F492123

General Info

Members Datasets Scaffolds Average Seq Length
1245 664 1041 219

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10236260|Ga0105245_102362602
Length 264
Sequence MPAHVSLLAGHHDCHAWLVAATIDWRQAMALKAAASSRPGRTRDMAALKLAIGNKNYSSWSMRPWLALRANDIPFVETVIPLYTDNPADKEQILSFSRAGKVPVLVDGDITVWDSLAIIEYIAERYPEKKLWPDDVAARAFARSVCAEMHSGFMALRGECGMNLHRPVRPVTLSADAKANVARVQEIWHICRTRYGAGGPFLFGRFGAADAMYAPVVHRFRTYAIEVAPETKAYMDTVMAMPAFQEWTRDGLAETLVIEKFETV

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
10 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
11 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
12 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
13 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
14 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
15 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
16 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
17 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
18 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
19 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
20 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
21 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
22 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
23 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
24 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
25 2773857925 Microvirga vignae BR3299 Isolate Unclassified
26 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
27 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
28 2791355199
29 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
30 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
31 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
32 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
33 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
34 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
35 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
36 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
37 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
38 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
39 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
40 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
41 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
42 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
43 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
44 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
45 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
46 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
47 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
48 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
49 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
50 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
51 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
52 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
53 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
54 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
55 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
56 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
57 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
58 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
59 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
60 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
61 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
62 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
63 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
64 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
65 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
66 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
67 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
68 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
69 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
70 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
71 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
72 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
73 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
74 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
75 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
76 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
77 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
78 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
79 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
80 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
81 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
82 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
83 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
84 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
85 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
86 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
87 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
88 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
89 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
90 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
91 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
92 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
93 2904699407
94 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
95 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
96 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
97 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
98 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
99 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
100 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
101 2922368715
102 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
103 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
104 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
105 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
106 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
107 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
108 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
109 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
110 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
111 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
112 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
113 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
114 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
115 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
116 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
117 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
118 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
119 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
120 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
121 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
122 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
123 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
124 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
125 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
126 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
127 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
128 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
129 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
130 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
131 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
132 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
133 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
134 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
135 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
136 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
137 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
138 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
139 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
140 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
141 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
142 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
143 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
144 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
145 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
146 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
147 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
148 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
149 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
150 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
151 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
152 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
153 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
154 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
155 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
156 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
157 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
158 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
159 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
160 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
161 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
162 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
163 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
164 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
165 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
166 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
167 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
168 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
169 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
170 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
171 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
172 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
173 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
174 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
175 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
176 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
177 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
178 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
179 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
180 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
181 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
182 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
183 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
184 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
185 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
186 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
187 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
188 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
189 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
190 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
191 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
192 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
193 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
194 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
195 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
196 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
197 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
198 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
199 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
200 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
201 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
202 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
203 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
204 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
205 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
206 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
207 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
208 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
209 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
210 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
211 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
212 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
213 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
214 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
215 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
216 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
217 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
218 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
219 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
220 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
221 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
222 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
223 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
224 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
225 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
226 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
227 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
228 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
229 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
230 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
231 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
232 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
233 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
234 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
235 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
236 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
237 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
238 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
239 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
240 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
241 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
242 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
243 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
244 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
245 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
246 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
247 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
248 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
249 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
250 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
251 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
252 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
253 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
254 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
255 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
256 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
257 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
258 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
259 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
260 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
261 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
262 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
263 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
264 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
265 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
266 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
267 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
268 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
269 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
270 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
271 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
272 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
273 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
274 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
275 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
276 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
277 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
278 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
279 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
280 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
281 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
282 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
283 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
284 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
285 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
286 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
287 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
288 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
289 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
290 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
291 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
292 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
293 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
294 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
295 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
296 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
297 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
298 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
299 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
300 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
301 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
302 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
303 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
304 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
305 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
306 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
353 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
354 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
357 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
358 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
359 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
360 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
361 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
362 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
364 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
365 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
366 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
367 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
368 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
369 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
370 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
371 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
373 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
374 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
375 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
376 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
377 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
378 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
379 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
380 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
381 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
382 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
383 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
384 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
385 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
386 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
387 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
388 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
389 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
390 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
391 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
392 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
393 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
394 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
395 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
396 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
397 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
398 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
399 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
400 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
401 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
402 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
403 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
404 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
405 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
406 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
407 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
408 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
409 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
410 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
411 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
412 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
413 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
414 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
415 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
416 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
417 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
418 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
419 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
420 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
421 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
422 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
423 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
424 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
425 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
426 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
427 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
428 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
429 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
430 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
431 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
432 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
433 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
434 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
435 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
436 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
437 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
438 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
439 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
440 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
441 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
442 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
443 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
444 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
445 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
446 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
447 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
448 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
449 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
450 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
451 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
452 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
453 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
454 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
455 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
456 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
457 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
458 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
459 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
460 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
461 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
462 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
463 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
464 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
465 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
466 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
467 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
468 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
469 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
470 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
471 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
472 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
473 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
474 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
475 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
476 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
477 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
478 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
479 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
480 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
481 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
482 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
483 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
484 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
485 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
486 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
487 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
488 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
489 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
490 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
491 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
492 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
493 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
494 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
495 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
496 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
497 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
498 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
499 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
500 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
501 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
502 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
503 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
504 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
505 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
506 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
507 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
508 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
509 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
510 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
511 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
512 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
513 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
514 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
515 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
516 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
517 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
518 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
519 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
520 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
521 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
522 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
523 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
524 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
525 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
526 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
527 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
528 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
529 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
530 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
531 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
532 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
533 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
534 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
535 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
536 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
537 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
538 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
539 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
540 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
541 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
542 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
543 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
544 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
545 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
