F492193
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1250 | 560 | 2500 | 101 |
Family's Representative Sequence
| Representative Sequence | 3300048929|Ga0496126_0093204|Ga0496126_0093204_854_1177 |
| Length | 107 |
| Sequence | MPNDPRFNDARELPPSSHDGLARFLGGSPLAVALRLVLLSILVGVVLAAIGFDPYNILRSIQLLFQRLWDLGFDAVNWLWRYFLLGAVIVIPIWFLSRLFGGAPRGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 9 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 11 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 78 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 79 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 80 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 81 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 84 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 85 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 90 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 93 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 94 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 121 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 122 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 125 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 126 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 127 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 128 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 129 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 198 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 199 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 200 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 201 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 202 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 203 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 204 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 205 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 206 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 207 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 208 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 209 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 210 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 211 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 212 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 213 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 214 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 215 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 216 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 217 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 218 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 219 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 220 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 221 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 222 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 223 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 224 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 225 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 226 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 227 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 228 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 229 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 230 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 231 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 232 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 233 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 234 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 235 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 236 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 237 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 238 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 239 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 240 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 241 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 242 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 243 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 244 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 245 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 246 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 247 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 248 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 249 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 250 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 251 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 252 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 253 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 254 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 255 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 256 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 257 | 3300036458 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 258 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 259 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 260 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 261 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 262 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 263 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 264 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 265 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 266 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 267 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 268 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 269 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 270 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 271 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 272 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 273 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 274 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 275 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 276 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 277 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 278 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 279 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 280 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 281 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 282 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 283 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 284 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 285 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 286 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 287 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 288 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 289 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 290 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 377 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 378 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 379 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 380 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 381 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 382 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 383 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 384 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 385 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 386 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 387 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 388 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 389 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 390 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 391 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 392 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 393 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 394 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 395 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 396 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 397 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 398 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 399 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 400 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 401 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 404 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 405 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 406 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 407 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 408 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 409 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 410 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 411 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 413 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 417 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 420 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 424 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 426 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 429 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 430 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 432 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 435 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 436 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 437 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 438 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 439 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 440 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 441 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 442 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 443 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 444 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 447 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 448 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 451 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 452 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 453 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 454 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 455 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 456 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 457 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 458 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 459 | 3300053106 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere | Metagenome | Endosphere |
| 460 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 461 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 462 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 463 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 464 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 465 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 466 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 467 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 468 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 469 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 470 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 471 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 472 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 473 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 474 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 475 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 476 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 477 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 478 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 479 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 480 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 481 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 482 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 483 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 484 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 485 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 486 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 487 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 488 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 489 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 490 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 491 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 492 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 493 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 494 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 495 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 496 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 497 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 498 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 499 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 500 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 501 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 502 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 503 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 504 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 505 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 506 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 507 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 508 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 509 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 510 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 511 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 512 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 513 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 514 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 515 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 516 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 517 | 2922368715 | |||
| 518 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 519 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 520 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 521 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 522 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 523 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 524 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 525 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 526 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 527 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 528 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 529 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 530 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 531 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 532 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 533 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 534 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 535 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 536 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 537 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 538 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 539 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 540 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 541 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 542 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 543 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 544 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 545 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 546 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 547 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 548 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 549 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 550 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 551 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 552 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 553 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 554 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 555 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 556 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 557 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 558 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 559 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 560 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.35 |
| Metatranscriptomes | 0.56 |
| Isolates | 6.08 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.96 |
| Nodule | 4.88 |
| Rhizoplane | 6.24 |
| Rhizosphere | 72.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496126_0093204 | 3300048929 | Bacteria | 2645 |
