bacteria 780
630 Ga0373924_0000990 3300035410 Bacteria 9005
631 Ga0373924_0128848 3300035410 Bacteria 1100
632 Ga0373931_0000737 3300035691 Bacteria 13621
633 Ga0373935_0006078 3300035692 Bacteria 7179
634 Ga0373935_0058500 3300035692 Bacteria 2462
635 Ga0373927_0000481 3300035695 Bacteria 30651
636 Ga0373927_0019543 3300035695 Bacteria 4441
637 Ga0373927_0026996 3300035695 Bacteria 3751
638 Ga0373927_0038189 3300035695 Bacteria 3118
639 Ga0373927_0051429 3300035695 Bacteria 2664
640 Ga0373927_0107782 3300035695 Bacteria 1815
641 Ga0373927_0120469 3300035695 Bacteria 1712
642 Ga0373933_0118829 3300035724 Bacteria 1654
643 Ga0373933_0273523 3300035724 Bacteria 1090
644 Ga0373933_0349459 3300035724 Bacteria 960
645 Ga0373933_0499398 3300035724 Bacteria 797
646 Ga0373947_0000441 3300035725 Bacteria 23573
647 Ga0373947_0031134 3300035725 Bacteria 3138
648 Ga0373937_0011434 3300036401 Bacteria 7788
649 Ga0373937_0023736 3300036401 Bacteria 5527
650 Ga0373937_1466963 3300036401 Bacteria 630
651 Ga0310112_029544 3300036458 Bacteria 754
652 Ga0372808_001174 3300036459 Bacteria 2606
653 Ga0373925_0005398 3300037068 Bacteria 9531
654 Ga0373925_0043326 3300037068 Bacteria 3340
655 Ga0373925_0054446 3300037068 Bacteria 2993
656 Ga0373925_0107728 3300037068 Bacteria 2149
657 Ga0373925_0384410 3300037068 Bacteria 1143
658 Ga0373925_1008502 3300037068 Bacteria 685
659 Ga0395899_0228139 3300037312 Bacteria 1287
660 Ga0395899_0253147 3300037312 Bacteria 1208
661 Ga0395900_0000937 3300037418 Bacteria 38218
662 Ga0395900_0013063 3300037418 Bacteria 8486
663 Ga0395900_0322035 3300037418 Bacteria 1526
664 Ga0395898_0011586 3300037466 Bacteria 9156
665 Ga0395898_0047647 3300037466 Bacteria 4205
666 Ga0395898_0121837 3300037466 Bacteria 2499
667 Ga0395905_0540377 3300037471 Bacteria 1066
668 Ga0436364_0457605 3300037853 Bacteria 1342
669 Ga0436364_0510045 3300037853 Bacteria 3197
670 Ga0436364_1253402 3300037853 Bacteria 1084
671 Ga0395901_0056407 3300038443 Bacteria 4086
672 Ga0395901_0197670 3300038443 Bacteria 2108
673 Ga0395901_0320497 3300038443 Bacteria 1604
674 Ga0436365_0034134 3300039437 Bacteria 1871
675 Ga0436365_0594717 3300039437 Bacteria 1263
676 Ga0436365_1242582 3300039437 Bacteria 1284
677 Ga0436365_1797143 3300039437 Bacteria 5250
678 Ga0436360_0226977 3300039438 Bacteria 1211
679 Ga0436360_1341430 3300039438 Bacteria 646
680 Ga0436361_0091611 3300039447 Bacteria 520
681 Ga0436361_1072639 3300039447 Bacteria 600
682 Ga0436363_0800260 3300039450 Bacteria 680
683 Ga0436362_0810915 3300039453 Bacteria 604
684 Ga0451789_0135100 3300041443 Bacteria 503
685 Ga0451789_1307874 3300041443 Bacteria 580
686 Ga0451791_0310571 3300041451 Bacteria 611
687 Ga0451797_1122517 3300041453 Bacteria 816
688 Ga0451795_1213101 3300041456 Bacteria 608
689 Ga0451802_1299051 3300041460 Bacteria 833
690 Ga0451807_0776538 3300041486 Bacteria 1146
691 Ga0451807_0962926 3300041486 Bacteria 661
692 Ga0451849_0021296 3300041505 Bacteria 714
693 Ga0451855_0859634 3300041511 Bacteria 598
694 Ga0451853_2617866 3300041512 Bacteria 1489
695 Ga0439458_0033608 3300042157 Bacteria 1229
696 Ga0439444_0192739 3300042437 Bacteria 511
697 Ga0439459_0135140 3300042438 Bacteria 633
698 Ga0466969_0251599 3300044656 Bacteria 801
699 Ga0466961_0123149 3300044693 Bacteria 1627
700 Ga0466963_0025316 3300044694 Bacteria 3784
701 Ga0466963_0297563 3300044694 Bacteria 1135
702 Ga0466963_0445244 3300044694 Bacteria 914
703 Ga0466968_0155689 3300044735 Bacteria 1052
704 Ga0466970_0199943 3300044765 Bacteria 1112
705 Ga0466957_0111626 3300044842 Bacteria 1734
706 Ga0466967_0022610 3300045976 Bacteria 5135
707 Ga0466967_0655043 3300045976 Bacteria 1038
708 Ga0466967_1457187 3300045976 Bacteria 682
709 Ga0466967_1791167 3300045976 Bacteria 611
710 Ga0495617_072307 3300046452 Bacteria 1134
711 Ga0495592_0016144 3300046454 Bacteria 5665
712 Ga0495592_0082735 3300046454 Bacteria 2319
713 Ga0495592_0093853 3300046454 Bacteria 2148
714 Ga0495592_0153992 3300046454 Bacteria 1587
715 Ga0495603_0000066 3300046455 Bacteria 45635
716 Ga0495603_0017631 3300046455 Bacteria 4323
717 Ga0495603_0059019 3300046455 Bacteria 2268
718 Ga0495603_0432281 3300046455 Bacteria 754
719 Ga0495603_0651822 3300046455 Bacteria 602
720 Ga0495603_0696473 3300046455 Bacteria 581
721 Ga0495590_0161562 3300046457 Bacteria 815
722 Ga0495629_0000131 3300046459 Bacteria 65274
723 Ga0495629_0000937 3300046459 Bacteria 23485
724 Ga0495629_0034072 3300046459 Bacteria 3600
725 Ga0495629_0230703 3300046459 Bacteria 1276
726 Ga0495629_0320986 3300046459 Bacteria 1059
727 Ga0495629_0502262 3300046459 Bacteria 818
728 Ga0495638_0018982 3300046460 Bacteria 4554
729 Ga0495638_0546552 3300046460 Bacteria 576
730 Ga0495641_0003604 3300046461 Bacteria 11470
731 Ga0495651_0000667 3300046462 Bacteria 26661
732 Ga0495651_0005386 3300046462 Bacteria 9761
733 Ga0495651_0511816 3300046462 Bacteria 767
734 Ga0495653_0083608 3300046463 Bacteria 2353
735 Ga0495653_0749875 3300046463 Bacteria 590
736 Ga0495580_0001382 3300046472 Bacteria 21285
737 Ga0495580_0060350 3300046472 Bacteria 2664
738 Ga0495580_0138889 3300046472 Bacteria 1685
739 Ga0495582_0000298 3300046473 Bacteria 27399
740 Ga0495582_0078675 3300046473 Bacteria 1829
741 Ga0495605_0161371 3300046474 Bacteria 995
742 Ga0495639_0000282 3300046475 Bacteria 25018
743 Ga0495639_0003381 3300046475 Bacteria 6913
744 Ga0495662_0000058 3300046476 Bacteria 37987
745 Ga0495662_0058347 3300046476 Bacteria 1864
746 Ga0495662_0094186 3300046476 Bacteria 1462
747 Ga0495662_0424564 3300046476 Bacteria 653
748 Ga0495662_0430480 3300046476 Bacteria 648
749 Ga0495664_0001603 3300046477 Bacteria 12028
750 Ga0495664_0002049 3300046477 Bacteria 10785
751 Ga0495664_0050287 3300046477 Bacteria 2475
752 Ga0495664_0308118 3300046477 Bacteria 955
753 Ga0495584_0237380 3300046491 Bacteria 927
754 Ga0495585_0186539 3300046492 Bacteria 1063
755 Ga0495594_0005015 3300046499 Bacteria 6814
756 Ga0495594_0058940 3300046499 Bacteria 2122
757 Ga0495594_0073373 3300046499 Bacteria 1905
758 Ga0495596_0185536 3300046500 Bacteria 809
759 Ga0495607_0163339 3300046501 Bacteria 1130
760 Ga0495607_0266296 3300046501 Bacteria 819
761 Ga0495583_0114782 3300046506 Bacteria 1139
762 Ga0495606_0225218 3300046507 Bacteria 1054
763 Ga0495606_0242701 3300046507 Bacteria 1004
764 Ga0495606_0382637 3300046507 Bacteria 738
765 Ga0495608_0002282 3300046511 Bacteria 13836
766 Ga0495608_0031166 3300046511 Bacteria 3606
767 Ga0495608_0111599 3300046511 Bacteria 1758
768 Ga0495608_0799149 3300046511 Bacteria 557
769 Ga0495610_0184572 3300046512 Bacteria 865
770 Ga0495616_0045329 3300046513 Bacteria 2226
771 Ga0495616_0239836 3300046513 Bacteria 782
772 Ga0495618_0028852 3300046514 Bacteria 3459
773 Ga0495618_0166773 3300046514 Bacteria 1402
774 Ga0495620_0172486 3300046515 Bacteria 838
775 Ga0495628_0017091 3300046516 Bacteria 6044
776 Ga0495628_0066411 3300046516 Bacteria 2820
777 Ga0495628_0069102 3300046516 Bacteria 2755
778 Ga0495628_0839546 3300046516 Bacteria 641
779 Ga0495630_0008565 3300046517 Bacteria 7339
780 Ga0495630_0097270 3300046517 Bacteria 2226
781 Ga0495630_0103613 3300046517 Bacteria 2153
782 Ga0495631_0125796 3300046518 Bacteria 1102
783 Ga0495637_0148775 3300046520 Bacteria 885
784 Ga0495643_0219741 3300046522 Bacteria 902
785 Ga0495648_0000943 3300046524 Bacteria 30112