546 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
547 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
548 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
549 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
550 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
551 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
552 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
553 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
554 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
555 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
556 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
557 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
558 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
559 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
560 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
561 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
562 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
563 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
564 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
565 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
566 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
567 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
568 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
569 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
570 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
571 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
572 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
573 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
574 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
575 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
576 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
577 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
578 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
579 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
580 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
581 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
582 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
583 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
584 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
585 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
586 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
587 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
588 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
589 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
590 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
591 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
592 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
593 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
594 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
595 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
596 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
597 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
598 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
599 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
600 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
601 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
602 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
603 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
604 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
605 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
606 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
607 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
608 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
609 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
610 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
611 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
612 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
613 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
614 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
615 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
616 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
617 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
618 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
619 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
620 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
621 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
622 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
623 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
624 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
625 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
626 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
627 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
628 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
629 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
630 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
631 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
632 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
633 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
634 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
635 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
636 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
637 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
638 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
639 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
640 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
641 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
642 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
643 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
644 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
645 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
646 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
647 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
648 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
649 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
650 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
651 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
652 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
653 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
654 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
655 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
656 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
657 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
658 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
659 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
660 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
661 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
662 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
663 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
664 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.9
Metatranscriptomes 0
Isolates 16.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.68
Nodule 12.77
Rhizoplane 5.38
Rhizosphere 52.37
Stem 0
Stem Tuber 0
Unclassified 9.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24750J21931_1016458 3300002070 Bacteria 1004
2 JGI25406J46586_10014356 3300003203 Bacteria 3371
3 JGI25153J46596_10001560 3300003215 Bacteria 13600
4 JGI25153J46596_10026655 3300003215 Bacteria 2041
5 rootH1_10253088 3300003323 Bacteria 3754
6 JGI25160J50197_1000471 3300003354 Bacteria 24649
7 JGI25160J50197_1003264 3300003354 Bacteria 7304
8 JGI25160J50197_1054240 3300003354 Bacteria 833
9 JGI25404J52841_10006645 3300003659 Bacteria 2427
10 Ga0055525_1007176 3300003759 Bacteria 942
11 Ga0055526_1029520 3300003771 Bacteria 1625
12 Ga0055531_10023384 3300003794 Bacteria 2318
13 Ga0055543_1004797 3300004625 Bacteria 3595
14 Ga0065165_1000676 3300005262 Bacteria 49091
15 Ga0065165_1001028 3300005262 Bacteria 33815
16 Ga0065165_1004302 3300005262 Bacteria 8962
17 Ga0065165_1014933 3300005262 Bacteria 2989
18 Ga0070676_10389457 3300005328 Bacteria 967
19 Ga0070683_100079587 3300005329 Bacteria 3067
20 Ga0070690_100004427 3300005330 Bacteria 7798
21 Ga0070690_100450707 3300005330 Bacteria 954
22 Ga0070670_100046591 3300005331 Bacteria 3729
23 Ga0070670_100086065 3300005331 Bacteria 2701
24 Ga0068869_100341008 3300005334 Bacteria 1219
25 Ga0070680_100096083 3300005336 Bacteria 2457
26 Ga0070682_100056399 3300005337 Bacteria 2470
27 Ga0070682_100158735 3300005337 Bacteria 1560
28 Ga0068868_100064444 3300005338 Bacteria 2909
29 Ga0068868_100263019 3300005338 Bacteria 1455
30 Ga0068868_100612619 3300005338 Bacteria 966
31 Ga0068868_101133988 3300005338 Bacteria 721
32 Ga0070660_100593344 3300005339 Bacteria 926
33 Ga0070689_100203772 3300005340 Bacteria 1616
34 Ga0070687_100016286 3300005343 Bacteria 3386
35 Ga0070661_100054794 3300005344 Bacteria 2921
36 Ga0070661_100323028 3300005344 Bacteria 1206
37 Ga0070661_100323533 3300005344 Bacteria 1205
38 Ga0070668_100026677 3300005347 Bacteria 4384
39 Ga0070668_100055646 3300005347 Bacteria 3054
40 Ga0070668_100317109 3300005347 Bacteria 1311
41 Ga0070668_100366112 3300005347 Bacteria 1223
42 Ga0070668_100387535 3300005347 Bacteria 1190
43 Ga0070668_100527265 3300005347 Bacteria 1025
44 Ga0070668_100981033 3300005347 Bacteria 759
45 Ga0070669_100445269 3300005353 Bacteria 1067
46 Ga0070675_100162118 3300005354 Bacteria 1923
47 Ga0070671_100004070 3300005355 Bacteria 11538
48 Ga0070674_100228264 3300005356 Bacteria 1452
49 Ga0070674_100279351 3300005356 Bacteria 1323
50 Ga0070674_100438268 3300005356 Bacteria 1076
51 Ga0070673_100063368 3300005364 Bacteria 2941
52 Ga0070673_100626823 3300005364 Bacteria 983
53 Ga0070659_100238690 3300005366 Bacteria 1503
54 Ga0070667_100278053 3300005367 Bacteria 1503
55 Ga0070667_100710206 3300005367 Bacteria 931
56 Ga0070667_100778232 3300005367 Bacteria 888
57 Ga0070667_101069845 3300005367 Bacteria 754
58 Ga0070709_10021834 3300005434 Bacteria 3736
59 Ga0070714_100014004 3300005435 Bacteria 6435
60 Ga0070714_100029874 3300005435 Bacteria 4534
61 Ga0070714_100126094 3300005435 Bacteria 2282
62 Ga0070714_100200117 3300005435 Bacteria 1827
63 Ga0070713_100012520 3300005436 Bacteria 6226
64 Ga0070713_100034225 3300005436 Bacteria 4079
65 Ga0070713_100822162 3300005436 Bacteria 891
66 Ga0070710_10061446 3300005437 Bacteria 2139
67 Ga0070710_10248827 3300005437 Bacteria 1142
68 Ga0070701_10273477 3300005438 Bacteria 1029
69 Ga0070711_100004721 3300005439 Bacteria 8068
70 Ga0070663_100014194 3300005455 Bacteria 5107
71 Ga0070663_100088773 3300005455 Bacteria 2286
72 Ga0070663_100257800 3300005455 Bacteria 1382
73 Ga0070678_100186943 3300005456 Bacteria 1700
74 Ga0070678_100400338 3300005456 Bacteria 1192
75 Ga0070662_100042888 3300005457 Bacteria 3233
76 Ga0070662_100239802 3300005457 Bacteria 1454
77 Ga0070681_10013643 3300005458 Bacteria 8086
78 Ga0070681_10348649 3300005458 Bacteria 1391
79 Ga0070681_10468245 3300005458 Bacteria 1173
80 Ga0070685_10251561 3300005466 Bacteria 1171
81 Ga0070698_100588742 3300005471 Bacteria 1052
82 Ga0070698_100686212 3300005471 Bacteria 966
83 Ga0070699_100238133 3300005518 Bacteria 1624
84 Ga0070679_100114708 3300005530 Bacteria 2680
85 Ga0070684_100169988 3300005535 Bacteria 1980
86 Ga0070684_100234373 3300005535 Bacteria 1676
87 Ga0068853_100067816 3300005539 Bacteria 3100
88 Ga0068853_100077357 3300005539 Bacteria 2906
89 Ga0068853_100145365 3300005539 Bacteria 2131
90 Ga0068853_100433344 3300005539 Bacteria 1234
91 Ga0070672_100193562 3300005543 Bacteria 1699
92 Ga0070672_100418258 3300005543 Bacteria 1151
93 Ga0070672_100560683 3300005543 Bacteria 992
94 Ga0070686_100918697 3300005544 Bacteria 713
95 Ga0070693_100058244 3300005547 Bacteria 2235
96 Ga0070665_100005911 3300005548 Bacteria 12536
97 Ga0070665_100050816 3300005548 Bacteria 4160
98 Ga0070665_100195652 3300005548 Bacteria 2023
99 Ga0070665_100654806 3300005548 Bacteria 1063
100 Ga0070665_100858703 3300005548 Bacteria 921
101 Ga0068855_100044859 3300005563 Bacteria 5230
102 Ga0068855_100309579 3300005563 Bacteria 1748
103 Ga0070664_100037767 3300005564 Bacteria 4061
104 Ga0070664_100323222 3300005564 Bacteria 1398
105 Ga0068857_100359990 3300005577 Bacteria 1348
106 Ga0068854_100026693 3300005578 Bacteria 3972
107 Ga0068854_100405048 3300005578 Bacteria 1130
108 Ga0068856_100003013 3300005614 Bacteria 17245
109 Ga0068856_100056762 3300005614 Bacteria 3864
110 Ga0068856_100229067 3300005614 Bacteria 1874
111 Ga0068856_100256524 3300005614 Bacteria 1764
112 Ga0070702_100032923 3300005615 Bacteria 2847
113 Ga0070702_100375453 3300005615 Bacteria 1009
114 Ga0068852_100037597 3300005616 Bacteria 4060
115 Ga0068852_100159514 3300005616 Bacteria 2105
116 Ga0068852_100616225 3300005616 Bacteria 1091
117 Ga0068852_100792333 3300005616 Bacteria 961
118 Ga0068859_100040881 3300005617 Bacteria 4657
119 Ga0068859_100327723 3300005617 Bacteria 1625
120 Ga0068859_101123683 3300005617 Bacteria 865
121 Ga0068859_101326218 3300005617 Bacteria 793
122 Ga0068864_100023148 3300005618 Bacteria 5216
123 Ga0068864_100107412 3300005618 Bacteria 2483
124 Ga0068864_100470002 3300005618 Bacteria 1205
125 Ga0068866_10237859 3300005718 Bacteria 1107
126 Ga0068861_100383509 3300005719 Bacteria 1242
127 Ga0068861_100427563 3300005719 Bacteria 1181
128 Ga0068870_10094649 3300005840 Bacteria 1677
129 Ga0068870_10101180 3300005840 Bacteria 1629
130 Ga0068863_100155365 3300005841 Bacteria 2190
131 Ga0068863_100337609 3300005841 Bacteria 1465
132 Ga0068863_100387813 3300005841 Bacteria 1365
133 Ga0068858_100216246 3300005842 Bacteria 1814
134 Ga0068858_100385350 3300005842 Bacteria 1345
135 Ga0068860_100115291 3300005843 Bacteria 2569
136 Ga0068860_100191475 3300005843 Bacteria 1979
137 Ga0068860_100287751 3300005843 Bacteria 1607
138 Ga0068860_100393161 3300005843 Bacteria 1370
139 Ga0068860_100625168 3300005843 Bacteria 1084
140 Ga0068862_100506583 3300005844 Bacteria 1146
141 Ga0081455_10008218 3300005937 Bacteria 10882
142 Ga0081455_10035420 3300005937 Bacteria 4461
143 Ga0081455_10068340 3300005937 Bacteria 2958
144 Ga0081455_10082648 3300005937 Bacteria 2627
145 Ga0081540_1000565 3300005983 Bacteria 35910
146 Ga0081540_1001009 3300005983 Bacteria 25255
147 Ga0081540_1005680 3300005983 Bacteria 9270
148 Ga0081540_1006403 3300005983 Bacteria 8581
149 Ga0081540_1021104 3300005983 Bacteria 3893
150 Ga0081540_1040102 3300005983 Bacteria 2445
151 Ga0081540_1045259 3300005983 Bacteria 2237
152 Ga0081540_1065883 3300005983 Bacteria 1700
153 Ga0081540_1085085 3300005983 Bacteria 1409
154 Ga0081539_10001416 3300005985 Bacteria 41282
155 Ga0081539_10013324 3300005985 Bacteria 6202
156 Ga0081539_10025700 3300005985 Bacteria 3780
157 Ga0081539_10153426 3300005985 Bacteria 1106
158 Ga0070717_10032963 3300006028 Bacteria 4177
159 Ga0070717_10419413 3300006028 Bacteria 1204
160 Ga0075365_10011750 3300006038 Bacteria 5163
161 Ga0075365_10015504 3300006038 Bacteria 4612
162 Ga0075365_10035365 3300006038 Bacteria 3231
163 Ga0075365_10087322 3300006038 Bacteria 2120
164 Ga0075365_10106223 3300006038 Bacteria 1926
165 Ga0075365_10117466 3300006038 Bacteria 1832
166 Ga0075365_10125621 3300006038 Bacteria 1772
167 Ga0075365_10162133 3300006038 Bacteria 1558
168 Ga0075365_10332486 3300006038 Bacteria 1070
169 Ga0075365_10364919 3300006038 Bacteria 1018
170 Ga0075368_10005658 3300006042 Bacteria 4315
171 Ga0075368_10012370 3300006042 Bacteria 3118
172 Ga0075368_10028085 3300006042 Bacteria 2172
173 Ga0075363_100000880 3300006048 Bacteria 10553
174 Ga0075363_100019979 3300006048 Bacteria 3355
175 Ga0075363_100082056 3300006048 Bacteria 1764
176 Ga0075363_100156238 3300006048 Bacteria 1289
177 Ga0075363_100222179 3300006048 Bacteria 1083
178 Ga0075363_100363162 3300006048 Bacteria 847
179 Ga0075364_10009112 3300006051 Bacteria 5944
180 Ga0075364_10019087 3300006051 Bacteria 4301
181 Ga0075364_10065710 3300006051 Bacteria 2381
182 Ga0075364_10095437 3300006051 Bacteria 1977
183 Ga0075364_10140052 3300006051 Bacteria 1627
184 Ga0075364_10176103 3300006051 Bacteria 1446
185 Ga0075432_10110782 3300006058 Bacteria 1023
186 Ga0070716_100122791 3300006173 Bacteria 1629
187 Ga0070712_100042726 3300006175 Bacteria 3118
188 Ga0075362_10029004 3300006177 Bacteria 2381
189 Ga0075362_10042719 3300006177 Bacteria 2005
190 Ga0075362_10107869 3300006177 Bacteria 1308
191 Ga0075362_10121203 3300006177 Bacteria 1238
192 Ga0075362_10153885 3300006177 Bacteria 1104
193 Ga0075362_10201582 3300006177 Bacteria 969
194 Ga0075367_10019651 3300006178 Bacteria 3749
195 Ga0075367_10025247 3300006178 Bacteria 3359
196 Ga0075367_10046062 3300006178 Bacteria 2561
197 Ga0075367_10060985 3300006178 Bacteria 2250
198 Ga0075367_10067004 3300006178 Bacteria 2152
199 Ga0075367_10191734 3300006178 Bacteria 1275
200 Ga0075369_10014996 3300006186 Bacteria 3103
201 Ga0075369_10091439 3300006186 Bacteria 1358
202 Ga0075366_10042978 3300006195 Bacteria 2676
203 Ga0075366_10062328 3300006195 Bacteria 2216
204 Ga0075366_10104305 3300006195 Bacteria 1703
205 Ga0075366_10122491 3300006195 Bacteria 1567
206 Ga0075366_10177709 3300006195 Bacteria 1292
207 Ga0075366_10234143 3300006195 Bacteria 1119
208 Ga0075366_10250692 3300006195 Bacteria 1080
209 Ga0097621_100175580 3300006237 Bacteria 1849
210 Ga0075370_10033831 3300006353 Bacteria 2863
211 Ga0075370_10043409 3300006353 Bacteria 2541
212 Ga0075370_10052172 3300006353 Bacteria 2319
213 Ga0075370_10079942 3300006353 Bacteria 1878
214 Ga0075370_10096250 3300006353 Bacteria 1710
215 Ga0068871_100304461 3300006358 Bacteria 1400
216 Ga0068871_100474964 3300006358 Bacteria 1124
217 Ga0075428_100085520 3300006844 Bacteria 3439
218 Ga0075431_100453439 3300006847 Bacteria 1278
219 Ga0075434_100162290 3300006871 Bacteria 2254
220 Ga0075436_100067047 3300006914 Bacteria 2481
221 Ga0097620_100040883 3300006931 Bacteria 4657
222 Ga0097620_100327726 3300006931 Bacteria 1625
223 Ga0097620_101123610 3300006931 Bacteria 865
224 Ga0097620_101326648 3300006931 Bacteria 793
225 Ga0099825_1040584 3300006941 Bacteria 1375
226 Ga0099824_1006697 3300006942 Bacteria 15679
227 Ga0099824_1015025 3300006942 Bacteria 7487
228 Ga0075435_100017984 3300007076 Bacteria 5361
229 Ga0075435_100460014 3300007076 Bacteria 1098
230 Ga0099794_10046548 3300007265 Bacteria 2078
231 Ga0099795_10010942 3300007788 Bacteria 2691
232 Ga0105250_10129780 3300009092 Bacteria 1040
233 Ga0105240_10025515 3300009093 Bacteria 7765
234 Ga0105240_10109631 3300009093 Bacteria 3343
235 Ga0105240_11111430 3300009093 Bacteria 840
236 Ga0111539_10010826 3300009094 Bacteria 11484
237 Ga0111539_10522638 3300009094 Bacteria 1383
238 Ga0105245_10040987 3300009098 Bacteria 4127
239 Ga0105245_10236260 3300009098 Bacteria 1770
240 Ga0105245_10317873 3300009098 Bacteria 1533
241 Ga0105247_10042883 3300009101 Bacteria 2771
242 Ga0105247_10199743 3300009101 Bacteria 1343
243 Ga0105247_10247390 3300009101 Bacteria 1217
244 Ga0105247_10266257 3300009101 Bacteria 1177
245 Ga0105247_10267345 3300009101 Bacteria 1175
246 Ga0105247_10371671 3300009101 Bacteria 1011
247 Ga0114129_10572337 3300009147 Bacteria 1467
248 Ga0105243_10071572 3300009148 Bacteria 2804
249 Ga0105243_10301725 3300009148 Bacteria 1452
250 Ga0105243_10361040 3300009148 Bacteria 1337
251 Ga0105241_10118471 3300009174 Bacteria 2129
252 Ga0105241_10131433 3300009174 Bacteria 2027
253 Ga0105241_10299360 3300009174 Bacteria 1380
254 Ga0105248_10360990 3300009177 Bacteria 1635
255 Ga0105237_10008457 3300009545 Bacteria 11137
256 Ga0105237_10125043 3300009545 Bacteria 2566
257 Ga0105237_10501605 3300009545 Bacteria 1220
258 Ga0105237_10636519 3300009545 Bacteria 1073
259 Ga0105238_10035756 3300009551 Bacteria 5049
260 Ga0105238_10109774 3300009551 Bacteria 2740
261 Ga0105238_10146736 3300009551 Bacteria 2335
262 Ga0105238_10219790 3300009551 Bacteria 1876
263 Ga0105238_10230700 3300009551 Bacteria 1828
264 Ga0105238_10257525 3300009551 Bacteria 1724
265 Ga0105249_10340285 3300009553 Bacteria 1517
266 Ga0105249_10743862 3300009553 Bacteria 1042
267 Ga0105249_10786915 3300009553 Bacteria 1015
268 Ga0105249_10966653 3300009553 Bacteria 920
269 Ga0105239_10046697 3300010375 Bacteria 4746
270 Ga0105239_10050580 3300010375 Bacteria 4557
271 Ga0105239_10099732 3300010375 Bacteria 3211
272 Ga0105239_10177285 3300010375 Bacteria 2384
273 Ga0105239_11035849 3300010375 Bacteria 944
274 Ga0105246_10074369 3300011119 Bacteria 2402
275 Ga0105246_10281708 3300011119 Bacteria 1334
276 Ga0105246_10300738 3300011119 Bacteria 1295
277 Ga0105246_10410575 3300011119 Bacteria 1127
278 Ga0157374_10010340 3300013296 Bacteria 8026
279 Ga0157374_10102780 3300013296 Bacteria 2741
280 Ga0157374_10138060 3300013296 Bacteria 2365
281 Ga0157374_10745262 3300013296 Bacteria 994
282 Ga0157378_10196236 3300013297 Bacteria 1907
283 Ga0157378_10496673 3300013297 Bacteria 1218
284 Ga0157378_11594091 3300013297 Bacteria 699
285 Ga0163162_10015299 3300013306 Bacteria 7494
286 Ga0163162_11243508 3300013306 Bacteria 845
287 Ga0157372_10281861 3300013307 Bacteria 1932
288 Ga0157375_10025490 3300013308 Bacteria 5495
289 Ga0163163_10020877 3300014325 Bacteria 6175
290 Ga0163163_10038915 3300014325 Bacteria 4638
291 Ga0163163_10119746 3300014325 Bacteria 2666
292 Ga0163163_10223609 3300014325 Bacteria 1931
293 Ga0163163_10762099 3300014325 Bacteria 1031
294 Ga0157380_10545568 3300014326 Bacteria 1136
295 Ga0157376_10002196 3300014969 Bacteria 13158
296 Ga0157376_10267181 3300014969 Bacteria 1605
297 Ga0163161_10095823 3300017792 Bacteria 2202
298 Ga0163161_10217268 3300017792 Bacteria 1479
299 Ga0163161_10245871 3300017792 Bacteria 1393
300 Ga0163161_10305165 3300017792 Bacteria 1255
301 Ga0214544_1003958 3300021320 Bacteria 30115
302 Ga0214542_1000002 3300021321 Bacteria 720798
303 Ga0214545_1000002 3300021324 Bacteria 727485
304 Ga0214543_1000013 3300021327 Bacteria 329117
305 Ga0213873_10004067 3300021358 Bacteria 2696
306 Ga0213876_10002558 3300021384 Bacteria 10644
307 Ga0213876_10308640 3300021384 Bacteria 841
308 Ga0213871_10001798 3300021441 Bacteria 3741
309 Ga0209563_108420 3300025230 Bacteria 1628
310 Ga0209677_103580 3300025253 Bacteria 4939
311 Ga0209148_1000319 3300025254 Bacteria 67129
312 Ga0209233_1001148 3300025261 Bacteria 10790
313 Ga0209233_1008818 3300025261 Bacteria 3096
314 Ga0209455_1003913 3300025272 Bacteria 5078
315 Ga0209455_1005042 3300025272 Bacteria 4179
316 Ga0209455_1006371 3300025272 Bacteria 3493
317 Ga0209673_1042772 3300025273 Bacteria 1271
318 Ga0209564_1006114 3300025295 Bacteria 6608
319 Ga0209758_1000100 3300025297 Bacteria 227948
320 Ga0209758_1000138 3300025297 Bacteria 175187
321 Ga0209758_1000569 3300025297 Bacteria 57936
322 Ga0209758_1001091 3300025297 Bacteria 35146
323 Ga0209758_1001321 3300025297 Bacteria 30110
324 Ga0209758_1015098 3300025297 Bacteria 4034
325 Ga0209758_1029333 3300025297 Bacteria 2303
326 Ga0209256_1016482 3300025299 Bacteria 2515
327 Ga0207426_1000575 3300025302 Bacteria 49342
328 Ga0207426_1000611 3300025302 Bacteria 46127
329 Ga0207426_1005308 3300025302 Bacteria 5932
330 Ga0207426_1052117 3300025302 Bacteria 1213
331 Ga0207426_1074254 3300025302 Bacteria 939
332 Ga0209257_1002363 3300025304 Bacteria 18933
333 Ga0209257_1016653 3300025304 Bacteria 2957
334 Ga0209257_1019833 3300025304 Bacteria 2513
335 Ga0207697_10084198 3300025315 Bacteria 1342
336 Ga0207692_10050274 3300025898 Bacteria 2107
337 Ga0207692_10223243 3300025898 Bacteria 1118
338 Ga0207710_10041299 3300025900 Bacteria 2045
339 Ga0207710_10044680 3300025900 Bacteria 1973
340 Ga0207710_10104578 3300025900 Bacteria 1339
341 Ga0207710_10294336 3300025900 Bacteria 819
342 Ga0207688_10079090 3300025901 Bacteria 1875
343 Ga0207688_10110472 3300025901 Bacteria 1595
344 Ga0207647_10046642 3300025904 Bacteria 2699
345 Ga0207699_10021053 3300025906 Bacteria 3507
346 Ga0207645_10053681 3300025907 Bacteria 2575
347 Ga0207645_10521149 3300025907 Bacteria 805
348 Ga0207643_10085357 3300025908 Bacteria 1833
349 Ga0207705_10367437 3300025909 Bacteria 1110
350 Ga0207705_10407268 3300025909 Bacteria 1052
351 Ga0207654_10108977 3300025911 Bacteria 1719
352 Ga0207654_10119307 3300025911 Bacteria 1654
353 Ga0207654_10424303 3300025911 Bacteria 928
354 Ga0207654_10732839 3300025911 Bacteria 711
355 Ga0207707_10146318 3300025912 Bacteria 2066
356 Ga0207707_10413505 3300025912 Bacteria 1157
357 Ga0207695_10000342 3300025913 Bacteria 108393
358 Ga0207671_10018432 3300025914 Bacteria 5355
359 Ga0207671_10055842 3300025914 Bacteria 2926
360 Ga0207671_10108951 3300025914 Bacteria 2105
361 Ga0207671_10659809 3300025914 Bacteria 833
362 Ga0207693_10012619 3300025915 Bacteria 6827
363 Ga0207693_10053523 3300025915 Bacteria 3167
364 Ga0207663_10294821 3300025916 Bacteria 1209
365 Ga0207662_10009080 3300025918 Bacteria 5462
366 Ga0207657_10475408 3300025919 Bacteria 980
367 Ga0207657_10518817 3300025919 Bacteria 933
368 Ga0207649_10040728 3300025920 Bacteria 2826
369 Ga0207652_10021542 3300025921 Bacteria 5319
370 Ga0207652_10602962 3300025921 Bacteria 985
371 Ga0207681_10206176 3300025923 Bacteria 1512
372 Ga0207694_10050067 3300025924 Bacteria 3234
373 Ga0207694_10058879 3300025924 Bacteria 2988
374 Ga0207694_10168659 3300025924 Bacteria 1771
375 Ga0207650_10218404 3300025925 Bacteria 1533
376 Ga0207650_10506633 3300025925 Bacteria 1009
377 Ga0207650_10649668 3300025925 Bacteria 889
378 Ga0207659_10163121 3300025926 Bacteria 1752
379 Ga0207687_10007169 3300025927 Bacteria 7349
380 Ga0207687_10113616 3300025927 Bacteria 2015
381 Ga0207700_10034864 3300025928 Bacteria 3617
382 Ga0207700_10041545 3300025928 Bacteria 3365
383 Ga0207664_10106019 3300025929 Bacteria 2330
384 Ga0207664_10423961 3300025929 Bacteria 1185
385 Ga0207644_10231862 3300025931 Bacteria 1467
386 Ga0207644_10726381 3300025931 Bacteria 829
387 Ga0207690_10294332 3300025932 Bacteria 1268
388 Ga0207706_10077308 3300025933 Bacteria 2927
389 Ga0207706_10099415 3300025933 Bacteria 2560
390 Ga0207706_10277211 3300025933 Bacteria 1463
391 Ga0207706_10364253 3300025933 Bacteria 1256
392 Ga0207706_10640314 3300025933 Bacteria 911
393 Ga0207686_10169929 3300025934 Bacteria 1537
394 Ga0207709_10125286 3300025935 Bacteria 1741
395 Ga0207670_10139288 3300025936 Bacteria 1787
396 Ga0207669_10230111 3300025937 Bacteria 1367
397 Ga0207704_10347613 3300025938 Bacteria 1153
398 Ga0207704_10610100 3300025938 Bacteria 894
399 Ga0207665_10041812 3300025939 Bacteria 3063
400 Ga0207665_10101483 3300025939 Bacteria 2009
401 Ga0207691_10062798 3300025940 Bacteria 3369
402 Ga0207711_10665094 3300025941 Bacteria 972
403 Ga0207711_10800613 3300025941 Bacteria 878
404 Ga0207689_10329768 3300025942 Bacteria 1267
405 Ga0207661_10090619 3300025944 Bacteria 2546
406 Ga0207661_10293056 3300025944 Bacteria 1457
407 Ga0207679_10157649 3300025945 Bacteria 1855
408 Ga0207679_10398804 3300025945 Bacteria 1210
409 Ga0207679_10579505 3300025945 Bacteria 1009
410 Ga0207667_10087606 3300025949 Bacteria 3220
411 Ga0207667_10134941 3300025949 Bacteria 2541
412 Ga0207667_10749069 3300025949 Bacteria 976
413 Ga0207651_10096535 3300025960 Bacteria 2180
414 Ga0207651_10601399 3300025960 Bacteria 961
415 Ga0207712_10273374 3300025961 Bacteria 1376
416 Ga0207712_10468502 3300025961 Bacteria 1072
417 Ga0207668_10050571 3300025972 Bacteria 2865
418 Ga0207668_10094403 3300025972 Bacteria 2205
419 Ga0207668_10261856 3300025972 Bacteria 1409
420 Ga0207668_10302464 3300025972 Bacteria 1320
421 Ga0207640_10361311 3300025981 Bacteria 1170
422 Ga0207640_10447573 3300025981 Bacteria 1064
423 Ga0207640_10496898 3300025981 Bacteria 1015
424 Ga0207640_10538620 3300025981 Bacteria 979
425 Ga0207658_10078350 3300025986 Bacteria 2525
426 Ga0207658_10079444 3300025986 Bacteria 2509
427 Ga0207658_10156056 3300025986 Bacteria 1865
428 Ga0207677_10334582 3300026023 Bacteria 1263
429 Ga0207703_10068579 3300026035 Bacteria 2922
430 Ga0207703_10108068 3300026035 Bacteria 2369
431 Ga0207703_10290027 3300026035 Bacteria 1489
432 Ga0207703_10508839 3300026035 Bacteria 1131
433 Ga0207678_10020589 3300026067 Bacteria 5784
434 Ga0207678_10025740 3300026067 Bacteria 5135
435 Ga0207678_10064623 3300026067 Bacteria 3144
436 Ga0207678_10064668 3300026067 Bacteria 3143
437 Ga0207678_10070693 3300026067 Bacteria 2992
438 Ga0207678_10267080 3300026067 Bacteria 1467
439 Ga0207708_10301281 3300026075 Bacteria 1304
440 Ga0207708_10306518 3300026075 Bacteria 1293
441 Ga0207708_10379312 3300026075 Bacteria 1165
442 Ga0207702_10000365 3300026078 Bacteria 51814
443 Ga0207702_10410380 3300026078 Bacteria 1308
444 Ga0207641_10232456 3300026088 Bacteria 1714