| 2 | JGI24740J21852_10040614 | 3300001979 | Bacteria | 1409 |
| 3 | JGI24740J21852_10100766 | 3300001979 | Bacteria | 735 |
| 4 | JGI24739J22299_10018096 | 3300001989 | Bacteria | 2535 |
| 5 | JGI24737J22298_10035570 | 3300001990 | Bacteria | 1540 |
| 6 | JGI24735J21928_10030238 | 3300002067 | Bacteria | 1610 |
| 7 | JGI24738J21930_10096468 | 3300002075 | Bacteria | 629 |
| 8 | JGI25165J46597_1007530 | 3300003214 | Bacteria | 1797 |
| 9 | JGI25153J46596_10002724 | 3300003215 | Bacteria | 10071 |
| 10 | JGI25153J46596_10006859 | 3300003215 | Bacteria | 5690 |
| 11 | JGI25153J46596_10014488 | 3300003215 | Bacteria | 3275 |
| 12 | JGI25160J50197_1002595 | 3300003354 | Bacteria | 8347 |
| 13 | JGI25160J50197_1013590 | 3300003354 | Bacteria | 2767 |
| 14 | JGI25404J52841_10003219 | 3300003659 | Bacteria | 3201 |
| 15 | JGI25404J52841_10005710 | 3300003659 | Bacteria | 2574 |
| 16 | JGI25404J52841_10025523 | 3300003659 | Bacteria | 1272 |
| 17 | JGI25404J52841_10111207 | 3300003659 | Bacteria | 576 |
| 18 | JGI25404J52841_10121062 | 3300003659 | Bacteria | 551 |
| 19 | JGI25404J52841_10129328 | 3300003659 | Bacteria | 534 |
| 20 | JGI25404J52841_10140125 | 3300003659 | Bacteria | 513 |
| 21 | Ga0055539_1011455 | 3300003752 | Bacteria | 1091 |
| 22 | Ga0055543_1001923 | 3300004625 | Bacteria | 7446 |
| 23 | Ga0065165_1001543 | 3300005262 | Bacteria | 24050 |
| 24 | Ga0065165_1004042 | 3300005262 | Bacteria | 9532 |
| 25 | Ga0065715_10239338 | 3300005293 | Bacteria | 1205 |
| 26 | Ga0070683_100031957 | 3300005329 | Bacteria | 4790 |
| 27 | Ga0070683_100547266 | 3300005329 | Bacteria | 1107 |
| 28 | Ga0070683_101367249 | 3300005329 | Bacteria | 681 |
| 29 | Ga0070690_100149207 | 3300005330 | Bacteria | 1594 |
| 30 | Ga0070670_100367474 | 3300005331 | Bacteria | 1266 |
| 31 | Ga0070670_101722591 | 3300005331 | Bacteria | 577 |
| 32 | Ga0068869_100069180 | 3300005334 | Bacteria | 2609 |
| 33 | Ga0068869_100172885 | 3300005334 | Bacteria | 1689 |
| 34 | Ga0070666_10241331 | 3300005335 | Bacteria | 1278 |
| 35 | Ga0070680_100307419 | 3300005336 | Bacteria | 1345 |
| 36 | Ga0070680_101138019 | 3300005336 | Bacteria | 675 |
| 37 | Ga0070680_101896680 | 3300005336 | Bacteria | 516 |
| 38 | Ga0070682_100071496 | 3300005337 | Bacteria | 2221 |
| 39 | Ga0070682_100379289 | 3300005337 | Bacteria | 1063 |
| 40 | Ga0070682_100560656 | 3300005337 | Bacteria | 896 |
| 41 | Ga0070682_100615341 | 3300005337 | Bacteria | 860 |
| 42 | Ga0070682_101273408 | 3300005337 | Bacteria | 623 |
| 43 | Ga0070682_101938668 | 3300005337 | Bacteria | 517 |
| 44 | Ga0068868_100286918 | 3300005338 | Bacteria | 1394 |
| 45 | Ga0068868_100830954 | 3300005338 | Bacteria | 835 |
| 46 | Ga0070689_100359098 | 3300005340 | Bacteria | 1224 |
| 47 | Ga0070691_10139385 | 3300005341 | Bacteria | 1235 |
| 48 | Ga0070661_100019593 | 3300005344 | Bacteria | 4822 |
| 49 | Ga0070661_100055569 | 3300005344 | Bacteria | 2899 |
| 50 | Ga0070661_100994375 | 3300005344 | Bacteria | 696 |
| 51 | Ga0070661_101879465 | 3300005344 | Bacteria | 509 |
| 52 | Ga0070692_11016861 | 3300005345 | Bacteria | 580 |
| 53 | Ga0070668_100042894 | 3300005347 | Bacteria | 3467 |
| 54 | Ga0070668_100571802 | 3300005347 | Bacteria | 986 |
| 55 | Ga0070668_101213960 | 3300005347 | Bacteria | 683 |
| 56 | Ga0070669_100550689 | 3300005353 | Bacteria | 962 |
| 57 | Ga0070675_101082660 | 3300005354 | Bacteria | 737 |
| 58 | Ga0070671_100085250 | 3300005355 | Bacteria | 2642 |
| 59 | Ga0070671_100152494 | 3300005355 | Bacteria | 1952 |
| 60 | Ga0070671_100308929 | 3300005355 | Bacteria | 1347 |
| 61 | Ga0070673_101160772 | 3300005364 | Bacteria | 723 |
| 62 | Ga0070688_100704014 | 3300005365 | Bacteria | 782 |
| 63 | Ga0070688_101288106 | 3300005365 | Bacteria | 589 |
| 64 | Ga0070667_100554409 | 3300005367 | Bacteria | 1056 |
| 65 | Ga0070709_10157291 | 3300005434 | Bacteria | 1577 |
| 66 | Ga0070709_10473753 | 3300005434 | Bacteria | 947 |
| 67 | Ga0070709_11454503 | 3300005434 | Bacteria | 556 |
| 68 | Ga0070714_100029988 | 3300005435 | Bacteria | 4525 |
| 69 | Ga0070714_100087283 | 3300005435 | Bacteria | 2728 |
| 70 | Ga0070714_102077640 | 3300005435 | Bacteria | 554 |
| 71 | Ga0070713_100024907 | 3300005436 | Bacteria | 4670 |
| 72 | Ga0070713_100052082 | 3300005436 | Bacteria | 3388 |
| 73 | Ga0070713_100157708 | 3300005436 | Bacteria | 2024 |
| 74 | Ga0070713_100215803 | 3300005436 | Bacteria | 1739 |
| 75 | Ga0070713_100223729 | 3300005436 | Bacteria | 1708 |
| 76 | Ga0070713_100753528 | 3300005436 | Bacteria | 932 |
| 77 | Ga0070713_100793763 | 3300005436 | Bacteria | 907 |
| 78 | Ga0070713_101826671 | 3300005436 | Bacteria | 590 |
| 79 | Ga0070710_10057595 | 3300005437 | Bacteria | 2203 |
| 80 | Ga0070710_10169670 | 3300005437 | Bacteria | 1359 |
| 81 | Ga0070710_10604326 | 3300005437 | Bacteria | 764 |
| 82 | Ga0070710_11294962 | 3300005437 | Bacteria | 542 |
| 83 | Ga0070710_11436279 | 3300005437 | Bacteria | 517 |
| 84 | Ga0070711_100043340 | 3300005439 | Bacteria | 3047 |
| 85 | Ga0070711_100347004 | 3300005439 | Bacteria | 1193 |
| 86 | Ga0070711_100809903 | 3300005439 | Bacteria | 795 |
| 87 | Ga0070700_100736280 | 3300005441 | Bacteria | 787 |
| 88 | Ga0070663_100090328 | 3300005455 | Bacteria | 2268 |
| 89 | Ga0070663_100114379 | 3300005455 | Bacteria | 2032 |
| 90 | Ga0070663_100137801 | 3300005455 | Bacteria | 1860 |
| 91 | Ga0070663_100287099 | 3300005455 | Bacteria | 1313 |
| 92 | Ga0070663_100289594 | 3300005455 | Bacteria | 1307 |
| 93 | Ga0070663_100573844 | 3300005455 | Bacteria | 945 |
| 94 | Ga0070663_100628560 | 3300005455 | Bacteria | 906 |
| 95 | Ga0070663_101282564 | 3300005455 | Bacteria | 646 |
| 96 | Ga0070678_102177391 | 3300005456 | Bacteria | 526 |
| 97 | Ga0070662_100252298 | 3300005457 | Bacteria | 1419 |
| 98 | Ga0070662_101273569 | 3300005457 | Bacteria | 632 |
| 99 | Ga0070681_10072573 | 3300005458 | Bacteria | 3405 |
| 100 | Ga0070681_10694972 | 3300005458 | Bacteria | 933 |
| 101 | Ga0070681_11134686 | 3300005458 | Bacteria | 703 |
| 102 | Ga0068867_101436807 | 3300005459 | Bacteria | 641 |
| 103 | Ga0070706_100069420 | 3300005467 | Bacteria | 3259 |
| 104 | Ga0070707_100171097 | 3300005468 | Bacteria | 2117 |
| 105 | Ga0070698_100049630 | 3300005471 | Bacteria | 4282 |
| 106 | Ga0070698_100610121 | 3300005471 | Bacteria | 1032 |
| 107 | Ga0070698_101757010 | 3300005471 | Bacteria | 573 |
| 108 | Ga0070679_100076441 | 3300005530 | Bacteria | 3338 |
| 109 | Ga0070679_100172660 | 3300005530 | Bacteria | 2135 |
| 110 | Ga0070679_100314036 | 3300005530 | Bacteria | 1517 |
| 111 | Ga0070684_100040027 | 3300005535 | Bacteria | 4033 |
| 112 | Ga0070697_101222492 | 3300005536 | Bacteria | 670 |
| 113 | Ga0068853_100024444 | 3300005539 | Bacteria | 5065 |
| 114 | Ga0068853_100027664 | 3300005539 | Bacteria | 4765 |
| 115 | Ga0068853_100084290 | 3300005539 | Bacteria | 2784 |
| 116 | Ga0068853_100228164 | 3300005539 | Bacteria | 1703 |
| 117 | Ga0068853_100304177 | 3300005539 | Bacteria | 1475 |
| 118 | Ga0068853_100595171 | 3300005539 | Bacteria | 1050 |
| 119 | Ga0068853_100798688 | 3300005539 | Bacteria | 904 |
| 120 | Ga0068853_101030539 | 3300005539 | Bacteria | 793 |
| 121 | Ga0068853_101096187 | 3300005539 | Bacteria | 768 |
| 122 | Ga0068853_101910414 | 3300005539 | Bacteria | 576 |
| 123 | Ga0070672_101106862 | 3300005543 | Bacteria | 704 |
| 124 | Ga0070686_100452254 | 3300005544 | Bacteria | 988 |
| 125 | Ga0070686_101036394 | 3300005544 | Bacteria | 675 |
| 126 | Ga0070693_100181272 | 3300005547 | Bacteria | 1356 |
| 127 | Ga0070693_100901114 | 3300005547 | Bacteria | 663 |
| 128 | Ga0070665_100086930 | 3300005548 | Bacteria | 3132 |
| 129 | Ga0070665_100160756 | 3300005548 | Bacteria | 2248 |
| 130 | Ga0070665_100271889 | 3300005548 | Bacteria | 1696 |
| 131 | Ga0070665_100635545 | 3300005548 | Bacteria | 1080 |
| 132 | Ga0070665_100724062 | 3300005548 | Bacteria | 1008 |
| 133 | Ga0070665_100916929 | 3300005548 | Bacteria | 889 |
| 134 | Ga0070665_101047453 | 3300005548 | Bacteria | 828 |
| 135 | Ga0070665_101891907 | 3300005548 | Bacteria | 603 |
| 136 | Ga0070704_100756419 | 3300005549 | Bacteria | 865 |
| 137 | Ga0068855_100055564 | 3300005563 | Bacteria | 4649 |
| 138 | Ga0068855_100201635 | 3300005563 | Bacteria | 2239 |
| 139 | Ga0068855_100602453 | 3300005563 | Bacteria | 1185 |
| 140 | Ga0068855_100803523 | 3300005563 | Bacteria | 999 |
| 141 | Ga0068855_100809056 | 3300005563 | Bacteria | 995 |
| 142 | Ga0068855_100964270 | 3300005563 | Bacteria | 898 |
| 143 | Ga0068855_101778643 | 3300005563 | Bacteria | 627 |
| 144 | Ga0068855_102064694 | 3300005563 | Bacteria | 575 |
| 145 | Ga0068855_102605036 | 3300005563 | Bacteria | 502 |
| 146 | Ga0070664_100165043 | 3300005564 | Bacteria | 1962 |
| 147 | Ga0070664_100660711 | 3300005564 | Bacteria | 972 |
| 148 | Ga0070664_100765455 | 3300005564 | Bacteria | 902 |
| 149 | Ga0070664_101460507 | 3300005564 | Bacteria | 647 |
| 150 | Ga0068857_100003131 | 3300005577 | Bacteria | 13690 |
| 151 | Ga0068857_100031174 | 3300005577 | Bacteria | 4711 |
| 152 | Ga0068857_100132504 | 3300005577 | Bacteria | 2248 |
| 153 | Ga0068857_100799322 | 3300005577 | Bacteria | 901 |
| 154 | Ga0068854_100008309 | 3300005578 | Bacteria | 6666 |
| 155 | Ga0068854_100522690 | 3300005578 | Bacteria | 1003 |
| 156 | Ga0068854_100878325 | 3300005578 | Bacteria | 787 |
| 157 | Ga0068856_100073867 | 3300005614 | Bacteria | 3376 |
| 158 | Ga0068856_100100242 | 3300005614 | Bacteria | 2888 |
| 159 | Ga0068856_100162266 | 3300005614 | Bacteria | 2246 |
| 160 | Ga0068856_100363125 | 3300005614 | Bacteria | 1467 |
| 161 | Ga0068856_101489134 | 3300005614 | Bacteria | 691 |
| 162 | Ga0068856_101748870 | 3300005614 | Bacteria | 634 |
| 163 | Ga0068856_102486254 | 3300005614 | Bacteria | 525 |
| 164 | Ga0070702_100896953 | 3300005615 | Bacteria | 694 |
| 165 | Ga0070702_101145875 | 3300005615 | Bacteria | 624 |
| 166 | Ga0070702_101537333 | 3300005615 | Bacteria | 548 |
| 167 | Ga0068852_100136236 | 3300005616 | Bacteria | 2267 |
| 168 | Ga0068852_100465641 | 3300005616 | Bacteria | 1254 |
| 169 | Ga0068852_101369889 | 3300005616 | Bacteria | 729 |
| 170 | Ga0068852_102294111 | 3300005616 | Bacteria | 561 |
| 171 | Ga0068859_100113160 | 3300005617 | Bacteria | 2777 |
| 172 | Ga0068859_100325970 | 3300005617 | Bacteria | 1630 |
| 173 | Ga0068859_100465838 | 3300005617 | Bacteria | 1359 |
| 174 | Ga0068859_101595023 | 3300005617 | Bacteria | 721 |
| 175 | Ga0068866_10745753 | 3300005718 | Bacteria | 676 |
| 176 | Ga0068861_100261871 | 3300005719 | Bacteria | 1481 |
| 177 | Ga0068861_100804464 | 3300005719 | Bacteria | 882 |
| 178 | Ga0068861_101529580 | 3300005719 | Bacteria | 655 |
| 179 | Ga0068851_10001649 | 3300005834 | Bacteria | 9784 |
| 180 | Ga0068851_10027032 | 3300005834 | Bacteria | 2825 |
| 181 | Ga0068851_10220891 | 3300005834 | Bacteria | 1064 |
| 182 | Ga0068870_11323214 | 3300005840 | Bacteria | 526 |
| 183 | Ga0068863_100385662 | 3300005841 | Bacteria | 1369 |
| 184 | Ga0068863_100407934 | 3300005841 | Bacteria | 1330 |
| 185 | Ga0068858_100120255 | 3300005842 | Bacteria | 2456 |
| 186 | Ga0068858_101204374 | 3300005842 | Bacteria | 744 |
| 187 | Ga0068862_101106662 | 3300005844 | Bacteria | 787 |
| 188 | Ga0081455_10036986 | 3300005937 | Bacteria | 4340 |
| 189 | Ga0081455_10047126 | 3300005937 | Bacteria | 3735 |
| 190 | Ga0081455_10950013 | 3300005937 | Bacteria | 533 |
| 191 | Ga0081455_11028642 | 3300005937 | Bacteria | 509 |
| 192 | Ga0081538_10033090 | 3300005981 | Bacteria | 3448 |
| 193 | Ga0081538_10088138 | 3300005981 | Bacteria | 1616 |
| 194 | Ga0081540_1002008 | 3300005983 | Bacteria | 16982 |
| 195 | Ga0081540_1002669 | 3300005983 | Bacteria | 14510 |
| 196 | Ga0081540_1004358 | 3300005983 | Bacteria | 10825 |
| 197 | Ga0081540_1013548 | 3300005983 | Bacteria | 5294 |
| 198 | Ga0081540_1016623 | 3300005983 | Bacteria | 4594 |
| 199 | Ga0081540_1017941 | 3300005983 | Bacteria | 4361 |
| 200 | Ga0081540_1058758 | 3300005983 | Bacteria | 1850 |
| 201 | Ga0081540_1156007 | 3300005983 | Bacteria | 893 |
| 202 | Ga0081540_1227991 | 3300005983 | Bacteria | 659 |
| 203 | Ga0081540_1256499 | 3300005983 | Bacteria | 609 |
| 204 | Ga0081540_1280575 | 3300005983 | Bacteria | 575 |
| 205 | Ga0081540_1331912 | 3300005983 | Bacteria | 521 |
| 206 | Ga0081539_10000902 | 3300005985 | Bacteria | 56412 |
| 207 | Ga0081539_10012998 | 3300005985 | Bacteria | 6323 |
| 208 | Ga0081539_10264041 | 3300005985 | Bacteria | 758 |
| 209 | Ga0081539_10360055 | 3300005985 | Bacteria | 610 |
| 210 | Ga0070717_10029119 | 3300006028 | Bacteria | 4428 |
| 211 | Ga0070717_10127050 | 3300006028 | Bacteria | 2189 |
| 212 | Ga0070717_10339663 | 3300006028 | Bacteria | 1341 |
| 213 | Ga0070717_11377629 | 3300006028 | Bacteria | 641 |
| 214 | Ga0075365_10025042 | 3300006038 | Bacteria | 3773 |
| 215 | Ga0075365_10234247 | 3300006038 | Bacteria | 1289 |
| 216 | Ga0075368_10002408 | 3300006042 | Bacteria | 6098 |
| 217 | Ga0075368_10095576 | 3300006042 | Bacteria | 1218 |
| 218 | Ga0075363_100000457 | 3300006048 | Bacteria | 12805 |
| 219 | Ga0075363_100273791 | 3300006048 | Bacteria | 975 |
| 220 | Ga0075363_100589058 | 3300006048 | Bacteria | 666 |
| 221 | Ga0075364_10089293 | 3300006051 | Bacteria | 2044 |
| 222 | Ga0070716_100401581 | 3300006173 | Bacteria | 986 |
| 223 | Ga0070712_100238466 | 3300006175 | Bacteria | 1448 |
| 224 | Ga0070712_100281435 | 3300006175 | Bacteria | 1340 |
| 225 | Ga0075362_10014331 | 3300006177 | Bacteria | 3196 |
| 226 | Ga0075362_10084138 | 3300006177 | Bacteria | 1469 |
| 227 | Ga0075367_10017461 | 3300006178 | Bacteria | 3939 |
| 228 | Ga0075367_10079893 | 3300006178 | Bacteria | 1977 |
| 229 | Ga0075367_10227306 | 3300006178 | Bacteria | 1168 |
| 230 | Ga0075366_10067485 | 3300006195 | Bacteria | 2129 |
| 231 | Ga0075366_10074999 | 3300006195 | Bacteria | 2017 |
| 232 | Ga0097621_100550989 | 3300006237 | Bacteria | 1050 |
| 233 | Ga0097621_100662267 | 3300006237 | Bacteria | 959 |
| 234 | Ga0075370_10043541 | 3300006353 | Bacteria | 2537 |
| 235 | Ga0075370_10082365 | 3300006353 | Bacteria | 1850 |
| 236 | Ga0075370_10177373 | 3300006353 | Bacteria | 1253 |
| 237 | Ga0075370_10244088 | 3300006353 | Bacteria | 1063 |
| 238 | Ga0075370_10368466 | 3300006353 | Bacteria | 860 |
| 239 | Ga0075370_11043211 | 3300006353 | Bacteria | 501 |
| 240 | Ga0068871_100693171 | 3300006358 | Bacteria | 933 |
| 241 | Ga0068871_100891808 | 3300006358 | Bacteria | 824 |
| 242 | Ga0075434_100016914 | 3300006871 | Bacteria | 7015 |
| 243 | Ga0075434_100590644 | 3300006871 | Bacteria | 1130 |
| 244 | Ga0075436_100306510 | 3300006914 | Bacteria | 1139 |
| 245 | Ga0097620_100113159 | 3300006931 | Bacteria | 2777 |
| 246 | Ga0097620_100325970 | 3300006931 | Bacteria | 1630 |
| 247 | Ga0097620_100465853 | 3300006931 | Bacteria | 1359 |
| 248 | Ga0097620_101595137 | 3300006931 | Bacteria | 721 |
| 249 | Ga0099794_10093466 | 3300007265 | Bacteria | 1495 |
| 250 | Ga0099795_10235221 | 3300007788 | Bacteria | 785 |
| 251 | Ga0105251_10415890 | 3300009011 | Bacteria | 619 |
| 252 | Ga0105250_10071694 | 3300009092 | Bacteria | 1399 |
| 253 | Ga0105240_10014949 | 3300009093 | Bacteria | 10574 |
| 254 | Ga0105240_10019882 | 3300009093 | Bacteria | 8969 |
| 255 | Ga0105240_10143012 | 3300009093 | Bacteria | 2858 |
| 256 | Ga0105240_10164801 | 3300009093 | Bacteria | 2629 |
| 257 | Ga0105240_10226359 | 3300009093 | Bacteria | 2176 |
| 258 | Ga0105240_10328349 | 3300009093 | Bacteria | 1741 |
| 259 | Ga0105240_11027213 | 3300009093 | Bacteria | 880 |
| 260 | Ga0105245_10233828 | 3300009098 | Bacteria | 1779 |
| 261 | Ga0105245_10499909 | 3300009098 | Bacteria | 1232 |
| 262 | Ga0105245_10908103 | 3300009098 | Bacteria | 922 |
| 263 | Ga0105245_11376847 | 3300009098 | Bacteria | 755 |
| 264 | Ga0105245_11602851 | 3300009098 | Bacteria | 703 |
| 265 | Ga0105247_10122301 | 3300009101 | Bacteria | 1688 |
| 266 | Ga0105247_10181027 | 3300009101 | Bacteria | 1407 |
| 267 | Ga0105247_10194459 | 3300009101 | Bacteria | 1360 |
| 268 | Ga0105247_11372860 | 3300009101 | Bacteria | 571 |
| 269 | Ga0105243_10160026 | 3300009148 | Bacteria | 1940 |
| 270 | Ga0105243_10319802 | 3300009148 | Bacteria | 1413 |
| 271 | Ga0105243_11095100 | 3300009148 | Bacteria | 805 |
| 272 | Ga0105243_11429303 | 3300009148 | Bacteria | 713 |
| 273 | Ga0105241_10394480 | 3300009174 | Bacteria | 1212 |
| 274 | Ga0105241_10487179 | 3300009174 | Bacteria | 1097 |
| 275 | Ga0105241_10560917 | 3300009174 | Bacteria | 1027 |
| 276 | Ga0105242_10138692 | 3300009176 | Bacteria | 2108 |