786 Ga0495648_0085628 3300046524 Bacteria 1780
787 Ga0495663_0026232 3300046525 Bacteria 1705
788 Ga0495666_0118980 3300046526 Bacteria 1238
789 Ga0495666_0122456 3300046526 Bacteria 1218
790 Ga0495652_0011826 3300046529 Bacteria 7888
791 Ga0495652_0061724 3300046529 Bacteria 3162
792 Ga0495652_0080485 3300046529 Bacteria 2690
793 Ga0495652_0091420 3300046529 Bacteria 2488
794 Ga0495652_0560890 3300046529 Bacteria 784
795 Ga0495654_0209272 3300046530 Bacteria 830
796 Ga0495665_0008719 3300046531 Bacteria 5505
797 Ga0495665_0017901 3300046531 Bacteria 3807
798 Ga0495640_0000617 3300046533 Bacteria 26230
799 Ga0495640_0020220 3300046533 Bacteria 4903
800 Ga0495640_0025442 3300046533 Bacteria 4294
801 Ga0495586_0145396 3300046535 Bacteria 1332
802 Ga0495586_0778416 3300046535 Bacteria 552
803 Ga0495587_0166367 3300046536 Bacteria 1253
804 Ga0495587_0181478 3300046536 Bacteria 1193
805 Ga0495587_0248772 3300046536 Bacteria 999
806 Ga0495587_0508810 3300046536 Bacteria 666
807 Ga0495609_0328833 3300046538 Bacteria 619
808 Ga0495621_0438974 3300046539 Bacteria 557
809 Ga0495645_0026862 3300046543 Bacteria 4181
810 Ga0495645_0116716 3300046543 Bacteria 1883
811 Ga0495622_0009108 3300046557 Bacteria 4596
812 Ga0495622_0037656 3300046557 Bacteria 2253
813 Ga0495622_0055403 3300046557 Bacteria 1839
814 Ga0495633_0082120 3300046558 Bacteria 1499
815 Ga0495667_0001870 3300046559 Bacteria 13969
816 Ga0495667_0034818 3300046559 Bacteria 3367
817 Ga0495668_0104639 3300046616 Bacteria 1548
818 Ga0495668_0448078 3300046616 Bacteria 710
819 Ga0495668_0646859 3300046616 Bacteria 584
820 Ga0495634_0000502 3300046642 Bacteria 38371
821 Ga0495634_0018374 3300046642 Bacteria 4977
822 Ga0495634_0030388 3300046642 Bacteria 3731
823 Ga0495634_0045287 3300046642 Bacteria 2975
824 Ga0495611_0201695 3300046648 Bacteria 927
825 Ga0495611_0275208 3300046648 Bacteria 778
826 Ga0495611_0519960 3300046648 Bacteria 540
827 Ga0495625_0100049 3300046660 Bacteria 1993
828 Ga0495625_0110135 3300046660 Bacteria 1883
829 Ga0495625_0460267 3300046660 Bacteria 784
830 Ga0495635_0000178 3300046663 Bacteria 40063
831 Ga0495635_0000278 3300046663 Bacteria 32846
832 Ga0495635_0073539 3300046663 Bacteria 2341
833 Ga0495635_0263784 3300046663 Bacteria 1159
834 Ga0495635_0454895 3300046663 Bacteria 846
835 Ga0495661_0513458 3300046665 Bacteria 570
836 Ga0495661_0634129 3300046665 Bacteria 500
837 Ga0495588_0001173 3300046674 Bacteria 11276
838 Ga0495588_0005976 3300046674 Bacteria 5458
839 Ga0495588_0028399 3300046674 Bacteria 2800
840 Ga0495657_0002467 3300046675 Bacteria 15564
841 Ga0495657_0011096 3300046675 Bacteria 6754
842 Ga0495657_0150232 3300046675 Bacteria 1447
843 Ga0495599_0001883 3300046678 Bacteria 12153
844 Ga0495599_0173105 3300046678 Bacteria 1331
845 Ga0495623_0002455 3300046679 Bacteria 12298
846 Ga0495623_0030832 3300046679 Bacteria 3449
847 Ga0495646_0023137 3300046680 Bacteria 3912
848 Ga0495646_0046271 3300046680 Bacteria 2653
849 Ga0495646_0067895 3300046680 Bacteria 2106
850 Ga0495647_0000555 3300046681 Bacteria 10991
851 Ga0495647_0017376 3300046681 Bacteria 2544
852 Ga0495658_0006651 3300046683 Bacteria 5683
853 Ga0495658_0007642 3300046683 Bacteria 5359
854 Ga0495658_0456172 3300046683 Bacteria 817
855 Ga0495669_0124011 3300046684 Bacteria 1213
856 Ga0495669_0383256 3300046684 Bacteria 680
857 Ga0495613_0027216 3300046689 Bacteria 4255
858 Ga0495613_0047301 3300046689 Bacteria 3178
859 Ga0495613_0072358 3300046689 Bacteria 2513
860 Ga0495613_0101301 3300046689 Bacteria 2080
861 Ga0495624_0003669 3300046690 Bacteria 11352
862 Ga0495624_0070763 3300046690 Bacteria 2171
863 Ga0495670_0446576 3300046691 Bacteria 700
864 Ga0495671_0412285 3300046692 Bacteria 646
865 Ga0495649_0519942 3300046694 Bacteria 591
866 Ga0495589_0557236 3300046794 Bacteria 522
867 Ga0495600_0003603 3300046809 Bacteria 9126
868 Ga0495600_0004239 3300046809 Bacteria 8565
869 Ga0495600_0113928 3300046809 Bacteria 1761
870 Ga0495600_0212154 3300046809 Bacteria 1240
871 Ga0495581_0000111 3300047315 Bacteria 34508
872 Ga0495581_0021494 3300047315 Bacteria 3739
873 Ga0495581_0215155 3300047315 Bacteria 1123
874 Ga0495604_0002068 3300047317 Bacteria 16200
875 Ga0495604_0005311 3300047317 Bacteria 10226
876 Ga0495604_0098811 3300047317 Bacteria 2149
877 Ga0495604_0153460 3300047317 Bacteria 1634
878 Ga0495604_0238274 3300047317 Bacteria 1245
879 Ga0495604_0279226 3300047317 Bacteria 1129
880 Ga0495674_0002855 3300047319 Bacteria 16780
881 Ga0495674_0010735 3300047319 Bacteria 8663
882 Ga0495674_0070478 3300047319 Bacteria 3020
883 Ga0495674_0103046 3300047319 Bacteria 2426
884 Ga0495674_0967522 3300047319 Bacteria 654
885 Ga0495672_0008900 3300047320 Bacteria 7336
886 Ga0495672_0264656 3300047320 Bacteria 828
887 Ga0495672_0289121 3300047320 Bacteria 780
888 Ga0495672_0329173 3300047320 Bacteria 715
889 Ga0495676_0076061 3300047321 Bacteria 2565
890 Ga0495676_0292374 3300047321 Bacteria 1100
891 Ga0495680_0007580 3300047322 Bacteria 9924
892 Ga0495683_0082250 3300047323 Bacteria 1569
893 Ga0495675_0001321 3300047444 Bacteria 15015
894 Ga0495675_0005803 3300047444 Bacteria 7543
895 Ga0495675_0118673 3300047444 Bacteria 1648
896 Ga0495677_0363546 3300047445 Bacteria 571
897 Ga0495685_146176 3300047447 Bacteria 769
898 Ga0495673_0027696 3300047469 Bacteria 2693
899 Ga0495673_0090503 3300047469 Bacteria 1251
900 Ga0495673_0112321 3300047469 Bacteria 1088
901 Ga0495673_0323057 3300047469 Bacteria 549
902 Ga0495681_0153397 3300047470 Bacteria 965
903 Ga0495681_0208200 3300047470 Bacteria 790
904 Ga0495684_0000161 3300047471 Bacteria 50269
905 Ga0495684_0012187 3300047471 Bacteria 6633
906 Ga0495684_0100118 3300047471 Bacteria 2191
907 Ga0495686_0023065 3300047472 Bacteria 4112
908 Ga0495686_0082124 3300047472 Bacteria 1967
909 Ga0495686_0461142 3300047472 Bacteria 674
910 Ga0495593_0000210 3300047673 Bacteria 30957
911 Ga0495593_0031631 3300047673 Bacteria 2889
912 Ga0495593_0035968 3300047673 Bacteria 2686
913 Ga0495593_0191695 3300047673 Bacteria 1028
914 Ga0495602_0016051 3300048088 Bacteria 7536
915 Ga0495602_0102410 3300048088 Bacteria 2346
916 Ga0495614_0008531 3300048089 Bacteria 4555
917 Ga0495614_0095767 3300048089 Bacteria 1294
918 Ga0495614_0513404 3300048089 Bacteria 571
919 Ga0495626_0222555 3300048091 Bacteria 766
920 Ga0496100_0034851 3300048903 Bacteria 3162
921 Ga0496100_0100995 3300048903 Bacteria 1988
922 Ga0496100_0498269 3300048903 Bacteria 938
923 Ga0496100_1367123 3300048903 Bacteria 559
924 Ga0496101_0002918 3300048904 Bacteria 10515
925 Ga0496101_0106500 3300048904 Bacteria 2105
926 Ga0496101_1232576 3300048904 Bacteria 586
927 Ga0496101_1390824 3300048904 Bacteria 547
928 Ga0496102_0018118 3300048905 Bacteria 6180
929 Ga0496102_0019762 3300048905 Bacteria 5937
930 Ga0496102_0023714 3300048905 Bacteria 5452
931 Ga0496102_0502472 3300048905 Bacteria 1135
932 Ga0496102_0536240 3300048905 Bacteria 1093
933 Ga0496102_1129153 3300048905 Bacteria 703
934 Ga0496103_0025993 3300048906 Bacteria 3541
935 Ga0496103_0545605 3300048906 Bacteria 740
936 Ga0496104_0005931 3300048907 Bacteria 10694
937 Ga0496104_0166136 3300048907 Bacteria 2116
938 Ga0496104_0360321 3300048907 Bacteria 1366
939 Ga0496104_0570136 3300048907 Bacteria 1042
940 Ga0496104_0864725 3300048907 Bacteria 809