445 Ga0207641_10579918 3300026088 Bacteria 1096
446 Ga0207641_10638652 3300026088 Bacteria 1045
447 Ga0207641_10877230 3300026088 Bacteria 890
448 Ga0207641_10958158 3300026088 Bacteria 851
449 Ga0207648_10043577 3300026089 Bacteria 3939
450 Ga0207676_10071416 3300026095 Bacteria 2787
451 Ga0207676_10229029 3300026095 Bacteria 1660
452 Ga0207676_10329485 3300026095 Bacteria 1405
453 Ga0207676_10479854 3300026095 Bacteria 1177
454 Ga0207676_10596069 3300026095 Bacteria 1061
455 Ga0207676_10681464 3300026095 Bacteria 994
456 Ga0207674_10045583 3300026116 Bacteria 4509
457 Ga0207674_10708110 3300026116 Bacteria 972
458 Ga0207675_100283259 3300026118 Bacteria 1611
459 Ga0207675_100449173 3300026118 Bacteria 1277
460 Ga0207683_10044978 3300026121 Bacteria 3860
461 Ga0207683_10056308 3300026121 Bacteria 3448
462 Ga0207683_10269411 3300026121 Bacteria 1555
463 Ga0207683_10635355 3300026121 Bacteria 989
464 Ga0207698_10132848 3300026142 Bacteria 2130
465 Ga0207698_10531214 3300026142 Bacteria 1150
466 Ga0209389_1000092 3300027296 Bacteria 82555
467 Ga0209389_1002136 3300027296 Bacteria 14827
468 Ga0209589_1000115 3300027357 Bacteria 82537
469 Ga0209489_100340 3300027361 Bacteria 82555
470 Ga0209489_109127 3300027361 Bacteria 12657
471 Ga0209700_100117 3300027363 Bacteria 115595
472 Ga0209588_1033615 3300027671 Bacteria 1645
473 Ga0209813_10004007 3300027866 Bacteria 3489
474 Ga0209813_10037770 3300027866 Bacteria 1457
475 Ga0207428_10032809 3300027907 Bacteria 4270
476 Ga0268266_10002227 3300028379 Bacteria 21177
477 Ga0268266_10034535 3300028379 Bacteria 4301
478 Ga0268266_10085947 3300028379 Bacteria 2749
479 Ga0268265_10026937 3300028380 Bacteria 4095
480 Ga0268265_10107968 3300028380 Bacteria 2265
481 Ga0268265_10189532 3300028380 Bacteria 1774
482 Ga0268265_10406584 3300028380 Bacteria 1260
483 Ga0268265_10605595 3300028380 Bacteria 1047
484 Ga0268264_10659322 3300028381 Bacteria 1036
485 Ga0265318_10127784 3300028577 Bacteria 934
486 Ga0307517_10176597 3300028786 Bacteria 1389
487 Ga0307517_10231704 3300028786 Bacteria 1107
488 Ga0307511_10052383 3300030521 Bacteria 3252
489 Ga0265330_10078568 3300031235 Bacteria 1423
490 Ga0265330_10124858 3300031235 Bacteria 1096
491 Ga0265340_10011504 3300031247 Bacteria 4702
492 Ga0265339_10011623 3300031249 Bacteria 5410
493 Ga0265339_10051301 3300031249 Bacteria 2252
494 Ga0265331_10085132 3300031250 Bacteria 1465
495 Ga0265331_10200945 3300031250 Bacteria 898
496 Ga0265316_10049602 3300031344 Bacteria 3306
497 Ga0265316_10367120 3300031344 Bacteria 1040
498 Ga0307509_10101865 3300031507 Bacteria 2904
499 Ga0307509_10134654 3300031507 Bacteria 2418
500 Ga0307509_10431683 3300031507 Bacteria 1016
501 Ga0307509_10629332 3300031507 Bacteria 743
502 Ga0307408_100549942 3300031548 Bacteria 1018
503 Ga0307508_10292536 3300031616 Bacteria 1222
504 Ga0307508_10420005 3300031616 Bacteria 929
505 Ga0265342_10011923 3300031712 Bacteria 5914
506 Ga0307516_10104028 3300031730 Bacteria 2652
507 Ga0307516_10166562 3300031730 Bacteria 1948
508 Ga0307405_10172869 3300031731 Bacteria 1543
509 Ga0307413_10037092 3300031824 Bacteria 2813
510 Ga0307413_10135965 3300031824 Bacteria 1690
511 Ga0307413_10319439 3300031824 Bacteria 1185
512 Ga0307410_10183059 3300031852 Bacteria 1587
513 Ga0307406_10356982 3300031901 Bacteria 1144
514 Ga0307407_10040269 3300031903 Bacteria 2604
515 Ga0307407_10159405 3300031903 Bacteria 1475
516 Ga0307407_10293913 3300031903 Bacteria 1130
517 Ga0307412_10298454 3300031911 Bacteria 1272
518 Ga0307409_100030635 3300031995 Bacteria 3869
519 Ga0307409_100051841 3300031995 Bacteria 3142
520 Ga0307409_100653531 3300031995 Bacteria 1045
521 Ga0307414_10384567 3300032004 Bacteria 1214
522 Ga0307411_10018506 3300032005 Bacteria 3998
523 Ga0307411_10356091 3300032005 Bacteria 1195
524 Ga0307415_100164140 3300032126 Bacteria 1725
525 Ga0307415_100212714 3300032126 Bacteria 1544
526 Ga0307415_100249852 3300032126 Bacteria 1440
527 Ga0307507_10045182 3300033179 Bacteria 4338
528 Ga0307510_10006740 3300033180 Bacteria 13693
529 Ga0307510_10030910 3300033180 Bacteria 6062
530 Ga0307510_10154786 3300033180 Bacteria 1902
531 Ga0307510_10367787 3300033180 Bacteria 885
532 Ga0373936_0056906 3300035113 Bacteria 1590
533 Ga0373936_0108226 3300035113 Bacteria 1178
534 Ga0373945_0216318 3300035116 Bacteria 800
535 Ga0373954_0247191 3300035118 Bacteria 878
536 Ga0373956_0157187 3300035119 Bacteria 1071
537 Ga0373955_0000411 3300035172 Bacteria 18219
538 Ga0373924_0002005 3300035410 Bacteria 6773
539 Ga0373931_0641833 3300035691 Bacteria 697
540 Ga0373935_0032588 3300035692 Bacteria 3238
541 Ga0373935_0106653 3300035692 Bacteria 1854
542 Ga0373927_0002098 3300035695 Bacteria 14719
543 Ga0373927_0045109 3300035695 Bacteria 2852
544 Ga0373927_0096108 3300035695 Bacteria 1926
545 Ga0373933_0000276 3300035724 Bacteria 33468
546 Ga0373933_0023096 3300035724 Bacteria 3549
547 Ga0373947_0203298 3300035725 Bacteria 1297
548 Ga0373937_0004238 3300036401 Bacteria 12157
549 Ga0373925_0032076 3300037068 Bacteria 3865
550 Ga0373925_0384840 3300037068 Bacteria 1143
551 Ga0373925_0715220 3300037068 Bacteria 826
552 Ga0395900_0000601 3300037418 Bacteria 49219
553 Ga0395900_0663087 3300037418 Bacteria 979
554 Ga0395898_0136215 3300037466 Bacteria 2351
555 Ga0395898_0950447 3300037466 Bacteria 796
556 Ga0395905_0042342 3300037471 Bacteria 4273
557 Ga0395905_0047738 3300037471 Bacteria 4011
558 Ga0395905_0523900 3300037471 Bacteria 1086
559 Ga0395901_0174292 3300038443 Bacteria 2256
560 Ga0395901_0402113 3300038443 Bacteria 1407
561 Ga0395901_0612358 3300038443 Bacteria 1097
562 Ga0395901_0763651 3300038443 Bacteria 959
563 Ga0436365_0074464 3300039437 Bacteria 14893
564 Ga0436365_0491407 3300039437 Bacteria 992
565 Ga0436365_0604857 3300039437 Bacteria 2749
566 Ga0436365_0871323 3300039437 Bacteria 58014
567 Ga0436365_1241914 3300039437 Bacteria 1108
568 Ga0436365_1832438 3300039437 Bacteria 3922
569 Ga0436360_0800369 3300039438 Bacteria 928
570 Ga0436363_0702677 3300039450 Bacteria 693
571 Ga0451787_680561 3300041441 Bacteria 1079
572 Ga0451791_1330780 3300041451 Bacteria 983
573 Ga0451835_0281011 3300041492 Bacteria 920
574 Ga0451837_0572566 3300041494 Bacteria 1249
575 Ga0451837_1293921 3300041494 Bacteria 1294
576 Ga0451849_1570337 3300041505 Bacteria 890
577 Ga0451853_0256934 3300041512 Bacteria 1265
578 Ga0451853_1014670 3300041512 Bacteria 1573
579 Ga0451853_3570517 3300041512 Bacteria 1536
580 Ga0466969_0017894 3300044656 Bacteria 3697
581 Ga0466972_0000206 3300044658 Bacteria 42982
582 Ga0466972_0125706 3300044658 Bacteria 1208
583 Ga0466965_0028858 3300044683 Bacteria 2697
584 Ga0466965_0447459 3300044683 Bacteria 719
585 Ga0466966_0000872 3300044684 Bacteria 19273
586 Ga0466961_0000082 3300044693 Bacteria 59328
587 Ga0466963_0156208 3300044694 Bacteria 1586
588 Ga0453684_0095053 3300044712 Bacteria 3664
589 Ga0466968_0008843 3300044735 Bacteria 3865
590 Ga0466957_0045023 3300044842 Bacteria 2675
591 Ga0466957_0073127 3300044842 Bacteria 2124
592 Ga0466957_0145247 3300044842 Bacteria 1531
593 Ga0466957_0263932 3300044842 Bacteria 1148
594 Ga0466960_0003192 3300044901 Bacteria 6283
595 Ga0466960_0202229 3300044901 Bacteria 1086
596 Ga0466960_0231571 3300044901 Bacteria 1020
597 Ga0466959_0007074 3300045049 Bacteria 7845
598 Ga0466959_0021459 3300045049 Bacteria 4763
599 Ga0451576_0158291 3300045051 Bacteria 2363
600 Ga0466967_0244666 3300045976 Bacteria 1712
601 Ga0495617_039527 3300046452 Bacteria 1578
602 Ga0495592_0176376 3300046454 Bacteria 1459
603 Ga0495603_0014808 3300046455 Bacteria 4717
604 Ga0495603_0015277 3300046455 Bacteria 4645
605 Ga0495603_0017171 3300046455 Bacteria 4381
606 Ga0495603_0028524 3300046455 Bacteria 3367
607 Ga0495590_0046719 3300046457 Bacteria 1510
608 Ga0495629_0001885 3300046459 Bacteria 16349
609 Ga0495629_0002653 3300046459 Bacteria 13712
610 Ga0495629_0126465 3300046459 Bacteria 1781
611 Ga0495629_0153510 3300046459 Bacteria 1600
612 Ga0495638_0135790 3300046460 Bacteria 1440
613 Ga0495638_0203855 3300046460 Bacteria 1115
614 Ga0495641_0078631 3300046461 Bacteria 1478
615 Ga0495641_0144547 3300046461 Bacteria 1063
616 Ga0495641_0206240 3300046461 Bacteria 881
617 Ga0495651_0035747 3300046462 Bacteria 3867
618 Ga0495651_0099543 3300046462 Bacteria 2168
619 Ga0495651_0235834 3300046462 Bacteria 1257
620 Ga0495651_0388564 3300046462 Bacteria 913
621 Ga0495653_0000879 3300046463 Bacteria 23181
622 Ga0495653_0270486 3300046463 Bacteria 1119
623 Ga0495650_0148975 3300046471 Bacteria 842
624 Ga0495605_0031470 3300046474 Bacteria 2710
625 Ga0495639_0355492 3300046475 Bacteria 736
626 Ga0495662_0197053 3300046476 Bacteria 993
627 Ga0495664_0008104 3300046477 Bacteria 5853
628 Ga0495664_0021339 3300046477 Bacteria 3741
629 Ga0495584_0068683 3300046491 Bacteria 1780
630 Ga0495585_0155823 3300046492 Bacteria 1188
631 Ga0495585_0290776 3300046492 Bacteria 805
632 Ga0495594_0055814 3300046499 Bacteria 2178
633 Ga0495594_0079549 3300046499 Bacteria 1830
634 Ga0495606_0029541 3300046507 Bacteria 3845
635 Ga0495606_0169363 3300046507 Bacteria 1268
636 Ga0495606_0276886 3300046507 Bacteria 919
637 Ga0495608_0003840 3300046511 Bacteria 10799
638 Ga0495608_0148802 3300046511 Bacteria 1493
639 Ga0495610_0017594 3300046512 Bacteria 4070
640 Ga0495610_0029933 3300046512 Bacteria 2860
641 Ga0495618_0006601 3300046514 Bacteria 7036
642 Ga0495618_0160778 3300046514 Bacteria 1432
643 Ga0495628_0117976 3300046516 Bacteria 2037
644 Ga0495628_0394550 3300046516 Bacteria 1012
645 Ga0495630_0140306 3300046517 Bacteria 1837
646 Ga0495631_0052606 3300046518 Bacteria 1778
647 Ga0495631_0092298 3300046518 Bacteria 1303
648 Ga0495631_0204183 3300046518 Bacteria 845
649 Ga0495632_0171491 3300046519 Bacteria 996
650 Ga0495637_0083951 3300046520 Bacteria 1266
651 Ga0495643_0010420 3300046522 Bacteria 5723
652 Ga0495643_0206504 3300046522 Bacteria 940
653 Ga0495648_0140085 3300046524 Bacteria 1274
654 Ga0495648_0197564 3300046524 Bacteria 1009
655 Ga0495663_0086352 3300046525 Bacteria 1017
656 Ga0495666_0057087 3300046526 Bacteria 1869
657 Ga0495652_0002357 3300046529 Bacteria 19599
658 Ga0495652_0009665 3300046529 Bacteria 8755
659 Ga0495652_0099942 3300046529 Bacteria 2355
660 Ga0495640_0007880 3300046533 Bacteria 8376
661 Ga0495640_0067035 3300046533 Bacteria 2419
662 Ga0495586_0127770 3300046535 Bacteria 1422
663 Ga0495586_0306647 3300046535 Bacteria 910
664 Ga0495587_0054380 3300046536 Bacteria 2359
665 Ga0495587_0117888 3300046536 Bacteria 1521
666 Ga0495598_0011296 3300046537 Bacteria 2161
667 Ga0495609_0161423 3300046538 Bacteria 950
668 Ga0495597_0069708 3300046542 Bacteria 1517
669 Ga0495645_0017952 3300046543 Bacteria 5076
670 Ga0495645_0048088 3300046543 Bacteria 3107
671 Ga0495622_0009657 3300046557 Bacteria 4462
672 Ga0495622_0026851 3300046557 Bacteria 2687
673 Ga0495633_0203505 3300046558 Bacteria 908
674 Ga0495633_0265777 3300046558 Bacteria 781
675 Ga0495667_0006955 3300046559 Bacteria 7673
676 Ga0495667_0104195 3300046559 Bacteria 1834
677 Ga0495656_0113224 3300046615 Bacteria 1272
678 Ga0495668_0075590 3300046616 Bacteria 1850
679 Ga0495668_0378673 3300046616 Bacteria 777
680 Ga0495634_0018119 3300046642 Bacteria 5017
681 Ga0495634_0046756 3300046642 Bacteria 2919
682 Ga0495634_0133738 3300046642 Bacteria 1579
683 Ga0495634_0203128 3300046642 Bacteria 1230
684 Ga0495611_0061325 3300046648 Bacteria 1709
685 Ga0495611_0158424 3300046648 Bacteria 1057
686 Ga0495625_0137529 3300046660 Bacteria 1650
687 Ga0495625_0234816 3300046660 Bacteria 1196
688 Ga0495635_0001944 3300046663 Bacteria 14052
689 Ga0495635_0025751 3300046663 Bacteria 4097
690 Ga0495635_0053641 3300046663 Bacteria 2778
691 Ga0495635_0231441 3300046663 Bacteria 1248
692 Ga0495661_0199581 3300046665 Bacteria 1048
693 Ga0495657_0020674 3300046675 Bacteria 4732
694 Ga0495657_0144563 3300046675 Bacteria 1480
695 Ga0495599_0002950 3300046678 Bacteria 9897
696 Ga0495599_0052690 3300046678 Bacteria 2549
697 Ga0495599_0273524 3300046678 Bacteria 1024
698 Ga0495623_0179442 3300046679 Bacteria 1231
699 Ga0495646_0061759 3300046680 Bacteria 2230
700 Ga0495669_0030370 3300046684 Bacteria 2372
701 Ga0495669_0030629 3300046684 Bacteria 2362
702 Ga0495669_0042880 3300046684 Bacteria 2013
703 Ga0495669_0084520 3300046684 Bacteria 1459
704 Ga0495613_0100144 3300046689 Bacteria 2093
705 Ga0495613_0459727 3300046689 Bacteria 861
706 Ga0495624_0027748 3300046690 Bacteria 3704
707 Ga0495670_0098099 3300046691 Bacteria 1506
708 Ga0495649_0008929 3300046694 Bacteria 5995
709 Ga0495649_0052228 3300046694 Bacteria 2215
710 Ga0495589_0149827 3300046794 Bacteria 1114
711 Ga0495600_0003365 3300046809 Bacteria 9401
712 Ga0495600_0106542 3300046809 Bacteria 1826
713 Ga0495600_0141242 3300046809 Bacteria 1562
714 Ga0495581_0383317 3300047315 Bacteria 820
715 Ga0495604_0000457 3300047317 Bacteria 36318
716 Ga0495604_0130086 3300047317 Bacteria 1810
717 Ga0495636_0128587 3300047318 Bacteria 1125
718 Ga0495674_0007544 3300047319 Bacteria 10388
719 Ga0495674_0024647 3300047319 Bacteria 5522
720 Ga0495674_0613683 3300047319 Bacteria 861
721 Ga0495676_0019047 3300047321 Bacteria 6044
722 Ga0495676_0112128 3300047321 Bacteria 1999
723 Ga0495676_0552137 3300047321 Bacteria 753
724 Ga0495680_0000217 3300047322 Bacteria 62734
725 Ga0495680_0022651 3300047322 Bacteria 5233
726 Ga0495680_0298674 3300047322 Bacteria 1131
727 Ga0495683_0054061 3300047323 Bacteria 2002
728 Ga0495683_0197169 3300047323 Bacteria 910
729 Ga0495687_099628 3300047443 Bacteria 1093
730 Ga0495675_0047405 3300047444 Bacteria 2734
731 Ga0495677_0092107 3300047445 Bacteria 1143
732 Ga0495685_117094 3300047447 Bacteria 875
733 Ga0495673_0081202 3300047469 Bacteria 1343
734 Ga0495673_0119301 3300047469 Bacteria 1046
735 Ga0495684_0002844 3300047471 Bacteria 13627
736 Ga0495684_0085268 3300047471 Bacteria 2395
737 Ga0495686_0120872 3300047472 Bacteria 1561
738 Ga0495686_0191603 3300047472 Bacteria 1178
739 Ga0495686_0218363 3300047472 Bacteria 1086
740 Ga0495593_0333521 3300047673 Bacteria 758
741 Ga0495602_0002288 3300048088 Bacteria 19366
742 Ga0495602_0032241 3300048088 Bacteria 4937
743 Ga0495602_0064976 3300048088 Bacteria 3152
744 Ga0495602_0445247 3300048088 Bacteria 915
745 Ga0495626_0177712 3300048091 Bacteria 884
746 Ga0496100_0023430 3300048903 Bacteria 3751
747 Ga0496100_0051487 3300048903 Bacteria 2673
748 Ga0496100_0200841 3300048903 Bacteria 1453
749 Ga0496100_0623037 3300048903 Bacteria 839
750 Ga0496101_0044574 3300048904 Bacteria 3174
751 Ga0496101_0218071 3300048904 Bacteria 1480
752 Ga0496101_0233495 3300048904 Bacteria 1430
753 Ga0496101_0361738 3300048904 Bacteria 1141
754 Ga0496102_0001372 3300048905 Bacteria 21715
755 Ga0496102_0055829 3300048905 Bacteria 3601
756 Ga0496102_0163510 3300048905 Bacteria 2094
757 Ga0496102_0247053 3300048905 Bacteria 1682
758 Ga0496102_0805369 3300048905 Bacteria 862
759 Ga0496102_1167607 3300048905 Bacteria 689
760 Ga0496103_0021125 3300048906 Bacteria 3916
761 Ga0496103_0028309 3300048906 Bacteria 3399
762 Ga0496103_0157565 3300048906 Bacteria 1456
763 Ga0496103_0204195 3300048906 Bacteria 1271
764 Ga0496103_0211040 3300048906 Bacteria 1249
765 Ga0496104_0000871 3300048907 Bacteria 25996
766 Ga0496104_0083890 3300048907 Bacteria 3039
767 Ga0496104_0194151 3300048907 Bacteria 1942
768 Ga0496104_0330228 3300048907 Bacteria 1438
769 Ga0496104_0645881 3300048907 Bacteria 967
770 Ga0496105_0000692 3300048908 Bacteria 22697
771 Ga0496105_0143125 3300048908 Bacteria 1967
772 Ga0496105_0230470 3300048908 Bacteria 1505
773 Ga0496106_0000664 3300048909 Bacteria 24642
774 Ga0496106_0006324 3300048909 Bacteria 8773
775 Ga0496106_0587978 3300048909 Bacteria 892
776 Ga0496106_0696044 3300048909 Bacteria 810
777 Ga0496106_0731540 3300048909 Bacteria 787
778 Ga0496106_0892161 3300048909 Bacteria 702
779 Ga0496107_0006521 3300048910 Bacteria 8028
780 Ga0496107_0146548 3300048910 Bacteria 1746
781 Ga0496108_0006613 3300048911 Bacteria 9398
782 Ga0496108_0070787 3300048911 Bacteria 2943
783 Ga0496109_0002448 3300048912 Bacteria 15545
784 Ga0496109_0034450 3300048912 Bacteria 4560
785 Ga0496109_0135370 3300048912 Bacteria 2302
786 Ga0496109_0194775 3300048912 Bacteria 1905
787 Ga0496109_0314130 3300048912 Bacteria 1478
788 Ga0496109_0454049 3300048912 Bacteria 1210
789 Ga0496110_0112071 3300048913 Bacteria 2452
790 Ga0496110_0127948 3300048913 Bacteria 2292
791 Ga0496111_0125268 3300048914 Bacteria 1899
792 Ga0496111_0196659 3300048914 Bacteria 1499
793 Ga0496112_0010931 3300048915 Bacteria 8264
794 Ga0496112_0118517 3300048915 Bacteria 2617
795 Ga0496112_0189733 3300048915 Bacteria 2017
796 Ga0496112_0285231 3300048915 Bacteria 1597
797 Ga0496112_0655315 3300048915 Bacteria 979
798 Ga0496112_1105701 3300048915 Bacteria 711
799 Ga0496113_0031029 3300048916 Bacteria 3874
800 Ga0496113_0047634 3300048916 Bacteria 3186
801 Ga0496113_0108554 3300048916 Bacteria 2157
802 Ga0496113_0457124 3300048916 Bacteria 1026
803 Ga0496113_0467667 3300048916 Bacteria 1013
804 Ga0496114_0029973 3300048917 Bacteria 4474
805 Ga0496114_0067981 3300048917 Bacteria 2990
806 Ga0496114_0086355 3300048917 Bacteria 2659
807 Ga0496114_0780164 3300048917 Bacteria 834
808 Ga0496115_0030017 3300048918 Bacteria 4274
809 Ga0496115_0295273 3300048918 Bacteria 1328
810 Ga0496115_0740187 3300048918 Bacteria 770
811 Ga0496116_0087144 3300048919 Bacteria 1912
812 Ga0496116_0287207 3300048919 Bacteria 792
813 Ga0496117_0019802 3300048920 Bacteria 5513
814 Ga0496117_0050066 3300048920 Bacteria 2965
815 Ga0496117_0105509 3300048920 Bacteria 1771
816 Ga0496117_0234664 3300048920 Bacteria 1011
817 Ga0496117_0266350 3300048920 Bacteria 926
818 Ga0496117_0306254 3300048920 Bacteria 839
819 Ga0496119_0011575 3300048922 Bacteria 7281
820 Ga0496119_0068346 3300048922 Bacteria 2092
821 Ga0496119_0080029 3300048922 Bacteria 1885
822 Ga0496120_0011179 3300048923 Bacteria 6195
823 Ga0496120_0036361 3300048923 Bacteria 2932
824 Ga0496121_0000077 3300048924 Bacteria 235293
825 Ga0496121_0035309 3300048924 Bacteria 4482
826 Ga0496121_0057403 3300048924 Bacteria 3227
827 Ga0496121_0097925 3300048924 Bacteria 2271
828 Ga0496121_0191974 3300048924 Bacteria 1463
829 Ga0496122_0261989 3300048925 Bacteria 959
830 Ga0496124_0006148 3300048927 Bacteria 13170
831 Ga0496124_0061614 3300048927 Bacteria 3144
832 Ga0496124_0123553 3300048927 Bacteria 2065
833 Ga0496124_0197513 3300048927 Bacteria 1533
834 Ga0496124_0298006 3300048927 Bacteria 1166
835 Ga0496125_0036626 3300048928 Bacteria 4279
836 Ga0496125_0054822 3300048928 Bacteria 3255
837 Ga0496125_0123585 3300048928 Bacteria 1840
838 Ga0496125_0151714 3300048928 Bacteria 1590
839 Ga0496126_0030696 3300048929 Bacteria 5088
840 Ga0496126_0050756 3300048929 Bacteria 3779
841 Ga0496126_0051484 3300048929 Bacteria 3748
842 Ga0496126_0117956 3300048929 Bacteria 2304
843 Ga0496126_0291410 3300048929 Bacteria 1349
844 Ga0501032_0517313 3300049569 Bacteria 762
845 Ga0501033_0036070 3300049570 Bacteria 3706
846 Ga0501034_0011050 3300049571 Bacteria 9376
847 Ga0501034_0316545 3300049571 Bacteria 1494
848 Ga0501036_0019092 3300049572 Bacteria 5753
849 Ga0501037_0047500 3300049573 Bacteria 3146
850 Ga0501038_0106772 3300049574 Bacteria 2323
851 Ga0501039_0227503 3300049575 Bacteria 1466
852 Ga0501039_0590222 3300049575 Bacteria 871
853 Ga0501043_0046534 3300049579 Bacteria 3411
854 Ga0501043_0470337 3300049579 Bacteria 942
855 Ga0501043_0671617 3300049579 Bacteria 759
856 Ga0501047_0009309 3300049581 Bacteria 9276
857 Ga0501047_0430987 3300049581 Bacteria 1149
858 Ga0501048_0096016 3300049582 Bacteria 2091
859 Ga0501067_0028816 3300049583 Bacteria 3078
860 Ga0501067_0055381 3300049583 Bacteria 2198
861 Ga0501069_0074327 3300049585 Bacteria 1907
862 Ga0501072_0007745 3300049588 Bacteria 8154
863 Ga0501080_0794965 3300049742 Bacteria 830
864 Ga0501083_0068093 3300049744 Bacteria 2369
865 Ga0501083_0089485 3300049744 Bacteria 2034
866 Ga0501083_0142831 3300049744 Bacteria 1567
867 Ga0501035_0047884 3300049822 Bacteria 3835
868 Ga0501035_0149430 3300049822 Bacteria 2028
869 Ga0501044_0083130 3300049823 Bacteria 3238
870 Ga0501044_0370651 3300049823 Bacteria 1348
871 nmdc:mga03683_10210_c2 3300050489 Bacteria 1759
872 nmdc:mga03683_147630_c1 3300050489 Bacteria 1060
873 nmdc:mga03683_205030_c1 3300050489 Bacteria 906
874 nmdc:mga03683_24601_c1 3300050489 Bacteria 2357
875 nmdc:mga03683_45101_c1 3300050489 Bacteria 1824
876 nmdc:mga03683_55649_c1 3300050489 Bacteria 1662
877 nmdc:mga03683_76077_c1 3300050489 Bacteria 1442
878 nmdc:mga03n38_28615_c1 3300050490 Bacteria 2325
879 nmdc:mga03n38_360865_c1 3300050490 Bacteria 792
880 nmdc:mga00v17_147044_c1 3300050491 Bacteria 1513
881 nmdc:mga00v17_165496_c1 3300050491 Bacteria 1425
882 nmdc:mga00v17_171065_c1 3300050491 Bacteria 1401
883 nmdc:mga00v17_223408_c1 3300050491 Bacteria 1220
884 nmdc:mga00v17_289368_c1 3300050491 Bacteria 1064
885 nmdc:mga00v17_382_c1 3300050491 Bacteria 25073
886 nmdc:mga00v17_450091_c1 3300050491 Bacteria 836
887 nmdc:mga0yw44_107801_c1 3300050492 Bacteria 1782
888 nmdc:mga0yw44_128690_c1 3300050492 Bacteria 1637
889 nmdc:mga0yw44_13081_c1 3300050492 Bacteria 4354
890 nmdc:mga0yw44_133499_c1 3300050492 Bacteria 1609
891 nmdc:mga0yw44_156254_c1 3300050492 Bacteria 1491
892 nmdc:mga0yw44_201211_c1 3300050492 Bacteria 1315
893 nmdc:mga0yw44_226092_c1 3300050492 Bacteria 1241
894 nmdc:mga0yw44_402985_c1 3300050492 Bacteria 925
895 nmdc:mga0yw44_455425_c1 3300050492 Bacteria 867
896 nmdc:mga0yw44_631947_c1 3300050492 Bacteria 728
897 nmdc:mga0yw44_75748_c1 3300050492 Bacteria 2099
898 nmdc:mga0yw44_85138_c1 3300050492 Bacteria 1989
899 nmdc:mga0k408_106791_c1 3300050493 Bacteria 1654
900 nmdc:mga0k408_132115_c1 3300050493 Bacteria 1482
901 nmdc:mga0k408_148275_c1 3300050493 Bacteria 1397
902 nmdc:mga0k408_151117_c1 3300050493 Bacteria 1383
903 nmdc:mga0k408_194317_c1 3300050493 Bacteria 1211
904 nmdc:mga0k408_252961_c1 3300050493 Bacteria 1052
905 nmdc:mga0k408_253828_c1 3300050493 Bacteria 1050
906 nmdc:mga0k408_43563_c1 3300050493 Bacteria 2586
907 nmdc:mga0k408_435983_c1 3300050493 Bacteria 779
908 nmdc:mga0k408_60180_c2 3300050493 Bacteria 1752
909 nmdc:mga0k408_6329_c1 3300050493 Bacteria 6318
910 nmdc:mga0k408_66551_c1 3300050493 Bacteria 2099
911 nmdc:mga0k408_92784_c1 3300050493 Bacteria 1775
912 nmdc:mga06z11_10788_c1 3300050494 Bacteria 3909
913 nmdc:mga06z11_14683_c1 3300050494 Bacteria 3477
914 nmdc:mga06z11_197373_c1 3300050494 Bacteria 1167
915 nmdc:mga06z11_221692_c1 3300050494 Bacteria 1105
916 nmdc:mga06z11_62309_c1 3300050494 Bacteria 1948
917 nmdc:mga06z11_94200_c1 3300050494 Bacteria 1632
918 nmdc:mga04h51_150696_c1 3300050495 Bacteria 889
919 nmdc:mga04h51_64585_c1 3300050495 Bacteria 1263
920 nmdc:mga04h51_9231_c1 3300050495 Bacteria 2210
921 nmdc:mga07m45_16139_c1 3300050496 Bacteria 3996
922 nmdc:mga07m45_16451_c1 3300050496 Bacteria 3960
923 nmdc:mga07m45_23084_c1 3300050496 Bacteria 3399
924 nmdc:mga07m45_262509_c1 3300050496 Bacteria 1005
925 nmdc:mga05p37_139821_c1 3300050507 Bacteria 2967
926 nmdc:mga05p37_840970_c1 3300050507 Bacteria 998
927 nmdc:mga06r32_442075_c1 3300050510 Bacteria 1280
928 nmdc:mga08y16_48697_c1 3300050511 Bacteria 4435
929 nmdc:mga08y16_508048_c1 3300050511 Bacteria 1224
930 nmdc:mga0n895_58986_c1 3300050512 Bacteria 3786
931 nmdc:mga0rr50_73302_c1 3300050513 Bacteria 2617
932 nmdc:mga0rr50_96907_c1 3300050513 Bacteria 2308
933 nmdc:mga0sz30_147496_c1 3300050516 Bacteria 1040
934 nmdc:mga0sz30_14861_c1 3300050516 Bacteria 2332
935 nmdc:mga0sz30_61268_c1 3300050516 Bacteria 1608
936 nmdc:mga0sz30_6501_c1 3300050516 Bacteria 1487
937 Ga0495601_0007238 3300053077 Bacteria 6509
938 Ga0495601_0313967 3300053077 Bacteria 1021
939 Ga0495612_0033835 3300053078 Bacteria 2068
940 Ga0495655_0117937 3300053083 Bacteria 805
941 Ga0495595_0000638 3300053084 Bacteria 13317
942 Ga0495619_0009871 3300053085 Bacteria 6017
943 Ga0495619_0078792 3300053085 Bacteria 2215
944 Ga0495619_0282095 3300053085 Bacteria 1151
945 Ga0500578_0168757 3300053086 Bacteria 1354
946 Ga0500643_000025 3300053087 Bacteria 259605
947 Ga0500646_0015878 3300053090 Bacteria 1963
948 Ga0500647_0016130 3300053091 Bacteria 3429
949 Ga0500647_0067394 3300053091 Bacteria 1721
950 Ga0500647_0091591 3300053091 Bacteria 1455
951 Ga0500583_0023251 3300053092 Bacteria 2609
952 Ga0500583_0202167 3300053092 Bacteria 987
953 Ga0500566_0001527 3300053094 Bacteria 13595
954 Ga0500566_0002901 3300053094 Bacteria 10225
955 Ga0500566_0029361 3300053094 Bacteria 3212
956 Ga0500566_0035605 3300053094 Bacteria 2892
957 Ga0500566_0040394 3300053094 Bacteria 2696
958 Ga0500640_000943 3300053095 Bacteria 8201
959 Ga0500641_0002405 3300053096 Bacteria 6638
960 Ga0500641_0017948 3300053096 Bacteria 2655
961 Ga0500641_0019320 3300053096 Bacteria 2575
962 Ga0500650_0030877 3300053098 Bacteria 2432
963 Ga0500650_0188397 3300053098 Bacteria 943
964 Ga0500555_004130 3300053103 Bacteria 4130
965 Ga0500556_0007468 3300053104 Bacteria 3127
966 Ga0500557_000001 3300053105 Bacteria 241298
967 Ga0500562_007409 3300053108 Bacteria 2767
968 Ga0500562_035216 3300053108 Bacteria 1326
969 Ga0500569_003720 3300053109 Bacteria 3146
970 Ga0500569_011892 3300053109 Bacteria 2091
971 Ga0500572_000012 3300053111 Bacteria 56206
972 Ga0500582_029976 3300053114 Bacteria 1653
973 Ga0500591_054228 3300053115 Bacteria 1870
974 Ga0500592_014648 3300053116 Bacteria 1257
975 Ga0500593_084161 3300053117 Bacteria 1357
976 Ga0500595_005116 3300053119 Bacteria 5755
977 Ga0500595_013076 3300053119 Bacteria 3187
978 Ga0500607_021112 3300053121 Bacteria 3671
979 Ga0500608_014338 3300053122 Bacteria 3536
980 Ga0500614_000718 3300053123 Bacteria 8478
981 Ga0500642_0000077 3300053130 Bacteria 53422
982 Ga0500642_0005483 3300053130 Bacteria 4096
983 Ga0500642_0012050 3300053130 Bacteria 3121
984 Ga0500642_0035098 3300053130 Bacteria 2126
985 Ga0500642_0111763 3300053130 Bacteria 1276
986 Ga0500652_103383 3300053131 Bacteria 1191
987 Ga0500652_103690 3300053131 Bacteria 1189
988 Ga0500655_012239 3300053133 Bacteria 1558
989 Ga0500658_0017657 3300053134 Bacteria 2667
990 Ga0500658_0100217 3300053134 Bacteria 1263
991 Ga0500658_0164783 3300053134 Bacteria 1005
992 Ga0500559_0006918 3300053136 Bacteria 5075
993 Ga0500559_0013588 3300053136 Bacteria 3446
994 Ga0500564_052566 3300053138 Bacteria 1861
995 Ga0500568_0045403 3300053139 Bacteria 1749
996 Ga0500573_0086678 3300053140 Bacteria 1773
997 Ga0500577_0015534 3300053142 Bacteria 2380
998 Ga0500589_052652 3300053147 Bacteria 1885
999 Ga0500589_061089 3300053147 Bacteria 1727
1000 Ga0500589_135538 3300053147 Bacteria 1022
1001 Ga0500590_060119 3300053148 Bacteria 1911
1002 Ga0500590_065456 3300053148 Bacteria 1817
1003 Ga0500590_068255 3300053148 Bacteria 1772
1004 Ga0500603_000044 3300053150 Bacteria 30278
1005 Ga0500603_004597 3300053150 Bacteria 2956
1006 Ga0500616_0083173 3300053153 Bacteria 1604
1007 Ga0500620_001768 3300053155 Bacteria 4115
1008 Ga0500622_0021327 3300053156 Bacteria 3439
1009 Ga0500622_0094635 3300053156 Bacteria 1478
1010 Ga0500622_0109746 3300053156 Bacteria 1349
1011 Ga0500627_0012394 3300053158 Bacteria 3194
1012 Ga0500627_0040336 3300053158 Bacteria 2003
1013 Ga0500627_0130939 3300053158 Bacteria 1133
1014 Ga0500630_004013 3300053159 Bacteria 7148
1015 Ga0500633_0066471 3300053160 Bacteria 1279
1016 Ga0500634_0086341 3300053161 Bacteria 1603
1017 Ga0500638_005628 3300053162 Bacteria 5021
1018 Ga0500638_022660 3300053162 Bacteria 2978
1019 Ga0500638_029075 3300053162 Bacteria 2658
1020 Ga0500638_048766 3300053162 Bacteria 2049
1021 Ga0500638_089310 3300053162 Bacteria 1453
1022 Ga0500638_178963 3300053162 Bacteria 917
1023 Ga0500639_000004 3300053163 Bacteria 216921
1024 Ga0500639_207576 3300053163 Bacteria 834
1025 Ga0500637_0003368 3300053178 Bacteria 7368
1026 Ga0500637_0190527 3300053178 Bacteria 1172
1027 Ga0500576_093321 3300053725 Bacteria 1245
1028 Ga0500657_015026 3300053728 Bacteria 3645
1029 Ga0500625_003211 3300053729 Bacteria 6395
1030 Ga0500645_063751 3300053730 Bacteria 1063
1031 Ga0500609_004080 3300053731 Bacteria 2032
1032 Ga0500596_000145 3300053735 Bacteria 10755
1033 Ga0500596_003796 3300053735 Bacteria 2833
1034 Ga0500599_002110 3300053736 Bacteria 2360
1035 Ga0500599_008015 3300053736 Bacteria 1366
1036 Ga0500601_000446 3300053737 Bacteria 6695
1037 Ga0500601_002164 3300053737 Bacteria 2111
1038 Ga0500661_000838 3300055283 Bacteria 5735
1039 Ga0500661_007306 3300055283 Bacteria 2048
1040 Ga0501082_0000327 3300060353 Bacteria 42286
1041 Ga0466962_0095439 3300061719 Bacteria 1426