| 277 | Ga0105242_10401226 | 3300009176 | Bacteria | 1280 |
| 278 | Ga0105242_13116887 | 3300009176 | Bacteria | 514 |
| 279 | Ga0105248_10070400 | 3300009177 | Bacteria | 3928 |
| 280 | Ga0105248_10123366 | 3300009177 | Bacteria | 2922 |
| 281 | Ga0105248_10520449 | 3300009177 | Bacteria | 1341 |
| 282 | Ga0105248_12598562 | 3300009177 | Bacteria | 577 |
| 283 | Ga0105248_12788544 | 3300009177 | Bacteria | 557 |
| 284 | Ga0105237_10028929 | 3300009545 | Bacteria | 5639 |
| 285 | Ga0105237_10048231 | 3300009545 | Bacteria | 4281 |
| 286 | Ga0105237_10108333 | 3300009545 | Bacteria | 2770 |
| 287 | Ga0105237_10401055 | 3300009545 | Bacteria | 1376 |
| 288 | Ga0105237_10859994 | 3300009545 | Bacteria | 914 |
| 289 | Ga0105237_11556942 | 3300009545 | Bacteria | 668 |
| 290 | Ga0105237_11581436 | 3300009545 | Bacteria | 662 |
| 291 | Ga0105237_12783856 | 3300009545 | Bacteria | 500 |
| 292 | Ga0105238_10105864 | 3300009551 | Bacteria | 2794 |
| 293 | Ga0105238_10212171 | 3300009551 | Bacteria | 1912 |
| 294 | Ga0105238_10990799 | 3300009551 | Bacteria | 861 |
| 295 | Ga0105249_10027700 | 3300009553 | Bacteria | 5114 |
| 296 | Ga0105249_10693850 | 3300009553 | Bacteria | 1078 |
| 297 | Ga0099796_10086991 | 3300010159 | Bacteria | 1156 |
| 298 | Ga0105239_10052448 | 3300010375 | Bacteria | 4473 |
| 299 | Ga0105239_10230018 | 3300010375 | Bacteria | 2080 |
| 300 | Ga0105239_10302257 | 3300010375 | Bacteria | 1802 |
| 301 | Ga0105239_10771620 | 3300010375 | Bacteria | 1101 |
| 302 | Ga0105239_12164931 | 3300010375 | Bacteria | 646 |
| 303 | Ga0105239_12548433 | 3300010375 | Bacteria | 596 |
| 304 | Ga0105239_13040845 | 3300010375 | Bacteria | 547 |
| 305 | Ga0105246_10159510 | 3300011119 | Bacteria | 1717 |
| 306 | Ga0105246_10354015 | 3300011119 | Bacteria | 1204 |
| 307 | Ga0105246_10956650 | 3300011119 | Bacteria | 772 |
| 308 | Ga0105246_11534297 | 3300011119 | Bacteria | 627 |
| 309 | Ga0105246_12424393 | 3300011119 | Bacteria | 515 |
| 310 | Ga0157373_10366731 | 3300013100 | Bacteria | 1029 |
| 311 | Ga0157373_11218541 | 3300013100 | Bacteria | 568 |
| 312 | Ga0157371_10254843 | 3300013102 | Bacteria | 1264 |
| 313 | Ga0157370_10160110 | 3300013104 | Bacteria | 2095 |
| 314 | Ga0157370_10232227 | 3300013104 | Bacteria | 1707 |
| 315 | Ga0157370_10626551 | 3300013104 | Bacteria | 984 |
| 316 | Ga0157369_10004460 | 3300013105 | Bacteria | 16494 |
| 317 | Ga0157369_10018976 | 3300013105 | Bacteria | 7703 |
| 318 | Ga0157369_12148914 | 3300013105 | Bacteria | 566 |
| 319 | Ga0157374_10110734 | 3300013296 | Bacteria | 2641 |
| 320 | Ga0157374_10164047 | 3300013296 | Bacteria | 2165 |
| 321 | Ga0163162_10110973 | 3300013306 | Bacteria | 2840 |
| 322 | Ga0163162_10858613 | 3300013306 | Bacteria | 1022 |
| 323 | Ga0163162_10887786 | 3300013306 | Bacteria | 1005 |
| 324 | Ga0163162_12055559 | 3300013306 | Bacteria | 655 |
| 325 | Ga0157372_10045484 | 3300013307 | Bacteria | 4870 |
| 326 | Ga0157372_10481603 | 3300013307 | Bacteria | 1447 |
| 327 | Ga0157372_11680354 | 3300013307 | Bacteria | 731 |
| 328 | Ga0157375_10067779 | 3300013308 | Bacteria | 3566 |
| 329 | Ga0157375_10120122 | 3300013308 | Bacteria | 2736 |
| 330 | Ga0157375_12745228 | 3300013308 | Bacteria | 589 |
| 331 | Ga0163163_10315548 | 3300014325 | Bacteria | 1617 |
| 332 | Ga0163163_11983504 | 3300014325 | Bacteria | 642 |
| 333 | Ga0157379_10059342 | 3300014968 | Bacteria | 3420 |
| 334 | Ga0157379_10331322 | 3300014968 | Bacteria | 1391 |
| 335 | Ga0157379_10371414 | 3300014968 | Bacteria | 1311 |
| 336 | Ga0157379_10580625 | 3300014968 | Bacteria | 1045 |
| 337 | Ga0157379_11409749 | 3300014968 | Bacteria | 675 |
| 338 | Ga0157376_10624820 | 3300014969 | Bacteria | 1075 |
| 339 | Ga0182006_1104364 | 3300015261 | Bacteria | 1002 |
| 340 | Ga0182007_10159157 | 3300015262 | Bacteria | 771 |
| 341 | Ga0163161_11398692 | 3300017792 | Bacteria | 611 |
| 342 | Ga0163161_11472570 | 3300017792 | Bacteria | 597 |
| 343 | Ga0206354_10622256 | 3300020081 | Bacteria | 1937 |
| 344 | Ga0154015_1445201 | 3300020610 | Bacteria | 538 |
| 345 | Ga0213872_10034797 | 3300021361 | Bacteria | 2305 |
| 346 | Ga0213876_10176160 | 3300021384 | Bacteria | 1138 |
| 347 | Ga0213875_10065765 | 3300021388 | Bacteria | 1694 |
| 348 | Ga0213871_10194272 | 3300021441 | Bacteria | 631 |
| 349 | Ga0224712_10268563 | 3300022467 | Bacteria | 792 |
| 350 | Ga0224712_10589203 | 3300022467 | Bacteria | 542 |
| 351 | Ga0209563_103179 | 3300025230 | Bacteria | 3462 |
| 352 | Ga0209677_100434 | 3300025253 | Bacteria | 24570 |
| 353 | Ga0209677_102685 | 3300025253 | Bacteria | 6419 |
| 354 | Ga0209148_1009199 | 3300025254 | Bacteria | 1941 |
| 355 | Ga0209233_1001815 | 3300025261 | Bacteria | 8212 |
| 356 | Ga0209233_1008918 | 3300025261 | Bacteria | 3073 |
| 357 | Ga0209455_1002067 | 3300025272 | Bacteria | 8110 |
| 358 | Ga0209673_1056243 | 3300025273 | Bacteria | 1008 |
| 359 | Ga0209564_1010640 | 3300025295 | Bacteria | 4210 |
| 360 | Ga0209758_1000389 | 3300025297 | Bacteria | 75919 |
| 361 | Ga0209758_1001056 | 3300025297 | Bacteria | 36006 |
| 362 | Ga0209758_1004662 | 3300025297 | Bacteria | 11214 |
| 363 | Ga0209758_1011597 | 3300025297 | Bacteria | 5077 |
| 364 | Ga0209758_1047353 | 3300025297 | Bacteria | 1539 |
| 365 | Ga0207426_1000380 | 3300025302 | Bacteria | 76046 |
| 366 | Ga0207426_1001551 | 3300025302 | Bacteria | 18658 |
| 367 | Ga0207426_1022964 | 3300025302 | Bacteria | 2134 |
| 368 | Ga0207426_1080914 | 3300025302 | Bacteria | 881 |
| 369 | Ga0209257_1009836 | 3300025304 | Bacteria | 5003 |
| 370 | Ga0209257_1125441 | 3300025304 | Bacteria | 595 |
| 371 | Ga0207656_10007457 | 3300025321 | Bacteria | 3983 |
| 372 | Ga0207656_10115012 | 3300025321 | Bacteria | 1247 |
| 373 | Ga0207692_10049368 | 3300025898 | Bacteria | 2123 |
| 374 | Ga0207692_10188672 | 3300025898 | Bacteria | 1205 |
| 375 | Ga0207710_10127075 | 3300025900 | Bacteria | 1222 |
| 376 | Ga0207710_10305729 | 3300025900 | Bacteria | 804 |
| 377 | Ga0207710_10617178 | 3300025900 | Bacteria | 567 |
| 378 | Ga0207688_10102200 | 3300025901 | Bacteria | 1656 |
| 379 | Ga0207688_10120678 | 3300025901 | Bacteria | 1529 |
| 380 | Ga0207680_10311187 | 3300025903 | Bacteria | 1099 |
| 381 | Ga0207647_10002061 | 3300025904 | Bacteria | 15362 |
| 382 | Ga0207685_10062660 | 3300025905 | Bacteria | 1478 |
| 383 | Ga0207685_10272466 | 3300025905 | Bacteria | 827 |
| 384 | Ga0207699_10085566 | 3300025906 | Bacteria | 1967 |
| 385 | Ga0207699_10168045 | 3300025906 | Bacteria | 1465 |
| 386 | Ga0207699_10238682 | 3300025906 | Bacteria | 1248 |
| 387 | Ga0207699_10268474 | 3300025906 | Bacteria | 1182 |
| 388 | Ga0207699_10312261 | 3300025906 | Bacteria | 1100 |
| 389 | Ga0207699_10385406 | 3300025906 | Bacteria | 996 |
| 390 | Ga0207684_10109834 | 3300025910 | Bacteria | 2361 |
| 391 | Ga0207654_10001581 | 3300025911 | Bacteria | 11962 |
| 392 | Ga0207654_10103926 | 3300025911 | Bacteria | 1755 |
| 393 | Ga0207654_10171867 | 3300025911 | Bacteria | 1408 |
| 394 | Ga0207654_10413381 | 3300025911 | Bacteria | 940 |
| 395 | Ga0207654_10484612 | 3300025911 | Bacteria | 871 |
| 396 | Ga0207707_10001012 | 3300025912 | Bacteria | 26958 |
| 397 | Ga0207707_10061491 | 3300025912 | Bacteria | 3267 |
| 398 | Ga0207707_10638807 | 3300025912 | Bacteria | 898 |
| 399 | Ga0207707_10944032 | 3300025912 | Bacteria | 711 |
| 400 | Ga0207695_10000463 | 3300025913 | Bacteria | 88316 |
| 401 | Ga0207695_10037987 | 3300025913 | Bacteria | 5191 |
| 402 | Ga0207695_10106934 | 3300025913 | Bacteria | 2783 |
| 403 | Ga0207695_10120623 | 3300025913 | Bacteria | 2591 |
| 404 | Ga0207695_10162848 | 3300025913 | Bacteria | 2161 |
| 405 | Ga0207695_10212399 | 3300025913 | Bacteria | 1845 |
| 406 | Ga0207695_10431082 | 3300025913 | Bacteria | 1202 |
| 407 | Ga0207695_10886801 | 3300025913 | Bacteria | 772 |
| 408 | Ga0207671_10259805 | 3300025914 | Bacteria | 1367 |
| 409 | Ga0207671_10270361 | 3300025914 | Bacteria | 1339 |
| 410 | Ga0207671_10360105 | 3300025914 | Bacteria | 1154 |
| 411 | Ga0207671_10521249 | 3300025914 | Bacteria | 948 |
| 412 | Ga0207671_10636540 | 3300025914 | Bacteria | 849 |
| 413 | Ga0207671_11329701 | 3300025914 | Bacteria | 559 |
| 414 | Ga0207693_10012775 | 3300025915 | Bacteria | 6777 |
| 415 | Ga0207693_10019974 | 3300025915 | Bacteria | 5328 |
| 416 | Ga0207693_10247808 | 3300025915 | Bacteria | 1398 |
| 417 | Ga0207693_10762965 | 3300025915 | Bacteria | 747 |
| 418 | Ga0207693_10879327 | 3300025915 | Bacteria | 688 |
| 419 | Ga0207663_10017436 | 3300025916 | Bacteria | 4001 |
| 420 | Ga0207663_11637220 | 3300025916 | Bacteria | 518 |
| 421 | Ga0207660_11550959 | 3300025917 | Bacteria | 534 |
| 422 | Ga0207657_11106517 | 3300025919 | Bacteria | 605 |
| 423 | Ga0207649_10019765 | 3300025920 | Bacteria | 3855 |
| 424 | Ga0207649_10985907 | 3300025920 | Bacteria | 663 |
| 425 | Ga0207652_10061396 | 3300025921 | Bacteria | 3245 |
| 426 | Ga0207652_10095839 | 3300025921 | Bacteria | 2614 |
| 427 | Ga0207652_10440252 | 3300025921 | Bacteria | 1175 |
| 428 | Ga0207681_10685696 | 3300025923 | Bacteria | 851 |
| 429 | Ga0207694_10000234 | 3300025924 | Bacteria | 53453 |
| 430 | Ga0207694_10047684 | 3300025924 | Bacteria | 3314 |
| 431 | Ga0207659_11047880 | 3300025926 | Bacteria | 702 |
| 432 | Ga0207687_10700519 | 3300025927 | Bacteria | 860 |
| 433 | Ga0207687_11962058 | 3300025927 | Bacteria | 500 |
| 434 | Ga0207700_10069972 | 3300025928 | Bacteria | 2696 |
| 435 | Ga0207700_10436320 | 3300025928 | Bacteria | 1152 |
| 436 | Ga0207700_10449344 | 3300025928 | Bacteria | 1136 |
| 437 | Ga0207700_11377137 | 3300025928 | Bacteria | 627 |
| 438 | Ga0207664_10003852 | 3300025929 | Bacteria | 10076 |
| 439 | Ga0207664_10172179 | 3300025929 | Bacteria | 1853 |
| 440 | Ga0207664_10665798 | 3300025929 | Bacteria | 936 |
| 441 | Ga0207664_10781728 | 3300025929 | Bacteria | 859 |
| 442 | Ga0207644_10201791 | 3300025931 | Bacteria | 1569 |
| 443 | Ga0207644_10262314 | 3300025931 | Bacteria | 1382 |
| 444 | Ga0207644_10484076 | 3300025931 | Bacteria | 1019 |
| 445 | Ga0207706_10077413 | 3300025933 | Bacteria | 2925 |
| 446 | Ga0207706_10139948 | 3300025933 | Bacteria | 2129 |
| 447 | Ga0207686_10117452 | 3300025934 | Bacteria | 1805 |
| 448 | Ga0207686_10656639 | 3300025934 | Bacteria | 830 |
| 449 | Ga0207686_10771396 | 3300025934 | Bacteria | 769 |
| 450 | Ga0207709_10903713 | 3300025935 | Bacteria | 718 |
| 451 | Ga0207665_10062967 | 3300025939 | Bacteria | 2518 |
| 452 | Ga0207665_10482214 | 3300025939 | Bacteria | 956 |
| 453 | Ga0207665_10621423 | 3300025939 | Bacteria | 845 |
| 454 | Ga0207665_10950211 | 3300025939 | Bacteria | 683 |
| 455 | Ga0207691_10799695 | 3300025940 | Bacteria | 793 |
| 456 | Ga0207711_10131544 | 3300025941 | Bacteria | 2244 |
| 457 | Ga0207711_10718864 | 3300025941 | Bacteria | 931 |
| 458 | Ga0207711_10931330 | 3300025941 | Bacteria | 807 |
| 459 | Ga0207689_10054191 | 3300025942 | Bacteria | 3304 |
| 460 | Ga0207689_10535687 | 3300025942 | Bacteria | 983 |
| 461 | Ga0207661_10000462 | 3300025944 | Bacteria | 26255 |
| 462 | Ga0207661_10335806 | 3300025944 | Bacteria | 1361 |
| 463 | Ga0207679_10153261 | 3300025945 | Bacteria | 1879 |
| 464 | Ga0207679_10170338 | 3300025945 | Bacteria | 1792 |
| 465 | Ga0207679_10661490 | 3300025945 | Bacteria | 945 |
| 466 | Ga0207679_10942325 | 3300025945 | Bacteria | 791 |
| 467 | Ga0207679_11177024 | 3300025945 | Bacteria | 703 |
| 468 | Ga0207667_10023472 | 3300025949 | Bacteria | 6791 |
| 469 | Ga0207667_10038547 | 3300025949 | Bacteria | 5102 |
| 470 | Ga0207667_10235722 | 3300025949 | Bacteria | 1873 |
| 471 | Ga0207667_11126230 | 3300025949 | Bacteria | 767 |
| 472 | Ga0207651_10317449 | 3300025960 | Bacteria | 1301 |
| 473 | Ga0207712_10161390 | 3300025961 | Bacteria | 1742 |
| 474 | Ga0207712_10436746 | 3300025961 | Bacteria | 1107 |
| 475 | Ga0207668_10334560 | 3300025972 | Bacteria | 1261 |
| 476 | Ga0207668_10401230 | 3300025972 | Bacteria | 1159 |
| 477 | Ga0207668_10950417 | 3300025972 | Bacteria | 766 |
| 478 | Ga0207640_10030135 | 3300025981 | Bacteria | 3338 |
| 479 | Ga0207640_10032190 | 3300025981 | Bacteria | 3250 |
| 480 | Ga0207640_10655852 | 3300025981 | Bacteria | 895 |
| 481 | Ga0207658_10971840 | 3300025986 | Bacteria | 774 |
| 482 | Ga0207677_10858545 | 3300026023 | Bacteria | 816 |
| 483 | Ga0207677_11051160 | 3300026023 | Bacteria | 740 |
| 484 | Ga0207703_10690523 | 3300026035 | Bacteria | 970 |
| 485 | Ga0207703_10916321 | 3300026035 | Bacteria | 839 |
| 486 | Ga0207703_11324014 | 3300026035 | Bacteria | 693 |
| 487 | Ga0207639_10019196 | 3300026041 | Bacteria | 4871 |
| 488 | Ga0207639_10061167 | 3300026041 | Bacteria | 2907 |
| 489 | Ga0207639_10074797 | 3300026041 | Bacteria | 2661 |
| 490 | Ga0207639_10179934 | 3300026041 | Bacteria | 1798 |
| 491 | Ga0207639_10239216 | 3300026041 | Bacteria | 1577 |
| 492 | Ga0207639_10603696 | 3300026041 | Bacteria | 1012 |
| 493 | Ga0207639_10629173 | 3300026041 | Bacteria | 991 |
| 494 | Ga0207639_10939872 | 3300026041 | Bacteria | 809 |
| 495 | Ga0207639_11269419 | 3300026041 | Bacteria | 691 |
| 496 | Ga0207678_10062471 | 3300026067 | Bacteria | 3201 |
| 497 | Ga0207678_10116704 | 3300026067 | Bacteria | 2277 |
| 498 | Ga0207678_10151381 | 3300026067 | Bacteria | 1981 |
| 499 | Ga0207678_10199725 | 3300026067 | Bacteria | 1709 |
| 500 | Ga0207678_10236470 | 3300026067 | Bacteria | 1564 |
| 501 | Ga0207678_10274484 | 3300026067 | Bacteria | 1446 |
| 502 | Ga0207678_10554337 | 3300026067 | Bacteria | 1005 |
| 503 | Ga0207678_10894801 | 3300026067 | Bacteria | 785 |
| 504 | Ga0207708_10656041 | 3300026075 | Bacteria | 893 |
| 505 | Ga0207702_10000098 | 3300026078 | Bacteria | 101326 |
| 506 | Ga0207702_10067998 | 3300026078 | Bacteria | 3060 |
| 507 | Ga0207702_10078592 | 3300026078 | Bacteria | 2857 |
| 508 | Ga0207702_10311802 | 3300026078 | Bacteria | 1496 |
| 509 | Ga0207702_11069453 | 3300026078 | Bacteria | 801 |
| 510 | Ga0207641_10485376 | 3300026088 | Bacteria | 1198 |
| 511 | Ga0207641_10693575 | 3300026088 | Bacteria | 1002 |
| 512 | Ga0207676_10084335 | 3300026095 | Bacteria | 2590 |
| 513 | Ga0207674_10006546 | 3300026116 | Bacteria | 13700 |
| 514 | Ga0207674_10010216 | 3300026116 | Bacteria | 10662 |
| 515 | Ga0207674_10382318 | 3300026116 | Bacteria | 1361 |
| 516 | Ga0207674_10451188 | 3300026116 | Bacteria | 1243 |
| 517 | Ga0207675_100349508 | 3300026118 | Bacteria | 1449 |
| 518 | Ga0207675_101247532 | 3300026118 | Bacteria | 764 |
| 519 | Ga0207675_102397169 | 3300026118 | Bacteria | 540 |
| 520 | Ga0207683_10296226 | 3300026121 | Bacteria | 1480 |
| 521 | Ga0207683_11156838 | 3300026121 | Bacteria | 717 |
| 522 | Ga0207698_10020893 | 3300026142 | Bacteria | 4517 |
| 523 | Ga0207698_10127697 | 3300026142 | Bacteria | 2166 |
| 524 | Ga0207698_10128172 | 3300026142 | Bacteria | 2163 |
| 525 | Ga0207698_10993614 | 3300026142 | Bacteria | 850 |
| 526 | Ga0207698_11520989 | 3300026142 | Bacteria | 685 |
| 527 | Ga0207698_11606195 | 3300026142 | Bacteria | 666 |
| 528 | Ga0207698_12640910 | 3300026142 | Bacteria | 511 |
| 529 | Ga0209813_10064721 | 3300027866 | Bacteria | 1175 |
| 530 | Ga0209813_10289579 | 3300027866 | Bacteria | 633 |
| 531 | Ga0268266_10005154 | 3300028379 | Bacteria | 12306 |
| 532 | Ga0268266_10044078 | 3300028379 | Bacteria | 3812 |
| 533 | Ga0268266_10167694 | 3300028379 | Bacteria | 1991 |
| 534 | Ga0268266_10203230 | 3300028379 | Bacteria | 1814 |
| 535 | Ga0268266_10571024 | 3300028379 | Bacteria | 1085 |
| 536 | Ga0268266_10826124 | 3300028379 | Bacteria | 895 |
| 537 | Ga0268266_11022832 | 3300028379 | Bacteria | 799 |
| 538 | Ga0268266_11409228 | 3300028379 | Bacteria | 672 |
| 539 | Ga0268266_12023254 | 3300028379 | Bacteria | 549 |
| 540 | Ga0268265_10316227 | 3300028380 | Bacteria | 1412 |
| 541 | Ga0268264_10000049 | 3300028381 | Bacteria | 329992 |
| 542 | Ga0307517_10002508 | 3300028786 | Bacteria | 29345 |
| 543 | Ga0307517_10462843 | 3300028786 | Bacteria | 654 |
| 544 | Ga0307515_10156128 | 3300028794 | Bacteria | 2354 |
| 545 | Ga0307511_10069798 | 3300030521 | Bacteria | 2579 |
| 546 | Ga0265763_1028713 | 3300030763 | Bacteria | 622 |
| 547 | Ga0265330_10006850 | 3300031235 | Bacteria | 5606 |
| 548 | Ga0265330_10042819 | 3300031235 | Bacteria | 2005 |
| 549 | Ga0265330_10083921 | 3300031235 | Bacteria | 1371 |
| 550 | Ga0265332_10030851 | 3300031238 | Bacteria | 2340 |
| 551 | Ga0265332_10199405 | 3300031238 | Bacteria | 832 |
| 552 | Ga0265328_10272053 | 3300031239 | Bacteria | 651 |
| 553 | Ga0265325_10016079 | 3300031241 | Bacteria | 4186 |