941 Ga0496105_0004596 3300048908 Bacteria 10399
942 Ga0496105_0013161 3300048908 Bacteria 6560
943 Ga0496106_0066930 3300048909 Bacteria 2737
944 Ga0496106_0081280 3300048909 Bacteria 2489
945 Ga0496106_0215946 3300048909 Bacteria 1528
946 Ga0496106_0247267 3300048909 Bacteria 1425
947 Ga0496107_0021320 3300048910 Bacteria 4579
948 Ga0496107_0041856 3300048910 Bacteria 3290
949 Ga0496107_0089617 3300048910 Bacteria 2246
950 Ga0496107_0511623 3300048910 Bacteria 890
951 Ga0496108_0095878 3300048911 Bacteria 2526
952 Ga0496108_0129556 3300048911 Bacteria 2168
953 Ga0496108_0146743 3300048911 Bacteria 2034
954 Ga0496108_0342254 3300048911 Bacteria 1305
955 Ga0496108_0388646 3300048911 Bacteria 1218
956 Ga0496108_0848401 3300048911 Bacteria 786
957 Ga0496109_0154877 3300048912 Bacteria 2146
958 Ga0496109_0338722 3300048912 Bacteria 1420
959 Ga0496109_0387458 3300048912 Bacteria 1320
960 Ga0496109_1329796 3300048912 Bacteria 654
961 Ga0496109_1475083 3300048912 Bacteria 615
962 Ga0496110_0029782 3300048913 Bacteria 4702
963 Ga0496110_0031507 3300048913 Bacteria 4575
964 Ga0496110_0365687 3300048913 Bacteria 1314
965 Ga0496110_0502080 3300048913 Bacteria 1104
966 Ga0496111_0021573 3300048914 Bacteria 4500
967 Ga0496111_0023000 3300048914 Bacteria 4371
968 Ga0496111_0173789 3300048914 Bacteria 1601
969 Ga0496111_0638328 3300048914 Bacteria 778
970 Ga0496111_0697659 3300048914 Bacteria 738
971 Ga0496112_0007361 3300048915 Bacteria 9767
972 Ga0496112_0054601 3300048915 Bacteria 3925
973 Ga0496112_0098430 3300048915 Bacteria 2894
974 Ga0496112_0274029 3300048915 Bacteria 1635
975 Ga0496112_0693491 3300048915 Bacteria 946
976 Ga0496112_1602149 3300048915 Bacteria 564
977 Ga0496113_0003380 3300048916 Bacteria 9540
978 Ga0496113_0029699 3300048916 Bacteria 3951
979 Ga0496113_0122933 3300048916 Bacteria 2031
980 Ga0496113_0429388 3300048916 Bacteria 1061
981 Ga0496114_0148974 3300048917 Bacteria 2029
982 Ga0496114_0199875 3300048917 Bacteria 1751
983 Ga0496114_0386682 3300048917 Bacteria 1239
984 Ga0496114_0660316 3300048917 Bacteria 919
985 Ga0496114_1544804 3300048917 Bacteria 552
986 Ga0496115_0034573 3300048918 Bacteria 3994
987 Ga0496115_0040822 3300048918 Bacteria 3690
988 Ga0496115_0292683 3300048918 Bacteria 1335
989 Ga0496115_1129355 3300048918 Bacteria 592
990 Ga0496116_0053113 3300048919 Bacteria 2679
991 Ga0496116_0063780 3300048919 Bacteria 2372
992 Ga0496116_0179849 3300048919 Bacteria 1134
993 Ga0496117_0044061 3300048920 Bacteria 3235
994 Ga0496117_0074361 3300048920 Bacteria 2262
995 Ga0496117_0314083 3300048920 Bacteria 824
996 Ga0496118_0021634 3300048921 Bacteria 5653
997 Ga0496118_0022102 3300048921 Bacteria 5574
998 Ga0496118_0071024 3300048921 Bacteria 2509
999 Ga0496118_0099007 3300048921 Bacteria 1978
1000 Ga0496119_0030902 3300048922 Bacteria 3602
1001 Ga0496119_0055976 3300048922 Bacteria 2392
1002 Ga0496119_0137517 3300048922 Bacteria 1323
1003 Ga0496120_0207037 3300048923 Bacteria 946
1004 Ga0496121_0000416 3300048924 Bacteria 84469
1005 Ga0496121_0011106 3300048924 Bacteria 10051
1006 Ga0496121_0014503 3300048924 Bacteria 8355
1007 Ga0496121_0015708 3300048924 Bacteria 7892
1008 Ga0496121_0072330 3300048924 Bacteria 2768
1009 Ga0496121_0088558 3300048924 Bacteria 2426
1010 Ga0496121_0120898 3300048924 Bacteria 1978
1011 Ga0496121_0213927 3300048924 Bacteria 1363
1012 Ga0496121_0228970 3300048924 Bacteria 1303
1013 Ga0496121_0356325 3300048924 Bacteria 973
1014 Ga0496122_0046480 3300048925 Bacteria 3361
1015 Ga0496122_0226553 3300048925 Bacteria 1067
1016 Ga0496124_0089914 3300048927 Bacteria 2506
1017 Ga0496124_0154454 3300048927 Bacteria 1796
1018 Ga0496124_0376913 3300048927 Bacteria 994
1019 Ga0496125_0035946 3300048928 Bacteria 4334
1020 Ga0496125_0077485 3300048928 Bacteria 2562
1021 Ga0496125_0396584 3300048928 Bacteria 808
1022 Ga0496126_0030246 3300048929 Bacteria 5132
1023 Ga0496126_0052388 3300048929 Bacteria 3709
1024 Ga0496126_0090310 3300048929 Bacteria 2695
1025 Ga0496126_0090739 3300048929 Bacteria 2688
1026 Ga0496126_0104650 3300048929 Bacteria 2472
1027 Ga0496126_0212892 3300048929 Bacteria 1626
1028 Ga0496126_0327199 3300048929 Bacteria 1258
1029 Ga0495678_146514 3300049459 Bacteria 767
1030 Ga0495682_0164539 3300049460 Bacteria 790
1031 Ga0501031_0000301 3300049568 Bacteria 28182
1032 Ga0501032_0000172 3300049569 Bacteria 52773
1033 Ga0501032_0862947 3300049569 Bacteria 571
1034 Ga0501033_0001887 3300049570 Bacteria 18238
1035 Ga0501034_0000676 3300049571 Bacteria 51758
1036 Ga0501034_0061070 3300049571 Bacteria 3786
1037 Ga0501036_0000390 3300049572 Bacteria 30889
1038 Ga0501036_0353515 3300049572 Bacteria 1227
1039 Ga0501037_0004356 3300049573 Bacteria 10275
1040 Ga0501038_0000089 3300049574 Bacteria 78009
1041 Ga0501038_0145219 3300049574 Bacteria 1938
1042 Ga0501038_0764310 3300049574 Bacteria 720
1043 Ga0501039_0000114 3300049575 Bacteria 54651
1044 Ga0501040_0888471 3300049576 Bacteria 645
1045 Ga0501042_0026453 3300049578 Bacteria 4077
1046 Ga0501042_0488167 3300049578 Bacteria 894
1047 Ga0501043_0001086 3300049579 Bacteria 23917
1048 Ga0501043_0217925 3300049579 Bacteria 1477
1049 Ga0501046_0003225 3300049580 Bacteria 14988
1050 Ga0501046_0186634 3300049580 Bacteria 1548
1051 Ga0501047_0000230 3300049581 Bacteria 66338
1052 Ga0501047_0036575 3300049581 Bacteria 4746
1053 Ga0501048_0000095 3300049582 Bacteria 47963
1054 Ga0501048_1156295 3300049582 Bacteria 557
1055 Ga0501067_0003250 3300049583 Bacteria 8949
1056 Ga0501067_0059385 3300049583 Bacteria 2117
1057 Ga0501067_0188792 3300049583 Bacteria 1148
1058 Ga0501067_0613980 3300049583 Bacteria 610
1059 Ga0501068_0020314 3300049584 Bacteria 3867
1060 Ga0501069_0019111 3300049585 Bacteria 3702
1061 Ga0501069_0121511 3300049585 Bacteria 1492
1062 Ga0501069_0232355 3300049585 Bacteria 1074
1063 Ga0501070_0007130 3300049586 Bacteria 9492
1064 Ga0501070_0017328 3300049586 Bacteria 6048
1065 Ga0501070_0201837 3300049586 Bacteria 1633
1066 Ga0501070_0835721 3300049586 Bacteria 721
1067 Ga0501071_0232092 3300049587 Bacteria 1390
1068 Ga0501071_0743655 3300049587 Bacteria 755
1069 Ga0501072_0001459 3300049588 Bacteria 17737
1070 Ga0501072_0274668 3300049588 Bacteria 1341
1071 Ga0501073_0000055 3300049589 Bacteria 71726
1072 Ga0501074_0000492 3300049590 Bacteria 24146
1073 Ga0501074_0341813 3300049590 Bacteria 1062
1074 Ga0501076_0072621 3300049592 Bacteria 2754
1075 Ga0501076_0643558 3300049592 Bacteria 875
1076 Ga0501076_1624104 3300049592 Bacteria 530
1077 Ga0501077_0501692 3300049593 Bacteria 778
1078 Ga0501079_0001966 3300049741 Bacteria 14729
1079 Ga0501079_0210727 3300049741 Bacteria 1518
1080 Ga0501080_0001671 3300049742 Bacteria 18890
1081 Ga0501081_0343029 3300049743 Bacteria 1100
1082 Ga0501083_0000570 3300049744 Bacteria 23630
1083 Ga0501083_0610189 3300049744 Bacteria 710
1084 Ga0501035_0000355 3300049822 Bacteria 52714
1085 Ga0501035_1168775 3300049822 Bacteria 598
1086 Ga0501035_1434305 3300049822 Bacteria 528
1087 Ga0501044_0000546 3300049823 Bacteria 45906
1088 Ga0501044_0094300 3300049823 Bacteria 3018
1089 Ga0501045_0012777 3300049824 Bacteria 5917
1090 Ga0501045_0388572 3300049824 Bacteria 1039
1091 nmdc:mga03n38_146_c2 3300050490 Bacteria 4789
1092 nmdc:mga03n38_604358_c1 3300050490 Bacteria 625
1093 nmdc:mga00v17_696061_c1 3300050491 Bacteria 652