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053158 Ga0500627_0012394 Ga0500627_0012394_1070_1717 188
2 3300005436 Ga0070713_100822162 Ga0070713_1008221622 195
3 3300005544 Ga0070686_100918697 Ga0070686_1009186971 195
4 3300006048 Ga0075363_100082056 Ga0075363_1000820562 195
5 3300006051 Ga0075364_10176103 Ga0075364_101761032 195
6 3300006177 Ga0075362_10107869 Ga0075362_101078692 195
7 3300006195 Ga0075366_10104305 Ga0075366_101043052 195
8 3300046678 Ga0495599_0273524 Ga0495599_0273524_376_1005 195
9 3300048918 Ga0496115_0740187 Ga0496115_0740187_108_719 195
10 3300035691 Ga0373931_0641833 Ga0373931_0641833_73_675 200
11 3300049744 Ga0501083_0089485 Ga0501083_0089485_942_1625 200
12 3300060353 Ga0501082_0000327 Ga0501082_0000327_33132_33815 200
13 3300031235 Ga0265330_10078568 Ga0265330_100785682 203
14 3300031250 Ga0265331_10200945 Ga0265331_102009451 203
15 3300031247 Ga0265340_10011504 Ga0265340_100115044 207
16 3300031344 Ga0265316_10049602 Ga0265316_100496022 207
17 3300031712 Ga0265342_10011923 Ga0265342_100119239 207
18 iso_pu_bacteria 2775506901 2776258812 210
19 3300049742 Ga0501080_0794965 Ga0501080_0794965_170_808 211
20 iso_pu_bacteria 2513237087 2513591757 211
21 iso_pu_bacteria 2773857925 2774870240 211
22 iso_pu_bacteria 2894232714 2894242363 211
23 iso_pu_bacteria 2643221588 2643950774 213
24 3300005356 Ga0070674_100279351 Ga0070674_1002793512 214
25 3300009148 Ga0105243_10301725 Ga0105243_103017252 214
26 3300009553 Ga0105249_10743862 Ga0105249_107438622 214
27 3300025901 Ga0207688_10079090 Ga0207688_100790902 214
28 3300025935 Ga0207709_10125286 Ga0207709_101252862 214
29 3300026075 Ga0207708_10301281 Ga0207708_103012812 214
30 iso_pu_bacteria 2513237101 2513691597 214
31 iso_pu_bacteria 2524023210 2524467635 214
32 iso_pu_bacteria 2524023228 2524539931 214
33 iso_pu_bacteria 2721755755 2723845976 214
34 iso_pu_bacteria 2791355199 2793079692 214
35 iso_pu_bacteria 2874604998 2874609362 214
36 iso_pu_bacteria 2874628541 2874636500 214
37 iso_pu_bacteria 2876808645 2876817110 214
38 iso_pu_bacteria 2879110137 2879110420 214
39 iso_pu_bacteria 2885383462 2885392538 214
40 iso_pu_bacteria 2889033259 2889040842 214
41 iso_pu_bacteria 2904690495 2904696632 214
42 iso_pu_bacteria 2904699407 2904701957 214
43 iso_pu_bacteria 2908756301 2908761253 214
44 iso_pu_bacteria 2922361189 2922367935 214
45 iso_pu_bacteria 2922386360 2922392178 214
46 iso_pu_bacteria 8006933436 8006941841 214
47 iso_pu_bacteria 8006973647 8006981589 214
48 iso_pu_bacteria 8006984368 8006990495 214
49 iso_pu_bacteria 8056673599 8056680622 214
50 3300003203 JGI25406J46586_10014356 JGI25406J46586_100143561 215
51 3300003659 JGI25404J52841_10006645 JGI25404J52841_100066452 215
52 3300005329 Ga0070683_100079587 Ga0070683_1000795872 215
53 3300005330 Ga0070690_100450707 Ga0070690_1004507071 215
54 3300005331 Ga0070670_100046591 Ga0070670_1000465913 215
55 3300005338 Ga0068868_100612619 Ga0068868_1006126192 215
56 3300005354 Ga0070675_100162118 Ga0070675_1001621182 215
57 3300005356 Ga0070674_100438268 Ga0070674_1004382681 215
58 3300005466 Ga0070685_10251561 Ga0070685_102515611 215
59 3300005535 Ga0070684_100234373 Ga0070684_1002343733 215
60 3300005615 Ga0070702_100375453 Ga0070702_1003754532 215
61 3300005618 Ga0068864_100107412 Ga0068864_1001074122 215
62 3300005937 Ga0081455_10008218 Ga0081455_1000821810 215
63 3300005983 Ga0081540_1001009 Ga0081540_100100920 215
64 3300005983 Ga0081540_1006403 Ga0081540_10064039 215
65 3300005983 Ga0081540_1021104 Ga0081540_10211045 215
66 3300005985 Ga0081539_10001416 Ga0081539_1000141621 215
67 3300005985 Ga0081539_10025700 Ga0081539_100257001 215
68 3300006038 Ga0075365_10087322 Ga0075365_100873224 215
69 3300006177 Ga0075362_10121203 Ga0075362_101212031 215
70 3300007076 Ga0075435_100460014 Ga0075435_1004600142 215
71 3300009094 Ga0111539_10010826 Ga0111539_100108265 215
72 3300009545 Ga0105237_10125043 Ga0105237_101250433 215
73 3300009551 Ga0105238_10035756 Ga0105238_100357563 215
74 3300013307 Ga0157372_10281861 Ga0157372_102818613 215
75 3300014326 Ga0157380_10545568 Ga0157380_105455682 215
76 3300017792 Ga0163161_10217268 Ga0163161_102172681 215
77 3300025914 Ga0207671_10108951 Ga0207671_101089512 215
78 3300025923 Ga0207681_10206176 Ga0207681_102061762 215
79 3300025924 Ga0207694_10168659 Ga0207694_101686592 215
80 3300025925 Ga0207650_10218404 Ga0207650_102184042 215
81 3300025926 Ga0207659_10163121 Ga0207659_101631212 215
82 3300025938 Ga0207704_10347613 Ga0207704_103476132 215
83 3300025944 Ga0207661_10090619 Ga0207661_100906192 215
84 3300025944 Ga0207661_10293056 Ga0207661_102930561 215
85 3300026095 Ga0207676_10229029 Ga0207676_102290292 215
86 3300027907 Ga0207428_10032809 Ga0207428_100328094 215
87 3300028577 Ga0265318_10127784 Ga0265318_101277842 215
88 3300031235 Ga0265330_10124858 Ga0265330_101248581 215
89 3300031249 Ga0265339_10051301 Ga0265339_100513012 215
90 3300031507 Ga0307509_10431683 Ga0307509_104316832 215
91 3300031824 Ga0307413_10037092 Ga0307413_100370922 215
92 3300031852 Ga0307410_10183059 Ga0307410_101830592 215
93 3300031901 Ga0307406_10356982 Ga0307406_103569822 215
94 3300031903 Ga0307407_10159405 Ga0307407_101594052 215
95 3300031995 Ga0307409_100051841 Ga0307409_1000518413 215
96 3300032004 Ga0307414_10384567 Ga0307414_103845672 215
97 3300032126 Ga0307415_100249852 Ga0307415_1002498522 215
98 3300035113 Ga0373936_0056906 Ga0373936_0056906_260_949 215
99 3300035113 Ga0373936_0108226 Ga0373936_0108226_144_818 215
100 3300035119 Ga0373956_0157187 Ga0373956_0157187_25_699 215
101 3300035692 Ga0373935_0106653 Ga0373935_0106653_384_1073 215
102 3300037068 Ga0373925_0715220 Ga0373925_0715220_57_800 215
103 3300039437 Ga0436365_0074464 Ga0436365_0074464_11901_12575 215
104 3300044901 Ga0466960_0202229 Ga0466960_0202229_382_1062 215
105 3300046455 Ga0495603_0017171 Ga0495603_0017171_588_1331 215
106 3300046517 Ga0495630_0140306 Ga0495630_0140306_539_1228 215
107 3300046535 Ga0495586_0127770 Ga0495586_0127770_359_1048 215
108 3300046642 Ga0495634_0046756 Ga0495634_0046756_1612_2301 215
109 3300046684 Ga0495669_0042880 Ga0495669_0042880_407_1150 215
110 3300047319 Ga0495674_0024647 Ga0495674_0024647_1527_2216 215
111 3300048903 Ga0496100_0023430 Ga0496100_0023430_2790_3473 215
112 3300049583 Ga0501067_0055381 Ga0501067_0055381_1085_1738 215
113 3300049588 Ga0501072_0007745 Ga0501072_0007745_682_1365 215
114 3300049744 Ga0501083_0068093 Ga0501083_0068093_140_823 215
115 3300049744 Ga0501083_0068093 Ga0501083_0068093_823_1491 215
116 3300050490 nmdc:mga03n38_360865_c1 nmdc:mga03n38_360865_c1_63_716 215
117 3300050492 nmdc:mga0yw44_402985_c1 nmdc:mga0yw44_402985_c1_14_667 215
118 3300050511 nmdc:mga08y16_48697_c1 nmdc:mga08y16_48697_c1_1551_2219 215
119 3300050513 nmdc:mga0rr50_96907_c1 nmdc:mga0rr50_96907_c1_1248_1901 215
120 3300053131 Ga0500652_103383 Ga0500652_103383_23_670 215
121 iso_pu_bacteria 2513237104 2513717679 215
122 3300003215 JGI25153J46596_10001560 JGI25153J46596_100015608 216
123 3300005330 Ga0070690_100004427 Ga0070690_1000044277 216
124 3300005343 Ga0070687_100016286 Ga0070687_1000162863 216
125 3300005617 Ga0068859_101326218 Ga0068859_1013262182 216
126 3300005842 Ga0068858_100216246 Ga0068858_1002162464 216
127 3300006038 Ga0075365_10332486 Ga0075365_103324862 216
128 3300006048 Ga0075363_100019979 Ga0075363_1000199792 216
129 3300006051 Ga0075364_10009112 Ga0075364_100091124 216
130 3300006051 Ga0075364_10019087 Ga0075364_100190872 216
131 3300006051 Ga0075364_10065710 Ga0075364_100657102 216
132 3300006177 Ga0075362_10153885 Ga0075362_101538852 216
133 3300006178 Ga0075367_10019651 Ga0075367_100196514 216
134 3300006186 Ga0075369_10014996 Ga0075369_100149963 216
135 3300006931 Ga0097620_101326648 Ga0097620_1013266481 216
136 3300013306 Ga0163162_11243508 Ga0163162_112435081 216
137 3300025297 Ga0209758_1000569 Ga0209758_100056912 216
138 3300025297 Ga0209758_1029333 Ga0209758_10293333 216
139 3300025918 Ga0207662_10009080 Ga0207662_100090803 216
140 3300025936 Ga0207670_10139288 Ga0207670_101392883 216
141 3300025960 Ga0207651_10601399 Ga0207651_106013991 216
142 3300026035 Ga0207703_10508839 Ga0207703_105088392 216
143 3300026088 Ga0207641_10958158 Ga0207641_109581581 216
144 3300031250 Ga0265331_10085132 Ga0265331_100851322 216
145 3300031344 Ga0265316_10367120 Ga0265316_103671202 216
146 3300035172 Ga0373955_0000411 Ga0373955_0000411_963_1637 216
147 3300035410 Ga0373924_0002005 Ga0373924_0002005_1306_1980 216
148 3300035695 Ga0373927_0045109 Ga0373927_0045109_1926_2600 216
149 3300035724 Ga0373933_0023096 Ga0373933_0023096_2720_3394 216
150 3300036401 Ga0373937_0004238 Ga0373937_0004238_6106_6780 216
151 3300037068 Ga0373925_0032076 Ga0373925_0032076_1389_2063 216
152 3300037466 Ga0395898_0136215 Ga0395898_0136215_966_1700 216
153 3300039437 Ga0436365_1241914 Ga0436365_1241914_339_1025 216
154 3300044658 Ga0466972_0125706 Ga0466972_0125706_148_804 216
155 3300044683 Ga0466965_0447459 Ga0466965_0447459_34_690 216
156 3300044735 Ga0466968_0008843 Ga0466968_0008843_1861_2517 216
157 3300044901 Ga0466960_0003192 Ga0466960_0003192_4529_5185 216
158 3300045051 Ga0451576_0158291 Ga0451576_0158291_97_774 216
159 3300046459 Ga0495629_0001885 Ga0495629_0001885_11105_11779 216
160 3300046462 Ga0495651_0035747 Ga0495651_0035747_63_737 216
161 3300046463 Ga0495653_0000879 Ga0495653_0000879_16355_17029 216
162 3300046477 Ga0495664_0008104 Ga0495664_0008104_3937_4611 216
163 3300046511 Ga0495608_0003840 Ga0495608_0003840_659_1333 216
164 3300046514 Ga0495618_0006601 Ga0495618_0006601_4685_5359 216
165 3300046516 Ga0495628_0117976 Ga0495628_0117976_468_1142 216
166 3300046529 Ga0495652_0002357 Ga0495652_0002357_8316_8990 216
167 3300046533 Ga0495640_0007880 Ga0495640_0007880_6592_7266 216
168 3300046535 Ga0495586_0306647 Ga0495586_0306647_54_740 216
169 3300046536 Ga0495587_0117888 Ga0495587_0117888_253_927 216
170 3300046543 Ga0495645_0048088 Ga0495645_0048088_1225_1899 216
171 3300046559 Ga0495667_0006955 Ga0495667_0006955_5089_5763 216
172 3300046642 Ga0495634_0018119 Ga0495634_0018119_1807_2481 216
173 3300046663 Ga0495635_0001944 Ga0495635_0001944_2183_2857 216
174 3300046678 Ga0495599_0002950 Ga0495599_0002950_5250_5924 216
175 3300046689 Ga0495613_0459727 Ga0495613_0459727_156_830 216
176 3300046809 Ga0495600_0003365 Ga0495600_0003365_5180_5854 216
177 3300047317 Ga0495604_0000457 Ga0495604_0000457_25074_25748 216
178 3300047319 Ga0495674_0007544 Ga0495674_0007544_3208_3882 216
179 3300047322 Ga0495680_0000217 Ga0495680_0000217_30754_31428 216
180 3300047471 Ga0495684_0002844 Ga0495684_0002844_10636_11310 216
181 3300048088 Ga0495602_0002288 Ga0495602_0002288_12314_12988 216
182 3300049744 Ga0501083_0142831 Ga0501083_0142831_403_1092 216
183 3300050489 nmdc:mga03683_10210_c2 nmdc:mga03683_10210_c2_520_1188 216
184 3300050489 nmdc:mga03683_205030_c1 nmdc:mga03683_205030_c1_18_695 216
185 3300050489 nmdc:mga03683_45101_c1 nmdc:mga03683_45101_c1_843_1520 216
186 3300050490 nmdc:mga03n38_28615_c1 nmdc:mga03n38_28615_c1_1227_1904 216
187 3300050491 nmdc:mga00v17_223408_c1 nmdc:mga00v17_223408_c1_47_724 216
188 3300050491 nmdc:mga00v17_382_c1 nmdc:mga00v17_382_c1_22387_23055 216
189 3300050491 nmdc:mga00v17_450091_c1 nmdc:mga00v17_450091_c1_71_748 216
190 3300050492 nmdc:mga0yw44_128690_c1 nmdc:mga0yw44_128690_c1_546_1223 216
191 3300050492 nmdc:mga0yw44_226092_c1 nmdc:mga0yw44_226092_c1_56_730 216
192 3300050493 nmdc:mga0k408_132115_c1 nmdc:mga0k408_132115_c1_737_1414 216
193 3300050493 nmdc:mga0k408_151117_c1 nmdc:mga0k408_151117_c1_679_1356 216
194 3300050493 nmdc:mga0k408_435983_c1 nmdc:mga0k408_435983_c1_82_759 216
195 3300050493 nmdc:mga0k408_6329_c1 nmdc:mga0k408_6329_c1_2531_3205 216
196 3300050493 nmdc:mga0k408_66551_c1 nmdc:mga0k408_66551_c1_672_1349 216
197 3300050494 nmdc:mga06z11_14683_c1 nmdc:mga06z11_14683_c1_1164_1841 216
198 3300050494 nmdc:mga06z11_94200_c1 nmdc:mga06z11_94200_c1_820_1497 216
199 3300050495 nmdc:mga04h51_9231_c1 nmdc:mga04h51_9231_c1_1365_2042 216
200 3300050496 nmdc:mga07m45_16451_c1 nmdc:mga07m45_16451_c1_210_887 216
201 3300050507 nmdc:mga05p37_840970_c1 nmdc:mga05p37_840970_c1_218_868 216
202 3300050516 nmdc:mga0sz30_6501_c1 nmdc:mga0sz30_6501_c1_373_1041 216
203 3300053077 Ga0495601_0007238 Ga0495601_0007238_1491_2165 216
204 3300053078 Ga0495612_0033835 Ga0495612_0033835_436_1110 216
205 3300053084 Ga0495595_0000638 Ga0495595_0000638_7357_8031 216
206 3300053085 Ga0495619_0009871 Ga0495619_0009871_5090_5764 216
207 3300053096 Ga0500641_0002405 Ga0500641_0002405_1195_1872 216
208 3300053098 Ga0500650_0188397 Ga0500650_0188397_66_752 216
209 3300053108 Ga0500562_035216 Ga0500562_035216_384_1061 216
210 3300053117 Ga0500593_084161 Ga0500593_084161_665_1333 216
211 3300053130 Ga0500642_0005483 Ga0500642_0005483_267_953 216
212 3300053131 Ga0500652_103690 Ga0500652_103690_277_963 216
213 3300053139 Ga0500568_0045403 Ga0500568_0045403_744_1412 216
214 3300053142 Ga0500577_0015534 Ga0500577_0015534_1596_2282 216
215 3300053158 Ga0500627_0130939 Ga0500627_0130939_434_1084 216
216 iso_pu_bacteria 2507262055 2507509588 216
217 iso_pu_bacteria 2508501009 2508543630 216
218 iso_pu_bacteria 2508501042 2508698579 216
219 iso_pu_bacteria 2511231028 2511400425 216
220 iso_pu_bacteria 2513237092 2513624595 216
221 iso_pu_bacteria 2513237094 2513638144 216
222 iso_pu_bacteria 2513237095 2513646397 216
223 iso_pu_bacteria 2513237102 2513700952 216
224 iso_pu_bacteria 2513237139 2513879419 216
225 iso_pu_bacteria 2513237161 2514016724 216
226 iso_pu_bacteria 2515154112 2515629060 216
227 iso_pu_bacteria 2517093001 2517103677 216
228 iso_pu_bacteria 2524023205 2524439657 216
229 iso_pu_bacteria 2528768022 2528853375 216
230 iso_pu_bacteria 2617270735 2617349094 216
231 iso_pu_bacteria 2617270741 2617376697 216
232 iso_pu_bacteria 2744054633 2745082112 216
233 iso_pu_bacteria 2791355196 2793060424 216
234 iso_pu_bacteria 2802429603 2805920317 216
235 iso_pu_bacteria 2816332527 2818240411 216
236 iso_pu_bacteria 2824600985 2824608979 216
237 iso_pu_bacteria 2824609381 2824610268 216
238 iso_pu_bacteria 2824617872 2824624358 216
239 iso_pu_bacteria 2824626560 2824630872 216
240 iso_pu_bacteria 2824635225 2824643300 216
241 iso_pu_bacteria 2824644064 2824651704 216
242 iso_pu_bacteria 2824653114 2824661251 216
243 iso_pu_bacteria 2824661429 2824666923 216
244 iso_pu_bacteria 2824671348 2824679436 216
245 iso_pu_bacteria 2824679649 2824686426 216
246 iso_pu_bacteria 2824687955 2824696046 216
247 iso_pu_bacteria 2824696289 2824703684 216
248 iso_pu_bacteria 2824704595 2824712155 216
249 iso_pu_bacteria 2824714736 2824721816 216
250 iso_pu_bacteria 2824723954 2824731691 216
251 iso_pu_bacteria 2824732956 2824740050 216
252 iso_pu_bacteria 2824746037 2824753765 216
253 iso_pu_bacteria 2824753945 2824759597 216
254 iso_pu_bacteria 2824763712 2824766724 216
255 iso_pu_bacteria 2824773399 2824773840 216
256 iso_pu_bacteria 2838122688 2838128737 216
257 iso_pu_bacteria 2841941048 2841948461 216
258 iso_pu_bacteria 2841949485 2841956424 216
259 iso_pu_bacteria 2841957949 2841962385 216
260 iso_pu_bacteria 2841966195 2841967197 216
261 iso_pu_bacteria 2841974524 2841979403 216
262 iso_pu_bacteria 2841983080 2841989882 216
263 iso_pu_bacteria 2842038055 2842039990 216
264 iso_pu_bacteria 2842045827 2842047065 216
265 iso_pu_bacteria 2844315083 2844318162 216
266 iso_pu_bacteria 2847930680 2847935034 216
267 iso_pu_bacteria 2847939898 2847945591 216
268 iso_pu_bacteria 2849076700 2849080250 216
269 iso_pu_bacteria 2857509624 2857510386 216
270 iso_pu_bacteria 2874590934 2874595299 216
271 iso_pu_bacteria 2874612657 2874613260 216
272 iso_pu_bacteria 2874620515 2874626928 216
273 iso_pu_bacteria 2874645413 2874651138 216
274 iso_pu_bacteria 2876761206 2876761257 216
275 iso_pu_bacteria 2876771140 2876775235 216
276 iso_pu_bacteria 2876818435 2876824050 216
277 iso_pu_bacteria 2879074833 2879080678 216
278 iso_pu_bacteria 2879083081 2879086428 216
279 iso_pu_bacteria 2879099564 2879109481 216
280 iso_pu_bacteria 2879127579 2879134738 216
281 iso_pu_bacteria 2879142872 2879144198 216
282 iso_pu_bacteria 2881364244 2881366483 216
283 iso_pu_bacteria 2881665667 2881673036 216
284 iso_pu_bacteria 2885366525 2885373472 216
285 iso_pu_bacteria 2888378607 2888383007 216
286 iso_pu_bacteria 2888388044 2888394823 216
287 iso_pu_bacteria 2888419890 2888423470 216
288 iso_pu_bacteria 2903727486 2903734135 216
289 iso_pu_bacteria 2904666416 2904669629 216
290 iso_pu_bacteria 2904711408 2904716897 216
291 iso_pu_bacteria 2906602504 2906608420 216
292 iso_pu_bacteria 2906626472 2906628118 216
293 iso_pu_bacteria 2906643746 2906652418 216
294 iso_pu_bacteria 2908775508 2908779198 216
295 iso_pu_bacteria 2922368715 2922373185 216
296 iso_pu_bacteria 2922393267 2922395398 216
297 iso_pu_bacteria 2929615660 2929615760 216
298 iso_pu_bacteria 2929624759 2929630374 216
299 iso_pu_bacteria 2932784394 2932792019 216
300 iso_pu_bacteria 2932794094 2932796267 216
301 iso_pu_bacteria 2932801729 2932804428 216
302 iso_pu_bacteria 2932809354 2932814114 216
303 iso_pu_bacteria 2932818245 2932819398 216
304 iso_pu_bacteria 2932828146 2932833891 216
305 iso_pu_bacteria 2933577622 2933578953 216
306 iso_pu_bacteria 2935608549 2935611536 216
307 iso_pu_bacteria 2935616580 2935618577 216
308 iso_pu_bacteria 2935638405 2935644580 216
309 iso_pu_bacteria 2935648319 2935648907 216
310 iso_pu_bacteria 2935656913 2935657011 216
311 iso_pu_bacteria 2935665750 2935673529 216
312 iso_pu_bacteria 2935675223 2935678416 216
313 iso_pu_bacteria 2935684952 2935688155 216
314 iso_pu_bacteria 2935694250 2935698821 216
315 iso_pu_bacteria 2935703347 2935708435 216
316 iso_pu_bacteria 2935713505 2935715174 216
317 iso_pu_bacteria 2935722832 2935726261 216
318 iso_pu_bacteria 2935732158 2935733993 216
319 iso_pu_bacteria 2935741537 2935743372 216
320 iso_pu_bacteria 2935750917 2935754590 216
321 iso_pu_bacteria 2935760218 2935765369 216
322 iso_pu_bacteria 2935769743 2935777032 216
323 iso_pu_bacteria 2935777560 2935784106 216
324 iso_pu_bacteria 2935785616 2935790361 216
325 iso_pu_bacteria 2935793552 2935798944 216
326 iso_pu_bacteria 2935801545 2935805320 216
327 iso_pu_bacteria 2935810662 2935816618 216
328 iso_pu_bacteria 2935819856 2935821013 216
329 iso_pu_bacteria 2935827899 2935833671 216
330 iso_pu_bacteria 2935837841 2935839643 216
331 iso_pu_bacteria 2935847175 2935850727 216
332 iso_pu_bacteria 2935855204 2935856942 216
333 iso_pu_bacteria 2935864058 2935871228 216