| 554 | Ga0265340_10027608 | 3300031247 | Bacteria | 2860 |
| 555 | Ga0265339_10450771 | 3300031249 | Bacteria | 597 |
| 556 | Ga0265331_10057754 | 3300031250 | Bacteria | 1839 |
| 557 | Ga0307513_10376775 | 3300031456 | Bacteria | 1159 |
| 558 | Ga0307509_10182179 | 3300031507 | Bacteria | 1963 |
| 559 | Ga0307408_100057784 | 3300031548 | Bacteria | 2818 |
| 560 | Ga0265313_10319021 | 3300031595 | Bacteria | 621 |
| 561 | Ga0307508_10024306 | 3300031616 | Bacteria | 5498 |
| 562 | Ga0307508_10081289 | 3300031616 | Bacteria | 2821 |
| 563 | Ga0307508_10438571 | 3300031616 | Bacteria | 898 |
| 564 | Ga0307508_10813008 | 3300031616 | Bacteria | 553 |
| 565 | Ga0265314_10104734 | 3300031711 | Bacteria | 1811 |
| 566 | Ga0265314_10126984 | 3300031711 | Bacteria | 1596 |
| 567 | Ga0265342_10054940 | 3300031712 | Bacteria | 2365 |
| 568 | Ga0265342_10061237 | 3300031712 | Bacteria | 2218 |
| 569 | Ga0307516_10003810 | 3300031730 | Bacteria | 19133 |
| 570 | Ga0307516_10010832 | 3300031730 | Bacteria | 9978 |
| 571 | Ga0307516_10154306 | 3300031730 | Bacteria | 2053 |
| 572 | Ga0307516_10178608 | 3300031730 | Bacteria | 1858 |
| 573 | Ga0307516_10254553 | 3300031730 | Bacteria | 1449 |
| 574 | Ga0307516_10294857 | 3300031730 | Bacteria | 1299 |
| 575 | Ga0307405_10344762 | 3300031731 | Bacteria | 1147 |
| 576 | Ga0307413_10066462 | 3300031824 | Bacteria | 2250 |
| 577 | Ga0307413_11046270 | 3300031824 | Bacteria | 702 |
| 578 | Ga0307410_10979388 | 3300031852 | Bacteria | 728 |
| 579 | Ga0307406_10292448 | 3300031901 | Bacteria | 1248 |
| 580 | Ga0307412_10057874 | 3300031911 | Bacteria | 2590 |
| 581 | Ga0307412_10808725 | 3300031911 | Bacteria | 814 |
| 582 | Ga0307409_100373739 | 3300031995 | Bacteria | 1352 |
| 583 | Ga0307409_102323776 | 3300031995 | Bacteria | 565 |
| 584 | Ga0307416_102606953 | 3300032002 | Bacteria | 603 |
| 585 | Ga0307414_11942616 | 3300032004 | Bacteria | 549 |
| 586 | Ga0307411_10078628 | 3300032005 | Bacteria | 2262 |
| 587 | Ga0307415_100239612 | 3300032126 | Bacteria | 1466 |
| 588 | Ga0307507_10093687 | 3300033179 | Bacteria | 2557 |
| 589 | Ga0307507_10633385 | 3300033179 | Bacteria | 546 |
| 590 | Ga0307510_10034452 | 3300033180 | Bacteria | 5669 |
| 591 | Ga0307510_10318437 | 3300033180 | Bacteria | 1013 |
| 592 | Ga0307510_10363639 | 3300033180 | Bacteria | 895 |
| 593 | Ga0316215_1002595 | 3300033544 | Bacteria | 1710 |
| 594 | Ga0373930_0050144 | 3300034816 | Bacteria | 910 |
| 595 | Ga0373930_0067039 | 3300034816 | Bacteria | 810 |
| 596 | Ga0373938_0176331 | 3300034957 | Bacteria | 581 |
| 597 | Ga0373926_0006082 | 3300035083 | Bacteria | 3997 |
| 598 | Ga0373926_0057714 | 3300035083 | Bacteria | 1410 |
| 599 | Ga0373934_0141563 | 3300035086 | Bacteria | 984 |
| 600 | Ga0373940_0004014 | 3300035088 | Bacteria | 3073 |
| 601 | Ga0373944_0065077 | 3300035089 | Bacteria | 1177 |
| 602 | Ga0373949_0079259 | 3300035090 | Bacteria | 873 |
| 603 | Ga0373951_0233827 | 3300035091 | Bacteria | 547 |
| 604 | Ga0373923_0003386 | 3300035111 | Bacteria | 5103 |
| 605 | Ga0373923_0192455 | 3300035111 | Bacteria | 940 |
| 606 | Ga0373936_0017983 | 3300035113 | Bacteria | 2726 |
| 607 | Ga0373941_0106617 | 3300035115 | Bacteria | 982 |
| 608 | Ga0373941_0241482 | 3300035115 | Bacteria | 702 |
| 609 | Ga0373945_0202285 | 3300035116 | Bacteria | 825 |
| 610 | Ga0373953_0045342 | 3300035117 | Bacteria | 1761 |
| 611 | Ga0373953_0054526 | 3300035117 | Bacteria | 1622 |
| 612 | Ga0373954_0003000 | 3300035118 | Bacteria | 7119 |
| 613 | Ga0373954_0013614 | 3300035118 | Bacteria | 3626 |
| 614 | Ga0373954_0014129 | 3300035118 | Bacteria | 3559 |
| 615 | Ga0373954_0201346 | 3300035118 | Bacteria | 978 |
| 616 | Ga0373957_0008180 | 3300035120 | Bacteria | 3378 |
| 617 | Ga0373957_0027291 | 3300035120 | Bacteria | 2074 |
| 618 | Ga0373960_0034486 | 3300035121 | Bacteria | 1432 |
| 619 | Ga0373943_0273222 | 3300035170 | Bacteria | 954 |
| 620 | Ga0373946_0027752 | 3300035171 | Bacteria | 2241 |
| 621 | Ga0373946_0290066 | 3300035171 | Bacteria | 807 |
| 622 | Ga0373946_0294653 | 3300035171 | Bacteria | 801 |
| 623 | Ga0373955_0037568 | 3300035172 | Bacteria | 2575 |
| 624 | Ga0373955_0059806 | 3300035172 | Bacteria | 2099 |
| 625 | Ga0373955_0118939 | 3300035172 | Bacteria | 1534 |
| 626 | Ga0373955_0168392 | 3300035172 | Bacteria | 1296 |
| 627 | Ga0373942_0068148 | 3300035207 | Bacteria | 1033 |
| 628 | Ga0373942_0331847 | 3300035207 | Bacteria | 534 |
| 629 | Ga0373961_0156535 | 3300035241 | Bacteria | 780 |
| 630 | Ga0373924_0000990 | 3300035410 | Bacteria | 9005 |
| 631 | Ga0373924_0128848 | 3300035410 | Bacteria | 1100 |
| 632 | Ga0373931_0000737 | 3300035691 | Bacteria | 13621 |
| 633 | Ga0373935_0006078 | 3300035692 | Bacteria | 7179 |
| 634 | Ga0373935_0058500 | 3300035692 | Bacteria | 2462 |
| 635 | Ga0373927_0000481 | 3300035695 | Bacteria | 30651 |
| 636 | Ga0373927_0019543 | 3300035695 | Bacteria | 4441 |
| 637 | Ga0373927_0026996 | 3300035695 | Bacteria | 3751 |
| 638 | Ga0373927_0038189 | 3300035695 | Bacteria | 3118 |
| 639 | Ga0373927_0051429 | 3300035695 | Bacteria | 2664 |
| 640 | Ga0373927_0107782 | 3300035695 | Bacteria | 1815 |
| 641 | Ga0373927_0120469 | 3300035695 | Bacteria | 1712 |
| 642 | Ga0373933_0118829 | 3300035724 | Bacteria | 1654 |
| 643 | Ga0373933_0273523 | 3300035724 | Bacteria | 1090 |
| 644 | Ga0373933_0349459 | 3300035724 | Bacteria | 960 |
| 645 | Ga0373933_0499398 | 3300035724 | Bacteria | 797 |
| 646 | Ga0373947_0000441 | 3300035725 | Bacteria | 23573 |
| 647 | Ga0373947_0031134 | 3300035725 | Bacteria | 3138 |
| 648 | Ga0373937_0011434 | 3300036401 | Bacteria | 7788 |
| 649 | Ga0373937_0023736 | 3300036401 | Bacteria | 5527 |
| 650 | Ga0373937_1466963 | 3300036401 | Bacteria | 630 |
| 651 | Ga0310112_029544 | 3300036458 | Bacteria | 754 |
| 652 | Ga0372808_001174 | 3300036459 | Bacteria | 2606 |
| 653 | Ga0373925_0005398 | 3300037068 | Bacteria | 9531 |
| 654 | Ga0373925_0043326 | 3300037068 | Bacteria | 3340 |
| 655 | Ga0373925_0054446 | 3300037068 | Bacteria | 2993 |
| 656 | Ga0373925_0107728 | 3300037068 | Bacteria | 2149 |
| 657 | Ga0373925_0384410 | 3300037068 | Bacteria | 1143 |
| 658 | Ga0373925_1008502 | 3300037068 | Bacteria | 685 |
| 659 | Ga0395899_0228139 | 3300037312 | Bacteria | 1287 |
| 660 | Ga0395899_0253147 | 3300037312 | Bacteria | 1208 |
| 661 | Ga0395900_0000937 | 3300037418 | Bacteria | 38218 |
| 662 | Ga0395900_0013063 | 3300037418 | Bacteria | 8486 |
| 663 | Ga0395900_0322035 | 3300037418 | Bacteria | 1526 |
| 664 | Ga0395898_0011586 | 3300037466 | Bacteria | 9156 |
| 665 | Ga0395898_0047647 | 3300037466 | Bacteria | 4205 |
| 666 | Ga0395898_0121837 | 3300037466 | Bacteria | 2499 |
| 667 | Ga0395905_0540377 | 3300037471 | Bacteria | 1066 |
| 668 | Ga0436364_0457605 | 3300037853 | Bacteria | 1342 |
| 669 | Ga0436364_0510045 | 3300037853 | Bacteria | 3197 |
| 670 | Ga0436364_1253402 | 3300037853 | Bacteria | 1084 |
| 671 | Ga0395901_0056407 | 3300038443 | Bacteria | 4086 |
| 672 | Ga0395901_0197670 | 3300038443 | Bacteria | 2108 |
| 673 | Ga0395901_0320497 | 3300038443 | Bacteria | 1604 |
| 674 | Ga0436365_0034134 | 3300039437 | Bacteria | 1871 |
| 675 | Ga0436365_0594717 | 3300039437 | Bacteria | 1263 |
| 676 | Ga0436365_1242582 | 3300039437 | Bacteria | 1284 |
| 677 | Ga0436365_1797143 | 3300039437 | Bacteria | 5250 |
| 678 | Ga0436360_0226977 | 3300039438 | Bacteria | 1211 |
| 679 | Ga0436360_1341430 | 3300039438 | Bacteria | 646 |
| 680 | Ga0436361_0091611 | 3300039447 | Bacteria | 520 |
| 681 | Ga0436361_1072639 | 3300039447 | Bacteria | 600 |
| 682 | Ga0436363_0800260 | 3300039450 | Bacteria | 680 |
| 683 | Ga0436362_0810915 | 3300039453 | Bacteria | 604 |
| 684 | Ga0451789_0135100 | 3300041443 | Bacteria | 503 |
| 685 | Ga0451789_1307874 | 3300041443 | Bacteria | 580 |
| 686 | Ga0451791_0310571 | 3300041451 | Bacteria | 611 |
| 687 | Ga0451797_1122517 | 3300041453 | Bacteria | 816 |
| 688 | Ga0451795_1213101 | 3300041456 | Bacteria | 608 |
| 689 | Ga0451802_1299051 | 3300041460 | Bacteria | 833 |
| 690 | Ga0451807_0776538 | 3300041486 | Bacteria | 1146 |
| 691 | Ga0451807_0962926 | 3300041486 | Bacteria | 661 |
| 692 | Ga0451849_0021296 | 3300041505 | Bacteria | 714 |
| 693 | Ga0451855_0859634 | 3300041511 | Bacteria | 598 |
| 694 | Ga0451853_2617866 | 3300041512 | Bacteria | 1489 |
| 695 | Ga0439458_0033608 | 3300042157 | Bacteria | 1229 |
| 696 | Ga0439444_0192739 | 3300042437 | Bacteria | 511 |
| 697 | Ga0439459_0135140 | 3300042438 | Bacteria | 633 |
| 698 | Ga0466969_0251599 | 3300044656 | Bacteria | 801 |
| 699 | Ga0466961_0123149 | 3300044693 | Bacteria | 1627 |
| 700 | Ga0466963_0025316 | 3300044694 | Bacteria | 3784 |
| 701 | Ga0466963_0297563 | 3300044694 | Bacteria | 1135 |
| 702 | Ga0466963_0445244 | 3300044694 | Bacteria | 914 |
| 703 | Ga0466968_0155689 | 3300044735 | Bacteria | 1052 |
| 704 | Ga0466970_0199943 | 3300044765 | Bacteria | 1112 |
| 705 | Ga0466957_0111626 | 3300044842 | Bacteria | 1734 |
| 706 | Ga0466967_0022610 | 3300045976 | Bacteria | 5135 |
| 707 | Ga0466967_0655043 | 3300045976 | Bacteria | 1038 |
| 708 | Ga0466967_1457187 | 3300045976 | Bacteria | 682 |
| 709 | Ga0466967_1791167 | 3300045976 | Bacteria | 611 |
| 710 | Ga0495617_072307 | 3300046452 | Bacteria | 1134 |
| 711 | Ga0495592_0016144 | 3300046454 | Bacteria | 5665 |
| 712 | Ga0495592_0082735 | 3300046454 | Bacteria | 2319 |
| 713 | Ga0495592_0093853 | 3300046454 | Bacteria | 2148 |
| 714 | Ga0495592_0153992 | 3300046454 | Bacteria | 1587 |
| 715 | Ga0495603_0000066 | 3300046455 | Bacteria | 45635 |
| 716 | Ga0495603_0017631 | 3300046455 | Bacteria | 4323 |
| 717 | Ga0495603_0059019 | 3300046455 | Bacteria | 2268 |
| 718 | Ga0495603_0432281 | 3300046455 | Bacteria | 754 |
| 719 | Ga0495603_0651822 | 3300046455 | Bacteria | 602 |
| 720 | Ga0495603_0696473 | 3300046455 | Bacteria | 581 |
| 721 | Ga0495590_0161562 | 3300046457 | Bacteria | 815 |
| 722 | Ga0495629_0000131 | 3300046459 | Bacteria | 65274 |
| 723 | Ga0495629_0000937 | 3300046459 | Bacteria | 23485 |
| 724 | Ga0495629_0034072 | 3300046459 | Bacteria | 3600 |
| 725 | Ga0495629_0230703 | 3300046459 | Bacteria | 1276 |
| 726 | Ga0495629_0320986 | 3300046459 | Bacteria | 1059 |
| 727 | Ga0495629_0502262 | 3300046459 | Bacteria | 818 |
| 728 | Ga0495638_0018982 | 3300046460 | Bacteria | 4554 |
| 729 | Ga0495638_0546552 | 3300046460 | Bacteria | 576 |
| 730 | Ga0495641_0003604 | 3300046461 | Bacteria | 11470 |
| 731 | Ga0495651_0000667 | 3300046462 | Bacteria | 26661 |
| 732 | Ga0495651_0005386 | 3300046462 | Bacteria | 9761 |
| 733 | Ga0495651_0511816 | 3300046462 | Bacteria | 767 |
| 734 | Ga0495653_0083608 | 3300046463 | Bacteria | 2353 |
| 735 | Ga0495653_0749875 | 3300046463 | Bacteria | 590 |
| 736 | Ga0495580_0001382 | 3300046472 | Bacteria | 21285 |
| 737 | Ga0495580_0060350 | 3300046472 | Bacteria | 2664 |
| 738 | Ga0495580_0138889 | 3300046472 | Bacteria | 1685 |
| 739 | Ga0495582_0000298 | 3300046473 | Bacteria | 27399 |
| 740 | Ga0495582_0078675 | 3300046473 | Bacteria | 1829 |
| 741 | Ga0495605_0161371 | 3300046474 | Bacteria | 995 |
| 742 | Ga0495639_0000282 | 3300046475 | Bacteria | 25018 |
| 743 | Ga0495639_0003381 | 3300046475 | Bacteria | 6913 |
| 744 | Ga0495662_0000058 | 3300046476 | Bacteria | 37987 |
| 745 | Ga0495662_0058347 | 3300046476 | Bacteria | 1864 |
| 746 | Ga0495662_0094186 | 3300046476 | Bacteria | 1462 |
| 747 | Ga0495662_0424564 | 3300046476 | Bacteria | 653 |
| 748 | Ga0495662_0430480 | 3300046476 | Bacteria | 648 |
| 749 | Ga0495664_0001603 | 3300046477 | Bacteria | 12028 |
| 750 | Ga0495664_0002049 | 3300046477 | Bacteria | 10785 |
| 751 | Ga0495664_0050287 | 3300046477 | Bacteria | 2475 |
| 752 | Ga0495664_0308118 | 3300046477 | Bacteria | 955 |
| 753 | Ga0495584_0237380 | 3300046491 | Bacteria | 927 |
| 754 | Ga0495585_0186539 | 3300046492 | Bacteria | 1063 |
| 755 | Ga0495594_0005015 | 3300046499 | Bacteria | 6814 |
| 756 | Ga0495594_0058940 | 3300046499 | Bacteria | 2122 |
| 757 | Ga0495594_0073373 | 3300046499 | Bacteria | 1905 |
| 758 | Ga0495596_0185536 | 3300046500 | Bacteria | 809 |
| 759 | Ga0495607_0163339 | 3300046501 | Bacteria | 1130 |
| 760 | Ga0495607_0266296 | 3300046501 | Bacteria | 819 |
| 761 | Ga0495583_0114782 | 3300046506 | Bacteria | 1139 |
| 762 | Ga0495606_0225218 | 3300046507 | Bacteria | 1054 |
| 763 | Ga0495606_0242701 | 3300046507 | Bacteria | 1004 |
| 764 | Ga0495606_0382637 | 3300046507 | Bacteria | 738 |
| 765 | Ga0495608_0002282 | 3300046511 | Bacteria | 13836 |
| 766 | Ga0495608_0031166 | 3300046511 | Bacteria | 3606 |
| 767 | Ga0495608_0111599 | 3300046511 | Bacteria | 1758 |
| 768 | Ga0495608_0799149 | 3300046511 | Bacteria | 557 |
| 769 | Ga0495610_0184572 | 3300046512 | Bacteria | 865 |
| 770 | Ga0495616_0045329 | 3300046513 | Bacteria | 2226 |
| 771 | Ga0495616_0239836 | 3300046513 | Bacteria | 782 |
| 772 | Ga0495618_0028852 | 3300046514 | Bacteria | 3459 |
| 773 | Ga0495618_0166773 | 3300046514 | Bacteria | 1402 |
| 774 | Ga0495620_0172486 | 3300046515 | Bacteria | 838 |
| 775 | Ga0495628_0017091 | 3300046516 | Bacteria | 6044 |
| 776 | Ga0495628_0066411 | 3300046516 | Bacteria | 2820 |
| 777 | Ga0495628_0069102 | 3300046516 | Bacteria | 2755 |
| 778 | Ga0495628_0839546 | 3300046516 | Bacteria | 641 |
| 779 | Ga0495630_0008565 | 3300046517 | Bacteria | 7339 |
| 780 | Ga0495630_0097270 | 3300046517 | Bacteria | 2226 |
| 781 | Ga0495630_0103613 | 3300046517 | Bacteria | 2153 |
| 782 | Ga0495631_0125796 | 3300046518 | Bacteria | 1102 |
| 783 | Ga0495637_0148775 | 3300046520 | Bacteria | 885 |
| 784 | Ga0495643_0219741 | 3300046522 | Bacteria | 902 |
| 785 | Ga0495648_0000943 | 3300046524 | Bacteria | 30112 |
| 786 | Ga0495648_0085628 | 3300046524 | Bacteria | 1780 |
| 787 | Ga0495663_0026232 | 3300046525 | Bacteria | 1705 |
| 788 | Ga0495666_0118980 | 3300046526 | Bacteria | 1238 |
| 789 | Ga0495666_0122456 | 3300046526 | Bacteria | 1218 |
| 790 | Ga0495652_0011826 | 3300046529 | Bacteria | 7888 |
| 791 | Ga0495652_0061724 | 3300046529 | Bacteria | 3162 |
| 792 | Ga0495652_0080485 | 3300046529 | Bacteria | 2690 |
| 793 | Ga0495652_0091420 | 3300046529 | Bacteria | 2488 |
| 794 | Ga0495652_0560890 | 3300046529 | Bacteria | 784 |
| 795 | Ga0495654_0209272 | 3300046530 | Bacteria | 830 |
| 796 | Ga0495665_0008719 | 3300046531 | Bacteria | 5505 |
| 797 | Ga0495665_0017901 | 3300046531 | Bacteria | 3807 |
| 798 | Ga0495640_0000617 | 3300046533 | Bacteria | 26230 |
| 799 | Ga0495640_0020220 | 3300046533 | Bacteria | 4903 |
| 800 | Ga0495640_0025442 | 3300046533 | Bacteria | 4294 |
| 801 | Ga0495586_0145396 | 3300046535 | Bacteria | 1332 |
| 802 | Ga0495586_0778416 | 3300046535 | Bacteria | 552 |
| 803 | Ga0495587_0166367 | 3300046536 | Bacteria | 1253 |
| 804 | Ga0495587_0181478 | 3300046536 | Bacteria | 1193 |
| 805 | Ga0495587_0248772 | 3300046536 | Bacteria | 999 |
| 806 | Ga0495587_0508810 | 3300046536 | Bacteria | 666 |
| 807 | Ga0495609_0328833 | 3300046538 | Bacteria | 619 |
| 808 | Ga0495621_0438974 | 3300046539 | Bacteria | 557 |
| 809 | Ga0495645_0026862 | 3300046543 | Bacteria | 4181 |
| 810 | Ga0495645_0116716 | 3300046543 | Bacteria | 1883 |
| 811 | Ga0495622_0009108 | 3300046557 | Bacteria | 4596 |
| 812 | Ga0495622_0037656 | 3300046557 | Bacteria | 2253 |
| 813 | Ga0495622_0055403 | 3300046557 | Bacteria | 1839 |
| 814 | Ga0495633_0082120 | 3300046558 | Bacteria | 1499 |
| 815 | Ga0495667_0001870 | 3300046559 | Bacteria | 13969 |
| 816 | Ga0495667_0034818 | 3300046559 | Bacteria | 3367 |
| 817 | Ga0495668_0104639 | 3300046616 | Bacteria | 1548 |
| 818 | Ga0495668_0448078 | 3300046616 | Bacteria | 710 |
| 819 | Ga0495668_0646859 | 3300046616 | Bacteria | 584 |
| 820 | Ga0495634_0000502 | 3300046642 | Bacteria | 38371 |
| 821 | Ga0495634_0018374 | 3300046642 | Bacteria | 4977 |
| 822 | Ga0495634_0030388 | 3300046642 | Bacteria | 3731 |
| 823 | Ga0495634_0045287 | 3300046642 | Bacteria | 2975 |
| 824 | Ga0495611_0201695 | 3300046648 | Bacteria | 927 |
| 825 | Ga0495611_0275208 | 3300046648 | Bacteria | 778 |
| 826 | Ga0495611_0519960 | 3300046648 | Bacteria | 540 |
| 827 | Ga0495625_0100049 | 3300046660 | Bacteria | 1993 |
| 828 | Ga0495625_0110135 | 3300046660 | Bacteria | 1883 |
| 829 | Ga0495625_0460267 | 3300046660 | Bacteria | 784 |
| 830 | Ga0495635_0000178 | 3300046663 | Bacteria | 40063 |
| 831 | Ga0495635_0000278 | 3300046663 | Bacteria | 32846 |
| 832 | Ga0495635_0073539 | 3300046663 | Bacteria | 2341 |
| 833 | Ga0495635_0263784 | 3300046663 | Bacteria | 1159 |
| 834 | Ga0495635_0454895 | 3300046663 | Bacteria | 846 |