1094 nmdc:mga0yw44_14698_c1 3300050492 Bacteria 4166
1095 nmdc:mga0yw44_190697_c1 3300050492 Bacteria 1352
1096 nmdc:mga0yw44_91986_c1 3300050492 Bacteria 1919
1097 nmdc:mga06z11_131674_c1 3300050494 Bacteria 1405
1098 nmdc:mga06z11_58590_c1 3300050494 Bacteria 1999
1099 nmdc:mga04h51_11225_c1 3300050495 Bacteria 1404
1100 nmdc:mga04h51_516562_c1 3300050495 Bacteria 512
1101 nmdc:mga07m45_328577_c2 3300050496 Bacteria 566
1102 nmdc:mga07m45_365629_c1 3300050496 Bacteria 838
1103 nmdc:mga0n895_245003_c1 3300050512 Bacteria 1819
1104 nmdc:mga0n895_896011_c1 3300050512 Bacteria 873
1105 nmdc:mga0rr50_119377_c1 3300050513 Bacteria 2096
1106 nmdc:mga08x19_280221_c1 3300050514 Bacteria 1155
1107 nmdc:mga0a205_1182474_c1 3300050515 Bacteria 612
1108 Ga0495601_0073688 3300053077 Bacteria 2183
1109 Ga0495601_0122184 3300053077 Bacteria 1692
1110 Ga0495601_0148842 3300053077 Bacteria 1528
1111 Ga0495601_0201206 3300053077 Bacteria 1301
1112 Ga0495601_0493014 3300053077 Bacteria 791
1113 Ga0495612_0006238 3300053078 Bacteria 4911
1114 Ga0495612_0051061 3300053078 Bacteria 1699
1115 Ga0495612_0234020 3300053078 Bacteria 815
1116 Ga0495612_0265549 3300053078 Bacteria 765
1117 Ga0495612_0274612 3300053078 Bacteria 752
1118 Ga0500610_0074278 3300053079 Bacteria 1773
1119 Ga0500610_0102904 3300053079 Bacteria 1476
1120 Ga0500635_0048895 3300053080 Bacteria 1442
1121 Ga0495595_0040765 3300053084 Bacteria 2123
1122 Ga0495595_0181672 3300053084 Bacteria 1043
1123 Ga0495619_0012613 3300053085 Bacteria 5319
1124 Ga0495619_0044373 3300053085 Bacteria 2918
1125 Ga0495619_0283041 3300053085 Bacteria 1149
1126 Ga0495619_0808084 3300053085 Bacteria 634
1127 Ga0500643_000278 3300053087 Bacteria 44354
1128 Ga0500646_0390932 3300053090 Bacteria 512
1129 Ga0500647_0077634 3300053091 Bacteria 1593
1130 Ga0500583_0048514 3300053092 Bacteria 1960
1131 Ga0500641_0005143 3300053096 Bacteria 4636
1132 Ga0500641_0017084 3300053096 Bacteria 2708
1133 Ga0500641_0030621 3300053096 Bacteria 2116
1134 Ga0500648_200584 3300053097 Bacteria 1003
1135 Ga0500555_001487 3300053103 Bacteria 7124
1136 Ga0500556_0104326 3300053104 Bacteria 1094
1137 Ga0500556_0214401 3300053104 Bacteria 760
1138 Ga0500557_000028 3300053105 Bacteria 78414
1139 Ga0500558_207792 3300053106 Bacteria 676
1140 Ga0500562_006678 3300053108 Bacteria 2908
1141 Ga0500592_052706 3300053116 Bacteria 662
1142 Ga0500595_000653 3300053119 Bacteria 20857
1143 Ga0500595_008924 3300053119 Bacteria 4072
1144 Ga0500595_046793 3300053119 Bacteria 1358
1145 Ga0500595_170266 3300053119 Bacteria 605
1146 Ga0500597_192449 3300053120 Bacteria 860
1147 Ga0500614_151196 3300053123 Bacteria 699
1148 Ga0500642_0000590 3300053130 Bacteria 10893
1149 Ga0500642_0189905 3300053130 Bacteria 958
1150 Ga0500652_158762 3300053131 Bacteria 935
1151 Ga0500568_0040122 3300053139 Bacteria 1886
1152 Ga0500568_0141723 3300053139 Bacteria 891
1153 Ga0500573_0176496 3300053140 Bacteria 1151
1154 Ga0500577_0065705 3300053142 Bacteria 1409
1155 Ga0500604_0091899 3300053151 Bacteria 992
1156 Ga0500604_0132514 3300053151 Bacteria 839
1157 Ga0500604_0193759 3300053151 Bacteria 698
1158 Ga0500616_0097299 3300053153 Bacteria 1445
1159 Ga0500619_229152 3300053154 Bacteria 617
1160 Ga0500622_0038166 3300053156 Bacteria 2506
1161 Ga0500633_0101430 3300053160 Bacteria 1059
1162 Ga0500638_125829 3300053162 Bacteria 1167
1163 Ga0500638_182850 3300053162 Bacteria 903
1164 Ga0500636_0416206 3300053177 Bacteria 618
1165 Ga0500636_0461383 3300053177 Bacteria 571
1166 Ga0500636_0473449 3300053177 Bacteria 560
1167 Ga0500637_0211898 3300053178 Bacteria 1099
1168 Ga0500645_050563 3300053730 Bacteria 1213
1169 Ga0500596_008868 3300053735 Bacteria 1590
1170 Ga0500599_022802 3300053736 Bacteria 896
1171 Ga0501084_0001687 3300054114 Bacteria 17561
1172 Ga0501082_0009399 3300060353 Bacteria 8417
1173 Ga0466962_0217020 3300061719 Bacteria 936
1174 2513677979 2513237098 Bacteria 9902361
1175 2513715566 2513237104 Bacteria 10034502
1176 2514016366 2513237161 Bacteria 8871253
1177 2517106999 2517093001 Bacteria 9002274
1178 2524435608 2524023205 Bacteria 8918781
1179 2524468343 2524023210 Bacteria 9029266
1180 2528858118 2528768022 Bacteria 10457665
1181 2617352931 2617270735 Bacteria 9163226
1182 2745079864 2744054633 Bacteria 8678936
1183 2824608406 2824600985 Bacteria 8488197
1184 2824617434 2824609381 Bacteria 8672835
1185 2824659991 2824653114 Bacteria 8493680
1186 2824669191 2824661429 Bacteria 9877870
1187 2824674753 2824671348 Bacteria 8369588
1188 2824694625 2824687955 Bacteria 8360029
1189 2824779850 2824773399 Bacteria 8360218
1190 2838130226 2838122688 Bacteria 8803140
1191 2841944331 2841941048 Bacteria 8688029
1192 2841954492 2841949485 Bacteria 8680857
1193 2841969108 2841966195 Bacteria 8673214
1194 2841979882 2841974524 Bacteria 8931498
1195 2841990937 2841983080 Bacteria 8395090
1196 2842044013 2842038055 Bacteria 8002051
1197 2842051998 2842045827 Bacteria 8006841
1198 2849082549 2849076700 Bacteria 7039503
1199 2876764518 2876761206 Bacteria 10111113
1200 2879099951 2879099564 Bacteria 10442239
1201 2885368123 2885366525 Bacteria 8326213
1202 2885384657 2885383462 Bacteria 9473874
1203 2888391160 2888388044 Bacteria 7304136
1204 2888420909 2888419890 Bacteria 7857137
1205 2903773441 2903768456 Bacteria 9749579
1206 2906651304 2906643746 Bacteria 8722424
1207 2922378500
1208 2929622413 2929615660 Bacteria 9193770
1209 2929631370 2929624759 Bacteria 9339455
1210 2932786212 2932784394 Bacteria 9704911
1211 2932816855 2932809354 Bacteria 9135765
1212 2932825995 2932818245 Bacteria 9955613
1213 2932829450 2932828146 Bacteria 9745859
1214 2933584507 2933577622 Bacteria 9116884
1215 2935617882 2935616580 Bacteria 9032984
1216 2935641634 2935638405 Bacteria 10015038
1217 2935669308 2935665750 Bacteria 9571747
1218 2935678096 2935675223 Bacteria 9928132
1219 2935693585 2935684952 Bacteria 9590419
1220 2935702905 2935694250 Bacteria 9291695
1221 2935707131 2935703347 Bacteria 10242284
1222 2935716949 2935713505 Bacteria 9608509
1223 2935730217 2935722832 Bacteria 9608746
1224 2935738388 2935732158 Bacteria 9706831
1225 2935750176 2935741537 Bacteria 9707219
1226 2935759770 2935750917 Bacteria 9590372
1227 2935764579 2935760218 Bacteria 9817913
1228 2935804488 2935801545 Bacteria 9301974
1229 2935819111 2935810662 Bacteria 9401221
1230 2935831365 2935827899 Bacteria 10038562
1231 2935841974 2935837841 Bacteria 9454360
1232 2935856619 2935855204 Bacteria 9035059
1233 2935870234 2935864058 Bacteria 9784707
1234 2935874441 2935873716 Bacteria 9632195
1235 2935964279 2935959822 Bacteria 7869783
1236 2935993902 2935992306 Bacteria 9802711
1237 2936005087 2936002035 Bacteria 9362176
1238 2936045738 2936037263 Bacteria 9446081
1239 2940565776 2940556831 Bacteria 9590747
1240 2941547025 2941538514 Bacteria 9402094
1241 3005509666 3005506211 Bacteria 6943378
1242 8016518786 8016511872 Bacteria 9921665
1243 8016585652 8016583857 Bacteria 10421953
1244 8017057893 8017057580 Bacteria 10023680
1245 8019577831 8019576017 Bacteria 10049540
1246 8019595933 8019586578 Bacteria 10212056
1247 8019605822 8019597564 Bacteria 10041141
1248 8019612712 8019608314 Bacteria 10042931
1249 8055750864 8055742211 Bacteria 9226248
1250 8056688974 8056681323 Bacteria 8472857
1251 Ga0496126_0093204
1252 JGI24740J21852_10040614