334 iso_pu_bacteria 2935873716 2935876267 216
335 iso_pu_bacteria 2935883170 2935888839 216
336 iso_pu_bacteria 2935908558 2935913904 216
337 iso_pu_bacteria 2935916978 2935920106 216
338 iso_pu_bacteria 2935926038 2935930445 216
339 iso_pu_bacteria 2935934488 2935939582 216
340 iso_pu_bacteria 2935942939 2935946531 216
341 iso_pu_bacteria 2935951376 2935955630 216
342 iso_pu_bacteria 2935959822 2935964558 216
343 iso_pu_bacteria 2935967501 2935972660 216
344 iso_pu_bacteria 2935975950 2935981515 216
345 iso_pu_bacteria 2935984226 2935989088 216
346 iso_pu_bacteria 2935992306 2935997770 216
347 iso_pu_bacteria 2936002035 2936007281 216
348 iso_pu_bacteria 2936011229 2936011817 216
349 iso_pu_bacteria 2936019824 2936020412 216
350 iso_pu_bacteria 2936028420 2936029106 216
351 iso_pu_bacteria 2936037263 2936043120 216
352 iso_pu_bacteria 2936046547 2936047135 216
353 iso_pu_bacteria 2936055302 2936061365 216
354 iso_pu_bacteria 2940556831 2940560033 216
355 iso_pu_bacteria 2941531003 2941533911 216
356 iso_pu_bacteria 2941538514 2941540332 216
357 iso_pu_bacteria 3005483717 3005490002 216
358 iso_pu_bacteria 3005506211 3005511656 216
359 iso_pu_bacteria 3005587118 3005590307 216
360 iso_pu_bacteria 3005594810 3005598214 216
361 iso_pu_bacteria 3005710791 3005713931 216
362 iso_pu_bacteria 3005718088 3005721393 216
363 iso_pu_bacteria 8016511872 8016514538 216
364 iso_pu_bacteria 8016522445 8016530622 216
365 iso_pu_bacteria 8016530956 8016535903 216
366 iso_pu_bacteria 8016539877 8016540185 216
367 iso_pu_bacteria 8016548790 8016553050 216
368 iso_pu_bacteria 8016566248 8016574252 216
369 iso_pu_bacteria 8016575299 8016578351 216
370 iso_pu_bacteria 8016583857 8016591493 216
371 iso_pu_bacteria 8016595262 8016599278 216
372 iso_pu_bacteria 8016603502 8016611764 216
373 iso_pu_bacteria 8016613128 8016622038 216
374 iso_pu_bacteria 8016622563 8016627817 216
375 iso_pu_bacteria 8016630954 8016632131 216
376 iso_pu_bacteria 8017057580 8017061888 216
377 iso_pu_bacteria 8019530166 8019535630 216
378 iso_pu_bacteria 8019538911 8019543851 216
379 iso_pu_bacteria 8019547302 8019554926 216
380 iso_pu_bacteria 8019576017 8019581422 216
381 iso_pu_bacteria 8019586578 8019589050 216
382 iso_pu_bacteria 8019597564 8019602184 216
383 iso_pu_bacteria 8019629233 8019635495 216
384 iso_pu_bacteria 8019638758 8019644209 216
385 iso_pu_bacteria 8019648815 8019657261 216
386 iso_pu_bacteria 8019659431 8019663304 216
387 iso_pu_bacteria 8019668869 8019672922 216
388 iso_pu_bacteria 8019678201 8019683221 216
389 iso_pu_bacteria 8019687851 8019688925 216
390 iso_pu_bacteria 8055742211 8055747408 216
391 iso_pu_bacteria 8056967851 8056972518 216
392 3300005338 Ga0068868_100064444 Ga0068868_1000644443 217
393 3300005344 Ga0070661_100054794 Ga0070661_1000547943 217
394 3300005435 Ga0070714_100014004 Ga0070714_1000140043 217
395 3300005455 Ga0070663_100014194 Ga0070663_1000141944 217
396 3300005456 Ga0070678_100186943 Ga0070678_1001869432 217
397 3300005471 Ga0070698_100686212 Ga0070698_1006862122 217
398 3300005535 Ga0070684_100169988 Ga0070684_1001699884 217
399 3300005564 Ga0070664_100037767 Ga0070664_1000377673 217
400 3300005578 Ga0068854_100026693 Ga0068854_1000266936 217
401 3300005578 Ga0068854_100405048 Ga0068854_1004050482 217
402 3300005614 Ga0068856_100003013 Ga0068856_10000301316 217
403 3300005614 Ga0068856_100229067 Ga0068856_1002290672 217
404 3300005616 Ga0068852_100159514 Ga0068852_1001595142 217
405 3300005618 Ga0068864_100023148 Ga0068864_1000231486 217
406 3300005840 Ga0068870_10094649 Ga0068870_100946492 217
407 3300005985 Ga0081539_10153426 Ga0081539_101534262 217
408 3300006237 Ga0097621_100175580 Ga0097621_1001755802 217
409 3300006942 Ga0099824_1006697 Ga0099824_100669717 217
410 3300007076 Ga0075435_100017984 Ga0075435_1000179843 217
411 3300007265 Ga0099794_10046548 Ga0099794_100465483 217
412 3300007788 Ga0099795_10010942 Ga0099795_100109424 217
413 3300009101 Ga0105247_10247390 Ga0105247_102473902 217
414 3300009101 Ga0105247_10266257 Ga0105247_102662572 217
415 3300010375 Ga0105239_10177285 Ga0105239_101772852 217
416 3300011119 Ga0105246_10300738 Ga0105246_103007382 217
417 3300013296 Ga0157374_10010340 Ga0157374_100103406 217
418 3300013297 Ga0157378_10196236 Ga0157378_101962363 217
419 3300013306 Ga0163162_10015299 Ga0163162_100152996 217
420 3300013308 Ga0157375_10025490 Ga0157375_100254905 217
421 3300014325 Ga0163163_10020877 Ga0163163_100208772 217
422 3300014969 Ga0157376_10002196 Ga0157376_100021967 217
423 3300021358 Ga0213873_10004067 Ga0213873_100040673 217
424 3300021384 Ga0213876_10002558 Ga0213876_100025588 217
425 3300025900 Ga0207710_10044680 Ga0207710_100446802 217
426 3300025908 Ga0207643_10085357 Ga0207643_100853573 217
427 3300025909 Ga0207705_10407268 Ga0207705_104072681 217
428 3300025919 Ga0207657_10475408 Ga0207657_104754082 217
429 3300025920 Ga0207649_10040728 Ga0207649_100407283 217
430 3300025929 Ga0207664_10106019 Ga0207664_101060194 217
431 3300025931 Ga0207644_10231862 Ga0207644_102318622 217
432 3300025941 Ga0207711_10665094 Ga0207711_106650942 217
433 3300025945 Ga0207679_10157649 Ga0207679_101576492 217
434 3300025981 Ga0207640_10361311 Ga0207640_103613112 217
435 3300026067 Ga0207678_10025740 Ga0207678_100257404 217
436 3300026078 Ga0207702_10000365 Ga0207702_1000036527 217
437 3300026088 Ga0207641_10232456 Ga0207641_102324561 217
438 3300026095 Ga0207676_10071416 Ga0207676_100714164 217
439 3300026121 Ga0207683_10044978 Ga0207683_100449781 217
440 3300027671 Ga0209588_1033615 Ga0209588_10336151 217
441 3300031616 Ga0307508_10292536 Ga0307508_102925361 217
442 3300035724 Ga0373933_0000276 Ga0373933_0000276_11854_12513 217
443 3300039437 Ga0436365_0871323 Ga0436365_0871323_40806_41462 217
444 3300041505 Ga0451849_1570337 Ga0451849_1570337_108_761 217
445 3300041512 Ga0451853_1014670 Ga0451853_1014670_156_809 217
446 3300046476 Ga0495662_0197053 Ga0495662_0197053_42_695 217
447 3300046507 Ga0495606_0276886 Ga0495606_0276886_107_760 217
448 3300047321 Ga0495676_0552137 Ga0495676_0552137_64_717 217
449 3300048903 Ga0496100_0051487 Ga0496100_0051487_1320_1973 217
450 3300048904 Ga0496101_0044574 Ga0496101_0044574_887_1540 217
451 3300048905 Ga0496102_0001372 Ga0496102_0001372_2259_2912 217
452 3300048906 Ga0496103_0021125 Ga0496103_0021125_2618_3271 217
453 3300048907 Ga0496104_0083890 Ga0496104_0083890_807_1460 217
454 3300048908 Ga0496105_0143125 Ga0496105_0143125_1062_1715 217
455 3300048909 Ga0496106_0006324 Ga0496106_0006324_4625_5278 217
456 3300048909 Ga0496106_0731540 Ga0496106_0731540_64_720 217
457 3300048910 Ga0496107_0006521 Ga0496107_0006521_2733_3386 217
458 3300048911 Ga0496108_0006613 Ga0496108_0006613_677_1330 217
459 3300048912 Ga0496109_0002448 Ga0496109_0002448_8431_9084 217
460 3300048913 Ga0496110_0112071 Ga0496110_0112071_880_1533 217
461 3300048915 Ga0496112_0010931 Ga0496112_0010931_3464_4120 217
462 3300048915 Ga0496112_0285231 Ga0496112_0285231_38_691 217
463 3300048915 Ga0496112_1105701 Ga0496112_1105701_26_685 217
464 3300048916 Ga0496113_0031029 Ga0496113_0031029_198_851 217
465 3300048917 Ga0496114_0067981 Ga0496114_0067981_1304_1957 217
466 3300049569 Ga0501032_0517313 Ga0501032_0517313_17_673 217
467 3300049570 Ga0501033_0036070 Ga0501033_0036070_2075_2731 217
468 3300049571 Ga0501034_0011050 Ga0501034_0011050_6120_6776 217
469 3300049571 Ga0501034_0316545 Ga0501034_0316545_239_895 217
470 3300049572 Ga0501036_0019092 Ga0501036_0019092_2567_3223 217
471 3300049573 Ga0501037_0047500 Ga0501037_0047500_2003_2659 217
472 3300049574 Ga0501038_0106772 Ga0501038_0106772_171_827 217
473 3300049575 Ga0501039_0227503 Ga0501039_0227503_78_734 217
474 3300049575 Ga0501039_0590222 Ga0501039_0590222_202_858 217
475 3300049579 Ga0501043_0046534 Ga0501043_0046534_165_821 217
476 3300049579 Ga0501043_0470337 Ga0501043_0470337_137_793 217
477 3300049579 Ga0501043_0671617 Ga0501043_0671617_49_705 217
478 3300049581 Ga0501047_0009309 Ga0501047_0009309_7980_8636 217
479 3300049581 Ga0501047_0430987 Ga0501047_0430987_154_810 217
480 3300049582 Ga0501048_0096016 Ga0501048_0096016_1217_1873 217
481 3300049822 Ga0501035_0047884 Ga0501035_0047884_2434_3090 217
482 3300049822 Ga0501035_0149430 Ga0501035_0149430_1315_1971 217
483 3300049823 Ga0501044_0083130 Ga0501044_0083130_2345_3001 217
484 3300049823 Ga0501044_0370651 Ga0501044_0370651_194_850 217
485 3300050512 nmdc:mga0n895_58986_c1 nmdc:mga0n895_58986_c1_15_668 217
486 3300053085 Ga0495619_0282095 Ga0495619_0282095_258_1016 217
487 3300053091 Ga0500647_0091591 Ga0500647_0091591_730_1386 217
488 3300053094 Ga0500566_0001527 Ga0500566_0001527_12402_13058 217
489 3300053095 Ga0500640_000943 Ga0500640_000943_4322_4978 217
490 3300053111 Ga0500572_000012 Ga0500572_000012_38088_38744 217
491 3300053115 Ga0500591_054228 Ga0500591_054228_676_1332 217
492 3300053122 Ga0500608_014338 Ga0500608_014338_2407_3063 217
493 3300053123 Ga0500614_000718 Ga0500614_000718_4062_4718 217
494 3300053136 Ga0500559_0006918 Ga0500559_0006918_1927_2583 217
495 3300053148 Ga0500590_060119 Ga0500590_060119_389_1045 217
496 3300053150 Ga0500603_000044 Ga0500603_000044_28439_29095 217
497 3300053159 Ga0500630_004013 Ga0500630_004013_1807_2463 217
498 3300053162 Ga0500638_048766 Ga0500638_048766_986_1642 217
499 3300053163 Ga0500639_000004 Ga0500639_000004_80587_81243 217
500 3300053725 Ga0500576_093321 Ga0500576_093321_233_889 217
501 3300053735 Ga0500596_000145 Ga0500596_000145_2945_3601 217
502 3300053737 Ga0500601_002164 Ga0500601_002164_641_1297 217
503 3300002070 JGI24750J21931_1016458 JGI24750J21931_10164582 218
504 3300003215 JGI25153J46596_10026655 JGI25153J46596_100266552 218
505 3300003323 rootH1_10253088 rootH1_102530884 218
506 3300003354 JGI25160J50197_1000471 JGI25160J50197_100047116 218
507 3300003354 JGI25160J50197_1003264 JGI25160J50197_10032649 218
508 3300003354 JGI25160J50197_1054240 JGI25160J50197_10542401 218
509 3300003759 Ga0055525_1007176 Ga0055525_10071761 218
510 3300003771 Ga0055526_1029520 Ga0055526_10295201 218
511 3300003794 Ga0055531_10023384 Ga0055531_100233842 218
512 3300004625 Ga0055543_1004797 Ga0055543_10047974 218
513 3300005262 Ga0065165_1000676 Ga0065165_100067616 218
514 3300005262 Ga0065165_1001028 Ga0065165_100102815 218
515 3300005262 Ga0065165_1004302 Ga0065165_100430211 218
516 3300005262 Ga0065165_1014933 Ga0065165_10149332 218
517 3300005328 Ga0070676_10389457 Ga0070676_103894571 218
518 3300005331 Ga0070670_100086065 Ga0070670_1000860652 218
519 3300005334 Ga0068869_100341008 Ga0068869_1003410082 218
520 3300005336 Ga0070680_100096083 Ga0070680_1000960831 218
521 3300005337 Ga0070682_100056399 Ga0070682_1000563993 218
522 3300005337 Ga0070682_100158735 Ga0070682_1001587352 218
523 3300005338 Ga0068868_100263019 Ga0068868_1002630192 218
524 3300005338 Ga0068868_101133988 Ga0068868_1011339881 218
525 3300005339 Ga0070660_100593344 Ga0070660_1005933441 218
526 3300005340 Ga0070689_100203772 Ga0070689_1002037722 218
527 3300005344 Ga0070661_100323028 Ga0070661_1003230281 218
528 3300005344 Ga0070661_100323533 Ga0070661_1003235331 218
529 3300005347 Ga0070668_100026677 Ga0070668_1000266772 218
530 3300005347 Ga0070668_100055646 Ga0070668_1000556464 218
531 3300005347 Ga0070668_100317109 Ga0070668_1003171091 218
532 3300005347 Ga0070668_100366112 Ga0070668_1003661121 218
533 3300005347 Ga0070668_100387535 Ga0070668_1003875351 218
534 3300005347 Ga0070668_100527265 Ga0070668_1005272651 218
535 3300005347 Ga0070668_100981033 Ga0070668_1009810331 218
536 3300005353 Ga0070669_100445269 Ga0070669_1004452692 218
537 3300005355 Ga0070671_100004070 Ga0070671_10000407011 218
538 3300005356 Ga0070674_100228264 Ga0070674_1002282641 218
539 3300005364 Ga0070673_100063368 Ga0070673_1000633683 218
540 3300005364 Ga0070673_100626823 Ga0070673_1006268232 218
541 3300005366 Ga0070659_100238690 Ga0070659_1002386901 218
542 3300005367 Ga0070667_100278053 Ga0070667_1002780531 218
543 3300005367 Ga0070667_100710206 Ga0070667_1007102061 218
544 3300005367 Ga0070667_100778232 Ga0070667_1007782321 218
545 3300005367 Ga0070667_101069845 Ga0070667_1010698451 218
546 3300005434 Ga0070709_10021834 Ga0070709_100218345 218
547 3300005435 Ga0070714_100029874 Ga0070714_1000298742 218
548 3300005435 Ga0070714_100126094 Ga0070714_1001260944 218
549 3300005435 Ga0070714_100200117 Ga0070714_1002001172 218
550 3300005436 Ga0070713_100012520 Ga0070713_1000125206 218
551 3300005436 Ga0070713_100034225 Ga0070713_1000342252 218
552 3300005437 Ga0070710_10061446 Ga0070710_100614462 218
553 3300005437 Ga0070710_10248827 Ga0070710_102488271 218
554 3300005438 Ga0070701_10273477 Ga0070701_102734772 218
555 3300005439 Ga0070711_100004721 Ga0070711_1000047219 218
556 3300005455 Ga0070663_100088773 Ga0070663_1000887734 218
557 3300005455 Ga0070663_100257800 Ga0070663_1002578001 218
558 3300005456 Ga0070678_100400338 Ga0070678_1004003382 218
559 3300005457 Ga0070662_100042888 Ga0070662_1000428884 218
560 3300005457 Ga0070662_100239802 Ga0070662_1002398021 218
561 3300005458 Ga0070681_10013643 Ga0070681_100136434 218
562 3300005458 Ga0070681_10348649 Ga0070681_103486492 218
563 3300005458 Ga0070681_10468245 Ga0070681_104682451 218
564 3300005471 Ga0070698_100588742 Ga0070698_1005887421 218
565 3300005518 Ga0070699_100238133 Ga0070699_1002381332 218
566 3300005530 Ga0070679_100114708 Ga0070679_1001147081 218
567 3300005539 Ga0068853_100067816 Ga0068853_1000678164 218
568 3300005539 Ga0068853_100077357 Ga0068853_1000773571 218
569 3300005539 Ga0068853_100145365 Ga0068853_1001453652 218
570 3300005539 Ga0068853_100433344 Ga0068853_1004333442 218
571 3300005543 Ga0070672_100193562 Ga0070672_1001935621 218
572 3300005543 Ga0070672_100418258 Ga0070672_1004182581 218
573 3300005543 Ga0070672_100560683 Ga0070672_1005606832 218
574 3300005547 Ga0070693_100058244 Ga0070693_1000582442 218
575 3300005548 Ga0070665_100005911 Ga0070665_10000591112 218
576 3300005548 Ga0070665_100050816 Ga0070665_1000508165 218
577 3300005548 Ga0070665_100195652 Ga0070665_1001956524 218
578 3300005548 Ga0070665_100654806 Ga0070665_1006548062 218
579 3300005548 Ga0070665_100858703 Ga0070665_1008587032 218
580 3300005563 Ga0068855_100044859 Ga0068855_1000448594 218
581 3300005563 Ga0068855_100309579 Ga0068855_1003095793 218
582 3300005564 Ga0070664_100323222 Ga0070664_1003232221 218
583 3300005577 Ga0068857_100359990 Ga0068857_1003599901 218
584 3300005614 Ga0068856_100056762 Ga0068856_1000567622 218
585 3300005614 Ga0068856_100256524 Ga0068856_1002565243 218
586 3300005615 Ga0070702_100032923 Ga0070702_1000329233 218
587 3300005616 Ga0068852_100037597 Ga0068852_1000375974 218
588 3300005616 Ga0068852_100616225 Ga0068852_1006162252 218
589 3300005616 Ga0068852_100792333 Ga0068852_1007923331 218
590 3300005617 Ga0068859_100040881 Ga0068859_1000408815 218
591 3300005617 Ga0068859_100327723 Ga0068859_1003277231 218
592 3300005617 Ga0068859_101123683 Ga0068859_1011236832 218
593 3300005618 Ga0068864_100470002 Ga0068864_1004700022 218
594 3300005718 Ga0068866_10237859 Ga0068866_102378591 218
595 3300005719 Ga0068861_100383509 Ga0068861_1003835092 218
596 3300005719 Ga0068861_100427563 Ga0068861_1004275631 218
597 3300005840 Ga0068870_10101180 Ga0068870_101011801 218
598 3300005841 Ga0068863_100155365 Ga0068863_1001553653 218
599 3300005841 Ga0068863_100337609 Ga0068863_1003376092 218
600 3300005841 Ga0068863_100387813 Ga0068863_1003878132 218
601 3300005842 Ga0068858_100385350 Ga0068858_1003853501 218
602 3300005843 Ga0068860_100115291 Ga0068860_1001152914 218
603 3300005843 Ga0068860_100191475 Ga0068860_1001914753 218
604 3300005843 Ga0068860_100287751 Ga0068860_1002877512 218
605 3300005843 Ga0068860_100393161 Ga0068860_1003931612 218
606 3300005843 Ga0068860_100625168 Ga0068860_1006251681 218
607 3300005844 Ga0068862_100506583 Ga0068862_1005065832 218
608 3300005937 Ga0081455_10035420 Ga0081455_100354206 218
609 3300005937 Ga0081455_10068340 Ga0081455_100683404 218
610 3300005937 Ga0081455_10082648 Ga0081455_100826481 218
611 3300005983 Ga0081540_1000565 Ga0081540_100056518 218
612 3300005983 Ga0081540_1005680 Ga0081540_10056807 218
613 3300005983 Ga0081540_1040102 Ga0081540_10401023 218
614 3300005983 Ga0081540_1045259 Ga0081540_10452594 218
615 3300005983 Ga0081540_1065883 Ga0081540_10658831 218
616 3300005983 Ga0081540_1085085 Ga0081540_10850852 218
617 3300005985 Ga0081539_10013324 Ga0081539_100133244 218
618 3300006028 Ga0070717_10032963 Ga0070717_100329634 218
619 3300006028 Ga0070717_10419413 Ga0070717_104194132 218
620 3300006038 Ga0075365_10011750 Ga0075365_100117504 218
621 3300006038 Ga0075365_10015504 Ga0075365_100155045 218
622 3300006038 Ga0075365_10035365 Ga0075365_100353652 218
623 3300006038 Ga0075365_10106223 Ga0075365_101062232 218
624 3300006038 Ga0075365_10117466 Ga0075365_101174661 218
625 3300006038 Ga0075365_10125621 Ga0075365_101256212 218
626 3300006038 Ga0075365_10162133 Ga0075365_101621332 218
627 3300006038 Ga0075365_10364919 Ga0075365_103649191 218
628 3300006042 Ga0075368_10005658 Ga0075368_100056583 218
629 3300006042 Ga0075368_10012370 Ga0075368_100123702 218
630 3300006042 Ga0075368_10028085 Ga0075368_100280853 218
631 3300006048 Ga0075363_100000880 Ga0075363_10000088010 218
632 3300006048 Ga0075363_100156238 Ga0075363_1001562382 218
633 3300006048 Ga0075363_100222179 Ga0075363_1002221792 218
634 3300006048 Ga0075363_100363162 Ga0075363_1003631621 218
635 3300006051 Ga0075364_10095437 Ga0075364_100954372 218
636 3300006051 Ga0075364_10140052 Ga0075364_101400522 218
637 3300006058 Ga0075432_10110782 Ga0075432_101107821 218
638 3300006173 Ga0070716_100122791 Ga0070716_1001227912 218
639 3300006175 Ga0070712_100042726 Ga0070712_1000427265 218
640 3300006177 Ga0075362_10029004 Ga0075362_100290042 218
641 3300006177 Ga0075362_10042719 Ga0075362_100427191 218
642 3300006177 Ga0075362_10201582 Ga0075362_102015822 218
643 3300006178 Ga0075367_10025247 Ga0075367_100252472 218
644 3300006178 Ga0075367_10046062 Ga0075367_100460621 218
645 3300006178 Ga0075367_10060985 Ga0075367_100609852 218
646 3300006178 Ga0075367_10067004 Ga0075367_100670042 218
647 3300006178 Ga0075367_10191734 Ga0075367_101917342 218
648 3300006186 Ga0075369_10091439 Ga0075369_100914391 218
649 3300006195 Ga0075366_10042978 Ga0075366_100429782 218
650 3300006195 Ga0075366_10062328 Ga0075366_100623282 218
651 3300006195 Ga0075366_10122491 Ga0075366_101224911 218
652 3300006195 Ga0075366_10177709 Ga0075366_101777091 218
653 3300006195 Ga0075366_10234143 Ga0075366_102341431 218