| 835 | Ga0495661_0513458 | 3300046665 | Bacteria | 570 |
| 836 | Ga0495661_0634129 | 3300046665 | Bacteria | 500 |
| 837 | Ga0495588_0001173 | 3300046674 | Bacteria | 11276 |
| 838 | Ga0495588_0005976 | 3300046674 | Bacteria | 5458 |
| 839 | Ga0495588_0028399 | 3300046674 | Bacteria | 2800 |
| 840 | Ga0495657_0002467 | 3300046675 | Bacteria | 15564 |
| 841 | Ga0495657_0011096 | 3300046675 | Bacteria | 6754 |
| 842 | Ga0495657_0150232 | 3300046675 | Bacteria | 1447 |
| 843 | Ga0495599_0001883 | 3300046678 | Bacteria | 12153 |
| 844 | Ga0495599_0173105 | 3300046678 | Bacteria | 1331 |
| 845 | Ga0495623_0002455 | 3300046679 | Bacteria | 12298 |
| 846 | Ga0495623_0030832 | 3300046679 | Bacteria | 3449 |
| 847 | Ga0495646_0023137 | 3300046680 | Bacteria | 3912 |
| 848 | Ga0495646_0046271 | 3300046680 | Bacteria | 2653 |
| 849 | Ga0495646_0067895 | 3300046680 | Bacteria | 2106 |
| 850 | Ga0495647_0000555 | 3300046681 | Bacteria | 10991 |
| 851 | Ga0495647_0017376 | 3300046681 | Bacteria | 2544 |
| 852 | Ga0495658_0006651 | 3300046683 | Bacteria | 5683 |
| 853 | Ga0495658_0007642 | 3300046683 | Bacteria | 5359 |
| 854 | Ga0495658_0456172 | 3300046683 | Bacteria | 817 |
| 855 | Ga0495669_0124011 | 3300046684 | Bacteria | 1213 |
| 856 | Ga0495669_0383256 | 3300046684 | Bacteria | 680 |
| 857 | Ga0495613_0027216 | 3300046689 | Bacteria | 4255 |
| 858 | Ga0495613_0047301 | 3300046689 | Bacteria | 3178 |
| 859 | Ga0495613_0072358 | 3300046689 | Bacteria | 2513 |
| 860 | Ga0495613_0101301 | 3300046689 | Bacteria | 2080 |
| 861 | Ga0495624_0003669 | 3300046690 | Bacteria | 11352 |
| 862 | Ga0495624_0070763 | 3300046690 | Bacteria | 2171 |
| 863 | Ga0495670_0446576 | 3300046691 | Bacteria | 700 |
| 864 | Ga0495671_0412285 | 3300046692 | Bacteria | 646 |
| 865 | Ga0495649_0519942 | 3300046694 | Bacteria | 591 |
| 866 | Ga0495589_0557236 | 3300046794 | Bacteria | 522 |
| 867 | Ga0495600_0003603 | 3300046809 | Bacteria | 9126 |
| 868 | Ga0495600_0004239 | 3300046809 | Bacteria | 8565 |
| 869 | Ga0495600_0113928 | 3300046809 | Bacteria | 1761 |
| 870 | Ga0495600_0212154 | 3300046809 | Bacteria | 1240 |
| 871 | Ga0495581_0000111 | 3300047315 | Bacteria | 34508 |
| 872 | Ga0495581_0021494 | 3300047315 | Bacteria | 3739 |
| 873 | Ga0495581_0215155 | 3300047315 | Bacteria | 1123 |
| 874 | Ga0495604_0002068 | 3300047317 | Bacteria | 16200 |
| 875 | Ga0495604_0005311 | 3300047317 | Bacteria | 10226 |
| 876 | Ga0495604_0098811 | 3300047317 | Bacteria | 2149 |
| 877 | Ga0495604_0153460 | 3300047317 | Bacteria | 1634 |
| 878 | Ga0495604_0238274 | 3300047317 | Bacteria | 1245 |
| 879 | Ga0495604_0279226 | 3300047317 | Bacteria | 1129 |
| 880 | Ga0495674_0002855 | 3300047319 | Bacteria | 16780 |
| 881 | Ga0495674_0010735 | 3300047319 | Bacteria | 8663 |
| 882 | Ga0495674_0070478 | 3300047319 | Bacteria | 3020 |
| 883 | Ga0495674_0103046 | 3300047319 | Bacteria | 2426 |
| 884 | Ga0495674_0967522 | 3300047319 | Bacteria | 654 |
| 885 | Ga0495672_0008900 | 3300047320 | Bacteria | 7336 |
| 886 | Ga0495672_0264656 | 3300047320 | Bacteria | 828 |
| 887 | Ga0495672_0289121 | 3300047320 | Bacteria | 780 |
| 888 | Ga0495672_0329173 | 3300047320 | Bacteria | 715 |
| 889 | Ga0495676_0076061 | 3300047321 | Bacteria | 2565 |
| 890 | Ga0495676_0292374 | 3300047321 | Bacteria | 1100 |
| 891 | Ga0495680_0007580 | 3300047322 | Bacteria | 9924 |
| 892 | Ga0495683_0082250 | 3300047323 | Bacteria | 1569 |
| 893 | Ga0495675_0001321 | 3300047444 | Bacteria | 15015 |
| 894 | Ga0495675_0005803 | 3300047444 | Bacteria | 7543 |
| 895 | Ga0495675_0118673 | 3300047444 | Bacteria | 1648 |
| 896 | Ga0495677_0363546 | 3300047445 | Bacteria | 571 |
| 897 | Ga0495685_146176 | 3300047447 | Bacteria | 769 |
| 898 | Ga0495673_0027696 | 3300047469 | Bacteria | 2693 |
| 899 | Ga0495673_0090503 | 3300047469 | Bacteria | 1251 |
| 900 | Ga0495673_0112321 | 3300047469 | Bacteria | 1088 |
| 901 | Ga0495673_0323057 | 3300047469 | Bacteria | 549 |
| 902 | Ga0495681_0153397 | 3300047470 | Bacteria | 965 |
| 903 | Ga0495681_0208200 | 3300047470 | Bacteria | 790 |
| 904 | Ga0495684_0000161 | 3300047471 | Bacteria | 50269 |
| 905 | Ga0495684_0012187 | 3300047471 | Bacteria | 6633 |
| 906 | Ga0495684_0100118 | 3300047471 | Bacteria | 2191 |
| 907 | Ga0495686_0023065 | 3300047472 | Bacteria | 4112 |
| 908 | Ga0495686_0082124 | 3300047472 | Bacteria | 1967 |
| 909 | Ga0495686_0461142 | 3300047472 | Bacteria | 674 |
| 910 | Ga0495593_0000210 | 3300047673 | Bacteria | 30957 |
| 911 | Ga0495593_0031631 | 3300047673 | Bacteria | 2889 |
| 912 | Ga0495593_0035968 | 3300047673 | Bacteria | 2686 |
| 913 | Ga0495593_0191695 | 3300047673 | Bacteria | 1028 |
| 914 | Ga0495602_0016051 | 3300048088 | Bacteria | 7536 |
| 915 | Ga0495602_0102410 | 3300048088 | Bacteria | 2346 |
| 916 | Ga0495614_0008531 | 3300048089 | Bacteria | 4555 |
| 917 | Ga0495614_0095767 | 3300048089 | Bacteria | 1294 |
| 918 | Ga0495614_0513404 | 3300048089 | Bacteria | 571 |
| 919 | Ga0495626_0222555 | 3300048091 | Bacteria | 766 |
| 920 | Ga0496100_0034851 | 3300048903 | Bacteria | 3162 |
| 921 | Ga0496100_0100995 | 3300048903 | Bacteria | 1988 |
| 922 | Ga0496100_0498269 | 3300048903 | Bacteria | 938 |
| 923 | Ga0496100_1367123 | 3300048903 | Bacteria | 559 |
| 924 | Ga0496101_0002918 | 3300048904 | Bacteria | 10515 |
| 925 | Ga0496101_0106500 | 3300048904 | Bacteria | 2105 |
| 926 | Ga0496101_1232576 | 3300048904 | Bacteria | 586 |
| 927 | Ga0496101_1390824 | 3300048904 | Bacteria | 547 |
| 928 | Ga0496102_0018118 | 3300048905 | Bacteria | 6180 |
| 929 | Ga0496102_0019762 | 3300048905 | Bacteria | 5937 |
| 930 | Ga0496102_0023714 | 3300048905 | Bacteria | 5452 |
| 931 | Ga0496102_0502472 | 3300048905 | Bacteria | 1135 |
| 932 | Ga0496102_0536240 | 3300048905 | Bacteria | 1093 |
| 933 | Ga0496102_1129153 | 3300048905 | Bacteria | 703 |
| 934 | Ga0496103_0025993 | 3300048906 | Bacteria | 3541 |
| 935 | Ga0496103_0545605 | 3300048906 | Bacteria | 740 |
| 936 | Ga0496104_0005931 | 3300048907 | Bacteria | 10694 |
| 937 | Ga0496104_0166136 | 3300048907 | Bacteria | 2116 |
| 938 | Ga0496104_0360321 | 3300048907 | Bacteria | 1366 |
| 939 | Ga0496104_0570136 | 3300048907 | Bacteria | 1042 |
| 940 | Ga0496104_0864725 | 3300048907 | Bacteria | 809 |
| 941 | Ga0496105_0004596 | 3300048908 | Bacteria | 10399 |
| 942 | Ga0496105_0013161 | 3300048908 | Bacteria | 6560 |
| 943 | Ga0496106_0066930 | 3300048909 | Bacteria | 2737 |
| 944 | Ga0496106_0081280 | 3300048909 | Bacteria | 2489 |
| 945 | Ga0496106_0215946 | 3300048909 | Bacteria | 1528 |
| 946 | Ga0496106_0247267 | 3300048909 | Bacteria | 1425 |
| 947 | Ga0496107_0021320 | 3300048910 | Bacteria | 4579 |
| 948 | Ga0496107_0041856 | 3300048910 | Bacteria | 3290 |
| 949 | Ga0496107_0089617 | 3300048910 | Bacteria | 2246 |
| 950 | Ga0496107_0511623 | 3300048910 | Bacteria | 890 |
| 951 | Ga0496108_0095878 | 3300048911 | Bacteria | 2526 |
| 952 | Ga0496108_0129556 | 3300048911 | Bacteria | 2168 |
| 953 | Ga0496108_0146743 | 3300048911 | Bacteria | 2034 |
| 954 | Ga0496108_0342254 | 3300048911 | Bacteria | 1305 |
| 955 | Ga0496108_0388646 | 3300048911 | Bacteria | 1218 |
| 956 | Ga0496108_0848401 | 3300048911 | Bacteria | 786 |
| 957 | Ga0496109_0154877 | 3300048912 | Bacteria | 2146 |
| 958 | Ga0496109_0338722 | 3300048912 | Bacteria | 1420 |
| 959 | Ga0496109_0387458 | 3300048912 | Bacteria | 1320 |
| 960 | Ga0496109_1329796 | 3300048912 | Bacteria | 654 |
| 961 | Ga0496109_1475083 | 3300048912 | Bacteria | 615 |
| 962 | Ga0496110_0029782 | 3300048913 | Bacteria | 4702 |
| 963 | Ga0496110_0031507 | 3300048913 | Bacteria | 4575 |
| 964 | Ga0496110_0365687 | 3300048913 | Bacteria | 1314 |
| 965 | Ga0496110_0502080 | 3300048913 | Bacteria | 1104 |
| 966 | Ga0496111_0021573 | 3300048914 | Bacteria | 4500 |
| 967 | Ga0496111_0023000 | 3300048914 | Bacteria | 4371 |
| 968 | Ga0496111_0173789 | 3300048914 | Bacteria | 1601 |
| 969 | Ga0496111_0638328 | 3300048914 | Bacteria | 778 |
| 970 | Ga0496111_0697659 | 3300048914 | Bacteria | 738 |
| 971 | Ga0496112_0007361 | 3300048915 | Bacteria | 9767 |
| 972 | Ga0496112_0054601 | 3300048915 | Bacteria | 3925 |
| 973 | Ga0496112_0098430 | 3300048915 | Bacteria | 2894 |
| 974 | Ga0496112_0274029 | 3300048915 | Bacteria | 1635 |
| 975 | Ga0496112_0693491 | 3300048915 | Bacteria | 946 |
| 976 | Ga0496112_1602149 | 3300048915 | Bacteria | 564 |
| 977 | Ga0496113_0003380 | 3300048916 | Bacteria | 9540 |
| 978 | Ga0496113_0029699 | 3300048916 | Bacteria | 3951 |
| 979 | Ga0496113_0122933 | 3300048916 | Bacteria | 2031 |
| 980 | Ga0496113_0429388 | 3300048916 | Bacteria | 1061 |
| 981 | Ga0496114_0148974 | 3300048917 | Bacteria | 2029 |
| 982 | Ga0496114_0199875 | 3300048917 | Bacteria | 1751 |
| 983 | Ga0496114_0386682 | 3300048917 | Bacteria | 1239 |
| 984 | Ga0496114_0660316 | 3300048917 | Bacteria | 919 |
| 985 | Ga0496114_1544804 | 3300048917 | Bacteria | 552 |
| 986 | Ga0496115_0034573 | 3300048918 | Bacteria | 3994 |
| 987 | Ga0496115_0040822 | 3300048918 | Bacteria | 3690 |
| 988 | Ga0496115_0292683 | 3300048918 | Bacteria | 1335 |
| 989 | Ga0496115_1129355 | 3300048918 | Bacteria | 592 |
| 990 | Ga0496116_0053113 | 3300048919 | Bacteria | 2679 |
| 991 | Ga0496116_0063780 | 3300048919 | Bacteria | 2372 |
| 992 | Ga0496116_0179849 | 3300048919 | Bacteria | 1134 |
| 993 | Ga0496117_0044061 | 3300048920 | Bacteria | 3235 |
| 994 | Ga0496117_0074361 | 3300048920 | Bacteria | 2262 |
| 995 | Ga0496117_0314083 | 3300048920 | Bacteria | 824 |
| 996 | Ga0496118_0021634 | 3300048921 | Bacteria | 5653 |
| 997 | Ga0496118_0022102 | 3300048921 | Bacteria | 5574 |
| 998 | Ga0496118_0071024 | 3300048921 | Bacteria | 2509 |
| 999 | Ga0496118_0099007 | 3300048921 | Bacteria | 1978 |
| 1000 | Ga0496119_0030902 | 3300048922 | Bacteria | 3602 |
| 1001 | Ga0496119_0055976 | 3300048922 | Bacteria | 2392 |
| 1002 | Ga0496119_0137517 | 3300048922 | Bacteria | 1323 |
| 1003 | Ga0496120_0207037 | 3300048923 | Bacteria | 946 |
| 1004 | Ga0496121_0000416 | 3300048924 | Bacteria | 84469 |
| 1005 | Ga0496121_0011106 | 3300048924 | Bacteria | 10051 |
| 1006 | Ga0496121_0014503 | 3300048924 | Bacteria | 8355 |
| 1007 | Ga0496121_0015708 | 3300048924 | Bacteria | 7892 |
| 1008 | Ga0496121_0072330 | 3300048924 | Bacteria | 2768 |
| 1009 | Ga0496121_0088558 | 3300048924 | Bacteria | 2426 |
| 1010 | Ga0496121_0120898 | 3300048924 | Bacteria | 1978 |
| 1011 | Ga0496121_0213927 | 3300048924 | Bacteria | 1363 |
| 1012 | Ga0496121_0228970 | 3300048924 | Bacteria | 1303 |
| 1013 | Ga0496121_0356325 | 3300048924 | Bacteria | 973 |
| 1014 | Ga0496122_0046480 | 3300048925 | Bacteria | 3361 |
| 1015 | Ga0496122_0226553 | 3300048925 | Bacteria | 1067 |
| 1016 | Ga0496124_0089914 | 3300048927 | Bacteria | 2506 |
| 1017 | Ga0496124_0154454 | 3300048927 | Bacteria | 1796 |
| 1018 | Ga0496124_0376913 | 3300048927 | Bacteria | 994 |
| 1019 | Ga0496125_0035946 | 3300048928 | Bacteria | 4334 |
| 1020 | Ga0496125_0077485 | 3300048928 | Bacteria | 2562 |
| 1021 | Ga0496125_0396584 | 3300048928 | Bacteria | 808 |
| 1022 | Ga0496126_0030246 | 3300048929 | Bacteria | 5132 |
| 1023 | Ga0496126_0052388 | 3300048929 | Bacteria | 3709 |
| 1024 | Ga0496126_0090310 | 3300048929 | Bacteria | 2695 |
| 1025 | Ga0496126_0090739 | 3300048929 | Bacteria | 2688 |
| 1026 | Ga0496126_0104650 | 3300048929 | Bacteria | 2472 |
| 1027 | Ga0496126_0212892 | 3300048929 | Bacteria | 1626 |
| 1028 | Ga0496126_0327199 | 3300048929 | Bacteria | 1258 |
| 1029 | Ga0495678_146514 | 3300049459 | Bacteria | 767 |
| 1030 | Ga0495682_0164539 | 3300049460 | Bacteria | 790 |
| 1031 | Ga0501031_0000301 | 3300049568 | Bacteria | 28182 |
| 1032 | Ga0501032_0000172 | 3300049569 | Bacteria | 52773 |
| 1033 | Ga0501032_0862947 | 3300049569 | Bacteria | 571 |
| 1034 | Ga0501033_0001887 | 3300049570 | Bacteria | 18238 |
| 1035 | Ga0501034_0000676 | 3300049571 | Bacteria | 51758 |
| 1036 | Ga0501034_0061070 | 3300049571 | Bacteria | 3786 |
| 1037 | Ga0501036_0000390 | 3300049572 | Bacteria | 30889 |
| 1038 | Ga0501036_0353515 | 3300049572 | Bacteria | 1227 |
| 1039 | Ga0501037_0004356 | 3300049573 | Bacteria | 10275 |
| 1040 | Ga0501038_0000089 | 3300049574 | Bacteria | 78009 |
| 1041 | Ga0501038_0145219 | 3300049574 | Bacteria | 1938 |
| 1042 | Ga0501038_0764310 | 3300049574 | Bacteria | 720 |
| 1043 | Ga0501039_0000114 | 3300049575 | Bacteria | 54651 |
| 1044 | Ga0501040_0888471 | 3300049576 | Bacteria | 645 |
| 1045 | Ga0501042_0026453 | 3300049578 | Bacteria | 4077 |
| 1046 | Ga0501042_0488167 | 3300049578 | Bacteria | 894 |
| 1047 | Ga0501043_0001086 | 3300049579 | Bacteria | 23917 |
| 1048 | Ga0501043_0217925 | 3300049579 | Bacteria | 1477 |
| 1049 | Ga0501046_0003225 | 3300049580 | Bacteria | 14988 |
| 1050 | Ga0501046_0186634 | 3300049580 | Bacteria | 1548 |
| 1051 | Ga0501047_0000230 | 3300049581 | Bacteria | 66338 |
| 1052 | Ga0501047_0036575 | 3300049581 | Bacteria | 4746 |
| 1053 | Ga0501048_0000095 | 3300049582 | Bacteria | 47963 |
| 1054 | Ga0501048_1156295 | 3300049582 | Bacteria | 557 |
| 1055 | Ga0501067_0003250 | 3300049583 | Bacteria | 8949 |
| 1056 | Ga0501067_0059385 | 3300049583 | Bacteria | 2117 |
| 1057 | Ga0501067_0188792 | 3300049583 | Bacteria | 1148 |
| 1058 | Ga0501067_0613980 | 3300049583 | Bacteria | 610 |
| 1059 | Ga0501068_0020314 | 3300049584 | Bacteria | 3867 |
| 1060 | Ga0501069_0019111 | 3300049585 | Bacteria | 3702 |
| 1061 | Ga0501069_0121511 | 3300049585 | Bacteria | 1492 |
| 1062 | Ga0501069_0232355 | 3300049585 | Bacteria | 1074 |
| 1063 | Ga0501070_0007130 | 3300049586 | Bacteria | 9492 |
| 1064 | Ga0501070_0017328 | 3300049586 | Bacteria | 6048 |
| 1065 | Ga0501070_0201837 | 3300049586 | Bacteria | 1633 |
| 1066 | Ga0501070_0835721 | 3300049586 | Bacteria | 721 |
| 1067 | Ga0501071_0232092 | 3300049587 | Bacteria | 1390 |
| 1068 | Ga0501071_0743655 | 3300049587 | Bacteria | 755 |
| 1069 | Ga0501072_0001459 | 3300049588 | Bacteria | 17737 |
| 1070 | Ga0501072_0274668 | 3300049588 | Bacteria | 1341 |
| 1071 | Ga0501073_0000055 | 3300049589 | Bacteria | 71726 |
| 1072 | Ga0501074_0000492 | 3300049590 | Bacteria | 24146 |
| 1073 | Ga0501074_0341813 | 3300049590 | Bacteria | 1062 |
| 1074 | Ga0501076_0072621 | 3300049592 | Bacteria | 2754 |
| 1075 | Ga0501076_0643558 | 3300049592 | Bacteria | 875 |
| 1076 | Ga0501076_1624104 | 3300049592 | Bacteria | 530 |
| 1077 | Ga0501077_0501692 | 3300049593 | Bacteria | 778 |
| 1078 | Ga0501079_0001966 | 3300049741 | Bacteria | 14729 |
| 1079 | Ga0501079_0210727 | 3300049741 | Bacteria | 1518 |
| 1080 | Ga0501080_0001671 | 3300049742 | Bacteria | 18890 |
| 1081 | Ga0501081_0343029 | 3300049743 | Bacteria | 1100 |
| 1082 | Ga0501083_0000570 | 3300049744 | Bacteria | 23630 |
| 1083 | Ga0501083_0610189 | 3300049744 | Bacteria | 710 |
| 1084 | Ga0501035_0000355 | 3300049822 | Bacteria | 52714 |
| 1085 | Ga0501035_1168775 | 3300049822 | Bacteria | 598 |
| 1086 | Ga0501035_1434305 | 3300049822 | Bacteria | 528 |
| 1087 | Ga0501044_0000546 | 3300049823 | Bacteria | 45906 |
| 1088 | Ga0501044_0094300 | 3300049823 | Bacteria | 3018 |
| 1089 | Ga0501045_0012777 | 3300049824 | Bacteria | 5917 |
| 1090 | Ga0501045_0388572 | 3300049824 | Bacteria | 1039 |
| 1091 | nmdc:mga03n38_146_c2 | 3300050490 | Bacteria | 4789 |
| 1092 | nmdc:mga03n38_604358_c1 | 3300050490 | Bacteria | 625 |
| 1093 | nmdc:mga00v17_696061_c1 | 3300050491 | Bacteria | 652 |
| 1094 | nmdc:mga0yw44_14698_c1 | 3300050492 | Bacteria | 4166 |
| 1095 | nmdc:mga0yw44_190697_c1 | 3300050492 | Bacteria | 1352 |
| 1096 | nmdc:mga0yw44_91986_c1 | 3300050492 | Bacteria | 1919 |
| 1097 | nmdc:mga06z11_131674_c1 | 3300050494 | Bacteria | 1405 |
| 1098 | nmdc:mga06z11_58590_c1 | 3300050494 | Bacteria | 1999 |
| 1099 | nmdc:mga04h51_11225_c1 | 3300050495 | Bacteria | 1404 |
| 1100 | nmdc:mga04h51_516562_c1 | 3300050495 | Bacteria | 512 |
| 1101 | nmdc:mga07m45_328577_c2 | 3300050496 | Bacteria | 566 |
| 1102 | nmdc:mga07m45_365629_c1 | 3300050496 | Bacteria | 838 |
| 1103 | nmdc:mga0n895_245003_c1 | 3300050512 | Bacteria | 1819 |
| 1104 | nmdc:mga0n895_896011_c1 | 3300050512 | Bacteria | 873 |
| 1105 | nmdc:mga0rr50_119377_c1 | 3300050513 | Bacteria | 2096 |
| 1106 | nmdc:mga08x19_280221_c1 | 3300050514 | Bacteria | 1155 |
| 1107 | nmdc:mga0a205_1182474_c1 | 3300050515 | Bacteria | 612 |
| 1108 | Ga0495601_0073688 | 3300053077 | Bacteria | 2183 |
| 1109 | Ga0495601_0122184 | 3300053077 | Bacteria | 1692 |
| 1110 | Ga0495601_0148842 | 3300053077 | Bacteria | 1528 |
| 1111 | Ga0495601_0201206 | 3300053077 | Bacteria | 1301 |