1253 JGI24740J21852_10100766
1254 JGI24739J22299_10018096
1255 JGI24737J22298_10035570
1256 JGI24735J21928_10030238
1257 JGI24738J21930_10096468
1258 JGI25165J46597_1007530
1259 JGI25153J46596_10002724
1260 JGI25153J46596_10006859
1261 JGI25153J46596_10014488
1262 JGI25160J50197_1002595
1263 JGI25160J50197_1013590
1264 JGI25404J52841_10003219
1265 JGI25404J52841_10005710
1266 JGI25404J52841_10025523
1267 JGI25404J52841_10111207
1268 JGI25404J52841_10121062
1269 JGI25404J52841_10129328
1270 JGI25404J52841_10140125
1271 Ga0055539_1011455
1272 Ga0055543_1001923
1273 Ga0065165_1001543
1274 Ga0065165_1004042
1275 Ga0065715_10239338
1276 Ga0070683_100031957
1277 Ga0070683_100547266
1278 Ga0070683_101367249
1279 Ga0070690_100149207
1280 Ga0070670_100367474
1281 Ga0070670_101722591
1282 Ga0068869_100069180
1283 Ga0068869_100172885
1284 Ga0070666_10241331
1285 Ga0070680_100307419
1286 Ga0070680_101138019
1287 Ga0070680_101896680
1288 Ga0070682_100071496
1289 Ga0070682_100379289
1290 Ga0070682_100560656
1291 Ga0070682_100615341
1292 Ga0070682_101273408
1293 Ga0070682_101938668
1294 Ga0068868_100286918
1295 Ga0068868_100830954
1296 Ga0070689_100359098
1297 Ga0070691_10139385
1298 Ga0070661_100019593
1299 Ga0070661_100055569
1300 Ga0070661_100994375
1301 Ga0070661_101879465
1302 Ga0070692_11016861
1303 Ga0070668_100042894
1304 Ga0070668_100571802
1305 Ga0070668_101213960
1306 Ga0070669_100550689
1307 Ga0070675_101082660
1308 Ga0070671_100085250
1309 Ga0070671_100152494
1310 Ga0070671_100308929
1311 Ga0070673_101160772
1312 Ga0070688_100704014
1313 Ga0070688_101288106
1314 Ga0070667_100554409
1315 Ga0070709_10157291
1316 Ga0070709_10473753
1317 Ga0070709_11454503
1318 Ga0070714_100029988
1319 Ga0070714_100087283
1320 Ga0070714_102077640
1321 Ga0070713_100024907
1322 Ga0070713_100052082
1323 Ga0070713_100157708
1324 Ga0070713_100215803
1325 Ga0070713_100223729
1326 Ga0070713_100753528
1327 Ga0070713_100793763
1328 Ga0070713_101826671
1329 Ga0070710_10057595
1330 Ga0070710_10169670
1331 Ga0070710_10604326
1332 Ga0070710_11294962
1333 Ga0070710_11436279
1334 Ga0070711_100043340
1335 Ga0070711_100347004
1336 Ga0070711_100809903
1337 Ga0070700_100736280
1338 Ga0070663_100090328
1339 Ga0070663_100114379
1340 Ga0070663_100137801
1341 Ga0070663_100287099
1342 Ga0070663_100289594
1343 Ga0070663_100573844
1344 Ga0070663_100628560
1345 Ga0070663_101282564
1346 Ga0070678_102177391
1347 Ga0070662_100252298
1348 Ga0070662_101273569
1349 Ga0070681_10072573
1350 Ga0070681_10694972
1351 Ga0070681_11134686
1352 Ga0068867_101436807
1353 Ga0070706_100069420
1354 Ga0070707_100171097
1355 Ga0070698_100049630
1356 Ga0070698_100610121
1357 Ga0070698_101757010
1358 Ga0070679_100076441
1359 Ga0070679_100172660
1360 Ga0070679_100314036
1361 Ga0070684_100040027
1362 Ga0070697_101222492
1363 Ga0068853_100024444
1364 Ga0068853_100027664
1365 Ga0068853_100084290
1366 Ga0068853_100228164
1367 Ga0068853_100304177
1368 Ga0068853_100595171
1369 Ga0068853_100798688
1370 Ga0068853_101030539
1371 Ga0068853_101096187
1372 Ga0068853_101910414
1373 Ga0070672_101106862
1374 Ga0070686_100452254
1375 Ga0070686_101036394
1376 Ga0070693_100181272
1377 Ga0070693_100901114
1378 Ga0070665_100086930
1379 Ga0070665_100160756
1380 Ga0070665_100271889
1381 Ga0070665_100635545
1382 Ga0070665_100724062
1383 Ga0070665_100916929
1384 Ga0070665_101047453
1385 Ga0070665_101891907
1386 Ga0070704_100756419
1387 Ga0068855_100055564
1388 Ga0068855_100201635
1389 Ga0068855_100602453
1390 Ga0068855_100803523
1391 Ga0068855_100809056
1392 Ga0068855_100964270
1393 Ga0068855_101778643
1394 Ga0068855_102064694
1395 Ga0068855_102605036
1396 Ga0070664_100165043
1397 Ga0070664_100660711
1398 Ga0070664_100765455
1399 Ga0070664_101460507
1400 Ga0068857_100003131
1401 Ga0068857_100031174
1402 Ga0068857_100132504
1403 Ga0068857_100799322
1404 Ga0068854_100008309
1405 Ga0068854_100522690
1406 Ga0068854_100878325
1407 Ga0068856_100073867
1408 Ga0068856_100100242
1409 Ga0068856_100162266
1410 Ga0068856_100363125
1411 Ga0068856_101489134
1412 Ga0068856_101748870
1413 Ga0068856_102486254
1414 Ga0070702_100896953
1415 Ga0070702_101145875
1416 Ga0070702_101537333
1417 Ga0068852_100136236
1418 Ga0068852_100465641
1419 Ga0068852_101369889
1420 Ga0068852_102294111
1421 Ga0068859_100113160
1422 Ga0068859_100325970
1423 Ga0068859_100465838
1424 Ga0068859_101595023
1425 Ga0068866_10745753
1426 Ga0068861_100261871
1427 Ga0068861_100804464
1428 Ga0068861_101529580
1429 Ga0068851_10001649
1430 Ga0068851_10027032
1431 Ga0068851_10220891
1432 Ga0068870_11323214
1433 Ga0068863_100385662
1434 Ga0068863_100407934
1435 Ga0068858_100120255
1436 Ga0068858_101204374
1437 Ga0068862_101106662
1438 Ga0081455_10036986
1439 Ga0081455_10047126
1440 Ga0081455_10950013
1441 Ga0081455_11028642
1442 Ga0081538_10033090
1443 Ga0081538_10088138
1444 Ga0081540_1002008
1445 Ga0081540_1002669
1446 Ga0081540_1004358
1447 Ga0081540_1013548
1448 Ga0081540_1016623
1449 Ga0081540_1017941
1450 Ga0081540_1058758
1451 Ga0081540_1156007
1452 Ga0081540_1227991
1453 Ga0081540_1256499
1454 Ga0081540_1280575
1455 Ga0081540_1331912
1456 Ga0081539_10000902
1457 Ga0081539_10012998
1458 Ga0081539_10264041
1459 Ga0081539_10360055
1460 Ga0070717_10029119
1461 Ga0070717_10127050
1462 Ga0070717_10339663
1463 Ga0070717_11377629
1464 Ga0075365_10025042
1465 Ga0075365_10234247
1466 Ga0075368_10002408
1467 Ga0075368_10095576
1468 Ga0075363_100000457
1469 Ga0075363_100273791
1470 Ga0075363_100589058
1471 Ga0075364_10089293
1472 Ga0070716_100401581
1473 Ga0070712_100238466
1474 Ga0070712_100281435
1475 Ga0075362_10014331
1476 Ga0075362_10084138
1477 Ga0075367_10017461
1478 Ga0075367_10079893
1479 Ga0075367_10227306
1480 Ga0075366_10067485
1481 Ga0075366_10074999
1482 Ga0097621_100550989
1483 Ga0097621_100662267
1484 Ga0075370_10043541
1485 Ga0075370_10082365
1486 Ga0075370_10177373
1487 Ga0075370_10244088
1488 Ga0075370_10368466
1489 Ga0075370_11043211
1490 Ga0068871_100693171
1491 Ga0068871_100891808
1492 Ga0075434_100016914
1493 Ga0075434_100590644
1494 Ga0075436_100306510
1495 Ga0097620_100113159
1496 Ga0097620_100325970
1497 Ga0097620_100465853
1498 Ga0097620_101595137
1499 Ga0099794_10093466
1500 Ga0099795_10235221
1501 Ga0105251_10415890
1502 Ga0105250_10071694
1503 Ga0105240_10014949
1504 Ga0105240_10019882
1505 Ga0105240_10143012
1506 Ga0105240_10164801
1507 Ga0105240_10226359
1508 Ga0105240_10328349
1509 Ga0105240_11027213
1510 Ga0105245_10233828
1511 Ga0105245_10499909
1512 Ga0105245_10908103
1513 Ga0105245_11376847
1514 Ga0105245_11602851
1515 Ga0105247_10122301
1516 Ga0105247_10181027
1517 Ga0105247_10194459
1518 Ga0105247_11372860
1519 Ga0105243_10160026
1520 Ga0105243_10319802
1521 Ga0105243_11095100
1522 Ga0105243_11429303
1523 Ga0105241_10394480
1524 Ga0105241_10487179
1525 Ga0105241_10560917
1526 Ga0105242_10138692
1527 Ga0105242_10401226
1528 Ga0105242_13116887
1529 Ga0105248_10070400
1530 Ga0105248_10123366
1531 Ga0105248_10520449
1532 Ga0105248_12598562
1533 Ga0105248_12788544
1534 Ga0105237_10028929
1535 Ga0105237_10048231
1536 Ga0105237_10108333
1537 Ga0105237_10401055
1538 Ga0105237_10859994
1539 Ga0105237_11556942
1540 Ga0105237_11581436
1541 Ga0105237_12783856
1542 Ga0105238_10105864
1543 Ga0105238_10212171
1544 Ga0105238_10990799
1545 Ga0105249_10027700
1546 Ga0105249_10693850
1547 Ga0099796_10086991
1548 Ga0105239_10052448
1549 Ga0105239_10230018
1550 Ga0105239_10302257
1551 Ga0105239_10771620
1552 Ga0105239_12164931
1553 Ga0105239_12548433
1554 Ga0105239_13040845
1555 Ga0105246_10159510
1556 Ga0105246_10354015
1557 Ga0105246_10956650
1558 Ga0105246_11534297
1559 Ga0105246_12424393
1560 Ga0157373_10366731
1561 Ga0157373_11218541
1562 Ga0157371_10254843
1563 Ga0157370_10160110
1564 Ga0157370_10232227
1565 Ga0157370_10626551
1566 Ga0157369_10004460
1567 Ga0157369_10018976
1568 Ga0157369_12148914
1569 Ga0157374_10110734
1570 Ga0157374_10164047
1571 Ga0163162_10110973
1572 Ga0163162_10858613
1573 Ga0163162_10887786
1574 Ga0163162_12055559
1575 Ga0157372_10045484
1576 Ga0157372_10481603
1577 Ga0157372_11680354
1578 Ga0157375_10067779
1579 Ga0157375_10120122
1580 Ga0157375_12745228
1581 Ga0163163_10315548
1582 Ga0163163_11983504
1583 Ga0157379_10059342
1584 Ga0157379_10331322
1585 Ga0157379_10371414
1586 Ga0157379_10580625
1587 Ga0157379_11409749
1588 Ga0157376_10624820
1589 Ga0182006_1104364
1590 Ga0182007_10159157
1591 Ga0163161_11398692
1592 Ga0163161_11472570
1593 Ga0206354_10622256
1594 Ga0154015_1445201
1595 Ga0213872_10034797
1596 Ga0213876_10176160
1597 Ga0213875_10065765
1598 Ga0213871_10194272
1599 Ga0224712_10268563
1600 Ga0224712_10589203
1601 Ga0209563_103179
1602 Ga0209677_100434
1603 Ga0209677_102685
1604 Ga0209148_1009199
1605 Ga0209233_1001815
1606 Ga0209233_1008918
1607 Ga0209455_1002067
1608 Ga0209673_1056243
1609 Ga0209564_1010640
1610 Ga0209758_1000389
1611 Ga0209758_1001056
1612 Ga0209758_1004662
1613 Ga0209758_1011597
1614 Ga0209758_1047353
1615 Ga0207426_1000380
1616 Ga0207426_1001551
1617 Ga0207426_1022964
1618 Ga0207426_1080914
1619 Ga0209257_1009836
1620 Ga0209257_1125441
1621 Ga0207656_10007457
1622 Ga0207656_10115012
1623 Ga0207692_10049368
1624 Ga0207692_10188672
1625 Ga0207710_10127075
1626 Ga0207710_10305729
1627 Ga0207710_10617178
1628 Ga0207688_10102200
1629 Ga0207688_10120678
1630 Ga0207680_10311187
1631 Ga0207647_10002061
1632 Ga0207685_10062660
1633 Ga0207685_10272466
1634 Ga0207699_10085566
1635 Ga0207699_10168045
1636 Ga0207699_10238682
1637 Ga0207699_10268474
1638 Ga0207699_10312261
1639 Ga0207699_10385406
1640 Ga0207684_10109834
1641 Ga0207654_10001581
1642 Ga0207654_10103926
1643 Ga0207654_10171867
1644 Ga0207654_10413381
1645 Ga0207654_10484612
1646 Ga0207707_10001012
1647 Ga0207707_10061491
1648 Ga0207707_10638807
1649 Ga0207707_10944032
1650 Ga0207695_10000463
1651 Ga0207695_10037987
1652 Ga0207695_10106934
1653 Ga0207695_10120623
1654 Ga0207695_10162848
1655 Ga0207695_10212399
1656 Ga0207695_10431082
1657 Ga0207695_10886801
1658 Ga0207671_10259805
1659 Ga0207671_10270361
1660 Ga0207671_10360105
1661 Ga0207671_10521249
1662 Ga0207671_10636540
1663 Ga0207671_11329701
1664 Ga0207693_10012775
1665 Ga0207693_10019974
1666 Ga0207693_10247808
1667 Ga0207693_10762965
1668 Ga0207693_10879327
1669 Ga0207663_10017436
1670 Ga0207663_11637220
1671 Ga0207660_11550959
1672 Ga0207657_11106517
1673 Ga0207649_10019765
1674 Ga0207649_10985907
1675 Ga0207652_10061396
1676 Ga0207652_10095839
1677 Ga0207652_10440252
1678 Ga0207681_10685696
1679 Ga0207694_10000234
1680 Ga0207694_10047684
1681 Ga0207659_11047880
1682 Ga0207687_10700519
1683 Ga0207687_11962058
1684 Ga0207700_10069972
1685 Ga0207700_10436320
1686 Ga0207700_10449344
1687 Ga0207700_11377137
1688 Ga0207664_10003852
1689 Ga0207664_10172179
1690 Ga0207664_10665798
1691 Ga0207664_10781728
1692 Ga0207644_10201791
1693 Ga0207644_10262314
1694 Ga0207644_10484076
1695 Ga0207706_10077413
1696 Ga0207706_10139948
1697 Ga0207686_10117452
1698 Ga0207686_10656639
1699 Ga0207686_10771396
1700 Ga0207709_10903713
1701 Ga0207665_10062967
1702 Ga0207665_10482214
1703 Ga0207665_10621423
1704 Ga0207665_10950211
1705 Ga0207691_10799695
1706 Ga0207711_10131544
1707 Ga0207711_10718864
1708 Ga0207711_10931330
1709 Ga0207689_10054191
1710 Ga0207689_10535687
1711 Ga0207661_10000462
1712 Ga0207661_10335806
1713 Ga0207679_10153261
1714 Ga0207679_10170338
1715 Ga0207679_10661490
1716 Ga0207679_10942325
1717 Ga0207679_11177024
1718 Ga0207667_10023472
1719 Ga0207667_10038547
1720 Ga0207667_10235722
1721 Ga0207667_11126230
1722 Ga0207651_10317449
1723 Ga0207712_10161390
1724 Ga0207712_10436746
1725 Ga0207668_10334560
1726 Ga0207668_10401230
1727 Ga0207668_10950417
1728 Ga0207640_10030135
1729 Ga0207640_10032190
1730 Ga0207640_10655852
1731 Ga0207658_10971840
1732 Ga0207677_10858545
1733 Ga0207677_11051160
1734 Ga0207703_10690523
1735 Ga0207703_10916321
1736 Ga0207703_11324014
1737 Ga0207639_10019196
1738 Ga0207639_10061167
1739 Ga0207639_10074797
1740 Ga0207639_10179934
1741 Ga0207639_10239216
1742 Ga0207639_10603696
1743 Ga0207639_10629173
1744 Ga0207639_10939872
1745 Ga0207639_11269419
1746 Ga0207678_10062471
1747 Ga0207678_10116704
1748 Ga0207678_10151381
1749 Ga0207678_10199725
1750 Ga0207678_10236470
1751 Ga0207678_10274484
1752 Ga0207678_10554337
1753 Ga0207678_10894801
1754 Ga0207708_10656041
1755 Ga0207702_10000098
1756 Ga0207702_10067998
1757 Ga0207702_10078592
1758 Ga0207702_10311802
1759 Ga0207702_11069453
1760 Ga0207641_10485376
1761 Ga0207641_10693575
1762 Ga0207676_10084335
1763 Ga0207674_10006546
1764 Ga0207674_10010216
1765 Ga0207674_10382318
1766 Ga0207674_10451188
1767 Ga0207675_100349508
1768 Ga0207675_101247532
1769 Ga0207675_102397169
1770 Ga0207683_10296226
1771 Ga0207683_11156838
1772 Ga0207698_10020893
1773 Ga0207698_10127697
1774 Ga0207698_10128172
1775 Ga0207698_10993614
1776 Ga0207698_11520989
1777 Ga0207698_11606195
1778 Ga0207698_12640910
1779 Ga0209813_10064721
1780 Ga0209813_10289579
1781 Ga0268266_10005154
1782 Ga0268266_10044078
1783 Ga0268266_10167694
1784 Ga0268266_10203230
1785 Ga0268266_10571024
1786 Ga0268266_10826124
1787 Ga0268266_11022832
1788 Ga0268266_11409228
1789 Ga0268266_12023254
1790 Ga0268265_10316227
1791 Ga0268264_10000049
1792 Ga0307517_10002508
1793 Ga0307517_10462843
1794 Ga0307515_10156128
1795 Ga0307511_10069798
1796 Ga0265763_1028713
1797 Ga0265330_10006850
1798 Ga0265330_10042819
1799 Ga0265330_10083921
1800 Ga0265332_10030851
1801 Ga0265332_10199405
1802 Ga0265328_10272053
1803 Ga0265325_10016079
1804 Ga0265340_10027608
1805 Ga0265339_10450771
1806 Ga0265331_10057754
1807 Ga0307513_10376775
1808 Ga0307509_10182179
1809 Ga0307408_100057784
1810 Ga0265313_10319021
1811 Ga0307508_10024306
1812 Ga0307508_10081289
1813 Ga0307508_10438571
1814 Ga0307508_10813008
1815 Ga0265314_10104734
1816 Ga0265314_10126984
1817 Ga0265342_10054940
1818 Ga0265342_10061237
1819 Ga0307516_10003810
1820 Ga0307516_10010832
1821 Ga0307516_10154306
1822 Ga0307516_10178608
1823 Ga0307516_10254553
1824 Ga0307516_10294857
1825 Ga0307405_10344762
1826 Ga0307413_10066462
1827 Ga0307413_11046270
1828 Ga0307410_10979388
1829 Ga0307406_10292448
1830 Ga0307412_10057874
1831 Ga0307412_10808725
1832 Ga0307409_100373739
1833 Ga0307409_102323776
1834 Ga0307416_102606953
1835 Ga0307414_11942616
1836 Ga0307411_10078628
1837 Ga0307415_100239612
1838 Ga0307507_10093687
1839 Ga0307507_10633385
1840 Ga0307510_10034452
1841 Ga0307510_10318437
1842 Ga0307510_10363639
1843 Ga0316215_1002595
1844 Ga0373930_0050144
1845 Ga0373930_0067039
1846 Ga0373938_0176331
1847 Ga0373926_0006082
1848 Ga0373926_0057714
1849 Ga0373934_0141563
1850 Ga0373940_0004014
1851 Ga0373944_0065077
1852 Ga0373949_0079259
1853 Ga0373951_0233827
1854 Ga0373923_0003386
1855 Ga0373923_0192455
1856 Ga0373936_0017983
1857 Ga0373941_0106617
1858 Ga0373941_0241482
1859 Ga0373945_0202285
1860 Ga0373953_0045342
1861 Ga0373953_0054526
1862 Ga0373954_0003000
1863 Ga0373954_0013614
1864 Ga0373954_0014129
1865 Ga0373954_0201346
1866 Ga0373957_0008180
1867 Ga0373957_0027291
1868 Ga0373960_0034486
1869 Ga0373943_0273222
1870 Ga0373946_0027752
1871 Ga0373946_0290066
1872 Ga0373946_0294653
1873 Ga0373955_0037568
1874 Ga0373955_0059806
1875 Ga0373955_0118939
1876 Ga0373955_0168392
1877 Ga0373942_0068148
1878 Ga0373942_0331847
1879 Ga0373961_0156535
1880 Ga0373924_0000990
1881 Ga0373924_0128848
1882 Ga0373931_0000737
1883 Ga0373935_0006078
1884 Ga0373935_0058500
1885 Ga0373927_0000481
1886 Ga0373927_0019543
1887 Ga0373927_0026996
1888 Ga0373927_0038189
1889 Ga0373927_0051429
1890 Ga0373927_0107782
1891 Ga0373927_0120469
1892 Ga0373933_0118829
1893 Ga0373933_0273523
1894 Ga0373933_0349459
1895 Ga0373933_0499398
1896 Ga0373947_0000441
1897 Ga0373947_0031134
1898 Ga0373937_0011434
1899 Ga0373937_0023736
1900 Ga0373937_1466963
1901 Ga0310112_029544
1902 Ga0372808_001174
1903 Ga0373925_0005398
1904 Ga0373925_0043326
1905 Ga0373925_0054446
1906 Ga0373925_0107728
1907 Ga0373925_0384410
1908 Ga0373925_1008502
1909 Ga0395899_0228139
1910 Ga0395899_0253147
1911 Ga0395900_0000937
1912 Ga0395900_0013063
1913 Ga0395900_0322035
1914 Ga0395898_0011586
1915 Ga0395898_0047647
1916 Ga0395898_0121837
1917 Ga0395905_0540377
1918 Ga0436364_0457605
1919 Ga0436364_0510045
1920 Ga0436364_1253402
1921 Ga0395901_0056407
1922 Ga0395901_0197670
1923 Ga0395901_0320497
1924 Ga0436365_0034134
1925 Ga0436365_0594717
1926 Ga0436365_1242582
1927 Ga0436365_1797143
1928 Ga0436360_0226977
1929 Ga0436360_1341430
1930 Ga0436361_0091611
1931 Ga0436361_1072639
1932 Ga0436363_0800260
1933 Ga0436362_0810915
1934 Ga0451789_0135100
1935 Ga0451789_1307874
1936 Ga0451791_0310571
1937 Ga0451797_1122517
1938 Ga0451795_1213101
1939 Ga0451802_1299051
1940 Ga0451807_0776538
1941 Ga0451807_0962926
1942 Ga0451849_0021296
1943 Ga0451855_0859634
1944 Ga0451853_2617866
1945 Ga0439458_0033608
1946 Ga0439444_0192739
1947 Ga0439459_0135140
1948 Ga0466969_0251599
1949 Ga0466961_0123149
1950 Ga0466963_0025316
1951 Ga0466963_0297563
1952 Ga0466963_0445244
1953 Ga0466968_0155689
1954 Ga0466970_0199943
1955 Ga0466957_0111626
1956 Ga0466967_0022610
1957 Ga0466967_0655043
1958 Ga0466967_1457187
1959 Ga0466967_1791167
1960 Ga0495617_072307
1961 Ga0495592_0016144
1962 Ga0495592_0082735
1963 Ga0495592_0093853
1964 Ga0495592_0153992
1965 Ga0495603_0000066
1966 Ga0495603_0017631
1967 Ga0495603_0059019
1968 Ga0495603_0432281
1969 Ga0495603_0651822
1970 Ga0495603_0696473
1971 Ga0495590_0161562
1972 Ga0495629_0000131
1973 Ga0495629_0000937
1974 Ga0495629_0034072
1975 Ga0495629_0230703
1976 Ga0495629_0320986
1977 Ga0495629_0502262
1978 Ga0495638_0018982
1979 Ga0495638_0546552
1980 Ga0495641_0003604
1981 Ga0495651_0000667
1982 Ga0495651_0005386
1983 Ga0495651_0511816
1984 Ga0495653_0083608
1985 Ga0495653_0749875
1986 Ga0495580_0001382
1987 Ga0495580_0060350
1988 Ga0495580_0138889
1989 Ga0495582_0000298
1990 Ga0495582_0078675
1991 Ga0495605_0161371
1992 Ga0495639_0000282
1993 Ga0495639_0003381
1994 Ga0495662_0000058
1995 Ga0495662_0058347
1996 Ga0495662_0094186
1997 Ga0495662_0424564
1998 Ga0495662_0430480
1999 Ga0495664_0001603
2000 Ga0495664_0002049
2001 Ga0495664_0050287
2002 Ga0495664_0308118
2003 Ga0495584_0237380
2004 Ga0495585_0186539
2005 Ga0495594_0005015
2006 Ga0495594_0058940
2007 Ga0495594_0073373
2008 Ga0495596_0185536
2009 Ga0495607_0163339
2010 Ga0495607_0266296
2011 Ga0495583_0114782
2012 Ga0495606_0225218
2013 Ga0495606_0242701
2014 Ga0495606_0382637
2015 Ga0495608_0002282
2016 Ga0495608_0031166
2017 Ga0495608_0111599
2018 Ga0495608_0799149
2019 Ga0495610_0184572
2020 Ga0495616_0045329
2021 Ga0495616_0239836
2022 Ga0495618_0028852
2023 Ga0495618_0166773
2024 Ga0495620_0172486
2025 Ga0495628_0017091
2026 Ga0495628_0066411
2027 Ga0495628_0069102
2028 Ga0495628_0839546
2029 Ga0495630_0008565
2030 Ga0495630_0097270
2031 Ga0495630_0103613
2032 Ga0495631_0125796
2033 Ga0495637_0148775
2034 Ga0495643_0219741
2035 Ga0495648_0000943
2036 Ga0495648_0085628
2037 Ga0495663_0026232
2038 Ga0495666_0118980
2039 Ga0495666_0122456
2040 Ga0495652_0011826
2041 Ga0495652_0061724
2042 Ga0495652_0080485
2043 Ga0495652_0091420
2044 Ga0495652_0560890
2045 Ga0495654_0209272
2046 Ga0495665_0008719
2047 Ga0495665_0017901
2048 Ga0495640_0000617
2049 Ga0495640_0020220
2050 Ga0495640_0025442
2051 Ga0495586_0145396
2052 Ga0495586_0778416
2053 Ga0495587_0166367
2054 Ga0495587_0181478
2055 Ga0495587_0248772
2056 Ga0495587_0508810
2057 Ga0495609_0328833
2058 Ga0495621_0438974
2059 Ga0495645_0026862
2060 Ga0495645_0116716
2061 Ga0495622_0009108
2062 Ga0495622_0037656
2063 Ga0495622_0055403
2064 Ga0495633_0082120
2065 Ga0495667_0001870
2066 Ga0495667_0034818
2067 Ga0495668_0104639
2068 Ga0495668_0448078
2069 Ga0495668_0646859
2070 Ga0495634_0000502
2071 Ga0495634_0018374
2072 Ga0495634_0030388
2073 Ga0495634_0045287
2074 Ga0495611_0201695
2075 Ga0495611_0275208
2076 Ga0495611_0519960
2077 Ga0495625_0100049
2078 Ga0495625_0110135
2079 Ga0495625_0460267
2080 Ga0495635_0000178
2081 Ga0495635_0000278
2082 Ga0495635_0073539
2083 Ga0495635_0263784
2084 Ga0495635_0454895
2085 Ga0495661_0513458
2086 Ga0495661_0634129
2087 Ga0495588_0001173
2088 Ga0495588_0005976
2089 Ga0495588_0028399
2090 Ga0495657_0002467
2091 Ga0495657_0011096
2092 Ga0495657_0150232
2093 Ga0495599_0001883
2094 Ga0495599_0173105
2095 Ga0495623_0002455
2096 Ga0495623_0030832
2097 Ga0495646_0023137
2098 Ga0495646_0046271
2099 Ga0495646_0067895
2100 Ga0495647_0000555
2101 Ga0495647_0017376
2102 Ga0495658_0006651
2103 Ga0495658_0007642
2104 Ga0495658_0456172
2105 Ga0495669_0124011
2106 Ga0495669_0383256
2107 Ga0495613_0027216
2108 Ga0495613_0047301
2109 Ga0495613_0072358
2110 Ga0495613_0101301
2111 Ga0495624_0003669
2112 Ga0495624_0070763
2113 Ga0495670_0446576
2114 Ga0495671_0412285
2115 Ga0495649_0519942
2116 Ga0495589_0557236
2117 Ga0495600_0003603
2118 Ga0495600_0004239
2119 Ga0495600_0113928
2120 Ga0495600_0212154
2121 Ga0495581_0000111
2122 Ga0495581_0021494
2123 Ga0495581_0215155
2124 Ga0495604_0002068
2125 Ga0495604_0005311
2126 Ga0495604_0098811
2127 Ga0495604_0153460
2128 Ga0495604_0238274
2129 Ga0495604_0279226
2130 Ga0495674_0002855
2131 Ga0495674_0010735
2132 Ga0495674_0070478
2133 Ga0495674_0103046
2134 Ga0495674_0967522
2135 Ga0495672_0008900
2136 Ga0495672_0264656
2137 Ga0495672_0289121
2138 Ga0495672_0329173
2139 Ga0495676_0076061
2140 Ga0495676_0292374
2141 Ga0495680_0007580
2142 Ga0495683_0082250
2143 Ga0495675_0001321
2144 Ga0495675_0005803
2145 Ga0495675_0118673
2146 Ga0495677_0363546
2147 Ga0495685_146176
2148 Ga0495673_0027696
2149 Ga0495673_0090503
2150 Ga0495673_0112321
2151 Ga0495673_0323057
2152 Ga0495681_0153397
2153 Ga0495681_0208200
2154 Ga0495684_0000161
2155 Ga0495684_0012187
2156 Ga0495684_0100118
2157 Ga0495686_0023065
2158 Ga0495686_0082124
2159 Ga0495686_0461142
2160 Ga0495593_0000210
2161 Ga0495593_0031631
2162 Ga0495593_0035968
2163 Ga0495593_0191695
2164 Ga0495602_0016051
2165 Ga0495602_0102410
2166 Ga0495614_0008531
2167 Ga0495614_0095767
2168 Ga0495614_0513404
2169 Ga0495626_0222555
2170 Ga0496100_0034851
2171 Ga0496100_0100995
2172 Ga0496100_0498269
2173 Ga0496100_1367123
2174 Ga0496101_0002918
2175 Ga0496101_0106500
2176 Ga0496101_1232576
2177 Ga0496101_1390824
2178 Ga0496102_0018118
2179 Ga0496102_0019762
2180 Ga0496102_0023714
2181 Ga0496102_0502472
2182 Ga0496102_0536240
2183 Ga0496102_1129153
2184 Ga0496103_0025993
2185 Ga0496103_0545605
2186 Ga0496104_0005931
2187 Ga0496104_0166136
2188 Ga0496104_0360321
2189 Ga0496104_0570136
2190 Ga0496104_0864725
2191 Ga0496105_0004596
2192 Ga0496105_0013161
2193 Ga0496106_0066930
2194 Ga0496106_0081280
2195 Ga0496106_0215946
2196 Ga0496106_0247267
2197 Ga0496107_0021320
2198 Ga0496107_0041856
2199 Ga0496107_0089617
2200 Ga0496107_0511623
2201 Ga0496108_0095878
2202 Ga0496108_0129556
2203 Ga0496108_0146743
2204 Ga0496108_0342254
2205 Ga0496108_0388646
2206 Ga0496108_0848401
2207 Ga0496109_0154877
2208 Ga0496109_0338722
2209 Ga0496109_0387458
2210 Ga0496109_1329796
2211 Ga0496109_1475083
2212 Ga0496110_0029782
2213 Ga0496110_0031507
2214 Ga0496110_0365687
2215 Ga0496110_0502080
2216 Ga0496111_0021573
2217 Ga0496111_0023000
2218 Ga0496111_0173789
2219 Ga0496111_0638328
2220 Ga0496111_0697659
2221 Ga0496112_0007361
2222 Ga0496112_0054601
2223 Ga0496112_0098430
2224 Ga0496112_0274029
2225 Ga0496112_0693491
2226 Ga0496112_1602149
2227 Ga0496113_0003380
2228 Ga0496113_0029699
2229 Ga0496113_0122933
2230 Ga0496113_0429388
2231 Ga0496114_0148974
2232 Ga0496114_0199875
2233 Ga0496114_0386682
2234 Ga0496114_0660316
2235 Ga0496114_1544804
2236 Ga0496115_0034573
2237 Ga0496115_0040822
2238 Ga0496115_0292683
2239 Ga0496115_1129355
2240 Ga0496116_0053113
2241 Ga0496116_0063780
2242 Ga0496116_0179849
2243 Ga0496117_0044061
2244 Ga0496117_0074361
2245 Ga0496117_0314083
2246 Ga0496118_0021634
2247 Ga0496118_0022102
2248 Ga0496118_0071024
2249 Ga0496118_0099007
2250 Ga0496119_0030902
2251 Ga0496119_0055976
2252 Ga0496119_0137517
2253 Ga0496120_0207037
2254 Ga0496121_0000416
2255 Ga0496121_0011106
2256 Ga0496121_0014503
2257 Ga0496121_0015708
2258 Ga0496121_0072330
2259 Ga0496121_0088558
2260 Ga0496121_0120898
2261 Ga0496121_0213927
2262 Ga0496121_0228970
2263 Ga0496121_0356325
2264 Ga0496122_0046480
2265 Ga0496122_0226553
2266 Ga0496124_0089914
2267 Ga0496124_0154454
2268 Ga0496124_0376913
2269 Ga0496125_0035946
2270 Ga0496125_0077485
2271 Ga0496125_0396584
2272 Ga0496126_0030246
2273 Ga0496126_0052388
2274 Ga0496126_0090310
2275 Ga0496126_0090739
2276 Ga0496126_0104650
2277 Ga0496126_0212892
2278 Ga0496126_0327199
2279 Ga0495678_146514
2280 Ga0495682_0164539
2281 Ga0501031_0000301
2282 Ga0501032_0000172
2283 Ga0501032_0862947
2284 Ga0501033_0001887
2285 Ga0501034_0000676
2286 Ga0501034_0061070
2287 Ga0501036_0000390
2288 Ga0501036_0353515
2289 Ga0501037_0004356
2290 Ga0501038_0000089
2291 Ga0501038_0145219
2292 Ga0501038_0764310
2293 Ga0501039_0000114
2294 Ga0501040_0888471
2295 Ga0501042_0026453
2296 Ga0501042_0488167
2297 Ga0501043_0001086
2298 Ga0501043_0217925
2299 Ga0501046_0003225
2300 Ga0501046_0186634
2301 Ga0501047_0000230
2302 Ga0501047_0036575
2303 Ga0501048_0000095
2304 Ga0501048_1156295
2305 Ga0501067_0003250
2306 Ga0501067_0059385
2307 Ga0501067_0188792
2308 Ga0501067_0613980
2309 Ga0501068_0020314
2310 Ga0501069_0019111
2311 Ga0501069_0121511
2312 Ga0501069_0232355
2313 Ga0501070_0007130
2314 Ga0501070_0017328
2315 Ga0501070_0201837
2316 Ga0501070_0835721
2317 Ga0501071_0232092
2318 Ga0501071_0743655
2319 Ga0501072_0001459
2320 Ga0501072_0274668
2321 Ga0501073_0000055
2322 Ga0501074_0000492
2323 Ga0501074_0341813
2324 Ga0501076_0072621
2325 Ga0501076_0643558
2326 Ga0501076_1624104
2327 Ga0501077_0501692
2328 Ga0501079_0001966
2329 Ga0501079_0210727
2330 Ga0501080_0001671
2331 Ga0501081_0343029
2332 Ga0501083_0000570
2333 Ga0501083_0610189
2334 Ga0501035_0000355
2335 Ga0501035_1168775
2336 Ga0501035_1434305
2337 Ga0501044_0000546
2338 Ga0501044_0094300
2339 Ga0501045_0012777
2340 Ga0501045_0388572
2341 nmdc:mga03n38_146_c2
2342 nmdc:mga03n38_604358_c1
2343 nmdc:mga00v17_696061_c1
2344 nmdc:mga0yw44_14698_c1
2345 nmdc:mga0yw44_190697_c1
2346 nmdc:mga0yw44_91986_c1
2347 nmdc:mga06z11_131674_c1
2348 nmdc:mga06z11_58590_c1
2349 nmdc:mga04h51_11225_c1
2350 nmdc:mga04h51_516562_c1
2351 nmdc:mga07m45_328577_c2
2352 nmdc:mga07m45_365629_c1
2353 nmdc:mga0n895_245003_c1
2354 nmdc:mga0n895_896011_c1
2355 nmdc:mga0rr50_119377_c1
2356 nmdc:mga08x19_280221_c1
2357 nmdc:mga0a205_1182474_c1
2358 Ga0495601_0073688
2359 Ga0495601_0122184
2360 Ga0495601_0148842
2361 Ga0495601_0201206
2362 Ga0495601_0493014
2363 Ga0495612_0006238
2364 Ga0495612_0051061
2365 Ga0495612_0234020
2366 Ga0495612_0265549
2367 Ga0495612_0274612
2368 Ga0500610_0074278
2369 Ga0500610_0102904
2370 Ga0500635_0048895
2371 Ga0495595_0040765
2372 Ga0495595_0181672
2373 Ga0495619_0012613
2374 Ga0495619_0044373
2375 Ga0495619_0283041
2376 Ga0495619_0808084
2377 Ga0500643_000278
2378 Ga0500646_0390932
2379 Ga0500647_0077634
2380 Ga0500583_0048514
2381 Ga0500641_0005143
2382 Ga0500641_0017084
2383 Ga0500641_0030621
2384 Ga0500648_200584
2385 Ga0500555_001487
2386 Ga0500556_0104326
2387 Ga0500556_0214401
2388 Ga0500557_000028
2389 Ga0500558_207792
2390 Ga0500562_006678
2391 Ga0500592_052706
2392 Ga0500595_000653
2393 Ga0500595_008924
2394 Ga0500595_046793
2395 Ga0500595_170266
2396 Ga0500597_192449
2397 Ga0500614_151196
2398 Ga0500642_0000590
2399 Ga0500642_0189905
2400 Ga0500652_158762
2401 Ga0500568_0040122
2402 Ga0500568_0141723
2403 Ga0500573_0176496
2404 Ga0500577_0065705
2405 Ga0500604_0091899
2406 Ga0500604_0132514
2407 Ga0500604_0193759
2408 Ga0500616_0097299
2409 Ga0500619_229152
2410 Ga0500622_0038166
2411 Ga0500633_0101430
2412 Ga0500638_125829
2413 Ga0500638_182850
2414 Ga0500636_0416206
2415 Ga0500636_0461383
2416 Ga0500636_0473449
2417 Ga0500637_0211898
2418 Ga0500645_050563
2419 Ga0500596_008868
2420 Ga0500599_022802
2421 Ga0501084_0001687
2422 Ga0501082_0009399
2423 Ga0466962_0217020
2424 2513677979
2425 2513715566
2426 2514016366
2427 2517106999
2428 2524435608
2429 2524468343
2430 2528858118
2431 2617352931
2432 2745079864
2433 2824608406
2434 2824617434
2435 2824659991
2436 2824669191
2437 2824674753
2438 2824694625
2439 2824779850
2440 2838130226
2441 2841944331
2442 2841954492
2443 2841969108
2444 2841979882
2445 2841990937
2446 2842044013
2447 2842051998
2448 2849082549
2449 2876764518
2450 2879099951
2451 2885368123
2452 2885384657
2453 2888391160
2454 2888420909
2455 2903773441
2456 2906651304
2457 2922378500
2458 2929622413
2459 2929631370
2460 2932786212
2461 2932816855
2462 2932825995
2463 2932829450
2464 2933584507
2465 2935617882
2466 2935641634
2467 2935669308
2468 2935678096
2469 2935693585
2470 2935702905
2471 2935707131
2472 2935716949
2473 2935730217
2474 2935738388
2475 2935750176
2476 2935759770
2477 2935764579
2478 2935804488
2479 2935819111
2480 2935831365
2481 2935841974
2482 2935856619
2483 2935870234
2484 2935874441
2485 2935964279
2486 2935993902
2487 2936005087
2488 2936045738
2489 2940565776
2490 2941547025
2491 3005509666
2492 8016518786
2493 8016585652
2494 8017057893
2495 8019577831
2496 8019595933
2497 8019605822
2498 8019612712
2499 8055750864
2500 8056688974

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20061

DUF6460

Domain of unknown function (DUF6460)

68

102

0.97

Map