654 3300006195 Ga0075366_10250692 Ga0075366_102506922 218
655 3300006353 Ga0075370_10033831 Ga0075370_100338311 218
656 3300006353 Ga0075370_10043409 Ga0075370_100434092 218
657 3300006353 Ga0075370_10052172 Ga0075370_100521721 218
658 3300006353 Ga0075370_10079942 Ga0075370_100799421 218
659 3300006353 Ga0075370_10096250 Ga0075370_100962502 218
660 3300006358 Ga0068871_100304461 Ga0068871_1003044612 218
661 3300006358 Ga0068871_100474964 Ga0068871_1004749642 218
662 3300006844 Ga0075428_100085520 Ga0075428_1000855202 218
663 3300006847 Ga0075431_100453439 Ga0075431_1004534392 218
664 3300006871 Ga0075434_100162290 Ga0075434_1001622902 218
665 3300006914 Ga0075436_100067047 Ga0075436_1000670473 218
666 3300006931 Ga0097620_100040883 Ga0097620_1000408835 218
667 3300006931 Ga0097620_100327726 Ga0097620_1003277262 218
668 3300006931 Ga0097620_101123610 Ga0097620_1011236102 218
669 3300006941 Ga0099825_1040584 Ga0099825_10405841 218
670 3300006942 Ga0099824_1015025 Ga0099824_10150255 218
671 3300009092 Ga0105250_10129780 Ga0105250_101297802 218
672 3300009093 Ga0105240_10025515 Ga0105240_100255153 218
673 3300009093 Ga0105240_10109631 Ga0105240_101096313 218
674 3300009093 Ga0105240_11111430 Ga0105240_111114301 218
675 3300009094 Ga0111539_10522638 Ga0111539_105226381 218
676 3300009098 Ga0105245_10040987 Ga0105245_100409871 218
677 3300009098 Ga0105245_10236260 Ga0105245_102362602 218
678 3300009098 Ga0105245_10317873 Ga0105245_103178732 218
679 3300009101 Ga0105247_10042883 Ga0105247_100428834 218
680 3300009101 Ga0105247_10199743 Ga0105247_101997432 218
681 3300009101 Ga0105247_10267345 Ga0105247_102673451 218
682 3300009101 Ga0105247_10371671 Ga0105247_103716711 218
683 3300009147 Ga0114129_10572337 Ga0114129_105723372 218
684 3300009148 Ga0105243_10071572 Ga0105243_100715724 218
685 3300009148 Ga0105243_10361040 Ga0105243_103610401 218
686 3300009174 Ga0105241_10118471 Ga0105241_101184712 218
687 3300009174 Ga0105241_10131433 Ga0105241_101314332 218
688 3300009174 Ga0105241_10299360 Ga0105241_102993602 218
689 3300009177 Ga0105248_10360990 Ga0105248_103609902 218
690 3300009545 Ga0105237_10008457 Ga0105237_100084575 218
691 3300009545 Ga0105237_10501605 Ga0105237_105016052 218
692 3300009545 Ga0105237_10636519 Ga0105237_106365191 218
693 3300009551 Ga0105238_10109774 Ga0105238_101097742 218
694 3300009551 Ga0105238_10146736 Ga0105238_101467362 218
695 3300009551 Ga0105238_10219790 Ga0105238_102197903 218
696 3300009551 Ga0105238_10230700 Ga0105238_102307002 218
697 3300009551 Ga0105238_10257525 Ga0105238_102575252 218
698 3300009553 Ga0105249_10340285 Ga0105249_103402852 218
699 3300009553 Ga0105249_10786915 Ga0105249_107869151 218
700 3300009553 Ga0105249_10966653 Ga0105249_109666532 218
701 3300010375 Ga0105239_10046697 Ga0105239_100466976 218
702 3300010375 Ga0105239_10050580 Ga0105239_100505806 218
703 3300010375 Ga0105239_10099732 Ga0105239_100997322 218
704 3300010375 Ga0105239_11035849 Ga0105239_110358492 218
705 3300011119 Ga0105246_10074369 Ga0105246_100743694 218
706 3300011119 Ga0105246_10281708 Ga0105246_102817081 218
707 3300011119 Ga0105246_10410575 Ga0105246_104105752 218
708 3300013296 Ga0157374_10102780 Ga0157374_101027803 218
709 3300013296 Ga0157374_10138060 Ga0157374_101380603 218
710 3300013296 Ga0157374_10745262 Ga0157374_107452622 218
711 3300013297 Ga0157378_10496673 Ga0157378_104966732 218
712 3300013297 Ga0157378_11594091 Ga0157378_115940911 218
713 3300014325 Ga0163163_10038915 Ga0163163_100389152 218
714 3300014325 Ga0163163_10119746 Ga0163163_101197464 218
715 3300014325 Ga0163163_10223609 Ga0163163_102236092 218
716 3300014325 Ga0163163_10762099 Ga0163163_107620991 218
717 3300014969 Ga0157376_10267181 Ga0157376_102671812 218
718 3300017792 Ga0163161_10095823 Ga0163161_100958233 218
719 3300017792 Ga0163161_10245871 Ga0163161_102458712 218
720 3300017792 Ga0163161_10305165 Ga0163161_103051652 218
721 3300021320 Ga0214544_1003958 Ga0214544_10039582 218
722 3300021321 Ga0214542_1000002 Ga0214542_1000002413 218
723 3300021324 Ga0214545_1000002 Ga0214545_1000002307 218
724 3300021327 Ga0214543_1000013 Ga0214543_100001315 218
725 3300021384 Ga0213876_10308640 Ga0213876_103086401 218
726 3300021441 Ga0213871_10001798 Ga0213871_100017982 218
727 3300025230 Ga0209563_108420 Ga0209563_1084201 218
728 3300025253 Ga0209677_103580 Ga0209677_1035806 218
729 3300025254 Ga0209148_1000319 Ga0209148_100031965 218
730 3300025261 Ga0209233_1001148 Ga0209233_10011487 218
731 3300025261 Ga0209233_1008818 Ga0209233_10088182 218
732 3300025272 Ga0209455_1003913 Ga0209455_10039134 218
733 3300025272 Ga0209455_1005042 Ga0209455_10050424 218
734 3300025272 Ga0209455_1006371 Ga0209455_10063714 218
735 3300025273 Ga0209673_1042772 Ga0209673_10427722 218
736 3300025295 Ga0209564_1006114 Ga0209564_10061142 218
737 3300025297 Ga0209758_1000100 Ga0209758_1000100215 218
738 3300025297 Ga0209758_1000138 Ga0209758_1000138134 218
739 3300025297 Ga0209758_1001091 Ga0209758_100109122 218
740 3300025297 Ga0209758_1001321 Ga0209758_100132129 218
741 3300025297 Ga0209758_1015098 Ga0209758_10150981 218
742 3300025299 Ga0209256_1016482 Ga0209256_10164822 218
743 3300025302 Ga0207426_1000575 Ga0207426_100057515 218
744 3300025302 Ga0207426_1000611 Ga0207426_100061137 218
745 3300025302 Ga0207426_1005308 Ga0207426_10053087 218
746 3300025302 Ga0207426_1052117 Ga0207426_10521172 218
747 3300025302 Ga0207426_1074254 Ga0207426_10742541 218
748 3300025304 Ga0209257_1002363 Ga0209257_10023632 218
749 3300025304 Ga0209257_1016653 Ga0209257_10166532 218
750 3300025304 Ga0209257_1019833 Ga0209257_10198333 218
751 3300025315 Ga0207697_10084198 Ga0207697_100841981 218
752 3300025898 Ga0207692_10050274 Ga0207692_100502742 218
753 3300025898 Ga0207692_10223243 Ga0207692_102232432 218
754 3300025900 Ga0207710_10041299 Ga0207710_100412992 218
755 3300025900 Ga0207710_10104578 Ga0207710_101045782 218
756 3300025900 Ga0207710_10294336 Ga0207710_102943361 218
757 3300025901 Ga0207688_10110472 Ga0207688_101104721 218
758 3300025904 Ga0207647_10046642 Ga0207647_100466424 218
759 3300025906 Ga0207699_10021053 Ga0207699_100210536 218
760 3300025907 Ga0207645_10053681 Ga0207645_100536811 218
761 3300025907 Ga0207645_10521149 Ga0207645_105211491 218
762 3300025909 Ga0207705_10367437 Ga0207705_103674372 218
763 3300025911 Ga0207654_10108977 Ga0207654_101089771 218
764 3300025911 Ga0207654_10119307 Ga0207654_101193072 218
765 3300025911 Ga0207654_10424303 Ga0207654_104243031 218
766 3300025911 Ga0207654_10732839 Ga0207654_107328391 218
767 3300025912 Ga0207707_10146318 Ga0207707_101463184 218
768 3300025912 Ga0207707_10413505 Ga0207707_104135051 218
769 3300025913 Ga0207695_10000342 Ga0207695_1000034247 218
770 3300025914 Ga0207671_10018432 Ga0207671_100184325 218
771 3300025914 Ga0207671_10055842 Ga0207671_100558424 218
772 3300025914 Ga0207671_10659809 Ga0207671_106598091 218
773 3300025915 Ga0207693_10012619 Ga0207693_100126192 218
774 3300025915 Ga0207693_10053523 Ga0207693_100535231 218
775 3300025916 Ga0207663_10294821 Ga0207663_102948212 218
776 3300025919 Ga0207657_10518817 Ga0207657_105188172 218
777 3300025921 Ga0207652_10021542 Ga0207652_100215423 218
778 3300025921 Ga0207652_10602962 Ga0207652_106029621 218
779 3300025924 Ga0207694_10050067 Ga0207694_100500673 218
780 3300025924 Ga0207694_10058879 Ga0207694_100588792 218
781 3300025925 Ga0207650_10506633 Ga0207650_105066331 218
782 3300025925 Ga0207650_10649668 Ga0207650_106496682 218
783 3300025927 Ga0207687_10007169 Ga0207687_100071694 218
784 3300025927 Ga0207687_10113616 Ga0207687_101136161 218
785 3300025928 Ga0207700_10034864 Ga0207700_100348645 218
786 3300025928 Ga0207700_10041545 Ga0207700_100415454 218
787 3300025929 Ga0207664_10423961 Ga0207664_104239612 218
788 3300025931 Ga0207644_10726381 Ga0207644_107263811 218
789 3300025932 Ga0207690_10294332 Ga0207690_102943322 218
790 3300025933 Ga0207706_10077308 Ga0207706_100773082 218
791 3300025933 Ga0207706_10099415 Ga0207706_100994152 218
792 3300025933 Ga0207706_10277211 Ga0207706_102772111 218
793 3300025933 Ga0207706_10364253 Ga0207706_103642532 218
794 3300025933 Ga0207706_10640314 Ga0207706_106403141 218
795 3300025934 Ga0207686_10169929 Ga0207686_101699292 218
796 3300025937 Ga0207669_10230111 Ga0207669_102301112 218
797 3300025938 Ga0207704_10610100 Ga0207704_106101001 218
798 3300025939 Ga0207665_10041812 Ga0207665_100418124 218
799 3300025939 Ga0207665_10101483 Ga0207665_101014832 218
800 3300025940 Ga0207691_10062798 Ga0207691_100627984 218
801 3300025941 Ga0207711_10800613 Ga0207711_108006131 218
802 3300025942 Ga0207689_10329768 Ga0207689_103297682 218
803 3300025945 Ga0207679_10398804 Ga0207679_103988042 218
804 3300025945 Ga0207679_10579505 Ga0207679_105795052 218
805 3300025949 Ga0207667_10087606 Ga0207667_100876064 218
806 3300025949 Ga0207667_10134941 Ga0207667_101349412 218
807 3300025949 Ga0207667_10749069 Ga0207667_107490692 218
808 3300025960 Ga0207651_10096535 Ga0207651_100965353 218
809 3300025961 Ga0207712_10273374 Ga0207712_102733742 218
810 3300025961 Ga0207712_10468502 Ga0207712_104685021 218
811 3300025972 Ga0207668_10050571 Ga0207668_100505712 218
812 3300025972 Ga0207668_10094403 Ga0207668_100944033 218
813 3300025972 Ga0207668_10261856 Ga0207668_102618562 218
814 3300025972 Ga0207668_10302464 Ga0207668_103024642 218
815 3300025981 Ga0207640_10447573 Ga0207640_104475732 218
816 3300025981 Ga0207640_10496898 Ga0207640_104968982 218
817 3300025981 Ga0207640_10538620 Ga0207640_105386201 218
818 3300025986 Ga0207658_10078350 Ga0207658_100783502 218
819 3300025986 Ga0207658_10079444 Ga0207658_100794442 218
820 3300025986 Ga0207658_10156056 Ga0207658_101560562 218
821 3300026023 Ga0207677_10334582 Ga0207677_103345821 218
822 3300026035 Ga0207703_10068579 Ga0207703_100685793 218
823 3300026035 Ga0207703_10108068 Ga0207703_101080682 218
824 3300026035 Ga0207703_10290027 Ga0207703_102900271 218
825 3300026067 Ga0207678_10020589 Ga0207678_100205898 218
826 3300026067 Ga0207678_10064623 Ga0207678_100646234 218
827 3300026067 Ga0207678_10064668 Ga0207678_100646681 218
828 3300026067 Ga0207678_10070693 Ga0207678_100706934 218
829 3300026067 Ga0207678_10267080 Ga0207678_102670801 218
830 3300026075 Ga0207708_10306518 Ga0207708_103065181 218
831 3300026075 Ga0207708_10379312 Ga0207708_103793122 218
832 3300026078 Ga0207702_10410380 Ga0207702_104103802 218
833 3300026088 Ga0207641_10579918 Ga0207641_105799181 218
834 3300026088 Ga0207641_10638652 Ga0207641_106386521 218
835 3300026088 Ga0207641_10877230 Ga0207641_108772302 218
836 3300026089 Ga0207648_10043577 Ga0207648_100435774 218
837 3300026095 Ga0207676_10329485 Ga0207676_103294852 218
838 3300026095 Ga0207676_10479854 Ga0207676_104798542 218
839 3300026095 Ga0207676_10596069 Ga0207676_105960692 218
840 3300026095 Ga0207676_10681464 Ga0207676_106814642 218
841 3300026116 Ga0207674_10045583 Ga0207674_100455836 218
842 3300026116 Ga0207674_10708110 Ga0207674_107081102 218
843 3300026118 Ga0207675_100283259 Ga0207675_1002832591 218
844 3300026118 Ga0207675_100449173 Ga0207675_1004491731 218
845 3300026121 Ga0207683_10056308 Ga0207683_100563083 218
846 3300026121 Ga0207683_10269411 Ga0207683_102694112 218
847 3300026121 Ga0207683_10635355 Ga0207683_106353551 218
848 3300026142 Ga0207698_10132848 Ga0207698_101328482 218
849 3300026142 Ga0207698_10531214 Ga0207698_105312141 218
850 3300027296 Ga0209389_1000092 Ga0209389_10000925 218
851 3300027296 Ga0209389_1002136 Ga0209389_100213614 218
852 3300027357 Ga0209589_1000115 Ga0209589_10001155 218
853 3300027361 Ga0209489_100340 Ga0209489_1003405 218
854 3300027361 Ga0209489_109127 Ga0209489_1091272 218
855 3300027363 Ga0209700_100117 Ga0209700_100117114 218
856 3300027866 Ga0209813_10004007 Ga0209813_100040074 218
857 3300027866 Ga0209813_10037770 Ga0209813_100377703 218
858 3300028379 Ga0268266_10002227 Ga0268266_1000222727 218
859 3300028379 Ga0268266_10034535 Ga0268266_100345356 218
860 3300028379 Ga0268266_10085947 Ga0268266_100859471 218
861 3300028380 Ga0268265_10026937 Ga0268265_100269374 218
862 3300028380 Ga0268265_10107968 Ga0268265_101079681 218
863 3300028380 Ga0268265_10189532 Ga0268265_101895322 218
864 3300028380 Ga0268265_10406584 Ga0268265_104065842 218
865 3300028380 Ga0268265_10605595 Ga0268265_106055952 218
866 3300028381 Ga0268264_10659322 Ga0268264_106593221 218
867 3300028786 Ga0307517_10176597 Ga0307517_101765971 218
868 3300028786 Ga0307517_10231704 Ga0307517_102317041 218
869 3300030521 Ga0307511_10052383 Ga0307511_100523831 218
870 3300031249 Ga0265339_10011623 Ga0265339_100116236 218
871 3300031507 Ga0307509_10101865 Ga0307509_101018653 218
872 3300031507 Ga0307509_10134654 Ga0307509_101346541 218
873 3300031507 Ga0307509_10629332 Ga0307509_106293321 218
874 3300031548 Ga0307408_100549942 Ga0307408_1005499421 218
875 3300031616 Ga0307508_10420005 Ga0307508_104200052 218
876 3300031730 Ga0307516_10104028 Ga0307516_101040282 218
877 3300031730 Ga0307516_10166562 Ga0307516_101665623 218
878 3300031731 Ga0307405_10172869 Ga0307405_101728692 218
879 3300031824 Ga0307413_10135965 Ga0307413_101359651 218
880 3300031824 Ga0307413_10319439 Ga0307413_103194391 218
881 3300031903 Ga0307407_10040269 Ga0307407_100402691 218
882 3300031903 Ga0307407_10293913 Ga0307407_102939131 218
883 3300031911 Ga0307412_10298454 Ga0307412_102984541 218
884 3300031995 Ga0307409_100030635 Ga0307409_1000306353 218
885 3300031995 Ga0307409_100653531 Ga0307409_1006535312 218
886 3300032005 Ga0307411_10018506 Ga0307411_100185065 218
887 3300032005 Ga0307411_10356091 Ga0307411_103560911 218
888 3300032126 Ga0307415_100164140 Ga0307415_1001641402 218
889 3300032126 Ga0307415_100212714 Ga0307415_1002127142 218
890 3300033179 Ga0307507_10045182 Ga0307507_100451825 218
891 3300033180 Ga0307510_10006740 Ga0307510_100067405 218
892 3300033180 Ga0307510_10030910 Ga0307510_100309102 218
893 3300033180 Ga0307510_10154786 Ga0307510_101547861 218
894 3300033180 Ga0307510_10367787 Ga0307510_103677871 218
895 3300035116 Ga0373945_0216318 Ga0373945_0216318_67_726 218
896 3300035118 Ga0373954_0247191 Ga0373954_0247191_52_714 218
897 3300035692 Ga0373935_0032588 Ga0373935_0032588_1513_2172 218
898 3300035695 Ga0373927_0002098 Ga0373927_0002098_12024_12683 218
899 3300035695 Ga0373927_0096108 Ga0373927_0096108_732_1388 218
900 3300035725 Ga0373947_0203298 Ga0373947_0203298_608_1264 218
901 3300037068 Ga0373925_0384840 Ga0373925_0384840_163_819 218
902 3300037418 Ga0395900_0000601 Ga0395900_0000601_26521_27183 218
903 3300037418 Ga0395900_0663087 Ga0395900_0663087_86_748 218
904 3300037466 Ga0395898_0950447 Ga0395898_0950447_104_766 218
905 3300037471 Ga0395905_0042342 Ga0395905_0042342_1018_1728 218
906 3300037471 Ga0395905_0047738 Ga0395905_0047738_742_1404 218
907 3300037471 Ga0395905_0523900 Ga0395905_0523900_31_687 218
908 3300038443 Ga0395901_0174292 Ga0395901_0174292_801_1511 218
909 3300038443 Ga0395901_0402113 Ga0395901_0402113_672_1334 218
910 3300038443 Ga0395901_0612358 Ga0395901_0612358_277_939 218
911 3300038443 Ga0395901_0763651 Ga0395901_0763651_287_943 218
912 3300039437 Ga0436365_0491407 Ga0436365_0491407_223_885 218
913 3300039437 Ga0436365_0604857 Ga0436365_0604857_1578_2237 218
914 3300039437 Ga0436365_1832438 Ga0436365_1832438_2434_3093 218
915 3300039438 Ga0436360_0800369 Ga0436360_0800369_152_811 218
916 3300039450 Ga0436363_0702677 Ga0436363_0702677_15_674 218
917 3300041441 Ga0451787_680561 Ga0451787_680561_106_762 218
918 3300041451 Ga0451791_1330780 Ga0451791_1330780_163_903 218
919 3300041492 Ga0451835_0281011 Ga0451835_0281011_184_846 218
920 3300041494 Ga0451837_0572566 Ga0451837_0572566_339_1001 218
921 3300041494 Ga0451837_1293921 Ga0451837_1293921_490_1146 218
922 3300041512 Ga0451853_0256934 Ga0451853_0256934_531_1187 218
923 3300041512 Ga0451853_3570517 Ga0451853_3570517_354_1016 218
924 3300044656 Ga0466969_0017894 Ga0466969_0017894_726_1388 218
925 3300044658 Ga0466972_0000206 Ga0466972_0000206_27439_28101 218
926 3300044683 Ga0466965_0028858 Ga0466965_0028858_1121_1783 218
927 3300044684 Ga0466966_0000872 Ga0466966_0000872_4465_5127 218
928 3300044693 Ga0466961_0000082 Ga0466961_0000082_5330_5992 218
929 3300044694 Ga0466963_0156208 Ga0466963_0156208_481_1143 218
930 3300044712 Ga0453684_0095053 Ga0453684_0095053_741_1415 218
931 3300044842 Ga0466957_0045023 Ga0466957_0045023_1486_2145 218
932 3300044842 Ga0466957_0073127 Ga0466957_0073127_527_1189 218
933 3300044842 Ga0466957_0145247 Ga0466957_0145247_727_1386 218
934 3300044842 Ga0466957_0263932 Ga0466957_0263932_195_854 218
935 3300044901 Ga0466960_0231571 Ga0466960_0231571_132_794 218
936 3300045049 Ga0466959_0007074 Ga0466959_0007074_6663_7322 218
937 3300045049 Ga0466959_0021459 Ga0466959_0021459_2347_3009 218
938 3300045976 Ga0466967_0244666 Ga0466967_0244666_245_904 218
939 3300046452 Ga0495617_039527 Ga0495617_039527_275_931 218
940 3300046454 Ga0495592_0176376 Ga0495592_0176376_758_1420 218
941 3300046455 Ga0495603_0014808 Ga0495603_0014808_334_990 218
942 3300046455 Ga0495603_0015277 Ga0495603_0015277_3959_4615 218
943 3300046455 Ga0495603_0028524 Ga0495603_0028524_342_998 218
944 3300046457 Ga0495590_0046719 Ga0495590_0046719_316_972 218
945 3300046459 Ga0495629_0002653 Ga0495629_0002653_2050_2712 218
946 3300046459 Ga0495629_0126465 Ga0495629_0126465_350_1012 218
947 3300046459 Ga0495629_0153510 Ga0495629_0153510_328_984 218
948 3300046460 Ga0495638_0135790 Ga0495638_0135790_518_1174 218
949 3300046460 Ga0495638_0203855 Ga0495638_0203855_133_789 218
950 3300046461 Ga0495641_0078631 Ga0495641_0078631_802_1458 218
951 3300046461 Ga0495641_0144547 Ga0495641_0144547_75_737 218
952 3300046461 Ga0495641_0206240 Ga0495641_0206240_121_777 218
953 3300046462 Ga0495651_0099543 Ga0495651_0099543_721_1377 218
954 3300046462 Ga0495651_0235834 Ga0495651_0235834_69_731 218
955 3300046462 Ga0495651_0388564 Ga0495651_0388564_97_759 218
956 3300046463 Ga0495653_0270486 Ga0495653_0270486_195_857 218
957 3300046471 Ga0495650_0148975 Ga0495650_0148975_54_710 218
958 3300046474 Ga0495605_0031470 Ga0495605_0031470_268_924 218
959 3300046475 Ga0495639_0355492 Ga0495639_0355492_14_676 218
960 3300046477 Ga0495664_0021339 Ga0495664_0021339_1110_1772 218
961 3300046491 Ga0495584_0068683 Ga0495584_0068683_83_739 218
962 3300046492 Ga0495585_0155823 Ga0495585_0155823_165_821 218
963 3300046492 Ga0495585_0290776 Ga0495585_0290776_32_688 218
964 3300046499 Ga0495594_0055814 Ga0495594_0055814_169_825 218
965 3300046499 Ga0495594_0079549 Ga0495594_0079549_306_962 218
966 3300046507 Ga0495606_0029541 Ga0495606_0029541_739_1404 218
967 3300046507 Ga0495606_0169363 Ga0495606_0169363_249_905 218
968 3300046511 Ga0495608_0148802 Ga0495608_0148802_19_681 218
969 3300046512 Ga0495610_0017594 Ga0495610_0017594_674_1336 218
970 3300046512 Ga0495610_0029933 Ga0495610_0029933_396_1058 218
971 3300046514 Ga0495618_0160778 Ga0495618_0160778_478_1140 218
972 3300046516 Ga0495628_0394550 Ga0495628_0394550_196_852 218
973 3300046518 Ga0495631_0052606 Ga0495631_0052606_694_1350 218
974 3300046518 Ga0495631_0092298 Ga0495631_0092298_448_1104 218
975 3300046518 Ga0495631_0204183 Ga0495631_0204183_73_735 218
976 3300046519 Ga0495632_0171491 Ga0495632_0171491_39_695 218
977 3300046520 Ga0495637_0083951 Ga0495637_0083951_480_1136 218
978 3300046522 Ga0495643_0010420 Ga0495643_0010420_924_1586 218
979 3300046522 Ga0495643_0206504 Ga0495643_0206504_211_873 218
980 3300046524 Ga0495648_0140085 Ga0495648_0140085_442_1104 218
981 3300046524 Ga0495648_0197564 Ga0495648_0197564_12_674 218
982 3300046525 Ga0495663_0086352 Ga0495663_0086352_30_686 218
983 3300046526 Ga0495666_0057087 Ga0495666_0057087_313_969 218
984 3300046529 Ga0495652_0009665 Ga0495652_0009665_501_1163 218
985 3300046529 Ga0495652_0099942 Ga0495652_0099942_1328_1990 218
986 3300046533 Ga0495640_0067035 Ga0495640_0067035_1195_1857 218
987 3300046536 Ga0495587_0054380 Ga0495587_0054380_616_1278 218
988 3300046537 Ga0495598_0011296 Ga0495598_0011296_57_713 218
989 3300046538 Ga0495609_0161423 Ga0495609_0161423_156_818 218
990 3300046542 Ga0495597_0069708 Ga0495597_0069708_524_1180 218
991 3300046543 Ga0495645_0017952 Ga0495645_0017952_1031_1693 218
992 3300046557 Ga0495622_0009657 Ga0495622_0009657_3101_3760 218
993 3300046557 Ga0495622_0026851 Ga0495622_0026851_351_1007 218
994 3300046558 Ga0495633_0203505 Ga0495633_0203505_58_714 218
995 3300046558 Ga0495633_0265777 Ga0495633_0265777_40_696 218
996 3300046559 Ga0495667_0104195 Ga0495667_0104195_590_1252 218
997 3300046615 Ga0495656_0113224 Ga0495656_0113224_420_1076 218
998 3300046616 Ga0495668_0075590 Ga0495668_0075590_472_1134 218
999 3300046616 Ga0495668_0378673 Ga0495668_0378673_60_722 218
1000 3300046642 Ga0495634_0133738 Ga0495634_0133738_407_1069 218
1001 3300046642 Ga0495634_0203128 Ga0495634_0203128_100_762 218
1002 3300046648 Ga0495611_0061325 Ga0495611_0061325_707_1363 218
1003 3300046648 Ga0495611_0158424 Ga0495611_0158424_181_837 218
1004 3300046660 Ga0495625_0137529 Ga0495625_0137529_382_1047 218
1005 3300046660 Ga0495625_0234816 Ga0495625_0234816_211_867 218
1006 3300046663 Ga0495635_0025751 Ga0495635_0025751_2170_2832 218
1007 3300046663 Ga0495635_0053641 Ga0495635_0053641_242_898 218
1008 3300046663 Ga0495635_0231441 Ga0495635_0231441_568_1230 218
1009 3300046665 Ga0495661_0199581 Ga0495661_0199581_293_949 218
1010 3300046675 Ga0495657_0020674 Ga0495657_0020674_3415_4077 218
1011 3300046675 Ga0495657_0144563 Ga0495657_0144563_312_974 218
1012 3300046678 Ga0495599_0052690 Ga0495599_0052690_653_1315 218
1013 3300046679 Ga0495623_0179442 Ga0495623_0179442_415_1077 218
1014 3300046680 Ga0495646_0061759 Ga0495646_0061759_391_1053 218
1015 3300046684 Ga0495669_0030370 Ga0495669_0030370_715_1371 218
1016 3300046684 Ga0495669_0030629 Ga0495669_0030629_1307_1972 218
1017 3300046684 Ga0495669_0084520 Ga0495669_0084520_491_1147 218
1018 3300046689 Ga0495613_0100144 Ga0495613_0100144_1357_2019 218
1019 3300046690 Ga0495624_0027748 Ga0495624_0027748_1383_2045 218
1020 3300046691 Ga0495670_0098099 Ga0495670_0098099_229_885 218
1021 3300046694 Ga0495649_0008929 Ga0495649_0008929_4135_4797 218
1022 3300046694 Ga0495649_0052228 Ga0495649_0052228_785_1447 218
1023 3300046794 Ga0495589_0149827 Ga0495589_0149827_12_668 218
1024 3300046809 Ga0495600_0106542 Ga0495600_0106542_816_1478 218
1025 3300046809 Ga0495600_0141242 Ga0495600_0141242_273_935 218
1026 3300047315 Ga0495581_0383317 Ga0495581_0383317_42_698 218
1027 3300047317 Ga0495604_0130086 Ga0495604_0130086_658_1320 218
1028 3300047318 Ga0495636_0128587 Ga0495636_0128587_307_963 218
1029 3300047319 Ga0495674_0613683 Ga0495674_0613683_169_828 218
1030 3300047321 Ga0495676_0019047 Ga0495676_0019047_304_960 218
1031 3300047321 Ga0495676_0112128 Ga0495676_0112128_395_1057 218
1032 3300047322 Ga0495680_0022651 Ga0495680_0022651_391_1053 218
1033 3300047322 Ga0495680_0298674 Ga0495680_0298674_104_760 218
1034 3300047323 Ga0495683_0054061 Ga0495683_0054061_1222_1884 218
1035 3300047323 Ga0495683_0197169 Ga0495683_0197169_119_775 218
1036 3300047443 Ga0495687_099628 Ga0495687_099628_332_994 218
1037 3300047444 Ga0495675_0047405 Ga0495675_0047405_1537_2199 218
1038 3300047445 Ga0495677_0092107 Ga0495677_0092107_118_783 218
1039 3300047447 Ga0495685_117094 Ga0495685_117094_161_817 218
1040 3300047469 Ga0495673_0081202 Ga0495673_0081202_53_715 218
1041 3300047469 Ga0495673_0119301 Ga0495673_0119301_326_988 218
1042 3300047471 Ga0495684_0085268 Ga0495684_0085268_1531_2193 218
1043 3300047472 Ga0495686_0120872 Ga0495686_0120872_517_1179 218
1044 3300047472 Ga0495686_0191603 Ga0495686_0191603_96_752 218
1045 3300047472 Ga0495686_0218363 Ga0495686_0218363_279_941 218
1046 3300047673 Ga0495593_0333521 Ga0495593_0333521_16_675 218
1047 3300048088 Ga0495602_0032241 Ga0495602_0032241_3166_3828 218
1048 3300048088 Ga0495602_0064976 Ga0495602_0064976_1588_2250 218
1049 3300048088 Ga0495602_0445247 Ga0495602_0445247_53_709 218
1050 3300048091 Ga0495626_0177712 Ga0495626_0177712_103_759 218
1051 3300048903 Ga0496100_0200841 Ga0496100_0200841_318_980 218
1052 3300048903 Ga0496100_0623037 Ga0496100_0623037_151_807 218
1053 3300048904 Ga0496101_0218071 Ga0496101_0218071_671_1333 218
1054 3300048904 Ga0496101_0233495 Ga0496101_0233495_496_1152 218
1055 3300048904 Ga0496101_0361738 Ga0496101_0361738_22_678 218
1056 3300048905 Ga0496102_0055829 Ga0496102_0055829_1682_2344 218
1057 3300048905 Ga0496102_0163510 Ga0496102_0163510_1323_1985 218
1058 3300048905 Ga0496102_0247053 Ga0496102_0247053_444_1100 218
1059 3300048905 Ga0496102_0805369 Ga0496102_0805369_157_819 218
1060 3300048905 Ga0496102_1167607 Ga0496102_1167607_16_672 218
1061 3300048906 Ga0496103_0028309 Ga0496103_0028309_1072_1734 218
1062 3300048906 Ga0496103_0157565 Ga0496103_0157565_158_820 218
1063 3300048906 Ga0496103_0204195 Ga0496103_0204195_266_922 218
1064 3300048906 Ga0496103_0211040 Ga0496103_0211040_183_845 218
1065 3300048907 Ga0496104_0000871 Ga0496104_0000871_14499_15161 218
1066 3300048907 Ga0496104_0194151 Ga0496104_0194151_492_1154 218
1067 3300048907 Ga0496104_0330228 Ga0496104_0330228_467_1123 218
1068 3300048907 Ga0496104_0645881 Ga0496104_0645881_257_919 218
1069 3300048908 Ga0496105_0000692 Ga0496105_0000692_9319_9981 218
1070 3300048908 Ga0496105_0230470 Ga0496105_0230470_697_1359 218
1071 3300048909 Ga0496106_0000664 Ga0496106_0000664_15609_16268 218
1072 3300048909 Ga0496106_0587978 Ga0496106_0587978_214_870 218
1073 3300048909 Ga0496106_0696044 Ga0496106_0696044_82_738 218
1074 3300048909 Ga0496106_0892161 Ga0496106_0892161_14_676 218
1075 3300048910 Ga0496107_0146548 Ga0496107_0146548_944_1600 218
1076 3300048911 Ga0496108_0070787 Ga0496108_0070787_1222_1884 218
1077 3300048912 Ga0496109_0034450 Ga0496109_0034450_1326_1988 218
1078 3300048912 Ga0496109_0135370 Ga0496109_0135370_1559_2221 218
1079 3300048912 Ga0496109_0194775 Ga0496109_0194775_1186_1848 218
1080 3300048912 Ga0496109_0314130 Ga0496109_0314130_790_1446 218
1081 3300048912 Ga0496109_0454049 Ga0496109_0454049_214_870 218
1082 3300048913 Ga0496110_0127948 Ga0496110_0127948_136_798 218
1083 3300048914 Ga0496111_0125268 Ga0496111_0125268_711_1373 218
1084 3300048914 Ga0496111_0196659 Ga0496111_0196659_704_1360 218
1085 3300048915 Ga0496112_0118517 Ga0496112_0118517_1570_2226 218
1086 3300048915 Ga0496112_0189733 Ga0496112_0189733_981_1643 218
1087 3300048915 Ga0496112_0655315 Ga0496112_0655315_156_818 218
1088 3300048916 Ga0496113_0047634 Ga0496113_0047634_2096_2758 218
1089 3300048916 Ga0496113_0108554 Ga0496113_0108554_1431_2093 218
1090 3300048916 Ga0496113_0457124 Ga0496113_0457124_77_733 218
1091 3300048916 Ga0496113_0467667 Ga0496113_0467667_333_995 218
1092 3300048917 Ga0496114_0029973 Ga0496114_0029973_3431_4087 218
1093 3300048917 Ga0496114_0086355 Ga0496114_0086355_581_1243 218
1094 3300048917 Ga0496114_0780164 Ga0496114_0780164_130_786 218
1095 3300048918 Ga0496115_0030017 Ga0496115_0030017_2792_3448 218
1096 3300048918 Ga0496115_0295273 Ga0496115_0295273_90_752 218
1097 3300048919 Ga0496116_0087144 Ga0496116_0087144_365_1027 218
1098 3300048919 Ga0496116_0287207 Ga0496116_0287207_73_735 218
1099 3300048920 Ga0496117_0019802 Ga0496117_0019802_3680_4339 218
1100 3300048920 Ga0496117_0050066 Ga0496117_0050066_1449_2111 218
1101 3300048920 Ga0496117_0105509 Ga0496117_0105509_399_1058 218
1102 3300048920 Ga0496117_0234664 Ga0496117_0234664_311_973 218
1103 3300048920 Ga0496117_0266350 Ga0496117_0266350_109_771 218
1104 3300048920 Ga0496117_0306254 Ga0496117_0306254_165_821 218
1105 3300048922 Ga0496119_0011575 Ga0496119_0011575_3063_3725 218
1106 3300048922 Ga0496119_0068346 Ga0496119_0068346_744_1406 218
1107 3300048922 Ga0496119_0080029 Ga0496119_0080029_1018_1680 218
1108 3300048923 Ga0496120_0011179 Ga0496120_0011179_4821_5483 218
1109 3300048923 Ga0496120_0036361 Ga0496120_0036361_866_1528 218
1110 3300048924 Ga0496121_0000077 Ga0496121_0000077_185852_186511 218
1111 3300048924 Ga0496121_0035309 Ga0496121_0035309_1317_1979 218
1112 3300048924 Ga0496121_0057403 Ga0496121_0057403_286_942 218
1113 3300048924 Ga0496121_0097925 Ga0496121_0097925_998_1660 218
1114 3300048924 Ga0496121_0191974 Ga0496121_0191974_249_905 218
1115 3300048925 Ga0496122_0261989 Ga0496122_0261989_65_727 218
1116 3300048927 Ga0496124_0006148 Ga0496124_0006148_1098_1757 218
1117 3300048927 Ga0496124_0061614 Ga0496124_0061614_632_1294 218
1118 3300048927 Ga0496124_0123553 Ga0496124_0123553_1270_1926 218
1119 3300048927 Ga0496124_0197513 Ga0496124_0197513_13_675 218
1120 3300048927 Ga0496124_0298006 Ga0496124_0298006_392_1048 218
1121 3300048928 Ga0496125_0036626 Ga0496125_0036626_3169_3831 218
1122 3300048928 Ga0496125_0054822 Ga0496125_0054822_384_1043 218
1123 3300048928 Ga0496125_0123585 Ga0496125_0123585_1132_1791 218
1124 3300048928 Ga0496125_0151714 Ga0496125_0151714_22_678 218
1125 3300048929 Ga0496126_0030696 Ga0496126_0030696_608_1270 218
1126 3300048929 Ga0496126_0050756 Ga0496126_0050756_314_970 218
1127 3300048929 Ga0496126_0051484 Ga0496126_0051484_1502_2161 218
1128 3300048929 Ga0496126_0117956 Ga0496126_0117956_1252_1908 218
1129 3300048929 Ga0496126_0291410 Ga0496126_0291410_146_802 218
1130 3300049583 Ga0501067_0028816 Ga0501067_0028816_1476_2132 218
1131 3300049585 Ga0501069_0074327 Ga0501069_0074327_456_1112 218
1132 3300050489 nmdc:mga03683_147630_c1 nmdc:mga03683_147630_c1_336_992 218
1133 3300050489 nmdc:mga03683_24601_c1 nmdc:mga03683_24601_c1_782_1438 218
1134 3300050489 nmdc:mga03683_55649_c1 nmdc:mga03683_55649_c1_309_971 218
1135 3300050489 nmdc:mga03683_76077_c1 nmdc:mga03683_76077_c1_388_1116 218
1136 3300050491 nmdc:mga00v17_147044_c1 nmdc:mga00v17_147044_c1_649_1311 218
1137 3300050491 nmdc:mga00v17_165496_c1 nmdc:mga00v17_165496_c1_293_955 218
1138 3300050491 nmdc:mga00v17_171065_c1 nmdc:mga00v17_171065_c1_671_1327 218
1139 3300050491 nmdc:mga00v17_289368_c1 nmdc:mga00v17_289368_c1_206_862 218
1140 3300050492 nmdc:mga0yw44_107801_c1 nmdc:mga0yw44_107801_c1_502_1164 218
1141 3300050492 nmdc:mga0yw44_13081_c1 nmdc:mga0yw44_13081_c1_3239_3901 218
1142 3300050492 nmdc:mga0yw44_133499_c1 nmdc:mga0yw44_133499_c1_330_992 218
1143 3300050492 nmdc:mga0yw44_156254_c1 nmdc:mga0yw44_156254_c1_402_1064 218
1144 3300050492 nmdc:mga0yw44_201211_c1 nmdc:mga0yw44_201211_c1_590_1246 218
1145 3300050492 nmdc:mga0yw44_455425_c1 nmdc:mga0yw44_455425_c1_41_697 218
1146 3300050492 nmdc:mga0yw44_631947_c1 nmdc:mga0yw44_631947_c1_44_700 218
1147 3300050492 nmdc:mga0yw44_75748_c1 nmdc:mga0yw44_75748_c1_1129_1791 218
1148 3300050492 nmdc:mga0yw44_85138_c1 nmdc:mga0yw44_85138_c1_330_986 218
1149 3300050493 nmdc:mga0k408_106791_c1 nmdc:mga0k408_106791_c1_686_1342 218
1150 3300050493 nmdc:mga0k408_148275_c1 nmdc:mga0k408_148275_c1_251_907 218
1151 3300050493 nmdc:mga0k408_194317_c1 nmdc:mga0k408_194317_c1_159_821 218
1152 3300050493 nmdc:mga0k408_252961_c1 nmdc:mga0k408_252961_c1_120_776 218
1153 3300050493 nmdc:mga0k408_253828_c1 nmdc:mga0k408_253828_c1_260_916 218
1154 3300050493 nmdc:mga0k408_43563_c1 nmdc:mga0k408_43563_c1_345_1001 218
1155 3300050493 nmdc:mga0k408_60180_c2 nmdc:mga0k408_60180_c2_992_1654 218
1156 3300050493 nmdc:mga0k408_92784_c1 nmdc:mga0k408_92784_c1_108_764 218
1157 3300050494 nmdc:mga06z11_10788_c1 nmdc:mga06z11_10788_c1_728_1384 218
1158 3300050494 nmdc:mga06z11_197373_c1 nmdc:mga06z11_197373_c1_302_958 218
1159 3300050494 nmdc:mga06z11_221692_c1 nmdc:mga06z11_221692_c1_70_726 218
1160 3300050494 nmdc:mga06z11_62309_c1 nmdc:mga06z11_62309_c1_699_1361 218
1161 3300050495 nmdc:mga04h51_150696_c1 nmdc:mga04h51_150696_c1_93_755 218
1162 3300050495 nmdc:mga04h51_64585_c1 nmdc:mga04h51_64585_c1_537_1193 218
1163 3300050496 nmdc:mga07m45_16139_c1 nmdc:mga07m45_16139_c1_2157_2819 218
1164 3300050496 nmdc:mga07m45_23084_c1 nmdc:mga07m45_23084_c1_1106_1762 218
1165 3300050496 nmdc:mga07m45_262509_c1 nmdc:mga07m45_262509_c1_135_791 218
1166 3300050507 nmdc:mga05p37_139821_c1 nmdc:mga05p37_139821_c1_1587_2243 218
1167 3300050510 nmdc:mga06r32_442075_c1 nmdc:mga06r32_442075_c1_551_1207 218
1168 3300050511 nmdc:mga08y16_508048_c1 nmdc:mga08y16_508048_c1_37_765 218
1169 3300050513 nmdc:mga0rr50_73302_c1 nmdc:mga0rr50_73302_c1_914_1570 218
1170 3300050516 nmdc:mga0sz30_147496_c1 nmdc:mga0sz30_147496_c1_29_685 218
1171 3300050516 nmdc:mga0sz30_14861_c1 nmdc:mga0sz30_14861_c1_1035_1709 218
1172 3300050516 nmdc:mga0sz30_61268_c1 nmdc:mga0sz30_61268_c1_741_1403 218
1173 3300053077 Ga0495601_0313967 Ga0495601_0313967_90_752 218
1174 3300053083 Ga0495655_0117937 Ga0495655_0117937_100_756 218
1175 3300053085 Ga0495619_0078792 Ga0495619_0078792_997_1659 218
1176 3300053086 Ga0500578_0168757 Ga0500578_0168757_87_752 218
1177 3300053087 Ga0500643_000025 Ga0500643_000025_1089_1751 218
1178 3300053090 Ga0500646_0015878 Ga0500646_0015878_875_1531 218
1179 3300053091 Ga0500647_0016130 Ga0500647_0016130_2612_3274 218
1180 3300053091 Ga0500647_0067394 Ga0500647_0067394_1009_1668 218
1181 3300053092 Ga0500583_0023251 Ga0500583_0023251_1161_1823 218
1182 3300053092 Ga0500583_0202167 Ga0500583_0202167_217_873 218
1183 3300053094 Ga0500566_0002901 Ga0500566_0002901_5360_6022 218
1184 3300053094 Ga0500566_0029361 Ga0500566_0029361_576_1235 218
1185 3300053094 Ga0500566_0035605 Ga0500566_0035605_393_1055 218
1186 3300053094 Ga0500566_0040394 Ga0500566_0040394_124_780 218
1187 3300053096 Ga0500641_0017948 Ga0500641_0017948_579_1235 218
1188 3300053096 Ga0500641_0019320 Ga0500641_0019320_428_1084 218
1189 3300053098 Ga0500650_0030877 Ga0500650_0030877_1012_1668 218
1190 3300053103 Ga0500555_004130 Ga0500555_004130_564_1226 218
1191 3300053104 Ga0500556_0007468 Ga0500556_0007468_1357_2019 218
1192 3300053105 Ga0500557_000001 Ga0500557_000001_182660_183322 218
1193 3300053108 Ga0500562_007409 Ga0500562_007409_364_1026 218
1194 3300053109 Ga0500569_003720 Ga0500569_003720_1198_1860 218
1195 3300053109 Ga0500569_011892 Ga0500569_011892_693_1355 218
1196 3300053114 Ga0500582_029976 Ga0500582_029976_804_1460 218
1197 3300053116 Ga0500592_014648 Ga0500592_014648_340_1002 218
1198 3300053119 Ga0500595_005116 Ga0500595_005116_2657_3313 218
1199 3300053119 Ga0500595_013076 Ga0500595_013076_1009_1665 218
1200 3300053121 Ga0500607_021112 Ga0500607_021112_1749_2411 218
1201 3300053130 Ga0500642_0000077 Ga0500642_0000077_37777_38439 218
1202 3300053130 Ga0500642_0012050 Ga0500642_0012050_331_993 218
1203 3300053130 Ga0500642_0035098 Ga0500642_0035098_407_1069 218
1204 3300053130 Ga0500642_0111763 Ga0500642_0111763_317_973 218
1205 3300053133 Ga0500655_012239 Ga0500655_012239_86_748 218
1206 3300053134 Ga0500658_0017657 Ga0500658_0017657_1884_2540 218
1207 3300053134 Ga0500658_0100217 Ga0500658_0100217_555_1217 218
1208 3300053134 Ga0500658_0164783 Ga0500658_0164783_321_983 218
1209 3300053136 Ga0500559_0013588 Ga0500559_0013588_819_1481 218
1210 3300053138 Ga0500564_052566 Ga0500564_052566_859_1521 218
1211 3300053140 Ga0500573_0086678 Ga0500573_0086678_737_1396 218
1212 3300053147 Ga0500589_052652 Ga0500589_052652_1191_1847 218
1213 3300053147 Ga0500589_061089 Ga0500589_061089_739_1401 218
1214 3300053147 Ga0500589_135538 Ga0500589_135538_326_982 218
1215 3300053148 Ga0500590_065456 Ga0500590_065456_869_1531 218
1216 3300053148 Ga0500590_068255 Ga0500590_068255_610_1266 218
1217 3300053150 Ga0500603_004597 Ga0500603_004597_44_703 218
1218 3300053153 Ga0500616_0083173 Ga0500616_0083173_792_1454 218
1219 3300053155 Ga0500620_001768 Ga0500620_001768_2514_3176 218
1220 3300053156 Ga0500622_0021327 Ga0500622_0021327_1826_2488 218
1221 3300053156 Ga0500622_0094635 Ga0500622_0094635_287_949 218
1222 3300053156 Ga0500622_0109746 Ga0500622_0109746_533_1189 218
1223 3300053158 Ga0500627_0040336 Ga0500627_0040336_952_1614 218
1224 3300053160 Ga0500633_0066471 Ga0500633_0066471_143_805 218
1225 3300053161 Ga0500634_0086341 Ga0500634_0086341_40_702 218
1226 3300053162 Ga0500638_005628 Ga0500638_005628_1082_1738 218
1227 3300053162 Ga0500638_022660 Ga0500638_022660_38_700 218
1228 3300053162 Ga0500638_029075 Ga0500638_029075_1294_1950 218
1229 3300053162 Ga0500638_089310 Ga0500638_089310_605_1267 218
1230 3300053162 Ga0500638_178963 Ga0500638_178963_11_670 218
1231 3300053163 Ga0500639_207576 Ga0500639_207576_88_750 218
1232 3300053178 Ga0500637_0003368 Ga0500637_0003368_1766_2422 218
1233 3300053178 Ga0500637_0190527 Ga0500637_0190527_320_982 218
1234 3300053728 Ga0500657_015026 Ga0500657_015026_833_1492 218
1235 3300053729 Ga0500625_003211 Ga0500625_003211_4059_4721 218
1236 3300053730 Ga0500645_063751 Ga0500645_063751_241_903 218
1237 3300053731 Ga0500609_004080 Ga0500609_004080_1209_1871 218
1238 3300053735 Ga0500596_003796 Ga0500596_003796_639_1298 218
1239 3300053736 Ga0500599_002110 Ga0500599_002110_1603_2265 218
1240 3300053736 Ga0500599_008015 Ga0500599_008015_294_956 218
1241 3300053737 Ga0500601_000446 Ga0500601_000446_4256_4918 218
1242 3300055283 Ga0500661_000838 Ga0500661_000838_1868_2524 218
1243 3300055283 Ga0500661_007306 Ga0500661_007306_1339_2001 218
1244 3300061719 Ga0466962_0095439 Ga0466962_0095439_703_1365 218
1245 iso_pu_bacteria 8006994254 8006996247 218

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

57

125

0.93

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

54

130

0.86

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

54

124

0.83

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

147

250

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mp4-assembly1.cif.gz_B crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure 0.8853 2 205
4mp4-assembly2.cif.gz_C-2 crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure 0.8841 2 205
4mp4-assembly2.cif.gz_C-2 crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure 0.8631 2 205
4isd-assembly2.cif.gz_C crystal structure of glutathione transferase homolog from burkholderia gl bgr1, target efi-501803, with bound glutathione 0.8434 2 205
3bby-assembly1.cif.gz_A-2 crystal structure of glutathione s-transferase (np_416804.1) from escherichia coli k12 at 1.85 a resolution 0.8394 2 205
ID Description Score Start End Superfamily
af_B6U5S1_5_83_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9003 1 87 3.40.30.10
af_B6U5S1_5_83_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8897 1 87 3.40.30.10
3ljrB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8807 2 81 3.40.30.10
1v2aB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8747 3 80 3.40.30.10
af_A0A0B5EC52_24_99_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.873 12 82 3.40.30.10
ID Description Score Start End GO Terms
AF-F7QP79-F1-model_v4 Glutathione S-transferase (EC 2.5.1.18) 0.9942 2 218 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-A0A844TFJ1-F1-model_v4 Glutathione S-transferase 0.9934 2 218 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-A0A844TFJ1-F1-model_v4 Glutathione S-transferase 0.9844 2 218 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-A0A1Q7VK14-F1-model_v4 GST N-terminal domain-containing protein 0.9805 1 216 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-A0A177M8Y9-F1-model_v4 Glutathione S-transferase 0.9802 2 216 GO:0004364
GO:0006559
GO:0006749
GO:0016034

Feature Viewer

pLDDT pTM Quality
95.4 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map