| 1112 | Ga0495601_0493014 | 3300053077 | Bacteria | 791 |
| 1113 | Ga0495612_0006238 | 3300053078 | Bacteria | 4911 |
| 1114 | Ga0495612_0051061 | 3300053078 | Bacteria | 1699 |
| 1115 | Ga0495612_0234020 | 3300053078 | Bacteria | 815 |
| 1116 | Ga0495612_0265549 | 3300053078 | Bacteria | 765 |
| 1117 | Ga0495612_0274612 | 3300053078 | Bacteria | 752 |
| 1118 | Ga0500610_0074278 | 3300053079 | Bacteria | 1773 |
| 1119 | Ga0500610_0102904 | 3300053079 | Bacteria | 1476 |
| 1120 | Ga0500635_0048895 | 3300053080 | Bacteria | 1442 |
| 1121 | Ga0495595_0040765 | 3300053084 | Bacteria | 2123 |
| 1122 | Ga0495595_0181672 | 3300053084 | Bacteria | 1043 |
| 1123 | Ga0495619_0012613 | 3300053085 | Bacteria | 5319 |
| 1124 | Ga0495619_0044373 | 3300053085 | Bacteria | 2918 |
| 1125 | Ga0495619_0283041 | 3300053085 | Bacteria | 1149 |
| 1126 | Ga0495619_0808084 | 3300053085 | Bacteria | 634 |
| 1127 | Ga0500643_000278 | 3300053087 | Bacteria | 44354 |
| 1128 | Ga0500646_0390932 | 3300053090 | Bacteria | 512 |
| 1129 | Ga0500647_0077634 | 3300053091 | Bacteria | 1593 |
| 1130 | Ga0500583_0048514 | 3300053092 | Bacteria | 1960 |
| 1131 | Ga0500641_0005143 | 3300053096 | Bacteria | 4636 |
| 1132 | Ga0500641_0017084 | 3300053096 | Bacteria | 2708 |
| 1133 | Ga0500641_0030621 | 3300053096 | Bacteria | 2116 |
| 1134 | Ga0500648_200584 | 3300053097 | Bacteria | 1003 |
| 1135 | Ga0500555_001487 | 3300053103 | Bacteria | 7124 |
| 1136 | Ga0500556_0104326 | 3300053104 | Bacteria | 1094 |
| 1137 | Ga0500556_0214401 | 3300053104 | Bacteria | 760 |
| 1138 | Ga0500557_000028 | 3300053105 | Bacteria | 78414 |
| 1139 | Ga0500558_207792 | 3300053106 | Bacteria | 676 |
| 1140 | Ga0500562_006678 | 3300053108 | Bacteria | 2908 |
| 1141 | Ga0500592_052706 | 3300053116 | Bacteria | 662 |
| 1142 | Ga0500595_000653 | 3300053119 | Bacteria | 20857 |
| 1143 | Ga0500595_008924 | 3300053119 | Bacteria | 4072 |
| 1144 | Ga0500595_046793 | 3300053119 | Bacteria | 1358 |
| 1145 | Ga0500595_170266 | 3300053119 | Bacteria | 605 |
| 1146 | Ga0500597_192449 | 3300053120 | Bacteria | 860 |
| 1147 | Ga0500614_151196 | 3300053123 | Bacteria | 699 |
| 1148 | Ga0500642_0000590 | 3300053130 | Bacteria | 10893 |
| 1149 | Ga0500642_0189905 | 3300053130 | Bacteria | 958 |
| 1150 | Ga0500652_158762 | 3300053131 | Bacteria | 935 |
| 1151 | Ga0500568_0040122 | 3300053139 | Bacteria | 1886 |
| 1152 | Ga0500568_0141723 | 3300053139 | Bacteria | 891 |
| 1153 | Ga0500573_0176496 | 3300053140 | Bacteria | 1151 |
| 1154 | Ga0500577_0065705 | 3300053142 | Bacteria | 1409 |
| 1155 | Ga0500604_0091899 | 3300053151 | Bacteria | 992 |
| 1156 | Ga0500604_0132514 | 3300053151 | Bacteria | 839 |
| 1157 | Ga0500604_0193759 | 3300053151 | Bacteria | 698 |
| 1158 | Ga0500616_0097299 | 3300053153 | Bacteria | 1445 |
| 1159 | Ga0500619_229152 | 3300053154 | Bacteria | 617 |
| 1160 | Ga0500622_0038166 | 3300053156 | Bacteria | 2506 |
| 1161 | Ga0500633_0101430 | 3300053160 | Bacteria | 1059 |
| 1162 | Ga0500638_125829 | 3300053162 | Bacteria | 1167 |
| 1163 | Ga0500638_182850 | 3300053162 | Bacteria | 903 |
| 1164 | Ga0500636_0416206 | 3300053177 | Bacteria | 618 |
| 1165 | Ga0500636_0461383 | 3300053177 | Bacteria | 571 |
| 1166 | Ga0500636_0473449 | 3300053177 | Bacteria | 560 |
| 1167 | Ga0500637_0211898 | 3300053178 | Bacteria | 1099 |
| 1168 | Ga0500645_050563 | 3300053730 | Bacteria | 1213 |
| 1169 | Ga0500596_008868 | 3300053735 | Bacteria | 1590 |
| 1170 | Ga0500599_022802 | 3300053736 | Bacteria | 896 |
| 1171 | Ga0501084_0001687 | 3300054114 | Bacteria | 17561 |
| 1172 | Ga0501082_0009399 | 3300060353 | Bacteria | 8417 |
| 1173 | Ga0466962_0217020 | 3300061719 | Bacteria | 936 |
| 1174 | 2513677979 | 2513237098 | Bacteria | 9902361 |
| 1175 | 2513715566 | 2513237104 | Bacteria | 10034502 |
| 1176 | 2514016366 | 2513237161 | Bacteria | 8871253 |
| 1177 | 2517106999 | 2517093001 | Bacteria | 9002274 |
| 1178 | 2524435608 | 2524023205 | Bacteria | 8918781 |
| 1179 | 2524468343 | 2524023210 | Bacteria | 9029266 |
| 1180 | 2528858118 | 2528768022 | Bacteria | 10457665 |
| 1181 | 2617352931 | 2617270735 | Bacteria | 9163226 |
| 1182 | 2745079864 | 2744054633 | Bacteria | 8678936 |
| 1183 | 2824608406 | 2824600985 | Bacteria | 8488197 |
| 1184 | 2824617434 | 2824609381 | Bacteria | 8672835 |
| 1185 | 2824659991 | 2824653114 | Bacteria | 8493680 |
| 1186 | 2824669191 | 2824661429 | Bacteria | 9877870 |
| 1187 | 2824674753 | 2824671348 | Bacteria | 8369588 |
| 1188 | 2824694625 | 2824687955 | Bacteria | 8360029 |
| 1189 | 2824779850 | 2824773399 | Bacteria | 8360218 |
| 1190 | 2838130226 | 2838122688 | Bacteria | 8803140 |
| 1191 | 2841944331 | 2841941048 | Bacteria | 8688029 |
| 1192 | 2841954492 | 2841949485 | Bacteria | 8680857 |
| 1193 | 2841969108 | 2841966195 | Bacteria | 8673214 |
| 1194 | 2841979882 | 2841974524 | Bacteria | 8931498 |
| 1195 | 2841990937 | 2841983080 | Bacteria | 8395090 |
| 1196 | 2842044013 | 2842038055 | Bacteria | 8002051 |
| 1197 | 2842051998 | 2842045827 | Bacteria | 8006841 |
| 1198 | 2849082549 | 2849076700 | Bacteria | 7039503 |
| 1199 | 2876764518 | 2876761206 | Bacteria | 10111113 |
| 1200 | 2879099951 | 2879099564 | Bacteria | 10442239 |
| 1201 | 2885368123 | 2885366525 | Bacteria | 8326213 |
| 1202 | 2885384657 | 2885383462 | Bacteria | 9473874 |
| 1203 | 2888391160 | 2888388044 | Bacteria | 7304136 |
| 1204 | 2888420909 | 2888419890 | Bacteria | 7857137 |
| 1205 | 2903773441 | 2903768456 | Bacteria | 9749579 |
| 1206 | 2906651304 | 2906643746 | Bacteria | 8722424 |
| 1207 | 2922378500 | |||
| 1208 | 2929622413 | 2929615660 | Bacteria | 9193770 |
| 1209 | 2929631370 | 2929624759 | Bacteria | 9339455 |
| 1210 | 2932786212 | 2932784394 | Bacteria | 9704911 |
| 1211 | 2932816855 | 2932809354 | Bacteria | 9135765 |
| 1212 | 2932825995 | 2932818245 | Bacteria | 9955613 |
| 1213 | 2932829450 | 2932828146 | Bacteria | 9745859 |
| 1214 | 2933584507 | 2933577622 | Bacteria | 9116884 |
| 1215 | 2935617882 | 2935616580 | Bacteria | 9032984 |
| 1216 | 2935641634 | 2935638405 | Bacteria | 10015038 |
| 1217 | 2935669308 | 2935665750 | Bacteria | 9571747 |
| 1218 | 2935678096 | 2935675223 | Bacteria | 9928132 |
| 1219 | 2935693585 | 2935684952 | Bacteria | 9590419 |
| 1220 | 2935702905 | 2935694250 | Bacteria | 9291695 |
| 1221 | 2935707131 | 2935703347 | Bacteria | 10242284 |
| 1222 | 2935716949 | 2935713505 | Bacteria | 9608509 |
| 1223 | 2935730217 | 2935722832 | Bacteria | 9608746 |
| 1224 | 2935738388 | 2935732158 | Bacteria | 9706831 |
| 1225 | 2935750176 | 2935741537 | Bacteria | 9707219 |
| 1226 | 2935759770 | 2935750917 | Bacteria | 9590372 |
| 1227 | 2935764579 | 2935760218 | Bacteria | 9817913 |
| 1228 | 2935804488 | 2935801545 | Bacteria | 9301974 |
| 1229 | 2935819111 | 2935810662 | Bacteria | 9401221 |
| 1230 | 2935831365 | 2935827899 | Bacteria | 10038562 |
| 1231 | 2935841974 | 2935837841 | Bacteria | 9454360 |
| 1232 | 2935856619 | 2935855204 | Bacteria | 9035059 |
| 1233 | 2935870234 | 2935864058 | Bacteria | 9784707 |
| 1234 | 2935874441 | 2935873716 | Bacteria | 9632195 |
| 1235 | 2935964279 | 2935959822 | Bacteria | 7869783 |
| 1236 | 2935993902 | 2935992306 | Bacteria | 9802711 |
| 1237 | 2936005087 | 2936002035 | Bacteria | 9362176 |
| 1238 | 2936045738 | 2936037263 | Bacteria | 9446081 |
| 1239 | 2940565776 | 2940556831 | Bacteria | 9590747 |
| 1240 | 2941547025 | 2941538514 | Bacteria | 9402094 |
| 1241 | 3005509666 | 3005506211 | Bacteria | 6943378 |
| 1242 | 8016518786 | 8016511872 | Bacteria | 9921665 |
| 1243 | 8016585652 | 8016583857 | Bacteria | 10421953 |
| 1244 | 8017057893 | 8017057580 | Bacteria | 10023680 |
| 1245 | 8019577831 | 8019576017 | Bacteria | 10049540 |
| 1246 | 8019595933 | 8019586578 | Bacteria | 10212056 |
| 1247 | 8019605822 | 8019597564 | Bacteria | 10041141 |
| 1248 | 8019612712 | 8019608314 | Bacteria | 10042931 |
| 1249 | 8055750864 | 8055742211 | Bacteria | 9226248 |
| 1250 | 8056688974 | 8056681323 | Bacteria | 8472857 |
| 1251 | Ga0496126_0093204 | |||
| 1252 | JGI24740J21852_10040614 | |||
| 1253 | JGI24740J21852_10100766 | |||
| 1254 | JGI24739J22299_10018096 | |||
| 1255 | JGI24737J22298_10035570 | |||
| 1256 | JGI24735J21928_10030238 | |||
| 1257 | JGI24738J21930_10096468 | |||
| 1258 | JGI25165J46597_1007530 | |||
| 1259 | JGI25153J46596_10002724 | |||
| 1260 | JGI25153J46596_10006859 | |||
| 1261 | JGI25153J46596_10014488 | |||
| 1262 | JGI25160J50197_1002595 | |||
| 1263 | JGI25160J50197_1013590 | |||
| 1264 | JGI25404J52841_10003219 | |||
| 1265 | JGI25404J52841_10005710 | |||
| 1266 | JGI25404J52841_10025523 | |||
| 1267 | JGI25404J52841_10111207 | |||
| 1268 | JGI25404J52841_10121062 | |||
| 1269 | JGI25404J52841_10129328 | |||
| 1270 | JGI25404J52841_10140125 | |||
| 1271 | Ga0055539_1011455 | |||
| 1272 | Ga0055543_1001923 | |||
| 1273 | Ga0065165_1001543 | |||
| 1274 | Ga0065165_1004042 | |||
| 1275 | Ga0065715_10239338 | |||
| 1276 | Ga0070683_100031957 | |||
| 1277 | Ga0070683_100547266 | |||
| 1278 | Ga0070683_101367249 | |||
| 1279 | Ga0070690_100149207 | |||
| 1280 | Ga0070670_100367474 | |||
| 1281 | Ga0070670_101722591 | |||
| 1282 | Ga0068869_100069180 | |||
| 1283 | Ga0068869_100172885 | |||
| 1284 | Ga0070666_10241331 | |||
| 1285 | Ga0070680_100307419 | |||
| 1286 | Ga0070680_101138019 | |||
| 1287 | Ga0070680_101896680 | |||
| 1288 | Ga0070682_100071496 | |||
| 1289 | Ga0070682_100379289 | |||
| 1290 | Ga0070682_100560656 | |||
| 1291 | Ga0070682_100615341 | |||
| 1292 | Ga0070682_101273408 | |||
| 1293 | Ga0070682_101938668 | |||
| 1294 | Ga0068868_100286918 | |||
| 1295 | Ga0068868_100830954 | |||
| 1296 | Ga0070689_100359098 | |||
| 1297 | Ga0070691_10139385 | |||
| 1298 | Ga0070661_100019593 | |||
| 1299 | Ga0070661_100055569 | |||
| 1300 | Ga0070661_100994375 | |||
| 1301 | Ga0070661_101879465 | |||
| 1302 | Ga0070692_11016861 | |||
| 1303 | Ga0070668_100042894 | |||
| 1304 | Ga0070668_100571802 | |||
| 1305 | Ga0070668_101213960 | |||
| 1306 | Ga0070669_100550689 | |||
| 1307 | Ga0070675_101082660 | |||
| 1308 | Ga0070671_100085250 | |||
| 1309 | Ga0070671_100152494 | |||
| 1310 | Ga0070671_100308929 | |||
| 1311 | Ga0070673_101160772 | |||
| 1312 | Ga0070688_100704014 | |||
| 1313 | Ga0070688_101288106 | |||
| 1314 | Ga0070667_100554409 | |||
| 1315 | Ga0070709_10157291 | |||
| 1316 | Ga0070709_10473753 | |||
| 1317 | Ga0070709_11454503 | |||
| 1318 | Ga0070714_100029988 | |||
| 1319 | Ga0070714_100087283 | |||
| 1320 | Ga0070714_102077640 | |||
| 1321 | Ga0070713_100024907 | |||
| 1322 | Ga0070713_100052082 | |||
| 1323 | Ga0070713_100157708 | |||
| 1324 | Ga0070713_100215803 | |||
| 1325 | Ga0070713_100223729 | |||
| 1326 | Ga0070713_100753528 | |||
| 1327 | Ga0070713_100793763 | |||
| 1328 | Ga0070713_101826671 | |||
| 1329 | Ga0070710_10057595 | |||
| 1330 | Ga0070710_10169670 | |||
| 1331 | Ga0070710_10604326 | |||
| 1332 | Ga0070710_11294962 | |||
| 1333 | Ga0070710_11436279 | |||
| 1334 | Ga0070711_100043340 | |||
| 1335 | Ga0070711_100347004 | |||
| 1336 | Ga0070711_100809903 | |||
| 1337 | Ga0070700_100736280 | |||
| 1338 | Ga0070663_100090328 | |||
| 1339 | Ga0070663_100114379 | |||
| 1340 | Ga0070663_100137801 | |||
| 1341 | Ga0070663_100287099 | |||
| 1342 | Ga0070663_100289594 | |||
| 1343 | Ga0070663_100573844 | |||
| 1344 | Ga0070663_100628560 | |||
| 1345 | Ga0070663_101282564 | |||
| 1346 | Ga0070678_102177391 | |||
| 1347 | Ga0070662_100252298 | |||
| 1348 | Ga0070662_101273569 | |||
| 1349 | Ga0070681_10072573 | |||
| 1350 | Ga0070681_10694972 | |||
| 1351 | Ga0070681_11134686 | |||
| 1352 | Ga0068867_101436807 | |||
| 1353 | Ga0070706_100069420 | |||
| 1354 | Ga0070707_100171097 | |||
| 1355 | Ga0070698_100049630 | |||
| 1356 | Ga0070698_100610121 | |||
| 1357 | Ga0070698_101757010 | |||
| 1358 | Ga0070679_100076441 | |||
| 1359 | Ga0070679_100172660 | |||
| 1360 | Ga0070679_100314036 | |||
| 1361 | Ga0070684_100040027 | |||
| 1362 | Ga0070697_101222492 | |||
| 1363 | Ga0068853_100024444 | |||
| 1364 | Ga0068853_100027664 | |||
| 1365 | Ga0068853_100084290 | |||
| 1366 | Ga0068853_100228164 | |||
| 1367 | Ga0068853_100304177 | |||
| 1368 | Ga0068853_100595171 | |||
| 1369 | Ga0068853_100798688 | |||
| 1370 | Ga0068853_101030539 | |||
| 1371 | Ga0068853_101096187 | |||
| 1372 | Ga0068853_101910414 | |||
| 1373 | Ga0070672_101106862 | |||
| 1374 | Ga0070686_100452254 | |||
| 1375 | Ga0070686_101036394 | |||
| 1376 | Ga0070693_100181272 | |||
| 1377 | Ga0070693_100901114 | |||
| 1378 | Ga0070665_100086930 | |||
| 1379 | Ga0070665_100160756 | |||
| 1380 | Ga0070665_100271889 | |||
| 1381 | Ga0070665_100635545 | |||
| 1382 | Ga0070665_100724062 | |||
| 1383 | Ga0070665_100916929 | |||
| 1384 | Ga0070665_101047453 | |||
| 1385 | Ga0070665_101891907 | |||
| 1386 | Ga0070704_100756419 | |||
| 1387 | Ga0068855_100055564 | |||
| 1388 | Ga0068855_100201635 | |||
| 1389 | Ga0068855_100602453 | |||
| 1390 | Ga0068855_100803523 | |||
| 1391 | Ga0068855_100809056 | |||
| 1392 | Ga0068855_100964270 | |||
| 1393 | Ga0068855_101778643 | |||
| 1394 | Ga0068855_102064694 | |||
| 1395 | Ga0068855_102605036 | |||
| 1396 | Ga0070664_100165043 | |||
| 1397 | Ga0070664_100660711 | |||
| 1398 | Ga0070664_100765455 | |||
| 1399 | Ga0070664_101460507 | |||
| 1400 | Ga0068857_100003131 | |||
| 1401 | Ga0068857_100031174 | |||
| 1402 | Ga0068857_100132504 | |||
| 1403 | Ga0068857_100799322 | |||
| 1404 | Ga0068854_100008309 | |||
| 1405 | Ga0068854_100522690 | |||
| 1406 | Ga0068854_100878325 | |||
| 1407 | Ga0068856_100073867 | |||
| 1408 | Ga0068856_100100242 | |||
| 1409 | Ga0068856_100162266 | |||
| 1410 | Ga0068856_100363125 | |||
| 1411 | Ga0068856_101489134 | |||
| 1412 | Ga0068856_101748870 | |||
| 1413 | Ga0068856_102486254 | |||
| 1414 | Ga0070702_100896953 | |||
| 1415 | Ga0070702_101145875 | |||
| 1416 | Ga0070702_101537333 | |||
| 1417 | Ga0068852_100136236 | |||
| 1418 | Ga0068852_100465641 | |||
| 1419 | Ga0068852_101369889 | |||
| 1420 | Ga0068852_102294111 | |||
| 1421 | Ga0068859_100113160 | |||
| 1422 | Ga0068859_100325970 | |||
| 1423 | Ga0068859_100465838 | |||
| 1424 | Ga0068859_101595023 | |||
| 1425 | Ga0068866_10745753 | |||
| 1426 | Ga0068861_100261871 | |||
| 1427 | Ga0068861_100804464 | |||
| 1428 | Ga0068861_101529580 | |||
| 1429 | Ga0068851_10001649 | |||
| 1430 | Ga0068851_10027032 | |||
| 1431 | Ga0068851_10220891 | |||
| 1432 | Ga0068870_11323214 | |||
| 1433 | Ga0068863_100385662 | |||
| 1434 | Ga0068863_100407934 | |||
| 1435 | Ga0068858_100120255 | |||
| 1436 | Ga0068858_101204374 | |||
| 1437 | Ga0068862_101106662 | |||
| 1438 | Ga0081455_10036986 | |||
| 1439 | Ga0081455_10047126 | |||
| 1440 | Ga0081455_10950013 | |||
| 1441 | Ga0081455_11028642 | |||
| 1442 | Ga0081538_10033090 | |||
| 1443 | Ga0081538_10088138 | |||
| 1444 | Ga0081540_1002008 | |||
| 1445 | Ga0081540_1002669 | |||
| 1446 | Ga0081540_1004358 | |||
| 1447 | Ga0081540_1013548 | |||
| 1448 | Ga0081540_1016623 | |||
| 1449 | Ga0081540_1017941 | |||
| 1450 | Ga0081540_1058758 | |||
| 1451 | Ga0081540_1156007 | |||
| 1452 | Ga0081540_1227991 | |||
| 1453 | Ga0081540_1256499 | |||
| 1454 | Ga0081540_1280575 | |||
| 1455 | Ga0081540_1331912 | |||
| 1456 | Ga0081539_10000902 | |||
| 1457 | Ga0081539_10012998 | |||
| 1458 | Ga0081539_10264041 | |||
| 1459 | Ga0081539_10360055 | |||
| 1460 | Ga0070717_10029119 | |||
| 1461 | Ga0070717_10127050 | |||
| 1462 | Ga0070717_10339663 | |||
| 1463 | Ga0070717_11377629 | |||
| 1464 | Ga0075365_10025042 | |||
| 1465 | Ga0075365_10234247 | |||
| 1466 | Ga0075368_10002408 | |||
| 1467 | Ga0075368_10095576 | |||
| 1468 | Ga0075363_100000457 | |||
| 1469 | Ga0075363_100273791 | |||
| 1470 | Ga0075363_100589058 | |||
| 1471 | Ga0075364_10089293 | |||
| 1472 | Ga0070716_100401581 | |||
| 1473 | Ga0070712_100238466 | |||
| 1474 | Ga0070712_100281435 | |||
| 1475 | Ga0075362_10014331 | |||
| 1476 | Ga0075362_10084138 | |||
| 1477 | Ga0075367_10017461 | |||
| 1478 | Ga0075367_10079893 | |||
| 1479 | Ga0075367_10227306 | |||
| 1480 | Ga0075366_10067485 | |||
| 1481 | Ga0075366_10074999 | |||
| 1482 | Ga0097621_100550989 | |||
| 1483 | Ga0097621_100662267 | |||
| 1484 | Ga0075370_10043541 | |||
| 1485 | Ga0075370_10082365 | |||
| 1486 | Ga0075370_10177373 | |||
| 1487 | Ga0075370_10244088 | |||
| 1488 | Ga0075370_10368466 | |||
| 1489 | Ga0075370_11043211 | |||
| 1490 | Ga0068871_100693171 | |||
| 1491 | Ga0068871_100891808 | |||
| 1492 | Ga0075434_100016914 | |||
| 1493 | Ga0075434_100590644 | |||
| 1494 | Ga0075436_100306510 | |||
| 1495 | Ga0097620_100113159 | |||
| 1496 | Ga0097620_100325970 | |||
| 1497 | Ga0097620_100465853 | |||
| 1498 | Ga0097620_101595137 | |||
| 1499 | Ga0099794_10093466 | |||
| 1500 | Ga0099795_10235221 | |||
| 1501 | Ga0105251_10415890 | |||
| 1502 | Ga0105250_10071694 | |||
| 1503 | Ga0105240_10014949 | |||
| 1504 | Ga0105240_10019882 | |||
| 1505 | Ga0105240_10143012 | |||
| 1506 | Ga0105240_10164801 | |||
| 1507 | Ga0105240_10226359 | |||
| 1508 | Ga0105240_10328349 | |||
| 1509 | Ga0105240_11027213 | |||
| 1510 | Ga0105245_10233828 | |||
| 1511 | Ga0105245_10499909 | |||
| 1512 | Ga0105245_10908103 | |||
| 1513 | Ga0105245_11376847 | |||
| 1514 | Ga0105245_11602851 | |||
| 1515 | Ga0105247_10122301 | |||
| 1516 | Ga0105247_10181027 | |||
| 1517 | Ga0105247_10194459 | |||
| 1518 | Ga0105247_11372860 | |||
| 1519 | Ga0105243_10160026 | |||
| 1520 | Ga0105243_10319802 | |||
| 1521 | Ga0105243_11095100 | |||
| 1522 | Ga0105243_11429303 | |||
| 1523 | Ga0105241_10394480 | |||
| 1524 | Ga0105241_10487179 | |||
| 1525 | Ga0105241_10560917 | |||
| 1526 | Ga0105242_10138692 | |||
| 1527 | Ga0105242_10401226 | |||
| 1528 | Ga0105242_13116887 | |||
| 1529 | Ga0105248_10070400 | |||
| 1530 | Ga0105248_10123366 | |||
| 1531 | Ga0105248_10520449 | |||
| 1532 | Ga0105248_12598562 | |||
| 1533 | Ga0105248_12788544 | |||
| 1534 | Ga0105237_10028929 | |||
| 1535 | Ga0105237_10048231 | |||
| 1536 | Ga0105237_10108333 | |||
| 1537 | Ga0105237_10401055 | |||
| 1538 | Ga0105237_10859994 | |||
| 1539 | Ga0105237_11556942 | |||
| 1540 | Ga0105237_11581436 | |||
| 1541 | Ga0105237_12783856 | |||
| 1542 | Ga0105238_10105864 | |||
| 1543 | Ga0105238_10212171 | |||
| 1544 | Ga0105238_10990799 | |||
| 1545 | Ga0105249_10027700 | |||
| 1546 | Ga0105249_10693850 | |||
| 1547 | Ga0099796_10086991 | |||
| 1548 | Ga0105239_10052448 | |||
| 1549 | Ga0105239_10230018 | |||
| 1550 | Ga0105239_10302257 | |||
| 1551 | Ga0105239_10771620 | |||
| 1552 | Ga0105239_12164931 | |||
| 1553 | Ga0105239_12548433 | |||
| 1554 | Ga0105239_13040845 | |||
| 1555 | Ga0105246_10159510 | |||
| 1556 | Ga0105246_10354015 | |||
| 1557 | Ga0105246_10956650 | |||
| 1558 | Ga0105246_11534297 | |||
| 1559 | Ga0105246_12424393 | |||
| 1560 | Ga0157373_10366731 | |||
| 1561 | Ga0157373_11218541 | |||
| 1562 | Ga0157371_10254843 | |||
| 1563 | Ga0157370_10160110 | |||
| 1564 | Ga0157370_10232227 | |||
| 1565 | Ga0157370_10626551 | |||
| 1566 | Ga0157369_10004460 | |||
| 1567 | Ga0157369_10018976 | |||
| 1568 | Ga0157369_12148914 | |||
| 1569 | Ga0157374_10110734 | |||
| 1570 | Ga0157374_10164047 | |||
| 1571 | Ga0163162_10110973 | |||
| 1572 | Ga0163162_10858613 | |||
| 1573 | Ga0163162_10887786 | |||
| 1574 | Ga0163162_12055559 | |||
| 1575 | Ga0157372_10045484 | |||
| 1576 | Ga0157372_10481603 | |||
| 1577 | Ga0157372_11680354 | |||
| 1578 | Ga0157375_10067779 | |||
| 1579 | Ga0157375_10120122 | |||
| 1580 | Ga0157375_12745228 | |||
| 1581 | Ga0163163_10315548 | |||
| 1582 | Ga0163163_11983504 | |||
| 1583 | Ga0157379_10059342 | |||
| 1584 | Ga0157379_10331322 | |||
| 1585 | Ga0157379_10371414 | |||
| 1586 | Ga0157379_10580625 | |||
| 1587 | Ga0157379_11409749 | |||
| 1588 | Ga0157376_10624820 | |||
| 1589 | Ga0182006_1104364 | |||
| 1590 | Ga0182007_10159157 | |||
| 1591 | Ga0163161_11398692 | |||
| 1592 | Ga0163161_11472570 | |||
| 1593 | Ga0206354_10622256 | |||
| 1594 | Ga0154015_1445201 | |||
| 1595 | Ga0213872_10034797 | |||
| 1596 | Ga0213876_10176160 | |||
| 1597 | Ga0213875_10065765 | |||
| 1598 | Ga0213871_10194272 | |||
| 1599 | Ga0224712_10268563 | |||
| 1600 | Ga0224712_10589203 | |||
| 1601 | Ga0209563_103179 | |||
| 1602 | Ga0209677_100434 | |||
| 1603 | Ga0209677_102685 | |||
| 1604 | Ga0209148_1009199 | |||
| 1605 | Ga0209233_1001815 | |||
| 1606 | Ga0209233_1008918 | |||
| 1607 | Ga0209455_1002067 | |||
| 1608 | Ga0209673_1056243 | |||
| 1609 | Ga0209564_1010640 | |||
| 1610 | Ga0209758_1000389 | |||
| 1611 | Ga0209758_1001056 | |||
| 1612 | Ga0209758_1004662 | |||
| 1613 | Ga0209758_1011597 | |||
| 1614 | Ga0209758_1047353 | |||
| 1615 | Ga0207426_1000380 | |||
| 1616 | Ga0207426_1001551 | |||
| 1617 | Ga0207426_1022964 | |||
| 1618 | Ga0207426_1080914 | |||
| 1619 | Ga0209257_1009836 | |||
| 1620 | Ga0209257_1125441 | |||
| 1621 | Ga0207656_10007457 | |||
| 1622 | Ga0207656_10115012 | |||
| 1623 | Ga0207692_10049368 | |||
| 1624 | Ga0207692_10188672 | |||
| 1625 | Ga0207710_10127075 | |||
| 1626 | Ga0207710_10305729 | |||
| 1627 | Ga0207710_10617178 | |||
| 1628 | Ga0207688_10102200 | |||
| 1629 | Ga0207688_10120678 | |||
| 1630 | Ga0207680_10311187 | |||
| 1631 | Ga0207647_10002061 | |||
| 1632 | Ga0207685_10062660 | |||
| 1633 | Ga0207685_10272466 | |||
| 1634 | Ga0207699_10085566 | |||
| 1635 | Ga0207699_10168045 | |||
| 1636 | Ga0207699_10238682 | |||
| 1637 | Ga0207699_10268474 | |||
| 1638 | Ga0207699_10312261 | |||
| 1639 | Ga0207699_10385406 | |||
| 1640 | Ga0207684_10109834 | |||
| 1641 | Ga0207654_10001581 | |||
| 1642 | Ga0207654_10103926 | |||
| 1643 | Ga0207654_10171867 | |||
| 1644 | Ga0207654_10413381 | |||
| 1645 | Ga0207654_10484612 | |||
| 1646 | Ga0207707_10001012 | |||
| 1647 | Ga0207707_10061491 | |||
| 1648 | Ga0207707_10638807 | |||
| 1649 | Ga0207707_10944032 | |||
| 1650 | Ga0207695_10000463 | |||
| 1651 | Ga0207695_10037987 | |||
| 1652 | Ga0207695_10106934 | |||
| 1653 | Ga0207695_10120623 | |||
| 1654 | Ga0207695_10162848 | |||
| 1655 | Ga0207695_10212399 | |||
| 1656 | Ga0207695_10431082 | |||
| 1657 | Ga0207695_10886801 | |||
| 1658 | Ga0207671_10259805 | |||
| 1659 | Ga0207671_10270361 | |||
| 1660 | Ga0207671_10360105 | |||
| 1661 | Ga0207671_10521249 | |||
| 1662 | Ga0207671_10636540 | |||
| 1663 | Ga0207671_11329701 | |||
| 1664 | Ga0207693_10012775 | |||
| 1665 | Ga0207693_10019974 | |||
| 1666 | Ga0207693_10247808 | |||
| 1667 | Ga0207693_10762965 | |||
| 1668 | Ga0207693_10879327 | |||
| 1669 | Ga0207663_10017436 | |||
| 1670 | Ga0207663_11637220 | |||
| 1671 | Ga0207660_11550959 | |||
| 1672 | Ga0207657_11106517 | |||
| 1673 | Ga0207649_10019765 | |||
| 1674 | Ga0207649_10985907 | |||
| 1675 | Ga0207652_10061396 | |||
| 1676 | Ga0207652_10095839 | |||
| 1677 | Ga0207652_10440252 | |||
| 1678 | Ga0207681_10685696 | |||
| 1679 | Ga0207694_10000234 | |||
| 1680 | Ga0207694_10047684 | |||
| 1681 | Ga0207659_11047880 | |||
| 1682 | Ga0207687_10700519 | |||
| 1683 | Ga0207687_11962058 | |||
| 1684 | Ga0207700_10069972 | |||
| 1685 | Ga0207700_10436320 | |||
| 1686 | Ga0207700_10449344 | |||
| 1687 | Ga0207700_11377137 | |||
| 1688 | Ga0207664_10003852 | |||
| 1689 | Ga0207664_10172179 | |||
| 1690 | Ga0207664_10665798 | |||
| 1691 | Ga0207664_10781728 | |||
| 1692 | Ga0207644_10201791 | |||
| 1693 | Ga0207644_10262314 | |||
| 1694 | Ga0207644_10484076 | |||
| 1695 | Ga0207706_10077413 | |||
| 1696 | Ga0207706_10139948 | |||
| 1697 | Ga0207686_10117452 | |||
| 1698 | Ga0207686_10656639 | |||
| 1699 | Ga0207686_10771396 | |||
| 1700 | Ga0207709_10903713 | |||
| 1701 | Ga0207665_10062967 | |||
| 1702 | Ga0207665_10482214 | |||
| 1703 | Ga0207665_10621423 | |||
| 1704 | Ga0207665_10950211 | |||
| 1705 | Ga0207691_10799695 | |||
| 1706 | Ga0207711_10131544 | |||
| 1707 | Ga0207711_10718864 | |||
| 1708 | Ga0207711_10931330 | |||
| 1709 | Ga0207689_10054191 | |||
| 1710 | Ga0207689_10535687 | |||
| 1711 | Ga0207661_10000462 | |||
| 1712 | Ga0207661_10335806 | |||
| 1713 | Ga0207679_10153261 | |||
| 1714 | Ga0207679_10170338 | |||
| 1715 | Ga0207679_10661490 | |||
| 1716 | Ga0207679_10942325 | |||
| 1717 | Ga0207679_11177024 | |||
| 1718 | Ga0207667_10023472 | |||
| 1719 | Ga0207667_10038547 | |||
| 1720 | Ga0207667_10235722 | |||
| 1721 | Ga0207667_11126230 | |||
| 1722 | Ga0207651_10317449 | |||
| 1723 | Ga0207712_10161390 | |||
| 1724 | Ga0207712_10436746 | |||
| 1725 | Ga0207668_10334560 | |||
| 1726 | Ga0207668_10401230 | |||
| 1727 | Ga0207668_10950417 | |||
| 1728 | Ga0207640_10030135 | |||
| 1729 | Ga0207640_10032190 | |||
| 1730 | Ga0207640_10655852 | |||
| 1731 | Ga0207658_10971840 | |||
| 1732 | Ga0207677_10858545 | |||
| 1733 | Ga0207677_11051160 | |||
| 1734 | Ga0207703_10690523 | |||
| 1735 | Ga0207703_10916321 | |||
| 1736 | Ga0207703_11324014 | |||
| 1737 | Ga0207639_10019196 | |||
| 1738 | Ga0207639_10061167 | |||
| 1739 | Ga0207639_10074797 | |||
| 1740 | Ga0207639_10179934 | |||
| 1741 | Ga0207639_10239216 | |||
| 1742 | Ga0207639_10603696 | |||
| 1743 | Ga0207639_10629173 | |||
| 1744 | Ga0207639_10939872 | |||
| 1745 | Ga0207639_11269419 | |||
| 1746 | Ga0207678_10062471 | |||
| 1747 | Ga0207678_10116704 | |||
| 1748 | Ga0207678_10151381 | |||
| 1749 | Ga0207678_10199725 | |||
| 1750 | Ga0207678_10236470 | |||
| 1751 | Ga0207678_10274484 | |||
| 1752 | Ga0207678_10554337 | |||
| 1753 | Ga0207678_10894801 | |||
| 1754 | Ga0207708_10656041 | |||
| 1755 | Ga0207702_10000098 | |||
| 1756 | Ga0207702_10067998 | |||
| 1757 | Ga0207702_10078592 | |||
| 1758 | Ga0207702_10311802 | |||
| 1759 | Ga0207702_11069453 | |||
| 1760 | Ga0207641_10485376 | |||
| 1761 | Ga0207641_10693575 | |||
| 1762 | Ga0207676_10084335 | |||
| 1763 | Ga0207674_10006546 | |||
| 1764 | Ga0207674_10010216 | |||
| 1765 | Ga0207674_10382318 | |||
| 1766 | Ga0207674_10451188 | |||
| 1767 | Ga0207675_100349508 | |||
| 1768 | Ga0207675_101247532 | |||
| 1769 | Ga0207675_102397169 | |||
| 1770 | Ga0207683_10296226 | |||
| 1771 | Ga0207683_11156838 | |||
| 1772 | Ga0207698_10020893 | |||
| 1773 | Ga0207698_10127697 | |||
| 1774 | Ga0207698_10128172 | |||
| 1775 | Ga0207698_10993614 | |||
| 1776 | Ga0207698_11520989 | |||
| 1777 | Ga0207698_11606195 | |||
| 1778 | Ga0207698_12640910 | |||
| 1779 | Ga0209813_10064721 | |||
| 1780 | Ga0209813_10289579 | |||
| 1781 | Ga0268266_10005154 | |||
| 1782 | Ga0268266_10044078 | |||
| 1783 | Ga0268266_10167694 | |||
| 1784 | Ga0268266_10203230 | |||
| 1785 | Ga0268266_10571024 | |||
| 1786 | Ga0268266_10826124 | |||
| 1787 | Ga0268266_11022832 | |||
| 1788 | Ga0268266_11409228 | |||
| 1789 | Ga0268266_12023254 | |||
| 1790 | Ga0268265_10316227 | |||
| 1791 | Ga0268264_10000049 | |||
| 1792 | Ga0307517_10002508 | |||
| 1793 | Ga0307517_10462843 | |||
| 1794 | Ga0307515_10156128 | |||
| 1795 | Ga0307511_10069798 | |||
| 1796 | Ga0265763_1028713 | |||
| 1797 | Ga0265330_10006850 | |||
| 1798 | Ga0265330_10042819 | |||
| 1799 | Ga0265330_10083921 | |||
| 1800 | Ga0265332_10030851 | |||
| 1801 | Ga0265332_10199405 | |||
| 1802 | Ga0265328_10272053 | |||
| 1803 | Ga0265325_10016079 | |||
| 1804 | Ga0265340_10027608 | |||
| 1805 | Ga0265339_10450771 | |||
| 1806 | Ga0265331_10057754 | |||
| 1807 | Ga0307513_10376775 | |||
| 1808 | Ga0307509_10182179 | |||
| 1809 | Ga0307408_100057784 | |||
| 1810 | Ga0265313_10319021 | |||
| 1811 | Ga0307508_10024306 | |||
| 1812 | Ga0307508_10081289 | |||
| 1813 | Ga0307508_10438571 | |||
| 1814 | Ga0307508_10813008 | |||
| 1815 | Ga0265314_10104734 | |||
| 1816 | Ga0265314_10126984 | |||
| 1817 | Ga0265342_10054940 | |||
| 1818 | Ga0265342_10061237 | |||
| 1819 | Ga0307516_10003810 | |||
| 1820 | Ga0307516_10010832 | |||
| 1821 | Ga0307516_10154306 | |||
| 1822 | Ga0307516_10178608 | |||
| 1823 | Ga0307516_10254553 | |||
| 1824 | Ga0307516_10294857 | |||
| 1825 | Ga0307405_10344762 | |||
| 1826 | Ga0307413_10066462 | |||
| 1827 | Ga0307413_11046270 | |||
| 1828 | Ga0307410_10979388 | |||
| 1829 | Ga0307406_10292448 | |||
| 1830 | Ga0307412_10057874 | |||
| 1831 | Ga0307412_10808725 | |||
| 1832 | Ga0307409_100373739 | |||
| 1833 | Ga0307409_102323776 | |||
| 1834 | Ga0307416_102606953 | |||
| 1835 | Ga0307414_11942616 | |||
| 1836 | Ga0307411_10078628 | |||
| 1837 | Ga0307415_100239612 | |||
| 1838 | Ga0307507_10093687 | |||
| 1839 | Ga0307507_10633385 | |||
| 1840 | Ga0307510_10034452 | |||
| 1841 | Ga0307510_10318437 | |||
| 1842 | Ga0307510_10363639 | |||
| 1843 | Ga0316215_1002595 | |||
| 1844 | Ga0373930_0050144 | |||
| 1845 | Ga0373930_0067039 | |||
| 1846 | Ga0373938_0176331 | |||
| 1847 | Ga0373926_0006082 | |||
| 1848 | Ga0373926_0057714 | |||
| 1849 | Ga0373934_0141563 | |||
| 1850 | Ga0373940_0004014 | |||
| 1851 | Ga0373944_0065077 | |||
| 1852 | Ga0373949_0079259 | |||
| 1853 | Ga0373951_0233827 | |||
| 1854 | Ga0373923_0003386 | |||
| 1855 | Ga0373923_0192455 | |||
| 1856 | Ga0373936_0017983 | |||
| 1857 | Ga0373941_0106617 | |||
| 1858 | Ga0373941_0241482 | |||
| 1859 | Ga0373945_0202285 | |||
| 1860 | Ga0373953_0045342 | |||
| 1861 | Ga0373953_0054526 | |||
| 1862 | Ga0373954_0003000 | |||
| 1863 | Ga0373954_0013614 | |||
| 1864 | Ga0373954_0014129 | |||
| 1865 | Ga0373954_0201346 | |||
| 1866 | Ga0373957_0008180 | |||
| 1867 | Ga0373957_0027291 | |||
| 1868 | Ga0373960_0034486 | |||
| 1869 | Ga0373943_0273222 | |||
| 1870 | Ga0373946_0027752 | |||
| 1871 | Ga0373946_0290066 | |||
| 1872 | Ga0373946_0294653 | |||
| 1873 | Ga0373955_0037568 | |||
| 1874 | Ga0373955_0059806 | |||
| 1875 | Ga0373955_0118939 | |||
| 1876 | Ga0373955_0168392 | |||
| 1877 | Ga0373942_0068148 | |||
| 1878 | Ga0373942_0331847 | |||
| 1879 | Ga0373961_0156535 | |||
| 1880 | Ga0373924_0000990 | |||
| 1881 | Ga0373924_0128848 | |||
| 1882 | Ga0373931_0000737 | |||
| 1883 | Ga0373935_0006078 | |||
| 1884 | Ga0373935_0058500 | |||
| 1885 | Ga0373927_0000481 | |||
| 1886 | Ga0373927_0019543 | |||
| 1887 | Ga0373927_0026996 | |||
| 1888 | Ga0373927_0038189 | |||
| 1889 | Ga0373927_0051429 | |||
| 1890 | Ga0373927_0107782 | |||
| 1891 | Ga0373927_0120469 | |||
| 1892 | Ga0373933_0118829 | |||
| 1893 | Ga0373933_0273523 | |||
| 1894 | Ga0373933_0349459 | |||
| 1895 | Ga0373933_0499398 | |||
| 1896 | Ga0373947_0000441 | |||
| 1897 | Ga0373947_0031134 | |||
| 1898 | Ga0373937_0011434 | |||
| 1899 | Ga0373937_0023736 | |||
| 1900 | Ga0373937_1466963 | |||
| 1901 | Ga0310112_029544 | |||
| 1902 | Ga0372808_001174 | |||
| 1903 | Ga0373925_0005398 | |||
| 1904 | Ga0373925_0043326 | |||
| 1905 | Ga0373925_0054446 | |||
| 1906 | Ga0373925_0107728 | |||
| 1907 | Ga0373925_0384410 | |||
| 1908 | Ga0373925_1008502 | |||
| 1909 | Ga0395899_0228139 | |||
| 1910 | Ga0395899_0253147 | |||
| 1911 | Ga0395900_0000937 | |||
| 1912 | Ga0395900_0013063 | |||
| 1913 | Ga0395900_0322035 | |||
| 1914 | Ga0395898_0011586 | |||
| 1915 | Ga0395898_0047647 | |||
| 1916 | Ga0395898_0121837 | |||
| 1917 | Ga0395905_0540377 | |||
| 1918 | Ga0436364_0457605 | |||
| 1919 | Ga0436364_0510045 | |||
| 1920 | Ga0436364_1253402 | |||
| 1921 | Ga0395901_0056407 | |||
| 1922 | Ga0395901_0197670 | |||
| 1923 | Ga0395901_0320497 | |||
| 1924 | Ga0436365_0034134 | |||
| 1925 | Ga0436365_0594717 | |||
| 1926 | Ga0436365_1242582 | |||
| 1927 | Ga0436365_1797143 | |||
| 1928 | Ga0436360_0226977 | |||
| 1929 | Ga0436360_1341430 | |||
| 1930 | Ga0436361_0091611 | |||
| 1931 | Ga0436361_1072639 | |||
| 1932 | Ga0436363_0800260 | |||
| 1933 | Ga0436362_0810915 | |||
| 1934 | Ga0451789_0135100 | |||
| 1935 | Ga0451789_1307874 | |||
| 1936 | Ga0451791_0310571 | |||
| 1937 | Ga0451797_1122517 | |||
| 1938 | Ga0451795_1213101 | |||
| 1939 | Ga0451802_1299051 | |||
| 1940 | Ga0451807_0776538 | |||
| 1941 | Ga0451807_0962926 | |||
| 1942 | Ga0451849_0021296 | |||
| 1943 | Ga0451855_0859634 | |||
| 1944 | Ga0451853_2617866 | |||
| 1945 | Ga0439458_0033608 | |||
| 1946 | Ga0439444_0192739 | |||
| 1947 | Ga0439459_0135140 | |||
| 1948 | Ga0466969_0251599 | |||
| 1949 | Ga0466961_0123149 | |||
| 1950 | Ga0466963_0025316 | |||
| 1951 | Ga0466963_0297563 | |||
| 1952 | Ga0466963_0445244 | |||
| 1953 | Ga0466968_0155689 | |||
| 1954 | Ga0466970_0199943 | |||
| 1955 | Ga0466957_0111626 | |||
| 1956 | Ga0466967_0022610 | |||
| 1957 | Ga0466967_0655043 | |||
| 1958 | Ga0466967_1457187 | |||
| 1959 | Ga0466967_1791167 | |||
| 1960 | Ga0495617_072307 | |||
| 1961 | Ga0495592_0016144 | |||
| 1962 | Ga0495592_0082735 | |||
| 1963 | Ga0495592_0093853 | |||
| 1964 | Ga0495592_0153992 | |||
| 1965 | Ga0495603_0000066 | |||
| 1966 | Ga0495603_0017631 | |||
| 1967 | Ga0495603_0059019 | |||
| 1968 | Ga0495603_0432281 | |||
| 1969 | Ga0495603_0651822 | |||
| 1970 | Ga0495603_0696473 | |||
| 1971 | Ga0495590_0161562 | |||
| 1972 | Ga0495629_0000131 | |||
| 1973 | Ga0495629_0000937 | |||
| 1974 | Ga0495629_0034072 | |||
| 1975 | Ga0495629_0230703 | |||
| 1976 | Ga0495629_0320986 | |||
| 1977 | Ga0495629_0502262 | |||
| 1978 | Ga0495638_0018982 | |||
| 1979 | Ga0495638_0546552 | |||
| 1980 | Ga0495641_0003604 | |||
| 1981 | Ga0495651_0000667 | |||
| 1982 | Ga0495651_0005386 | |||
| 1983 | Ga0495651_0511816 | |||
| 1984 | Ga0495653_0083608 | |||
| 1985 | Ga0495653_0749875 | |||
| 1986 | Ga0495580_0001382 | |||
| 1987 | Ga0495580_0060350 | |||
| 1988 | Ga0495580_0138889 | |||
| 1989 | Ga0495582_0000298 | |||
| 1990 | Ga0495582_0078675 | |||
| 1991 | Ga0495605_0161371 | |||
| 1992 | Ga0495639_0000282 | |||
| 1993 | Ga0495639_0003381 | |||
| 1994 | Ga0495662_0000058 | |||
| 1995 | Ga0495662_0058347 | |||
| 1996 | Ga0495662_0094186 | |||
| 1997 | Ga0495662_0424564 | |||
| 1998 | Ga0495662_0430480 | |||
| 1999 | Ga0495664_0001603 | |||
| 2000 | Ga0495664_0002049 | |||
| 2001 | Ga0495664_0050287 | |||
| 2002 | Ga0495664_0308118 | |||
| 2003 | Ga0495584_0237380 | |||
| 2004 | Ga0495585_0186539 | |||
| 2005 | Ga0495594_0005015 | |||
| 2006 | Ga0495594_0058940 | |||
| 2007 | Ga0495594_0073373 | |||
| 2008 | Ga0495596_0185536 | |||
| 2009 | Ga0495607_0163339 | |||
| 2010 | Ga0495607_0266296 | |||
| 2011 | Ga0495583_0114782 | |||
| 2012 | Ga0495606_0225218 | |||
| 2013 | Ga0495606_0242701 | |||
| 2014 | Ga0495606_0382637 | |||
| 2015 | Ga0495608_0002282 | |||
| 2016 | Ga0495608_0031166 | |||
| 2017 | Ga0495608_0111599 | |||
| 2018 | Ga0495608_0799149 | |||
| 2019 | Ga0495610_0184572 | |||
| 2020 | Ga0495616_0045329 | |||
| 2021 | Ga0495616_0239836 | |||
| 2022 | Ga0495618_0028852 | |||
| 2023 | Ga0495618_0166773 | |||
| 2024 | Ga0495620_0172486 | |||
| 2025 | Ga0495628_0017091 | |||
| 2026 | Ga0495628_0066411 | |||
| 2027 | Ga0495628_0069102 | |||
| 2028 | Ga0495628_0839546 | |||
| 2029 | Ga0495630_0008565 | |||
| 2030 | Ga0495630_0097270 | |||
| 2031 | Ga0495630_0103613 | |||
| 2032 | Ga0495631_0125796 | |||
| 2033 | Ga0495637_0148775 | |||
| 2034 | Ga0495643_0219741 | |||
| 2035 | Ga0495648_0000943 | |||
| 2036 | Ga0495648_0085628 | |||
| 2037 | Ga0495663_0026232 | |||
| 2038 | Ga0495666_0118980 | |||
| 2039 | Ga0495666_0122456 | |||
| 2040 | Ga0495652_0011826 | |||
| 2041 | Ga0495652_0061724 | |||
| 2042 | Ga0495652_0080485 | |||
| 2043 | Ga0495652_0091420 | |||
| 2044 | Ga0495652_0560890 | |||
| 2045 | Ga0495654_0209272 | |||
| 2046 | Ga0495665_0008719 | |||
| 2047 | Ga0495665_0017901 | |||
| 2048 | Ga0495640_0000617 | |||
| 2049 | Ga0495640_0020220 | |||
| 2050 | Ga0495640_0025442 | |||
| 2051 | Ga0495586_0145396 | |||
| 2052 | Ga0495586_0778416 | |||
| 2053 | Ga0495587_0166367 | |||
| 2054 | Ga0495587_0181478 | |||
| 2055 | Ga0495587_0248772 | |||
| 2056 | Ga0495587_0508810 | |||
| 2057 | Ga0495609_0328833 | |||
| 2058 | Ga0495621_0438974 | |||
| 2059 | Ga0495645_0026862 | |||
| 2060 | Ga0495645_0116716 | |||
| 2061 | Ga0495622_0009108 | |||
| 2062 | Ga0495622_0037656 | |||
| 2063 | Ga0495622_0055403 | |||
| 2064 | Ga0495633_0082120 | |||
| 2065 | Ga0495667_0001870 | |||
| 2066 | Ga0495667_0034818 | |||
| 2067 | Ga0495668_0104639 | |||
| 2068 | Ga0495668_0448078 | |||
| 2069 | Ga0495668_0646859 | |||
| 2070 | Ga0495634_0000502 | |||
| 2071 | Ga0495634_0018374 | |||
| 2072 | Ga0495634_0030388 | |||
| 2073 | Ga0495634_0045287 | |||
| 2074 | Ga0495611_0201695 | |||
| 2075 | Ga0495611_0275208 | |||
| 2076 | Ga0495611_0519960 | |||
| 2077 | Ga0495625_0100049 | |||
| 2078 | Ga0495625_0110135 | |||
| 2079 | Ga0495625_0460267 | |||
| 2080 | Ga0495635_0000178 | |||
| 2081 | Ga0495635_0000278 | |||
| 2082 | Ga0495635_0073539 | |||
| 2083 | Ga0495635_0263784 | |||
| 2084 | Ga0495635_0454895 | |||
| 2085 | Ga0495661_0513458 | |||
| 2086 | Ga0495661_0634129 | |||
| 2087 | Ga0495588_0001173 | |||
| 2088 | Ga0495588_0005976 | |||
| 2089 | Ga0495588_0028399 | |||
| 2090 | Ga0495657_0002467 | |||
| 2091 | Ga0495657_0011096 | |||
| 2092 | Ga0495657_0150232 | |||
| 2093 | Ga0495599_0001883 | |||
| 2094 | Ga0495599_0173105 | |||
| 2095 | Ga0495623_0002455 | |||
| 2096 | Ga0495623_0030832 | |||
| 2097 | Ga0495646_0023137 | |||
| 2098 | Ga0495646_0046271 | |||
| 2099 | Ga0495646_0067895 | |||
| 2100 | Ga0495647_0000555 | |||
| 2101 | Ga0495647_0017376 | |||
| 2102 | Ga0495658_0006651 | |||
| 2103 | Ga0495658_0007642 | |||
| 2104 | Ga0495658_0456172 | |||
| 2105 | Ga0495669_0124011 | |||
| 2106 | Ga0495669_0383256 | |||
| 2107 | Ga0495613_0027216 | |||
| 2108 | Ga0495613_0047301 | |||
| 2109 | Ga0495613_0072358 | |||
| 2110 | Ga0495613_0101301 | |||
| 2111 | Ga0495624_0003669 | |||
| 2112 | Ga0495624_0070763 | |||
| 2113 | Ga0495670_0446576 | |||
| 2114 | Ga0495671_0412285 | |||
| 2115 | Ga0495649_0519942 | |||
| 2116 | Ga0495589_0557236 | |||
| 2117 | Ga0495600_0003603 | |||
| 2118 | Ga0495600_0004239 | |||
| 2119 | Ga0495600_0113928 | |||
| 2120 | Ga0495600_0212154 | |||
| 2121 | Ga0495581_0000111 | |||
| 2122 | Ga0495581_0021494 | |||
| 2123 | Ga0495581_0215155 | |||
| 2124 | Ga0495604_0002068 | |||
| 2125 | Ga0495604_0005311 | |||
| 2126 | Ga0495604_0098811 | |||
| 2127 | Ga0495604_0153460 | |||
| 2128 | Ga0495604_0238274 | |||
| 2129 | Ga0495604_0279226 | |||
| 2130 | Ga0495674_0002855 | |||
| 2131 | Ga0495674_0010735 | |||
| 2132 | Ga0495674_0070478 | |||
| 2133 | Ga0495674_0103046 | |||
| 2134 | Ga0495674_0967522 | |||
| 2135 | Ga0495672_0008900 | |||
| 2136 | Ga0495672_0264656 | |||
| 2137 | Ga0495672_0289121 | |||
| 2138 | Ga0495672_0329173 | |||
| 2139 | Ga0495676_0076061 | |||
| 2140 | Ga0495676_0292374 | |||
| 2141 | Ga0495680_0007580 | |||
| 2142 | Ga0495683_0082250 | |||
| 2143 | Ga0495675_0001321 | |||
| 2144 | Ga0495675_0005803 | |||
| 2145 | Ga0495675_0118673 | |||
| 2146 | Ga0495677_0363546 | |||
| 2147 | Ga0495685_146176 | |||
| 2148 | Ga0495673_0027696 | |||
| 2149 | Ga0495673_0090503 | |||
| 2150 | Ga0495673_0112321 | |||
| 2151 | Ga0495673_0323057 | |||
| 2152 | Ga0495681_0153397 | |||
| 2153 | Ga0495681_0208200 | |||
| 2154 | Ga0495684_0000161 | |||
| 2155 | Ga0495684_0012187 | |||
| 2156 | Ga0495684_0100118 | |||
| 2157 | Ga0495686_0023065 | |||
| 2158 | Ga0495686_0082124 | |||
| 2159 | Ga0495686_0461142 | |||
| 2160 | Ga0495593_0000210 | |||
| 2161 | Ga0495593_0031631 | |||
| 2162 | Ga0495593_0035968 | |||
| 2163 | Ga0495593_0191695 | |||
| 2164 | Ga0495602_0016051 | |||
| 2165 | Ga0495602_0102410 | |||
| 2166 | Ga0495614_0008531 | |||
| 2167 | Ga0495614_0095767 | |||
| 2168 | Ga0495614_0513404 | |||
| 2169 | Ga0495626_0222555 | |||
| 2170 | Ga0496100_0034851 | |||
| 2171 | Ga0496100_0100995 | |||
| 2172 | Ga0496100_0498269 | |||
| 2173 | Ga0496100_1367123 | |||
| 2174 | Ga0496101_0002918 | |||
| 2175 | Ga0496101_0106500 | |||
| 2176 | Ga0496101_1232576 | |||
| 2177 | Ga0496101_1390824 | |||
| 2178 | Ga0496102_0018118 | |||
| 2179 | Ga0496102_0019762 | |||
| 2180 | Ga0496102_0023714 | |||
| 2181 | Ga0496102_0502472 | |||
| 2182 | Ga0496102_0536240 | |||
| 2183 | Ga0496102_1129153 | |||
| 2184 | Ga0496103_0025993 | |||
| 2185 | Ga0496103_0545605 | |||
| 2186 | Ga0496104_0005931 | |||
| 2187 | Ga0496104_0166136 | |||
| 2188 | Ga0496104_0360321 | |||
| 2189 | Ga0496104_0570136 | |||
| 2190 | Ga0496104_0864725 | |||
| 2191 | Ga0496105_0004596 | |||
| 2192 | Ga0496105_0013161 | |||
| 2193 | Ga0496106_0066930 | |||
| 2194 | Ga0496106_0081280 | |||
| 2195 | Ga0496106_0215946 | |||
| 2196 | Ga0496106_0247267 | |||
| 2197 | Ga0496107_0021320 | |||
| 2198 | Ga0496107_0041856 | |||
| 2199 | Ga0496107_0089617 | |||
| 2200 | Ga0496107_0511623 | |||
| 2201 | Ga0496108_0095878 | |||
| 2202 | Ga0496108_0129556 | |||
| 2203 | Ga0496108_0146743 | |||
| 2204 | Ga0496108_0342254 | |||
| 2205 | Ga0496108_0388646 | |||
| 2206 | Ga0496108_0848401 | |||
| 2207 | Ga0496109_0154877 | |||
| 2208 | Ga0496109_0338722 | |||
| 2209 | Ga0496109_0387458 | |||
| 2210 | Ga0496109_1329796 | |||
| 2211 | Ga0496109_1475083 | |||
| 2212 | Ga0496110_0029782 | |||
| 2213 | Ga0496110_0031507 | |||
| 2214 | Ga0496110_0365687 | |||
| 2215 | Ga0496110_0502080 | |||
| 2216 | Ga0496111_0021573 | |||
| 2217 | Ga0496111_0023000 | |||
| 2218 | Ga0496111_0173789 | |||
| 2219 | Ga0496111_0638328 | |||
| 2220 | Ga0496111_0697659 | |||
| 2221 | Ga0496112_0007361 | |||
| 2222 | Ga0496112_0054601 | |||
| 2223 | Ga0496112_0098430 | |||
| 2224 | Ga0496112_0274029 | |||
| 2225 | Ga0496112_0693491 | |||
| 2226 | Ga0496112_1602149 | |||
| 2227 | Ga0496113_0003380 | |||
| 2228 | Ga0496113_0029699 | |||
| 2229 | Ga0496113_0122933 | |||
| 2230 | Ga0496113_0429388 | |||
| 2231 | Ga0496114_0148974 | |||
| 2232 | Ga0496114_0199875 | |||
| 2233 | Ga0496114_0386682 | |||
| 2234 | Ga0496114_0660316 | |||
| 2235 | Ga0496114_1544804 | |||
| 2236 | Ga0496115_0034573 | |||
| 2237 | Ga0496115_0040822 | |||
| 2238 | Ga0496115_0292683 | |||
| 2239 | Ga0496115_1129355 | |||
| 2240 | Ga0496116_0053113 | |||
| 2241 | Ga0496116_0063780 | |||
| 2242 | Ga0496116_0179849 | |||
| 2243 | Ga0496117_0044061 | |||
| 2244 | Ga0496117_0074361 | |||
| 2245 | Ga0496117_0314083 | |||
| 2246 | Ga0496118_0021634 | |||
| 2247 | Ga0496118_0022102 | |||
| 2248 | Ga0496118_0071024 | |||
| 2249 | Ga0496118_0099007 | |||
| 2250 | Ga0496119_0030902 | |||
| 2251 | Ga0496119_0055976 | |||
| 2252 | Ga0496119_0137517 | |||
| 2253 | Ga0496120_0207037 | |||
| 2254 | Ga0496121_0000416 | |||
| 2255 | Ga0496121_0011106 | |||
| 2256 | Ga0496121_0014503 | |||
| 2257 | Ga0496121_0015708 | |||
| 2258 | Ga0496121_0072330 | |||
| 2259 | Ga0496121_0088558 | |||
| 2260 | Ga0496121_0120898 | |||
| 2261 | Ga0496121_0213927 | |||
| 2262 | Ga0496121_0228970 | |||
| 2263 | Ga0496121_0356325 | |||
| 2264 | Ga0496122_0046480 | |||
| 2265 | Ga0496122_0226553 | |||
| 2266 | Ga0496124_0089914 | |||
| 2267 | Ga0496124_0154454 | |||
| 2268 | Ga0496124_0376913 | |||
| 2269 | Ga0496125_0035946 | |||
| 2270 | Ga0496125_0077485 | |||
| 2271 | Ga0496125_0396584 | |||
| 2272 | Ga0496126_0030246 | |||
| 2273 | Ga0496126_0052388 | |||
| 2274 | Ga0496126_0090310 | |||
| 2275 | Ga0496126_0090739 | |||
| 2276 | Ga0496126_0104650 | |||
| 2277 | Ga0496126_0212892 | |||
| 2278 | Ga0496126_0327199 | |||
| 2279 | Ga0495678_146514 | |||
| 2280 | Ga0495682_0164539 | |||
| 2281 | Ga0501031_0000301 | |||
| 2282 | Ga0501032_0000172 | |||
| 2283 | Ga0501032_0862947 | |||
| 2284 | Ga0501033_0001887 | |||
| 2285 | Ga0501034_0000676 | |||
| 2286 | Ga0501034_0061070 | |||
| 2287 | Ga0501036_0000390 | |||
| 2288 | Ga0501036_0353515 | |||
| 2289 | Ga0501037_0004356 | |||
| 2290 | Ga0501038_0000089 | |||
| 2291 | Ga0501038_0145219 | |||
| 2292 | Ga0501038_0764310 | |||
| 2293 | Ga0501039_0000114 | |||
| 2294 | Ga0501040_0888471 | |||
| 2295 | Ga0501042_0026453 | |||
| 2296 | Ga0501042_0488167 | |||
| 2297 | Ga0501043_0001086 | |||
| 2298 | Ga0501043_0217925 | |||
| 2299 | Ga0501046_0003225 | |||
| 2300 | Ga0501046_0186634 | |||
| 2301 | Ga0501047_0000230 | |||
| 2302 | Ga0501047_0036575 | |||
| 2303 | Ga0501048_0000095 | |||
| 2304 | Ga0501048_1156295 | |||
| 2305 | Ga0501067_0003250 | |||
| 2306 | Ga0501067_0059385 | |||
| 2307 | Ga0501067_0188792 | |||
| 2308 | Ga0501067_0613980 | |||
| 2309 | Ga0501068_0020314 | |||
| 2310 | Ga0501069_0019111 | |||
| 2311 | Ga0501069_0121511 | |||
| 2312 | Ga0501069_0232355 | |||
| 2313 | Ga0501070_0007130 | |||
| 2314 | Ga0501070_0017328 | |||
| 2315 | Ga0501070_0201837 | |||
| 2316 | Ga0501070_0835721 | |||
| 2317 | Ga0501071_0232092 | |||
| 2318 | Ga0501071_0743655 | |||
| 2319 | Ga0501072_0001459 | |||
| 2320 | Ga0501072_0274668 | |||
| 2321 | Ga0501073_0000055 | |||
| 2322 | Ga0501074_0000492 | |||
| 2323 | Ga0501074_0341813 | |||
| 2324 | Ga0501076_0072621 | |||
| 2325 | Ga0501076_0643558 | |||
| 2326 | Ga0501076_1624104 | |||
| 2327 | Ga0501077_0501692 | |||
| 2328 | Ga0501079_0001966 | |||
| 2329 | Ga0501079_0210727 | |||
| 2330 | Ga0501080_0001671 | |||
| 2331 | Ga0501081_0343029 | |||
| 2332 | Ga0501083_0000570 | |||
| 2333 | Ga0501083_0610189 | |||
| 2334 | Ga0501035_0000355 | |||
| 2335 | Ga0501035_1168775 | |||
| 2336 | Ga0501035_1434305 | |||
| 2337 | Ga0501044_0000546 | |||
| 2338 | Ga0501044_0094300 | |||
| 2339 | Ga0501045_0012777 | |||
| 2340 | Ga0501045_0388572 | |||
| 2341 | nmdc:mga03n38_146_c2 | |||
| 2342 | nmdc:mga03n38_604358_c1 | |||
| 2343 | nmdc:mga00v17_696061_c1 | |||
| 2344 | nmdc:mga0yw44_14698_c1 | |||
| 2345 | nmdc:mga0yw44_190697_c1 | |||
| 2346 | nmdc:mga0yw44_91986_c1 | |||
| 2347 | nmdc:mga06z11_131674_c1 | |||
| 2348 | nmdc:mga06z11_58590_c1 | |||
| 2349 | nmdc:mga04h51_11225_c1 | |||
| 2350 | nmdc:mga04h51_516562_c1 | |||
| 2351 | nmdc:mga07m45_328577_c2 | |||
| 2352 | nmdc:mga07m45_365629_c1 | |||
| 2353 | nmdc:mga0n895_245003_c1 | |||
| 2354 | nmdc:mga0n895_896011_c1 | |||
| 2355 | nmdc:mga0rr50_119377_c1 | |||
| 2356 | nmdc:mga08x19_280221_c1 | |||
| 2357 | nmdc:mga0a205_1182474_c1 | |||
| 2358 | Ga0495601_0073688 | |||
| 2359 | Ga0495601_0122184 | |||
| 2360 | Ga0495601_0148842 | |||
| 2361 | Ga0495601_0201206 | |||
| 2362 | Ga0495601_0493014 | |||
| 2363 | Ga0495612_0006238 | |||
| 2364 | Ga0495612_0051061 | |||
| 2365 | Ga0495612_0234020 | |||
| 2366 | Ga0495612_0265549 | |||
| 2367 | Ga0495612_0274612 | |||
| 2368 | Ga0500610_0074278 | |||
| 2369 | Ga0500610_0102904 | |||
| 2370 | Ga0500635_0048895 | |||
| 2371 | Ga0495595_0040765 | |||
| 2372 | Ga0495595_0181672 | |||
| 2373 | Ga0495619_0012613 | |||
| 2374 | Ga0495619_0044373 | |||
| 2375 | Ga0495619_0283041 | |||
| 2376 | Ga0495619_0808084 | |||
| 2377 | Ga0500643_000278 | |||
| 2378 | Ga0500646_0390932 | |||
| 2379 | Ga0500647_0077634 | |||
| 2380 | Ga0500583_0048514 | |||
| 2381 | Ga0500641_0005143 | |||
| 2382 | Ga0500641_0017084 | |||
| 2383 | Ga0500641_0030621 | |||
| 2384 | Ga0500648_200584 | |||
| 2385 | Ga0500555_001487 | |||
| 2386 | Ga0500556_0104326 | |||
| 2387 | Ga0500556_0214401 | |||
| 2388 | Ga0500557_000028 | |||
| 2389 | Ga0500558_207792 | |||
| 2390 | Ga0500562_006678 | |||
| 2391 | Ga0500592_052706 | |||
| 2392 | Ga0500595_000653 | |||
| 2393 | Ga0500595_008924 | |||
| 2394 | Ga0500595_046793 | |||
| 2395 | Ga0500595_170266 | |||
| 2396 | Ga0500597_192449 | |||
| 2397 | Ga0500614_151196 | |||
| 2398 | Ga0500642_0000590 | |||
| 2399 | Ga0500642_0189905 | |||
| 2400 | Ga0500652_158762 | |||
| 2401 | Ga0500568_0040122 | |||
| 2402 | Ga0500568_0141723 | |||
| 2403 | Ga0500573_0176496 | |||
| 2404 | Ga0500577_0065705 | |||
| 2405 | Ga0500604_0091899 | |||
| 2406 | Ga0500604_0132514 | |||
| 2407 | Ga0500604_0193759 | |||
| 2408 | Ga0500616_0097299 | |||
| 2409 | Ga0500619_229152 | |||
| 2410 | Ga0500622_0038166 | |||
| 2411 | Ga0500633_0101430 | |||
| 2412 | Ga0500638_125829 | |||
| 2413 | Ga0500638_182850 | |||
| 2414 | Ga0500636_0416206 | |||
| 2415 | Ga0500636_0461383 | |||
| 2416 | Ga0500636_0473449 | |||
| 2417 | Ga0500637_0211898 | |||
| 2418 | Ga0500645_050563 | |||
| 2419 | Ga0500596_008868 | |||
| 2420 | Ga0500599_022802 | |||
| 2421 | Ga0501084_0001687 | |||
| 2422 | Ga0501082_0009399 | |||
| 2423 | Ga0466962_0217020 | |||
| 2424 | 2513677979 | |||
| 2425 | 2513715566 | |||
| 2426 | 2514016366 | |||
| 2427 | 2517106999 | |||
| 2428 | 2524435608 | |||
| 2429 | 2524468343 | |||
| 2430 | 2528858118 | |||
| 2431 | 2617352931 | |||
| 2432 | 2745079864 | |||
| 2433 | 2824608406 | |||
| 2434 | 2824617434 | |||
| 2435 | 2824659991 | |||
| 2436 | 2824669191 | |||
| 2437 | 2824674753 | |||
| 2438 | 2824694625 | |||
| 2439 | 2824779850 | |||
| 2440 | 2838130226 | |||
| 2441 | 2841944331 | |||
| 2442 | 2841954492 | |||
| 2443 | 2841969108 | |||
| 2444 | 2841979882 | |||
| 2445 | 2841990937 | |||
| 2446 | 2842044013 | |||
| 2447 | 2842051998 | |||
| 2448 | 2849082549 | |||
| 2449 | 2876764518 | |||
| 2450 | 2879099951 | |||
| 2451 | 2885368123 | |||
| 2452 | 2885384657 | |||
| 2453 | 2888391160 | |||
| 2454 | 2888420909 | |||
| 2455 | 2903773441 | |||
| 2456 | 2906651304 | |||
| 2457 | 2922378500 | |||
| 2458 | 2929622413 | |||
| 2459 | 2929631370 | |||
| 2460 | 2932786212 | |||
| 2461 | 2932816855 | |||
| 2462 | 2932825995 | |||
| 2463 | 2932829450 | |||
| 2464 | 2933584507 | |||
| 2465 | 2935617882 | |||
| 2466 | 2935641634 | |||
| 2467 | 2935669308 | |||
| 2468 | 2935678096 | |||
| 2469 | 2935693585 | |||
| 2470 | 2935702905 | |||
| 2471 | 2935707131 | |||
| 2472 | 2935716949 | |||
| 2473 | 2935730217 | |||
| 2474 | 2935738388 | |||
| 2475 | 2935750176 | |||
| 2476 | 2935759770 | |||
| 2477 | 2935764579 | |||
| 2478 | 2935804488 | |||
| 2479 | 2935819111 | |||
| 2480 | 2935831365 | |||
| 2481 | 2935841974 | |||
| 2482 | 2935856619 | |||
| 2483 | 2935870234 | |||
| 2484 | 2935874441 | |||
| 2485 | 2935964279 | |||
| 2486 | 2935993902 | |||
| 2487 | 2936005087 | |||
| 2488 | 2936045738 | |||
| 2489 | 2940565776 | |||
| 2490 | 2941547025 | |||
| 2491 | 3005509666 | |||
| 2492 | 8016518786 | |||
| 2493 | 8016585652 | |||
| 2494 | 8017057893 | |||
| 2495 | 8019577831 | |||
| 2496 | 8019595933 | |||
| 2497 | 8019605822 | |||
| 2498 | 8019612712 | |||
| 2499 | 8055750864 | |||
| 2500 | 8056688974 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy