F492123
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1245 | 664 | 1041 | 219 |
Family's Representative Sequence
| Representative Sequence | 3300009098|Ga0105245_10236260|Ga0105245_102362602 |
| Length | 264 |
| Sequence | MPAHVSLLAGHHDCHAWLVAATIDWRQAMALKAAASSRPGRTRDMAALKLAIGNKNYSSWSMRPWLALRANDIPFVETVIPLYTDNPADKEQILSFSRAGKVPVLVDGDITVWDSLAIIEYIAERYPEKKLWPDDVAARAFARSVCAEMHSGFMALRGECGMNLHRPVRPVTLSADAKANVARVQEIWHICRTRYGAGGPFLFGRFGAADAMYAPVVHRFRTYAIEVAPETKAYMDTVMAMPAFQEWTRDGLAETLVIEKFETV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 5 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 6 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 7 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 8 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 9 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 10 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 11 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 12 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 13 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 14 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 15 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 16 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 17 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 18 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 19 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 20 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 21 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 22 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 23 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 24 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 25 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 26 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 27 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 28 | 2791355199 | |||
| 29 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 30 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 31 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 32 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 33 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 34 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 35 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 36 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 37 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 38 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 39 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 40 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 41 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 42 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 43 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 44 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 45 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 46 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 47 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 48 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 49 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 50 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 51 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 52 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 53 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 54 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 55 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 56 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 57 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 58 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 59 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 60 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 61 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 62 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 63 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 64 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 65 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 66 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 67 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 68 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 69 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 70 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 71 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 72 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 73 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 74 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 75 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 76 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 77 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 78 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 79 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 80 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 81 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 82 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 83 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 84 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 85 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 86 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 87 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 88 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 89 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 90 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 91 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 92 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 93 | 2904699407 | |||
| 94 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 95 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 96 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 97 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 98 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 99 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 100 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 101 | 2922368715 | |||
| 102 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 103 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 104 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 105 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 106 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 107 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 108 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 109 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 110 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 111 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 112 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 113 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 114 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 115 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 116 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 117 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 118 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 119 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 120 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 121 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 122 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 123 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 124 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 125 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 126 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 127 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 128 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 129 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 130 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 131 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 132 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 133 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 134 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 135 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 136 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 137 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 138 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 139 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 140 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 141 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 142 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 143 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 144 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 145 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 146 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 147 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 148 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 149 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 150 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 151 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 152 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 153 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 154 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 155 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 156 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 157 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 158 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 159 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 160 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 161 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 162 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 163 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 164 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 165 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 166 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 167 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 168 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 169 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 170 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 171 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 172 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 173 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 174 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 175 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 176 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 177 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 178 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 179 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 180 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 181 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 182 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 183 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 184 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 185 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 186 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 187 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 188 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 189 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 190 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 191 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 192 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 193 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 194 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 195 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 196 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 197 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 198 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 199 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 200 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 201 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 202 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 203 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 204 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 205 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 206 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 207 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 208 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 209 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 210 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 211 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 212 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 213 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 214 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 215 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 216 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 217 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 218 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 219 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 220 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 221 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 222 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 223 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 224 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 225 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 226 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 227 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 228 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 229 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 230 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 231 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 232 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 233 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 234 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 235 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 236 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 237 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 238 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 239 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 240 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 241 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 242 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 243 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 244 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 245 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 246 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 247 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 248 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 249 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 250 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 251 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 252 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 254 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 255 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 256 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 257 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 258 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 259 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 261 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 262 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 263 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 264 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 265 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 266 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 267 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 269 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 270 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 272 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 273 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 274 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 275 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 276 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 277 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 278 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 279 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 280 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 281 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 282 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 283 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 284 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 285 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 286 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 287 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 288 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 289 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 290 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 291 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 292 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 293 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 294 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 295 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 296 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 297 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 298 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 299 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 300 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 301 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 302 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 303 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 304 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 305 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 306 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 365 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 366 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 367 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 368 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 370 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 371 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 373 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 374 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 375 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 376 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 377 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 378 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 379 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 380 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 381 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 382 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 383 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 384 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 385 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 386 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 387 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 388 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 389 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 390 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 391 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 392 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 393 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 394 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 395 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 396 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 397 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 398 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 399 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 400 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 401 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 402 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 403 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 404 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 405 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 406 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 407 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 408 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 409 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 410 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 411 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 412 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 413 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 414 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 415 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 416 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 417 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 418 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 419 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 420 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 421 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 422 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 423 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 424 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 425 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 426 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 427 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 428 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 429 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 430 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 431 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 432 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 433 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 434 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 435 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 436 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 437 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 438 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 515 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 516 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 517 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 518 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 519 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 520 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 521 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 522 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 523 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 524 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 525 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 526 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 527 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 528 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 529 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 530 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 531 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 532 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 533 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 534 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 535 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 536 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 537 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 538 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 539 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 540 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 541 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 542 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 543 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 544 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 545 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 546 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 547 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 548 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 549 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 550 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 551 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 552 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 553 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 554 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 555 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 556 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 557 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 558 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 559 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 560 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 561 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 562 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 563 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 564 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 565 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 566 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 567 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 568 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 569 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 570 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 571 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 572 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 573 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 574 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 575 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 576 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 577 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 578 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 579 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 580 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 581 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 582 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 583 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 584 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 585 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 586 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 587 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 588 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 589 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 590 | 3300053114 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere | Metagenome | Endosphere |
| 591 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 592 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 593 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 594 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 595 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 596 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 597 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 598 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 599 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 600 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 601 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 602 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 603 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 604 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 605 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 606 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 607 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 608 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 609 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 610 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 611 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 612 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 613 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 614 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 615 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 616 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 617 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 618 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 619 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 620 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 621 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 622 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 623 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 624 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 625 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 626 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 627 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 628 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 629 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 630 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 631 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 632 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 633 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 634 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 635 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 636 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 637 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 638 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 639 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 640 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 641 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 642 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 643 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 644 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 645 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 646 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 647 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 648 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 649 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 650 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 651 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 652 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 653 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 654 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 655 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 656 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 657 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 658 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 659 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 660 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 661 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 662 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 663 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 664 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.9 |
| Metatranscriptomes | 0 |
| Isolates | 16.1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 19.68 |
| Nodule | 12.77 |
| Rhizoplane | 5.38 |
| Rhizosphere | 52.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.8 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24750J21931_1016458 | 3300002070 | Bacteria | 1004 |
| 2 | JGI25406J46586_10014356 | 3300003203 | Bacteria | 3371 |
| 3 | JGI25153J46596_10001560 | 3300003215 | Bacteria | 13600 |
| 4 | JGI25153J46596_10026655 | 3300003215 | Bacteria | 2041 |
| 5 | rootH1_10253088 | 3300003323 | Bacteria | 3754 |
| 6 | JGI25160J50197_1000471 | 3300003354 | Bacteria | 24649 |
| 7 | JGI25160J50197_1003264 | 3300003354 | Bacteria | 7304 |
| 8 | JGI25160J50197_1054240 | 3300003354 | Bacteria | 833 |
| 9 | JGI25404J52841_10006645 | 3300003659 | Bacteria | 2427 |
| 10 | Ga0055525_1007176 | 3300003759 | Bacteria | 942 |
| 11 | Ga0055526_1029520 | 3300003771 | Bacteria | 1625 |
| 12 | Ga0055531_10023384 | 3300003794 | Bacteria | 2318 |
| 13 | Ga0055543_1004797 | 3300004625 | Bacteria | 3595 |
| 14 | Ga0065165_1000676 | 3300005262 | Bacteria | 49091 |
| 15 | Ga0065165_1001028 | 3300005262 | Bacteria | 33815 |
| 16 | Ga0065165_1004302 | 3300005262 | Bacteria | 8962 |
| 17 | Ga0065165_1014933 | 3300005262 | Bacteria | 2989 |
| 18 | Ga0070676_10389457 | 3300005328 | Bacteria | 967 |
| 19 | Ga0070683_100079587 | 3300005329 | Bacteria | 3067 |
| 20 | Ga0070690_100004427 | 3300005330 | Bacteria | 7798 |
| 21 | Ga0070690_100450707 | 3300005330 | Bacteria | 954 |
| 22 | Ga0070670_100046591 | 3300005331 | Bacteria | 3729 |
| 23 | Ga0070670_100086065 | 3300005331 | Bacteria | 2701 |
| 24 | Ga0068869_100341008 | 3300005334 | Bacteria | 1219 |
| 25 | Ga0070680_100096083 | 3300005336 | Bacteria | 2457 |
| 26 | Ga0070682_100056399 | 3300005337 | Bacteria | 2470 |
| 27 | Ga0070682_100158735 | 3300005337 | Bacteria | 1560 |
| 28 | Ga0068868_100064444 | 3300005338 | Bacteria | 2909 |
| 29 | Ga0068868_100263019 | 3300005338 | Bacteria | 1455 |
| 30 | Ga0068868_100612619 | 3300005338 | Bacteria | 966 |
| 31 | Ga0068868_101133988 | 3300005338 | Bacteria | 721 |
| 32 | Ga0070660_100593344 | 3300005339 | Bacteria | 926 |
| 33 | Ga0070689_100203772 | 3300005340 | Bacteria | 1616 |
| 34 | Ga0070687_100016286 | 3300005343 | Bacteria | 3386 |
| 35 | Ga0070661_100054794 | 3300005344 | Bacteria | 2921 |
| 36 | Ga0070661_100323028 | 3300005344 | Bacteria | 1206 |
| 37 | Ga0070661_100323533 | 3300005344 | Bacteria | 1205 |
| 38 | Ga0070668_100026677 | 3300005347 | Bacteria | 4384 |
| 39 | Ga0070668_100055646 | 3300005347 | Bacteria | 3054 |
| 40 | Ga0070668_100317109 | 3300005347 | Bacteria | 1311 |
| 41 | Ga0070668_100366112 | 3300005347 | Bacteria | 1223 |
| 42 | Ga0070668_100387535 | 3300005347 | Bacteria | 1190 |
| 43 | Ga0070668_100527265 | 3300005347 | Bacteria | 1025 |
| 44 | Ga0070668_100981033 | 3300005347 | Bacteria | 759 |
| 45 | Ga0070669_100445269 | 3300005353 | Bacteria | 1067 |
| 46 | Ga0070675_100162118 | 3300005354 | Bacteria | 1923 |
| 47 | Ga0070671_100004070 | 3300005355 | Bacteria | 11538 |
| 48 | Ga0070674_100228264 | 3300005356 | Bacteria | 1452 |
| 49 | Ga0070674_100279351 | 3300005356 | Bacteria | 1323 |
| 50 | Ga0070674_100438268 | 3300005356 | Bacteria | 1076 |
| 51 | Ga0070673_100063368 | 3300005364 | Bacteria | 2941 |
| 52 | Ga0070673_100626823 | 3300005364 | Bacteria | 983 |
| 53 | Ga0070659_100238690 | 3300005366 | Bacteria | 1503 |
| 54 | Ga0070667_100278053 | 3300005367 | Bacteria | 1503 |
| 55 | Ga0070667_100710206 | 3300005367 | Bacteria | 931 |
| 56 | Ga0070667_100778232 | 3300005367 | Bacteria | 888 |
| 57 | Ga0070667_101069845 | 3300005367 | Bacteria | 754 |
| 58 | Ga0070709_10021834 | 3300005434 | Bacteria | 3736 |
| 59 | Ga0070714_100014004 | 3300005435 | Bacteria | 6435 |
| 60 | Ga0070714_100029874 | 3300005435 | Bacteria | 4534 |
| 61 | Ga0070714_100126094 | 3300005435 | Bacteria | 2282 |
| 62 | Ga0070714_100200117 | 3300005435 | Bacteria | 1827 |
| 63 | Ga0070713_100012520 | 3300005436 | Bacteria | 6226 |
| 64 | Ga0070713_100034225 | 3300005436 | Bacteria | 4079 |
| 65 | Ga0070713_100822162 | 3300005436 | Bacteria | 891 |
| 66 | Ga0070710_10061446 | 3300005437 | Bacteria | 2139 |
| 67 | Ga0070710_10248827 | 3300005437 | Bacteria | 1142 |
| 68 | Ga0070701_10273477 | 3300005438 | Bacteria | 1029 |
| 69 | Ga0070711_100004721 | 3300005439 | Bacteria | 8068 |
| 70 | Ga0070663_100014194 | 3300005455 | Bacteria | 5107 |
| 71 | Ga0070663_100088773 | 3300005455 | Bacteria | 2286 |
| 72 | Ga0070663_100257800 | 3300005455 | Bacteria | 1382 |
| 73 | Ga0070678_100186943 | 3300005456 | Bacteria | 1700 |
| 74 | Ga0070678_100400338 | 3300005456 | Bacteria | 1192 |
| 75 | Ga0070662_100042888 | 3300005457 | Bacteria | 3233 |
| 76 | Ga0070662_100239802 | 3300005457 | Bacteria | 1454 |
| 77 | Ga0070681_10013643 | 3300005458 | Bacteria | 8086 |
| 78 | Ga0070681_10348649 | 3300005458 | Bacteria | 1391 |
| 79 | Ga0070681_10468245 | 3300005458 | Bacteria | 1173 |
| 80 | Ga0070685_10251561 | 3300005466 | Bacteria | 1171 |
| 81 | Ga0070698_100588742 | 3300005471 | Bacteria | 1052 |
| 82 | Ga0070698_100686212 | 3300005471 | Bacteria | 966 |
| 83 | Ga0070699_100238133 | 3300005518 | Bacteria | 1624 |
| 84 | Ga0070679_100114708 | 3300005530 | Bacteria | 2680 |
| 85 | Ga0070684_100169988 | 3300005535 | Bacteria | 1980 |
| 86 | Ga0070684_100234373 | 3300005535 | Bacteria | 1676 |
| 87 | Ga0068853_100067816 | 3300005539 | Bacteria | 3100 |
| 88 | Ga0068853_100077357 | 3300005539 | Bacteria | 2906 |
| 89 | Ga0068853_100145365 | 3300005539 | Bacteria | 2131 |
| 90 | Ga0068853_100433344 | 3300005539 | Bacteria | 1234 |
| 91 | Ga0070672_100193562 | 3300005543 | Bacteria | 1699 |
| 92 | Ga0070672_100418258 | 3300005543 | Bacteria | 1151 |
| 93 | Ga0070672_100560683 | 3300005543 | Bacteria | 992 |
| 94 | Ga0070686_100918697 | 3300005544 | Bacteria | 713 |
| 95 | Ga0070693_100058244 | 3300005547 | Bacteria | 2235 |
| 96 | Ga0070665_100005911 | 3300005548 | Bacteria | 12536 |
| 97 | Ga0070665_100050816 | 3300005548 | Bacteria | 4160 |
| 98 | Ga0070665_100195652 | 3300005548 | Bacteria | 2023 |
| 99 | Ga0070665_100654806 | 3300005548 | Bacteria | 1063 |
| 100 | Ga0070665_100858703 | 3300005548 | Bacteria | 921 |
| 101 | Ga0068855_100044859 | 3300005563 | Bacteria | 5230 |
| 102 | Ga0068855_100309579 | 3300005563 | Bacteria | 1748 |
| 103 | Ga0070664_100037767 | 3300005564 | Bacteria | 4061 |
| 104 | Ga0070664_100323222 | 3300005564 | Bacteria | 1398 |
| 105 | Ga0068857_100359990 | 3300005577 | Bacteria | 1348 |
| 106 | Ga0068854_100026693 | 3300005578 | Bacteria | 3972 |
| 107 | Ga0068854_100405048 | 3300005578 | Bacteria | 1130 |
| 108 | Ga0068856_100003013 | 3300005614 | Bacteria | 17245 |
| 109 | Ga0068856_100056762 | 3300005614 | Bacteria | 3864 |
| 110 | Ga0068856_100229067 | 3300005614 | Bacteria | 1874 |
| 111 | Ga0068856_100256524 | 3300005614 | Bacteria | 1764 |
| 112 | Ga0070702_100032923 | 3300005615 | Bacteria | 2847 |
| 113 | Ga0070702_100375453 | 3300005615 | Bacteria | 1009 |
| 114 | Ga0068852_100037597 | 3300005616 | Bacteria | 4060 |
| 115 | Ga0068852_100159514 | 3300005616 | Bacteria | 2105 |
| 116 | Ga0068852_100616225 | 3300005616 | Bacteria | 1091 |
| 117 | Ga0068852_100792333 | 3300005616 | Bacteria | 961 |
| 118 | Ga0068859_100040881 | 3300005617 | Bacteria | 4657 |
| 119 | Ga0068859_100327723 | 3300005617 | Bacteria | 1625 |
| 120 | Ga0068859_101123683 | 3300005617 | Bacteria | 865 |
| 121 | Ga0068859_101326218 | 3300005617 | Bacteria | 793 |
| 122 | Ga0068864_100023148 | 3300005618 | Bacteria | 5216 |
| 123 | Ga0068864_100107412 | 3300005618 | Bacteria | 2483 |
| 124 | Ga0068864_100470002 | 3300005618 | Bacteria | 1205 |
| 125 | Ga0068866_10237859 | 3300005718 | Bacteria | 1107 |
| 126 | Ga0068861_100383509 | 3300005719 | Bacteria | 1242 |
| 127 | Ga0068861_100427563 | 3300005719 | Bacteria | 1181 |
| 128 | Ga0068870_10094649 | 3300005840 | Bacteria | 1677 |
| 129 | Ga0068870_10101180 | 3300005840 | Bacteria | 1629 |
| 130 | Ga0068863_100155365 | 3300005841 | Bacteria | 2190 |
| 131 | Ga0068863_100337609 | 3300005841 | Bacteria | 1465 |
| 132 | Ga0068863_100387813 | 3300005841 | Bacteria | 1365 |
| 133 | Ga0068858_100216246 | 3300005842 | Bacteria | 1814 |
| 134 | Ga0068858_100385350 | 3300005842 | Bacteria | 1345 |
| 135 | Ga0068860_100115291 | 3300005843 | Bacteria | 2569 |
| 136 | Ga0068860_100191475 | 3300005843 | Bacteria | 1979 |
| 137 | Ga0068860_100287751 | 3300005843 | Bacteria | 1607 |
| 138 | Ga0068860_100393161 | 3300005843 | Bacteria | 1370 |
| 139 | Ga0068860_100625168 | 3300005843 | Bacteria | 1084 |
| 140 | Ga0068862_100506583 | 3300005844 | Bacteria | 1146 |
| 141 | Ga0081455_10008218 | 3300005937 | Bacteria | 10882 |
| 142 | Ga0081455_10035420 | 3300005937 | Bacteria | 4461 |
| 143 | Ga0081455_10068340 | 3300005937 | Bacteria | 2958 |
| 144 | Ga0081455_10082648 | 3300005937 | Bacteria | 2627 |
| 145 | Ga0081540_1000565 | 3300005983 | Bacteria | 35910 |
| 146 | Ga0081540_1001009 | 3300005983 | Bacteria | 25255 |
| 147 | Ga0081540_1005680 | 3300005983 | Bacteria | 9270 |
| 148 | Ga0081540_1006403 | 3300005983 | Bacteria | 8581 |
| 149 | Ga0081540_1021104 | 3300005983 | Bacteria | 3893 |
| 150 | Ga0081540_1040102 | 3300005983 | Bacteria | 2445 |
| 151 | Ga0081540_1045259 | 3300005983 | Bacteria | 2237 |
| 152 | Ga0081540_1065883 | 3300005983 | Bacteria | 1700 |
| 153 | Ga0081540_1085085 | 3300005983 | Bacteria | 1409 |
| 154 | Ga0081539_10001416 | 3300005985 | Bacteria | 41282 |
| 155 | Ga0081539_10013324 | 3300005985 | Bacteria | 6202 |
| 156 | Ga0081539_10025700 | 3300005985 | Bacteria | 3780 |
| 157 | Ga0081539_10153426 | 3300005985 | Bacteria | 1106 |
| 158 | Ga0070717_10032963 | 3300006028 | Bacteria | 4177 |
| 159 | Ga0070717_10419413 | 3300006028 | Bacteria | 1204 |
| 160 | Ga0075365_10011750 | 3300006038 | Bacteria | 5163 |
| 161 | Ga0075365_10015504 | 3300006038 | Bacteria | 4612 |
| 162 | Ga0075365_10035365 | 3300006038 | Bacteria | 3231 |
| 163 | Ga0075365_10087322 | 3300006038 | Bacteria | 2120 |
| 164 | Ga0075365_10106223 | 3300006038 | Bacteria | 1926 |
| 165 | Ga0075365_10117466 | 3300006038 | Bacteria | 1832 |
| 166 | Ga0075365_10125621 | 3300006038 | Bacteria | 1772 |
| 167 | Ga0075365_10162133 | 3300006038 | Bacteria | 1558 |
| 168 | Ga0075365_10332486 | 3300006038 | Bacteria | 1070 |
| 169 | Ga0075365_10364919 | 3300006038 | Bacteria | 1018 |
| 170 | Ga0075368_10005658 | 3300006042 | Bacteria | 4315 |
| 171 | Ga0075368_10012370 | 3300006042 | Bacteria | 3118 |
| 172 | Ga0075368_10028085 | 3300006042 | Bacteria | 2172 |
| 173 | Ga0075363_100000880 | 3300006048 | Bacteria | 10553 |
| 174 | Ga0075363_100019979 | 3300006048 | Bacteria | 3355 |
| 175 | Ga0075363_100082056 | 3300006048 | Bacteria | 1764 |
| 176 | Ga0075363_100156238 | 3300006048 | Bacteria | 1289 |
| 177 | Ga0075363_100222179 | 3300006048 | Bacteria | 1083 |
| 178 | Ga0075363_100363162 | 3300006048 | Bacteria | 847 |
| 179 | Ga0075364_10009112 | 3300006051 | Bacteria | 5944 |
| 180 | Ga0075364_10019087 | 3300006051 | Bacteria | 4301 |
| 181 | Ga0075364_10065710 | 3300006051 | Bacteria | 2381 |
| 182 | Ga0075364_10095437 | 3300006051 | Bacteria | 1977 |
| 183 | Ga0075364_10140052 | 3300006051 | Bacteria | 1627 |
| 184 | Ga0075364_10176103 | 3300006051 | Bacteria | 1446 |
| 185 | Ga0075432_10110782 | 3300006058 | Bacteria | 1023 |
| 186 | Ga0070716_100122791 | 3300006173 | Bacteria | 1629 |
| 187 | Ga0070712_100042726 | 3300006175 | Bacteria | 3118 |
| 188 | Ga0075362_10029004 | 3300006177 | Bacteria | 2381 |
| 189 | Ga0075362_10042719 | 3300006177 | Bacteria | 2005 |
| 190 | Ga0075362_10107869 | 3300006177 | Bacteria | 1308 |
| 191 | Ga0075362_10121203 | 3300006177 | Bacteria | 1238 |
| 192 | Ga0075362_10153885 | 3300006177 | Bacteria | 1104 |
| 193 | Ga0075362_10201582 | 3300006177 | Bacteria | 969 |
| 194 | Ga0075367_10019651 | 3300006178 | Bacteria | 3749 |
| 195 | Ga0075367_10025247 | 3300006178 | Bacteria | 3359 |
| 196 | Ga0075367_10046062 | 3300006178 | Bacteria | 2561 |
| 197 | Ga0075367_10060985 | 3300006178 | Bacteria | 2250 |
| 198 | Ga0075367_10067004 | 3300006178 | Bacteria | 2152 |
| 199 | Ga0075367_10191734 | 3300006178 | Bacteria | 1275 |
| 200 | Ga0075369_10014996 | 3300006186 | Bacteria | 3103 |
| 201 | Ga0075369_10091439 | 3300006186 | Bacteria | 1358 |
| 202 | Ga0075366_10042978 | 3300006195 | Bacteria | 2676 |
| 203 | Ga0075366_10062328 | 3300006195 | Bacteria | 2216 |
| 204 | Ga0075366_10104305 | 3300006195 | Bacteria | 1703 |
| 205 | Ga0075366_10122491 | 3300006195 | Bacteria | 1567 |
| 206 | Ga0075366_10177709 | 3300006195 | Bacteria | 1292 |
| 207 | Ga0075366_10234143 | 3300006195 | Bacteria | 1119 |
| 208 | Ga0075366_10250692 | 3300006195 | Bacteria | 1080 |
| 209 | Ga0097621_100175580 | 3300006237 | Bacteria | 1849 |
| 210 | Ga0075370_10033831 | 3300006353 | Bacteria | 2863 |
| 211 | Ga0075370_10043409 | 3300006353 | Bacteria | 2541 |
| 212 | Ga0075370_10052172 | 3300006353 | Bacteria | 2319 |
| 213 | Ga0075370_10079942 | 3300006353 | Bacteria | 1878 |
| 214 | Ga0075370_10096250 | 3300006353 | Bacteria | 1710 |
| 215 | Ga0068871_100304461 | 3300006358 | Bacteria | 1400 |
| 216 | Ga0068871_100474964 | 3300006358 | Bacteria | 1124 |
| 217 | Ga0075428_100085520 | 3300006844 | Bacteria | 3439 |
| 218 | Ga0075431_100453439 | 3300006847 | Bacteria | 1278 |
| 219 | Ga0075434_100162290 | 3300006871 | Bacteria | 2254 |
| 220 | Ga0075436_100067047 | 3300006914 | Bacteria | 2481 |
| 221 | Ga0097620_100040883 | 3300006931 | Bacteria | 4657 |
| 222 | Ga0097620_100327726 | 3300006931 | Bacteria | 1625 |
| 223 | Ga0097620_101123610 | 3300006931 | Bacteria | 865 |
| 224 | Ga0097620_101326648 | 3300006931 | Bacteria | 793 |
| 225 | Ga0099825_1040584 | 3300006941 | Bacteria | 1375 |
| 226 | Ga0099824_1006697 | 3300006942 | Bacteria | 15679 |
| 227 | Ga0099824_1015025 | 3300006942 | Bacteria | 7487 |
| 228 | Ga0075435_100017984 | 3300007076 | Bacteria | 5361 |
| 229 | Ga0075435_100460014 | 3300007076 | Bacteria | 1098 |
| 230 | Ga0099794_10046548 | 3300007265 | Bacteria | 2078 |
| 231 | Ga0099795_10010942 | 3300007788 | Bacteria | 2691 |
| 232 | Ga0105250_10129780 | 3300009092 | Bacteria | 1040 |
| 233 | Ga0105240_10025515 | 3300009093 | Bacteria | 7765 |
| 234 | Ga0105240_10109631 | 3300009093 | Bacteria | 3343 |
| 235 | Ga0105240_11111430 | 3300009093 | Bacteria | 840 |
| 236 | Ga0111539_10010826 | 3300009094 | Bacteria | 11484 |
| 237 | Ga0111539_10522638 | 3300009094 | Bacteria | 1383 |
| 238 | Ga0105245_10040987 | 3300009098 | Bacteria | 4127 |
| 239 | Ga0105245_10236260 | 3300009098 | Bacteria | 1770 |
| 240 | Ga0105245_10317873 | 3300009098 | Bacteria | 1533 |
| 241 | Ga0105247_10042883 | 3300009101 | Bacteria | 2771 |
| 242 | Ga0105247_10199743 | 3300009101 | Bacteria | 1343 |
| 243 | Ga0105247_10247390 | 3300009101 | Bacteria | 1217 |
| 244 | Ga0105247_10266257 | 3300009101 | Bacteria | 1177 |
| 245 | Ga0105247_10267345 | 3300009101 | Bacteria | 1175 |
| 246 | Ga0105247_10371671 | 3300009101 | Bacteria | 1011 |
| 247 | Ga0114129_10572337 | 3300009147 | Bacteria | 1467 |
| 248 | Ga0105243_10071572 | 3300009148 | Bacteria | 2804 |
| 249 | Ga0105243_10301725 | 3300009148 | Bacteria | 1452 |
| 250 | Ga0105243_10361040 | 3300009148 | Bacteria | 1337 |
| 251 | Ga0105241_10118471 | 3300009174 | Bacteria | 2129 |
| 252 | Ga0105241_10131433 | 3300009174 | Bacteria | 2027 |
| 253 | Ga0105241_10299360 | 3300009174 | Bacteria | 1380 |
| 254 | Ga0105248_10360990 | 3300009177 | Bacteria | 1635 |
| 255 | Ga0105237_10008457 | 3300009545 | Bacteria | 11137 |
| 256 | Ga0105237_10125043 | 3300009545 | Bacteria | 2566 |
| 257 | Ga0105237_10501605 | 3300009545 | Bacteria | 1220 |
| 258 | Ga0105237_10636519 | 3300009545 | Bacteria | 1073 |
| 259 | Ga0105238_10035756 | 3300009551 | Bacteria | 5049 |
| 260 | Ga0105238_10109774 | 3300009551 | Bacteria | 2740 |
| 261 | Ga0105238_10146736 | 3300009551 | Bacteria | 2335 |
| 262 | Ga0105238_10219790 | 3300009551 | Bacteria | 1876 |
| 263 | Ga0105238_10230700 | 3300009551 | Bacteria | 1828 |
| 264 | Ga0105238_10257525 | 3300009551 | Bacteria | 1724 |
| 265 | Ga0105249_10340285 | 3300009553 | Bacteria | 1517 |
| 266 | Ga0105249_10743862 | 3300009553 | Bacteria | 1042 |
| 267 | Ga0105249_10786915 | 3300009553 | Bacteria | 1015 |
| 268 | Ga0105249_10966653 | 3300009553 | Bacteria | 920 |
| 269 | Ga0105239_10046697 | 3300010375 | Bacteria | 4746 |
| 270 | Ga0105239_10050580 | 3300010375 | Bacteria | 4557 |
| 271 | Ga0105239_10099732 | 3300010375 | Bacteria | 3211 |
| 272 | Ga0105239_10177285 | 3300010375 | Bacteria | 2384 |
| 273 | Ga0105239_11035849 | 3300010375 | Bacteria | 944 |
| 274 | Ga0105246_10074369 | 3300011119 | Bacteria | 2402 |
| 275 | Ga0105246_10281708 | 3300011119 | Bacteria | 1334 |
| 276 | Ga0105246_10300738 | 3300011119 | Bacteria | 1295 |
| 277 | Ga0105246_10410575 | 3300011119 | Bacteria | 1127 |
| 278 | Ga0157374_10010340 | 3300013296 | Bacteria | 8026 |
| 279 | Ga0157374_10102780 | 3300013296 | Bacteria | 2741 |
| 280 | Ga0157374_10138060 | 3300013296 | Bacteria | 2365 |
| 281 | Ga0157374_10745262 | 3300013296 | Bacteria | 994 |
| 282 | Ga0157378_10196236 | 3300013297 | Bacteria | 1907 |
| 283 | Ga0157378_10496673 | 3300013297 | Bacteria | 1218 |
| 284 | Ga0157378_11594091 | 3300013297 | Bacteria | 699 |
| 285 | Ga0163162_10015299 | 3300013306 | Bacteria | 7494 |
| 286 | Ga0163162_11243508 | 3300013306 | Bacteria | 845 |
| 287 | Ga0157372_10281861 | 3300013307 | Bacteria | 1932 |
| 288 | Ga0157375_10025490 | 3300013308 | Bacteria | 5495 |
| 289 | Ga0163163_10020877 | 3300014325 | Bacteria | 6175 |
| 290 | Ga0163163_10038915 | 3300014325 | Bacteria | 4638 |
| 291 | Ga0163163_10119746 | 3300014325 | Bacteria | 2666 |
| 292 | Ga0163163_10223609 | 3300014325 | Bacteria | 1931 |
| 293 | Ga0163163_10762099 | 3300014325 | Bacteria | 1031 |
| 294 | Ga0157380_10545568 | 3300014326 | Bacteria | 1136 |
| 295 | Ga0157376_10002196 | 3300014969 | Bacteria | 13158 |
| 296 | Ga0157376_10267181 | 3300014969 | Bacteria | 1605 |
| 297 | Ga0163161_10095823 | 3300017792 | Bacteria | 2202 |
| 298 | Ga0163161_10217268 | 3300017792 | Bacteria | 1479 |
| 299 | Ga0163161_10245871 | 3300017792 | Bacteria | 1393 |
| 300 | Ga0163161_10305165 | 3300017792 | Bacteria | 1255 |
| 301 | Ga0214544_1003958 | 3300021320 | Bacteria | 30115 |
| 302 | Ga0214542_1000002 | 3300021321 | Bacteria | 720798 |
| 303 | Ga0214545_1000002 | 3300021324 | Bacteria | 727485 |
| 304 | Ga0214543_1000013 | 3300021327 | Bacteria | 329117 |
| 305 | Ga0213873_10004067 | 3300021358 | Bacteria | 2696 |
| 306 | Ga0213876_10002558 | 3300021384 | Bacteria | 10644 |
| 307 | Ga0213876_10308640 | 3300021384 | Bacteria | 841 |
| 308 | Ga0213871_10001798 | 3300021441 | Bacteria | 3741 |
| 309 | Ga0209563_108420 | 3300025230 | Bacteria | 1628 |
| 310 | Ga0209677_103580 | 3300025253 | Bacteria | 4939 |
| 311 | Ga0209148_1000319 | 3300025254 | Bacteria | 67129 |
| 312 | Ga0209233_1001148 | 3300025261 | Bacteria | 10790 |
| 313 | Ga0209233_1008818 | 3300025261 | Bacteria | 3096 |
| 314 | Ga0209455_1003913 | 3300025272 | Bacteria | 5078 |
| 315 | Ga0209455_1005042 | 3300025272 | Bacteria | 4179 |
| 316 | Ga0209455_1006371 | 3300025272 | Bacteria | 3493 |
| 317 | Ga0209673_1042772 | 3300025273 | Bacteria | 1271 |
| 318 | Ga0209564_1006114 | 3300025295 | Bacteria | 6608 |
| 319 | Ga0209758_1000100 | 3300025297 | Bacteria | 227948 |
| 320 | Ga0209758_1000138 | 3300025297 | Bacteria | 175187 |
| 321 | Ga0209758_1000569 | 3300025297 | Bacteria | 57936 |
| 322 | Ga0209758_1001091 | 3300025297 | Bacteria | 35146 |
| 323 | Ga0209758_1001321 | 3300025297 | Bacteria | 30110 |
| 324 | Ga0209758_1015098 | 3300025297 | Bacteria | 4034 |
| 325 | Ga0209758_1029333 | 3300025297 | Bacteria | 2303 |
| 326 | Ga0209256_1016482 | 3300025299 | Bacteria | 2515 |
| 327 | Ga0207426_1000575 | 3300025302 | Bacteria | 49342 |
| 328 | Ga0207426_1000611 | 3300025302 | Bacteria | 46127 |
| 329 | Ga0207426_1005308 | 3300025302 | Bacteria | 5932 |
| 330 | Ga0207426_1052117 | 3300025302 | Bacteria | 1213 |
| 331 | Ga0207426_1074254 | 3300025302 | Bacteria | 939 |
| 332 | Ga0209257_1002363 | 3300025304 | Bacteria | 18933 |
| 333 | Ga0209257_1016653 | 3300025304 | Bacteria | 2957 |
| 334 | Ga0209257_1019833 | 3300025304 | Bacteria | 2513 |
| 335 | Ga0207697_10084198 | 3300025315 | Bacteria | 1342 |
| 336 | Ga0207692_10050274 | 3300025898 | Bacteria | 2107 |
| 337 | Ga0207692_10223243 | 3300025898 | Bacteria | 1118 |
| 338 | Ga0207710_10041299 | 3300025900 | Bacteria | 2045 |
| 339 | Ga0207710_10044680 | 3300025900 | Bacteria | 1973 |
| 340 | Ga0207710_10104578 | 3300025900 | Bacteria | 1339 |
| 341 | Ga0207710_10294336 | 3300025900 | Bacteria | 819 |
| 342 | Ga0207688_10079090 | 3300025901 | Bacteria | 1875 |
| 343 | Ga0207688_10110472 | 3300025901 | Bacteria | 1595 |
| 344 | Ga0207647_10046642 | 3300025904 | Bacteria | 2699 |
| 345 | Ga0207699_10021053 | 3300025906 | Bacteria | 3507 |
| 346 | Ga0207645_10053681 | 3300025907 | Bacteria | 2575 |
| 347 | Ga0207645_10521149 | 3300025907 | Bacteria | 805 |
| 348 | Ga0207643_10085357 | 3300025908 | Bacteria | 1833 |
| 349 | Ga0207705_10367437 | 3300025909 | Bacteria | 1110 |
| 350 | Ga0207705_10407268 | 3300025909 | Bacteria | 1052 |
| 351 | Ga0207654_10108977 | 3300025911 | Bacteria | 1719 |
| 352 | Ga0207654_10119307 | 3300025911 | Bacteria | 1654 |
| 353 | Ga0207654_10424303 | 3300025911 | Bacteria | 928 |
| 354 | Ga0207654_10732839 | 3300025911 | Bacteria | 711 |
| 355 | Ga0207707_10146318 | 3300025912 | Bacteria | 2066 |
| 356 | Ga0207707_10413505 | 3300025912 | Bacteria | 1157 |
| 357 | Ga0207695_10000342 | 3300025913 | Bacteria | 108393 |
| 358 | Ga0207671_10018432 | 3300025914 | Bacteria | 5355 |
| 359 | Ga0207671_10055842 | 3300025914 | Bacteria | 2926 |
| 360 | Ga0207671_10108951 | 3300025914 | Bacteria | 2105 |
| 361 | Ga0207671_10659809 | 3300025914 | Bacteria | 833 |
| 362 | Ga0207693_10012619 | 3300025915 | Bacteria | 6827 |
| 363 | Ga0207693_10053523 | 3300025915 | Bacteria | 3167 |
| 364 | Ga0207663_10294821 | 3300025916 | Bacteria | 1209 |
| 365 | Ga0207662_10009080 | 3300025918 | Bacteria | 5462 |
| 366 | Ga0207657_10475408 | 3300025919 | Bacteria | 980 |
| 367 | Ga0207657_10518817 | 3300025919 | Bacteria | 933 |
| 368 | Ga0207649_10040728 | 3300025920 | Bacteria | 2826 |
| 369 | Ga0207652_10021542 | 3300025921 | Bacteria | 5319 |
| 370 | Ga0207652_10602962 | 3300025921 | Bacteria | 985 |
| 371 | Ga0207681_10206176 | 3300025923 | Bacteria | 1512 |
| 372 | Ga0207694_10050067 | 3300025924 | Bacteria | 3234 |
| 373 | Ga0207694_10058879 | 3300025924 | Bacteria | 2988 |
| 374 | Ga0207694_10168659 | 3300025924 | Bacteria | 1771 |
| 375 | Ga0207650_10218404 | 3300025925 | Bacteria | 1533 |
| 376 | Ga0207650_10506633 | 3300025925 | Bacteria | 1009 |
| 377 | Ga0207650_10649668 | 3300025925 | Bacteria | 889 |
| 378 | Ga0207659_10163121 | 3300025926 | Bacteria | 1752 |
| 379 | Ga0207687_10007169 | 3300025927 | Bacteria | 7349 |
| 380 | Ga0207687_10113616 | 3300025927 | Bacteria | 2015 |
| 381 | Ga0207700_10034864 | 3300025928 | Bacteria | 3617 |
| 382 | Ga0207700_10041545 | 3300025928 | Bacteria | 3365 |
| 383 | Ga0207664_10106019 | 3300025929 | Bacteria | 2330 |
| 384 | Ga0207664_10423961 | 3300025929 | Bacteria | 1185 |
| 385 | Ga0207644_10231862 | 3300025931 | Bacteria | 1467 |
| 386 | Ga0207644_10726381 | 3300025931 | Bacteria | 829 |
| 387 | Ga0207690_10294332 | 3300025932 | Bacteria | 1268 |
| 388 | Ga0207706_10077308 | 3300025933 | Bacteria | 2927 |
| 389 | Ga0207706_10099415 | 3300025933 | Bacteria | 2560 |
| 390 | Ga0207706_10277211 | 3300025933 | Bacteria | 1463 |
| 391 | Ga0207706_10364253 | 3300025933 | Bacteria | 1256 |
| 392 | Ga0207706_10640314 | 3300025933 | Bacteria | 911 |
| 393 | Ga0207686_10169929 | 3300025934 | Bacteria | 1537 |
| 394 | Ga0207709_10125286 | 3300025935 | Bacteria | 1741 |
| 395 | Ga0207670_10139288 | 3300025936 | Bacteria | 1787 |
| 396 | Ga0207669_10230111 | 3300025937 | Bacteria | 1367 |
| 397 | Ga0207704_10347613 | 3300025938 | Bacteria | 1153 |
| 398 | Ga0207704_10610100 | 3300025938 | Bacteria | 894 |
| 399 | Ga0207665_10041812 | 3300025939 | Bacteria | 3063 |
| 400 | Ga0207665_10101483 | 3300025939 | Bacteria | 2009 |
| 401 | Ga0207691_10062798 | 3300025940 | Bacteria | 3369 |
| 402 | Ga0207711_10665094 | 3300025941 | Bacteria | 972 |
| 403 | Ga0207711_10800613 | 3300025941 | Bacteria | 878 |
| 404 | Ga0207689_10329768 | 3300025942 | Bacteria | 1267 |
| 405 | Ga0207661_10090619 | 3300025944 | Bacteria | 2546 |
| 406 | Ga0207661_10293056 | 3300025944 | Bacteria | 1457 |
| 407 | Ga0207679_10157649 | 3300025945 | Bacteria | 1855 |
| 408 | Ga0207679_10398804 | 3300025945 | Bacteria | 1210 |
| 409 | Ga0207679_10579505 | 3300025945 | Bacteria | 1009 |
| 410 | Ga0207667_10087606 | 3300025949 | Bacteria | 3220 |
| 411 | Ga0207667_10134941 | 3300025949 | Bacteria | 2541 |
| 412 | Ga0207667_10749069 | 3300025949 | Bacteria | 976 |
| 413 | Ga0207651_10096535 | 3300025960 | Bacteria | 2180 |
| 414 | Ga0207651_10601399 | 3300025960 | Bacteria | 961 |
| 415 | Ga0207712_10273374 | 3300025961 | Bacteria | 1376 |
| 416 | Ga0207712_10468502 | 3300025961 | Bacteria | 1072 |
| 417 | Ga0207668_10050571 | 3300025972 | Bacteria | 2865 |
| 418 | Ga0207668_10094403 | 3300025972 | Bacteria | 2205 |
| 419 | Ga0207668_10261856 | 3300025972 | Bacteria | 1409 |
| 420 | Ga0207668_10302464 | 3300025972 | Bacteria | 1320 |
| 421 | Ga0207640_10361311 | 3300025981 | Bacteria | 1170 |
| 422 | Ga0207640_10447573 | 3300025981 | Bacteria | 1064 |
| 423 | Ga0207640_10496898 | 3300025981 | Bacteria | 1015 |
| 424 | Ga0207640_10538620 | 3300025981 | Bacteria | 979 |
| 425 | Ga0207658_10078350 | 3300025986 | Bacteria | 2525 |
| 426 | Ga0207658_10079444 | 3300025986 | Bacteria | 2509 |
| 427 | Ga0207658_10156056 | 3300025986 | Bacteria | 1865 |
| 428 | Ga0207677_10334582 | 3300026023 | Bacteria | 1263 |
| 429 | Ga0207703_10068579 | 3300026035 | Bacteria | 2922 |
| 430 | Ga0207703_10108068 | 3300026035 | Bacteria | 2369 |
| 431 | Ga0207703_10290027 | 3300026035 | Bacteria | 1489 |
| 432 | Ga0207703_10508839 | 3300026035 | Bacteria | 1131 |
| 433 | Ga0207678_10020589 | 3300026067 | Bacteria | 5784 |
| 434 | Ga0207678_10025740 | 3300026067 | Bacteria | 5135 |
| 435 | Ga0207678_10064623 | 3300026067 | Bacteria | 3144 |
| 436 | Ga0207678_10064668 | 3300026067 | Bacteria | 3143 |
| 437 | Ga0207678_10070693 | 3300026067 | Bacteria | 2992 |
| 438 | Ga0207678_10267080 | 3300026067 | Bacteria | 1467 |
| 439 | Ga0207708_10301281 | 3300026075 | Bacteria | 1304 |
| 440 | Ga0207708_10306518 | 3300026075 | Bacteria | 1293 |
| 441 | Ga0207708_10379312 | 3300026075 | Bacteria | 1165 |
| 442 | Ga0207702_10000365 | 3300026078 | Bacteria | 51814 |
| 443 | Ga0207702_10410380 | 3300026078 | Bacteria | 1308 |
| 444 | Ga0207641_10232456 | 3300026088 | Bacteria | 1714 |
| 445 | Ga0207641_10579918 | 3300026088 | Bacteria | 1096 |
| 446 | Ga0207641_10638652 | 3300026088 | Bacteria | 1045 |
| 447 | Ga0207641_10877230 | 3300026088 | Bacteria | 890 |
| 448 | Ga0207641_10958158 | 3300026088 | Bacteria | 851 |
| 449 | Ga0207648_10043577 | 3300026089 | Bacteria | 3939 |
| 450 | Ga0207676_10071416 | 3300026095 | Bacteria | 2787 |
| 451 | Ga0207676_10229029 | 3300026095 | Bacteria | 1660 |
| 452 | Ga0207676_10329485 | 3300026095 | Bacteria | 1405 |
| 453 | Ga0207676_10479854 | 3300026095 | Bacteria | 1177 |
| 454 | Ga0207676_10596069 | 3300026095 | Bacteria | 1061 |
| 455 | Ga0207676_10681464 | 3300026095 | Bacteria | 994 |
| 456 | Ga0207674_10045583 | 3300026116 | Bacteria | 4509 |
| 457 | Ga0207674_10708110 | 3300026116 | Bacteria | 972 |
| 458 | Ga0207675_100283259 | 3300026118 | Bacteria | 1611 |
| 459 | Ga0207675_100449173 | 3300026118 | Bacteria | 1277 |
| 460 | Ga0207683_10044978 | 3300026121 | Bacteria | 3860 |
| 461 | Ga0207683_10056308 | 3300026121 | Bacteria | 3448 |
| 462 | Ga0207683_10269411 | 3300026121 | Bacteria | 1555 |
| 463 | Ga0207683_10635355 | 3300026121 | Bacteria | 989 |
| 464 | Ga0207698_10132848 | 3300026142 | Bacteria | 2130 |
| 465 | Ga0207698_10531214 | 3300026142 | Bacteria | 1150 |
| 466 | Ga0209389_1000092 | 3300027296 | Bacteria | 82555 |
| 467 | Ga0209389_1002136 | 3300027296 | Bacteria | 14827 |
| 468 | Ga0209589_1000115 | 3300027357 | Bacteria | 82537 |
| 469 | Ga0209489_100340 | 3300027361 | Bacteria | 82555 |
| 470 | Ga0209489_109127 | 3300027361 | Bacteria | 12657 |
| 471 | Ga0209700_100117 | 3300027363 | Bacteria | 115595 |
| 472 | Ga0209588_1033615 | 3300027671 | Bacteria | 1645 |
| 473 | Ga0209813_10004007 | 3300027866 | Bacteria | 3489 |
| 474 | Ga0209813_10037770 | 3300027866 | Bacteria | 1457 |
| 475 | Ga0207428_10032809 | 3300027907 | Bacteria | 4270 |
| 476 | Ga0268266_10002227 | 3300028379 | Bacteria | 21177 |
| 477 | Ga0268266_10034535 | 3300028379 | Bacteria | 4301 |
| 478 | Ga0268266_10085947 | 3300028379 | Bacteria | 2749 |
| 479 | Ga0268265_10026937 | 3300028380 | Bacteria | 4095 |
| 480 | Ga0268265_10107968 | 3300028380 | Bacteria | 2265 |
| 481 | Ga0268265_10189532 | 3300028380 | Bacteria | 1774 |
| 482 | Ga0268265_10406584 | 3300028380 | Bacteria | 1260 |
| 483 | Ga0268265_10605595 | 3300028380 | Bacteria | 1047 |
| 484 | Ga0268264_10659322 | 3300028381 | Bacteria | 1036 |
| 485 | Ga0265318_10127784 | 3300028577 | Bacteria | 934 |
| 486 | Ga0307517_10176597 | 3300028786 | Bacteria | 1389 |
| 487 | Ga0307517_10231704 | 3300028786 | Bacteria | 1107 |
| 488 | Ga0307511_10052383 | 3300030521 | Bacteria | 3252 |
| 489 | Ga0265330_10078568 | 3300031235 | Bacteria | 1423 |
| 490 | Ga0265330_10124858 | 3300031235 | Bacteria | 1096 |
| 491 | Ga0265340_10011504 | 3300031247 | Bacteria | 4702 |
| 492 | Ga0265339_10011623 | 3300031249 | Bacteria | 5410 |
| 493 | Ga0265339_10051301 | 3300031249 | Bacteria | 2252 |
| 494 | Ga0265331_10085132 | 3300031250 | Bacteria | 1465 |
| 495 | Ga0265331_10200945 | 3300031250 | Bacteria | 898 |
| 496 | Ga0265316_10049602 | 3300031344 | Bacteria | 3306 |
| 497 | Ga0265316_10367120 | 3300031344 | Bacteria | 1040 |
| 498 | Ga0307509_10101865 | 3300031507 | Bacteria | 2904 |
| 499 | Ga0307509_10134654 | 3300031507 | Bacteria | 2418 |
| 500 | Ga0307509_10431683 | 3300031507 | Bacteria | 1016 |
| 501 | Ga0307509_10629332 | 3300031507 | Bacteria | 743 |
| 502 | Ga0307408_100549942 | 3300031548 | Bacteria | 1018 |
| 503 | Ga0307508_10292536 | 3300031616 | Bacteria | 1222 |
| 504 | Ga0307508_10420005 | 3300031616 | Bacteria | 929 |
| 505 | Ga0265342_10011923 | 3300031712 | Bacteria | 5914 |
| 506 | Ga0307516_10104028 | 3300031730 | Bacteria | 2652 |
| 507 | Ga0307516_10166562 | 3300031730 | Bacteria | 1948 |
| 508 | Ga0307405_10172869 | 3300031731 | Bacteria | 1543 |
| 509 | Ga0307413_10037092 | 3300031824 | Bacteria | 2813 |
| 510 | Ga0307413_10135965 | 3300031824 | Bacteria | 1690 |
| 511 | Ga0307413_10319439 | 3300031824 | Bacteria | 1185 |
| 512 | Ga0307410_10183059 | 3300031852 | Bacteria | 1587 |
| 513 | Ga0307406_10356982 | 3300031901 | Bacteria | 1144 |
| 514 | Ga0307407_10040269 | 3300031903 | Bacteria | 2604 |
| 515 | Ga0307407_10159405 | 3300031903 | Bacteria | 1475 |
| 516 | Ga0307407_10293913 | 3300031903 | Bacteria | 1130 |
| 517 | Ga0307412_10298454 | 3300031911 | Bacteria | 1272 |
| 518 | Ga0307409_100030635 | 3300031995 | Bacteria | 3869 |
| 519 | Ga0307409_100051841 | 3300031995 | Bacteria | 3142 |
| 520 | Ga0307409_100653531 | 3300031995 | Bacteria | 1045 |
| 521 | Ga0307414_10384567 | 3300032004 | Bacteria | 1214 |
| 522 | Ga0307411_10018506 | 3300032005 | Bacteria | 3998 |
| 523 | Ga0307411_10356091 | 3300032005 | Bacteria | 1195 |
| 524 | Ga0307415_100164140 | 3300032126 | Bacteria | 1725 |
| 525 | Ga0307415_100212714 | 3300032126 | Bacteria | 1544 |
| 526 | Ga0307415_100249852 | 3300032126 | Bacteria | 1440 |
| 527 | Ga0307507_10045182 | 3300033179 | Bacteria | 4338 |
| 528 | Ga0307510_10006740 | 3300033180 | Bacteria | 13693 |
| 529 | Ga0307510_10030910 | 3300033180 | Bacteria | 6062 |
| 530 | Ga0307510_10154786 | 3300033180 | Bacteria | 1902 |
| 531 | Ga0307510_10367787 | 3300033180 | Bacteria | 885 |
| 532 | Ga0373936_0056906 | 3300035113 | Bacteria | 1590 |
| 533 | Ga0373936_0108226 | 3300035113 | Bacteria | 1178 |
| 534 | Ga0373945_0216318 | 3300035116 | Bacteria | 800 |
| 535 | Ga0373954_0247191 | 3300035118 | Bacteria | 878 |
| 536 | Ga0373956_0157187 | 3300035119 | Bacteria | 1071 |
| 537 | Ga0373955_0000411 | 3300035172 | Bacteria | 18219 |
| 538 | Ga0373924_0002005 | 3300035410 | Bacteria | 6773 |
| 539 | Ga0373931_0641833 | 3300035691 | Bacteria | 697 |
| 540 | Ga0373935_0032588 | 3300035692 | Bacteria | 3238 |
| 541 | Ga0373935_0106653 | 3300035692 | Bacteria | 1854 |
| 542 | Ga0373927_0002098 | 3300035695 | Bacteria | 14719 |
| 543 | Ga0373927_0045109 | 3300035695 | Bacteria | 2852 |
| 544 | Ga0373927_0096108 | 3300035695 | Bacteria | 1926 |
| 545 | Ga0373933_0000276 | 3300035724 | Bacteria | 33468 |
| 546 | Ga0373933_0023096 | 3300035724 | Bacteria | 3549 |
| 547 | Ga0373947_0203298 | 3300035725 | Bacteria | 1297 |
| 548 | Ga0373937_0004238 | 3300036401 | Bacteria | 12157 |
| 549 | Ga0373925_0032076 | 3300037068 | Bacteria | 3865 |
| 550 | Ga0373925_0384840 | 3300037068 | Bacteria | 1143 |
| 551 | Ga0373925_0715220 | 3300037068 | Bacteria | 826 |
| 552 | Ga0395900_0000601 | 3300037418 | Bacteria | 49219 |
| 553 | Ga0395900_0663087 | 3300037418 | Bacteria | 979 |
| 554 | Ga0395898_0136215 | 3300037466 | Bacteria | 2351 |
| 555 | Ga0395898_0950447 | 3300037466 | Bacteria | 796 |
| 556 | Ga0395905_0042342 | 3300037471 | Bacteria | 4273 |
| 557 | Ga0395905_0047738 | 3300037471 | Bacteria | 4011 |
| 558 | Ga0395905_0523900 | 3300037471 | Bacteria | 1086 |
| 559 | Ga0395901_0174292 | 3300038443 | Bacteria | 2256 |
| 560 | Ga0395901_0402113 | 3300038443 | Bacteria | 1407 |
| 561 | Ga0395901_0612358 | 3300038443 | Bacteria | 1097 |
| 562 | Ga0395901_0763651 | 3300038443 | Bacteria | 959 |
| 563 | Ga0436365_0074464 | 3300039437 | Bacteria | 14893 |
| 564 | Ga0436365_0491407 | 3300039437 | Bacteria | 992 |
| 565 | Ga0436365_0604857 | 3300039437 | Bacteria | 2749 |
| 566 | Ga0436365_0871323 | 3300039437 | Bacteria | 58014 |
| 567 | Ga0436365_1241914 | 3300039437 | Bacteria | 1108 |
| 568 | Ga0436365_1832438 | 3300039437 | Bacteria | 3922 |
| 569 | Ga0436360_0800369 | 3300039438 | Bacteria | 928 |
| 570 | Ga0436363_0702677 | 3300039450 | Bacteria | 693 |
| 571 | Ga0451787_680561 | 3300041441 | Bacteria | 1079 |
| 572 | Ga0451791_1330780 | 3300041451 | Bacteria | 983 |
| 573 | Ga0451835_0281011 | 3300041492 | Bacteria | 920 |
| 574 | Ga0451837_0572566 | 3300041494 | Bacteria | 1249 |
| 575 | Ga0451837_1293921 | 3300041494 | Bacteria | 1294 |
| 576 | Ga0451849_1570337 | 3300041505 | Bacteria | 890 |
| 577 | Ga0451853_0256934 | 3300041512 | Bacteria | 1265 |
| 578 | Ga0451853_1014670 | 3300041512 | Bacteria | 1573 |
| 579 | Ga0451853_3570517 | 3300041512 | Bacteria | 1536 |
| 580 | Ga0466969_0017894 | 3300044656 | Bacteria | 3697 |
| 581 | Ga0466972_0000206 | 3300044658 | Bacteria | 42982 |
| 582 | Ga0466972_0125706 | 3300044658 | Bacteria | 1208 |
| 583 | Ga0466965_0028858 | 3300044683 | Bacteria | 2697 |
| 584 | Ga0466965_0447459 | 3300044683 | Bacteria | 719 |
| 585 | Ga0466966_0000872 | 3300044684 | Bacteria | 19273 |
| 586 | Ga0466961_0000082 | 3300044693 | Bacteria | 59328 |
| 587 | Ga0466963_0156208 | 3300044694 | Bacteria | 1586 |
| 588 | Ga0453684_0095053 | 3300044712 | Bacteria | 3664 |
| 589 | Ga0466968_0008843 | 3300044735 | Bacteria | 3865 |
| 590 | Ga0466957_0045023 | 3300044842 | Bacteria | 2675 |
| 591 | Ga0466957_0073127 | 3300044842 | Bacteria | 2124 |
| 592 | Ga0466957_0145247 | 3300044842 | Bacteria | 1531 |
| 593 | Ga0466957_0263932 | 3300044842 | Bacteria | 1148 |
| 594 | Ga0466960_0003192 | 3300044901 | Bacteria | 6283 |
| 595 | Ga0466960_0202229 | 3300044901 | Bacteria | 1086 |
| 596 | Ga0466960_0231571 | 3300044901 | Bacteria | 1020 |
| 597 | Ga0466959_0007074 | 3300045049 | Bacteria | 7845 |
| 598 | Ga0466959_0021459 | 3300045049 | Bacteria | 4763 |
| 599 | Ga0451576_0158291 | 3300045051 | Bacteria | 2363 |
| 600 | Ga0466967_0244666 | 3300045976 | Bacteria | 1712 |
| 601 | Ga0495617_039527 | 3300046452 | Bacteria | 1578 |
| 602 | Ga0495592_0176376 | 3300046454 | Bacteria | 1459 |
| 603 | Ga0495603_0014808 | 3300046455 | Bacteria | 4717 |
| 604 | Ga0495603_0015277 | 3300046455 | Bacteria | 4645 |
| 605 | Ga0495603_0017171 | 3300046455 | Bacteria | 4381 |
| 606 | Ga0495603_0028524 | 3300046455 | Bacteria | 3367 |
| 607 | Ga0495590_0046719 | 3300046457 | Bacteria | 1510 |
| 608 | Ga0495629_0001885 | 3300046459 | Bacteria | 16349 |
| 609 | Ga0495629_0002653 | 3300046459 | Bacteria | 13712 |
| 610 | Ga0495629_0126465 | 3300046459 | Bacteria | 1781 |
| 611 | Ga0495629_0153510 | 3300046459 | Bacteria | 1600 |
| 612 | Ga0495638_0135790 | 3300046460 | Bacteria | 1440 |
| 613 | Ga0495638_0203855 | 3300046460 | Bacteria | 1115 |
| 614 | Ga0495641_0078631 | 3300046461 | Bacteria | 1478 |
| 615 | Ga0495641_0144547 | 3300046461 | Bacteria | 1063 |
| 616 | Ga0495641_0206240 | 3300046461 | Bacteria | 881 |
| 617 | Ga0495651_0035747 | 3300046462 | Bacteria | 3867 |
| 618 | Ga0495651_0099543 | 3300046462 | Bacteria | 2168 |
| 619 | Ga0495651_0235834 | 3300046462 | Bacteria | 1257 |
| 620 | Ga0495651_0388564 | 3300046462 | Bacteria | 913 |
| 621 | Ga0495653_0000879 | 3300046463 | Bacteria | 23181 |
| 622 | Ga0495653_0270486 | 3300046463 | Bacteria | 1119 |
| 623 | Ga0495650_0148975 | 3300046471 | Bacteria | 842 |
| 624 | Ga0495605_0031470 | 3300046474 | Bacteria | 2710 |
| 625 | Ga0495639_0355492 | 3300046475 | Bacteria | 736 |
| 626 | Ga0495662_0197053 | 3300046476 | Bacteria | 993 |
| 627 | Ga0495664_0008104 | 3300046477 | Bacteria | 5853 |
| 628 | Ga0495664_0021339 | 3300046477 | Bacteria | 3741 |
| 629 | Ga0495584_0068683 | 3300046491 | Bacteria | 1780 |
| 630 | Ga0495585_0155823 | 3300046492 | Bacteria | 1188 |
| 631 | Ga0495585_0290776 | 3300046492 | Bacteria | 805 |
| 632 | Ga0495594_0055814 | 3300046499 | Bacteria | 2178 |
| 633 | Ga0495594_0079549 | 3300046499 | Bacteria | 1830 |
| 634 | Ga0495606_0029541 | 3300046507 | Bacteria | 3845 |
| 635 | Ga0495606_0169363 | 3300046507 | Bacteria | 1268 |
| 636 | Ga0495606_0276886 | 3300046507 | Bacteria | 919 |
| 637 | Ga0495608_0003840 | 3300046511 | Bacteria | 10799 |
| 638 | Ga0495608_0148802 | 3300046511 | Bacteria | 1493 |
| 639 | Ga0495610_0017594 | 3300046512 | Bacteria | 4070 |
| 640 | Ga0495610_0029933 | 3300046512 | Bacteria | 2860 |
| 641 | Ga0495618_0006601 | 3300046514 | Bacteria | 7036 |
| 642 | Ga0495618_0160778 | 3300046514 | Bacteria | 1432 |
| 643 | Ga0495628_0117976 | 3300046516 | Bacteria | 2037 |
| 644 | Ga0495628_0394550 | 3300046516 | Bacteria | 1012 |
| 645 | Ga0495630_0140306 | 3300046517 | Bacteria | 1837 |
| 646 | Ga0495631_0052606 | 3300046518 | Bacteria | 1778 |
| 647 | Ga0495631_0092298 | 3300046518 | Bacteria | 1303 |
| 648 | Ga0495631_0204183 | 3300046518 | Bacteria | 845 |
| 649 | Ga0495632_0171491 | 3300046519 | Bacteria | 996 |
| 650 | Ga0495637_0083951 | 3300046520 | Bacteria | 1266 |
| 651 | Ga0495643_0010420 | 3300046522 | Bacteria | 5723 |
| 652 | Ga0495643_0206504 | 3300046522 | Bacteria | 940 |
| 653 | Ga0495648_0140085 | 3300046524 | Bacteria | 1274 |
| 654 | Ga0495648_0197564 | 3300046524 | Bacteria | 1009 |
| 655 | Ga0495663_0086352 | 3300046525 | Bacteria | 1017 |
| 656 | Ga0495666_0057087 | 3300046526 | Bacteria | 1869 |
| 657 | Ga0495652_0002357 | 3300046529 | Bacteria | 19599 |
| 658 | Ga0495652_0009665 | 3300046529 | Bacteria | 8755 |
| 659 | Ga0495652_0099942 | 3300046529 | Bacteria | 2355 |
| 660 | Ga0495640_0007880 | 3300046533 | Bacteria | 8376 |
| 661 | Ga0495640_0067035 | 3300046533 | Bacteria | 2419 |
| 662 | Ga0495586_0127770 | 3300046535 | Bacteria | 1422 |
| 663 | Ga0495586_0306647 | 3300046535 | Bacteria | 910 |
| 664 | Ga0495587_0054380 | 3300046536 | Bacteria | 2359 |
| 665 | Ga0495587_0117888 | 3300046536 | Bacteria | 1521 |
| 666 | Ga0495598_0011296 | 3300046537 | Bacteria | 2161 |
| 667 | Ga0495609_0161423 | 3300046538 | Bacteria | 950 |
| 668 | Ga0495597_0069708 | 3300046542 | Bacteria | 1517 |
| 669 | Ga0495645_0017952 | 3300046543 | Bacteria | 5076 |
| 670 | Ga0495645_0048088 | 3300046543 | Bacteria | 3107 |
| 671 | Ga0495622_0009657 | 3300046557 | Bacteria | 4462 |
| 672 | Ga0495622_0026851 | 3300046557 | Bacteria | 2687 |
| 673 | Ga0495633_0203505 | 3300046558 | Bacteria | 908 |
| 674 | Ga0495633_0265777 | 3300046558 | Bacteria | 781 |
| 675 | Ga0495667_0006955 | 3300046559 | Bacteria | 7673 |
| 676 | Ga0495667_0104195 | 3300046559 | Bacteria | 1834 |
| 677 | Ga0495656_0113224 | 3300046615 | Bacteria | 1272 |
| 678 | Ga0495668_0075590 | 3300046616 | Bacteria | 1850 |
| 679 | Ga0495668_0378673 | 3300046616 | Bacteria | 777 |
| 680 | Ga0495634_0018119 | 3300046642 | Bacteria | 5017 |
| 681 | Ga0495634_0046756 | 3300046642 | Bacteria | 2919 |
| 682 | Ga0495634_0133738 | 3300046642 | Bacteria | 1579 |
| 683 | Ga0495634_0203128 | 3300046642 | Bacteria | 1230 |
| 684 | Ga0495611_0061325 | 3300046648 | Bacteria | 1709 |
| 685 | Ga0495611_0158424 | 3300046648 | Bacteria | 1057 |
| 686 | Ga0495625_0137529 | 3300046660 | Bacteria | 1650 |
| 687 | Ga0495625_0234816 | 3300046660 | Bacteria | 1196 |
| 688 | Ga0495635_0001944 | 3300046663 | Bacteria | 14052 |
| 689 | Ga0495635_0025751 | 3300046663 | Bacteria | 4097 |
| 690 | Ga0495635_0053641 | 3300046663 | Bacteria | 2778 |
| 691 | Ga0495635_0231441 | 3300046663 | Bacteria | 1248 |
| 692 | Ga0495661_0199581 | 3300046665 | Bacteria | 1048 |
| 693 | Ga0495657_0020674 | 3300046675 | Bacteria | 4732 |
| 694 | Ga0495657_0144563 | 3300046675 | Bacteria | 1480 |
| 695 | Ga0495599_0002950 | 3300046678 | Bacteria | 9897 |
| 696 | Ga0495599_0052690 | 3300046678 | Bacteria | 2549 |
| 697 | Ga0495599_0273524 | 3300046678 | Bacteria | 1024 |
| 698 | Ga0495623_0179442 | 3300046679 | Bacteria | 1231 |
| 699 | Ga0495646_0061759 | 3300046680 | Bacteria | 2230 |
| 700 | Ga0495669_0030370 | 3300046684 | Bacteria | 2372 |
| 701 | Ga0495669_0030629 | 3300046684 | Bacteria | 2362 |
| 702 | Ga0495669_0042880 | 3300046684 | Bacteria | 2013 |
| 703 | Ga0495669_0084520 | 3300046684 | Bacteria | 1459 |
| 704 | Ga0495613_0100144 | 3300046689 | Bacteria | 2093 |
| 705 | Ga0495613_0459727 | 3300046689 | Bacteria | 861 |
| 706 | Ga0495624_0027748 | 3300046690 | Bacteria | 3704 |
| 707 | Ga0495670_0098099 | 3300046691 | Bacteria | 1506 |
| 708 | Ga0495649_0008929 | 3300046694 | Bacteria | 5995 |
| 709 | Ga0495649_0052228 | 3300046694 | Bacteria | 2215 |
| 710 | Ga0495589_0149827 | 3300046794 | Bacteria | 1114 |
| 711 | Ga0495600_0003365 | 3300046809 | Bacteria | 9401 |
| 712 | Ga0495600_0106542 | 3300046809 | Bacteria | 1826 |
| 713 | Ga0495600_0141242 | 3300046809 | Bacteria | 1562 |
| 714 | Ga0495581_0383317 | 3300047315 | Bacteria | 820 |
| 715 | Ga0495604_0000457 | 3300047317 | Bacteria | 36318 |
| 716 | Ga0495604_0130086 | 3300047317 | Bacteria | 1810 |
| 717 | Ga0495636_0128587 | 3300047318 | Bacteria | 1125 |
| 718 | Ga0495674_0007544 | 3300047319 | Bacteria | 10388 |
| 719 | Ga0495674_0024647 | 3300047319 | Bacteria | 5522 |
| 720 | Ga0495674_0613683 | 3300047319 | Bacteria | 861 |
| 721 | Ga0495676_0019047 | 3300047321 | Bacteria | 6044 |
| 722 | Ga0495676_0112128 | 3300047321 | Bacteria | 1999 |
| 723 | Ga0495676_0552137 | 3300047321 | Bacteria | 753 |
| 724 | Ga0495680_0000217 | 3300047322 | Bacteria | 62734 |
| 725 | Ga0495680_0022651 | 3300047322 | Bacteria | 5233 |
| 726 | Ga0495680_0298674 | 3300047322 | Bacteria | 1131 |
| 727 | Ga0495683_0054061 | 3300047323 | Bacteria | 2002 |
| 728 | Ga0495683_0197169 | 3300047323 | Bacteria | 910 |
| 729 | Ga0495687_099628 | 3300047443 | Bacteria | 1093 |
| 730 | Ga0495675_0047405 | 3300047444 | Bacteria | 2734 |
| 731 | Ga0495677_0092107 | 3300047445 | Bacteria | 1143 |
| 732 | Ga0495685_117094 | 3300047447 | Bacteria | 875 |
| 733 | Ga0495673_0081202 | 3300047469 | Bacteria | 1343 |
| 734 | Ga0495673_0119301 | 3300047469 | Bacteria | 1046 |
| 735 | Ga0495684_0002844 | 3300047471 | Bacteria | 13627 |
| 736 | Ga0495684_0085268 | 3300047471 | Bacteria | 2395 |
| 737 | Ga0495686_0120872 | 3300047472 | Bacteria | 1561 |
| 738 | Ga0495686_0191603 | 3300047472 | Bacteria | 1178 |
| 739 | Ga0495686_0218363 | 3300047472 | Bacteria | 1086 |
| 740 | Ga0495593_0333521 | 3300047673 | Bacteria | 758 |
| 741 | Ga0495602_0002288 | 3300048088 | Bacteria | 19366 |
| 742 | Ga0495602_0032241 | 3300048088 | Bacteria | 4937 |
| 743 | Ga0495602_0064976 | 3300048088 | Bacteria | 3152 |
| 744 | Ga0495602_0445247 | 3300048088 | Bacteria | 915 |
| 745 | Ga0495626_0177712 | 3300048091 | Bacteria | 884 |
| 746 | Ga0496100_0023430 | 3300048903 | Bacteria | 3751 |
| 747 | Ga0496100_0051487 | 3300048903 | Bacteria | 2673 |
| 748 | Ga0496100_0200841 | 3300048903 | Bacteria | 1453 |
| 749 | Ga0496100_0623037 | 3300048903 | Bacteria | 839 |
| 750 | Ga0496101_0044574 | 3300048904 | Bacteria | 3174 |
| 751 | Ga0496101_0218071 | 3300048904 | Bacteria | 1480 |
| 752 | Ga0496101_0233495 | 3300048904 | Bacteria | 1430 |
| 753 | Ga0496101_0361738 | 3300048904 | Bacteria | 1141 |
| 754 | Ga0496102_0001372 | 3300048905 | Bacteria | 21715 |
| 755 | Ga0496102_0055829 | 3300048905 | Bacteria | 3601 |
| 756 | Ga0496102_0163510 | 3300048905 | Bacteria | 2094 |
| 757 | Ga0496102_0247053 | 3300048905 | Bacteria | 1682 |
| 758 | Ga0496102_0805369 | 3300048905 | Bacteria | 862 |
| 759 | Ga0496102_1167607 | 3300048905 | Bacteria | 689 |
| 760 | Ga0496103_0021125 | 3300048906 | Bacteria | 3916 |
| 761 | Ga0496103_0028309 | 3300048906 | Bacteria | 3399 |
| 762 | Ga0496103_0157565 | 3300048906 | Bacteria | 1456 |
| 763 | Ga0496103_0204195 | 3300048906 | Bacteria | 1271 |
| 764 | Ga0496103_0211040 | 3300048906 | Bacteria | 1249 |
| 765 | Ga0496104_0000871 | 3300048907 | Bacteria | 25996 |
| 766 | Ga0496104_0083890 | 3300048907 | Bacteria | 3039 |
| 767 | Ga0496104_0194151 | 3300048907 | Bacteria | 1942 |
| 768 | Ga0496104_0330228 | 3300048907 | Bacteria | 1438 |
| 769 | Ga0496104_0645881 | 3300048907 | Bacteria | 967 |
| 770 | Ga0496105_0000692 | 3300048908 | Bacteria | 22697 |
| 771 | Ga0496105_0143125 | 3300048908 | Bacteria | 1967 |
| 772 | Ga0496105_0230470 | 3300048908 | Bacteria | 1505 |
| 773 | Ga0496106_0000664 | 3300048909 | Bacteria | 24642 |
| 774 | Ga0496106_0006324 | 3300048909 | Bacteria | 8773 |
| 775 | Ga0496106_0587978 | 3300048909 | Bacteria | 892 |
| 776 | Ga0496106_0696044 | 3300048909 | Bacteria | 810 |
| 777 | Ga0496106_0731540 | 3300048909 | Bacteria | 787 |
| 778 | Ga0496106_0892161 | 3300048909 | Bacteria | 702 |
| 779 | Ga0496107_0006521 | 3300048910 | Bacteria | 8028 |
| 780 | Ga0496107_0146548 | 3300048910 | Bacteria | 1746 |
| 781 | Ga0496108_0006613 | 3300048911 | Bacteria | 9398 |
| 782 | Ga0496108_0070787 | 3300048911 | Bacteria | 2943 |
| 783 | Ga0496109_0002448 | 3300048912 | Bacteria | 15545 |
| 784 | Ga0496109_0034450 | 3300048912 | Bacteria | 4560 |
| 785 | Ga0496109_0135370 | 3300048912 | Bacteria | 2302 |
| 786 | Ga0496109_0194775 | 3300048912 | Bacteria | 1905 |
| 787 | Ga0496109_0314130 | 3300048912 | Bacteria | 1478 |
| 788 | Ga0496109_0454049 | 3300048912 | Bacteria | 1210 |
| 789 | Ga0496110_0112071 | 3300048913 | Bacteria | 2452 |
| 790 | Ga0496110_0127948 | 3300048913 | Bacteria | 2292 |
| 791 | Ga0496111_0125268 | 3300048914 | Bacteria | 1899 |
| 792 | Ga0496111_0196659 | 3300048914 | Bacteria | 1499 |
| 793 | Ga0496112_0010931 | 3300048915 | Bacteria | 8264 |
| 794 | Ga0496112_0118517 | 3300048915 | Bacteria | 2617 |
| 795 | Ga0496112_0189733 | 3300048915 | Bacteria | 2017 |
| 796 | Ga0496112_0285231 | 3300048915 | Bacteria | 1597 |
| 797 | Ga0496112_0655315 | 3300048915 | Bacteria | 979 |
| 798 | Ga0496112_1105701 | 3300048915 | Bacteria | 711 |
| 799 | Ga0496113_0031029 | 3300048916 | Bacteria | 3874 |
| 800 | Ga0496113_0047634 | 3300048916 | Bacteria | 3186 |
| 801 | Ga0496113_0108554 | 3300048916 | Bacteria | 2157 |
| 802 | Ga0496113_0457124 | 3300048916 | Bacteria | 1026 |
| 803 | Ga0496113_0467667 | 3300048916 | Bacteria | 1013 |
| 804 | Ga0496114_0029973 | 3300048917 | Bacteria | 4474 |
| 805 | Ga0496114_0067981 | 3300048917 | Bacteria | 2990 |
| 806 | Ga0496114_0086355 | 3300048917 | Bacteria | 2659 |
| 807 | Ga0496114_0780164 | 3300048917 | Bacteria | 834 |
| 808 | Ga0496115_0030017 | 3300048918 | Bacteria | 4274 |
| 809 | Ga0496115_0295273 | 3300048918 | Bacteria | 1328 |
| 810 | Ga0496115_0740187 | 3300048918 | Bacteria | 770 |
| 811 | Ga0496116_0087144 | 3300048919 | Bacteria | 1912 |
| 812 | Ga0496116_0287207 | 3300048919 | Bacteria | 792 |
| 813 | Ga0496117_0019802 | 3300048920 | Bacteria | 5513 |
| 814 | Ga0496117_0050066 | 3300048920 | Bacteria | 2965 |
| 815 | Ga0496117_0105509 | 3300048920 | Bacteria | 1771 |
| 816 | Ga0496117_0234664 | 3300048920 | Bacteria | 1011 |
| 817 | Ga0496117_0266350 | 3300048920 | Bacteria | 926 |
| 818 | Ga0496117_0306254 | 3300048920 | Bacteria | 839 |
| 819 | Ga0496119_0011575 | 3300048922 | Bacteria | 7281 |
| 820 | Ga0496119_0068346 | 3300048922 | Bacteria | 2092 |
| 821 | Ga0496119_0080029 | 3300048922 | Bacteria | 1885 |
| 822 | Ga0496120_0011179 | 3300048923 | Bacteria | 6195 |
| 823 | Ga0496120_0036361 | 3300048923 | Bacteria | 2932 |
| 824 | Ga0496121_0000077 | 3300048924 | Bacteria | 235293 |
| 825 | Ga0496121_0035309 | 3300048924 | Bacteria | 4482 |
| 826 | Ga0496121_0057403 | 3300048924 | Bacteria | 3227 |
| 827 | Ga0496121_0097925 | 3300048924 | Bacteria | 2271 |
| 828 | Ga0496121_0191974 | 3300048924 | Bacteria | 1463 |
| 829 | Ga0496122_0261989 | 3300048925 | Bacteria | 959 |
| 830 | Ga0496124_0006148 | 3300048927 | Bacteria | 13170 |
| 831 | Ga0496124_0061614 | 3300048927 | Bacteria | 3144 |
| 832 | Ga0496124_0123553 | 3300048927 | Bacteria | 2065 |
| 833 | Ga0496124_0197513 | 3300048927 | Bacteria | 1533 |
| 834 | Ga0496124_0298006 | 3300048927 | Bacteria | 1166 |
| 835 | Ga0496125_0036626 | 3300048928 | Bacteria | 4279 |
| 836 | Ga0496125_0054822 | 3300048928 | Bacteria | 3255 |
| 837 | Ga0496125_0123585 | 3300048928 | Bacteria | 1840 |
| 838 | Ga0496125_0151714 | 3300048928 | Bacteria | 1590 |
| 839 | Ga0496126_0030696 | 3300048929 | Bacteria | 5088 |
| 840 | Ga0496126_0050756 | 3300048929 | Bacteria | 3779 |
| 841 | Ga0496126_0051484 | 3300048929 | Bacteria | 3748 |
| 842 | Ga0496126_0117956 | 3300048929 | Bacteria | 2304 |
| 843 | Ga0496126_0291410 | 3300048929 | Bacteria | 1349 |
| 844 | Ga0501032_0517313 | 3300049569 | Bacteria | 762 |
| 845 | Ga0501033_0036070 | 3300049570 | Bacteria | 3706 |
| 846 | Ga0501034_0011050 | 3300049571 | Bacteria | 9376 |
| 847 | Ga0501034_0316545 | 3300049571 | Bacteria | 1494 |
| 848 | Ga0501036_0019092 | 3300049572 | Bacteria | 5753 |
| 849 | Ga0501037_0047500 | 3300049573 | Bacteria | 3146 |
| 850 | Ga0501038_0106772 | 3300049574 | Bacteria | 2323 |
| 851 | Ga0501039_0227503 | 3300049575 | Bacteria | 1466 |
| 852 | Ga0501039_0590222 | 3300049575 | Bacteria | 871 |
| 853 | Ga0501043_0046534 | 3300049579 | Bacteria | 3411 |
| 854 | Ga0501043_0470337 | 3300049579 | Bacteria | 942 |
| 855 | Ga0501043_0671617 | 3300049579 | Bacteria | 759 |
| 856 | Ga0501047_0009309 | 3300049581 | Bacteria | 9276 |
| 857 | Ga0501047_0430987 | 3300049581 | Bacteria | 1149 |
| 858 | Ga0501048_0096016 | 3300049582 | Bacteria | 2091 |
| 859 | Ga0501067_0028816 | 3300049583 | Bacteria | 3078 |
| 860 | Ga0501067_0055381 | 3300049583 | Bacteria | 2198 |
| 861 | Ga0501069_0074327 | 3300049585 | Bacteria | 1907 |
| 862 | Ga0501072_0007745 | 3300049588 | Bacteria | 8154 |
| 863 | Ga0501080_0794965 | 3300049742 | Bacteria | 830 |
| 864 | Ga0501083_0068093 | 3300049744 | Bacteria | 2369 |
| 865 | Ga0501083_0089485 | 3300049744 | Bacteria | 2034 |
| 866 | Ga0501083_0142831 | 3300049744 | Bacteria | 1567 |
| 867 | Ga0501035_0047884 | 3300049822 | Bacteria | 3835 |
| 868 | Ga0501035_0149430 | 3300049822 | Bacteria | 2028 |
| 869 | Ga0501044_0083130 | 3300049823 | Bacteria | 3238 |
| 870 | Ga0501044_0370651 | 3300049823 | Bacteria | 1348 |
| 871 | nmdc:mga03683_10210_c2 | 3300050489 | Bacteria | 1759 |
| 872 | nmdc:mga03683_147630_c1 | 3300050489 | Bacteria | 1060 |
| 873 | nmdc:mga03683_205030_c1 | 3300050489 | Bacteria | 906 |
| 874 | nmdc:mga03683_24601_c1 | 3300050489 | Bacteria | 2357 |
| 875 | nmdc:mga03683_45101_c1 | 3300050489 | Bacteria | 1824 |
| 876 | nmdc:mga03683_55649_c1 | 3300050489 | Bacteria | 1662 |
| 877 | nmdc:mga03683_76077_c1 | 3300050489 | Bacteria | 1442 |
| 878 | nmdc:mga03n38_28615_c1 | 3300050490 | Bacteria | 2325 |
| 879 | nmdc:mga03n38_360865_c1 | 3300050490 | Bacteria | 792 |
| 880 | nmdc:mga00v17_147044_c1 | 3300050491 | Bacteria | 1513 |
| 881 | nmdc:mga00v17_165496_c1 | 3300050491 | Bacteria | 1425 |
| 882 | nmdc:mga00v17_171065_c1 | 3300050491 | Bacteria | 1401 |
| 883 | nmdc:mga00v17_223408_c1 | 3300050491 | Bacteria | 1220 |
| 884 | nmdc:mga00v17_289368_c1 | 3300050491 | Bacteria | 1064 |
| 885 | nmdc:mga00v17_382_c1 | 3300050491 | Bacteria | 25073 |
| 886 | nmdc:mga00v17_450091_c1 | 3300050491 | Bacteria | 836 |
| 887 | nmdc:mga0yw44_107801_c1 | 3300050492 | Bacteria | 1782 |
| 888 | nmdc:mga0yw44_128690_c1 | 3300050492 | Bacteria | 1637 |
| 889 | nmdc:mga0yw44_13081_c1 | 3300050492 | Bacteria | 4354 |
| 890 | nmdc:mga0yw44_133499_c1 | 3300050492 | Bacteria | 1609 |
| 891 | nmdc:mga0yw44_156254_c1 | 3300050492 | Bacteria | 1491 |
| 892 | nmdc:mga0yw44_201211_c1 | 3300050492 | Bacteria | 1315 |
| 893 | nmdc:mga0yw44_226092_c1 | 3300050492 | Bacteria | 1241 |
| 894 | nmdc:mga0yw44_402985_c1 | 3300050492 | Bacteria | 925 |
| 895 | nmdc:mga0yw44_455425_c1 | 3300050492 | Bacteria | 867 |
| 896 | nmdc:mga0yw44_631947_c1 | 3300050492 | Bacteria | 728 |
| 897 | nmdc:mga0yw44_75748_c1 | 3300050492 | Bacteria | 2099 |
| 898 | nmdc:mga0yw44_85138_c1 | 3300050492 | Bacteria | 1989 |
| 899 | nmdc:mga0k408_106791_c1 | 3300050493 | Bacteria | 1654 |
| 900 | nmdc:mga0k408_132115_c1 | 3300050493 | Bacteria | 1482 |
| 901 | nmdc:mga0k408_148275_c1 | 3300050493 | Bacteria | 1397 |
| 902 | nmdc:mga0k408_151117_c1 | 3300050493 | Bacteria | 1383 |
| 903 | nmdc:mga0k408_194317_c1 | 3300050493 | Bacteria | 1211 |
| 904 | nmdc:mga0k408_252961_c1 | 3300050493 | Bacteria | 1052 |
| 905 | nmdc:mga0k408_253828_c1 | 3300050493 | Bacteria | 1050 |
| 906 | nmdc:mga0k408_43563_c1 | 3300050493 | Bacteria | 2586 |
| 907 | nmdc:mga0k408_435983_c1 | 3300050493 | Bacteria | 779 |
| 908 | nmdc:mga0k408_60180_c2 | 3300050493 | Bacteria | 1752 |
| 909 | nmdc:mga0k408_6329_c1 | 3300050493 | Bacteria | 6318 |
| 910 | nmdc:mga0k408_66551_c1 | 3300050493 | Bacteria | 2099 |
| 911 | nmdc:mga0k408_92784_c1 | 3300050493 | Bacteria | 1775 |
| 912 | nmdc:mga06z11_10788_c1 | 3300050494 | Bacteria | 3909 |
| 913 | nmdc:mga06z11_14683_c1 | 3300050494 | Bacteria | 3477 |
| 914 | nmdc:mga06z11_197373_c1 | 3300050494 | Bacteria | 1167 |
| 915 | nmdc:mga06z11_221692_c1 | 3300050494 | Bacteria | 1105 |
| 916 | nmdc:mga06z11_62309_c1 | 3300050494 | Bacteria | 1948 |
| 917 | nmdc:mga06z11_94200_c1 | 3300050494 | Bacteria | 1632 |
| 918 | nmdc:mga04h51_150696_c1 | 3300050495 | Bacteria | 889 |
| 919 | nmdc:mga04h51_64585_c1 | 3300050495 | Bacteria | 1263 |
| 920 | nmdc:mga04h51_9231_c1 | 3300050495 | Bacteria | 2210 |
| 921 | nmdc:mga07m45_16139_c1 | 3300050496 | Bacteria | 3996 |
| 922 | nmdc:mga07m45_16451_c1 | 3300050496 | Bacteria | 3960 |
| 923 | nmdc:mga07m45_23084_c1 | 3300050496 | Bacteria | 3399 |
| 924 | nmdc:mga07m45_262509_c1 | 3300050496 | Bacteria | 1005 |
| 925 | nmdc:mga05p37_139821_c1 | 3300050507 | Bacteria | 2967 |
| 926 | nmdc:mga05p37_840970_c1 | 3300050507 | Bacteria | 998 |
| 927 | nmdc:mga06r32_442075_c1 | 3300050510 | Bacteria | 1280 |
| 928 | nmdc:mga08y16_48697_c1 | 3300050511 | Bacteria | 4435 |
| 929 | nmdc:mga08y16_508048_c1 | 3300050511 | Bacteria | 1224 |
| 930 | nmdc:mga0n895_58986_c1 | 3300050512 | Bacteria | 3786 |
| 931 | nmdc:mga0rr50_73302_c1 | 3300050513 | Bacteria | 2617 |
| 932 | nmdc:mga0rr50_96907_c1 | 3300050513 | Bacteria | 2308 |
| 933 | nmdc:mga0sz30_147496_c1 | 3300050516 | Bacteria | 1040 |
| 934 | nmdc:mga0sz30_14861_c1 | 3300050516 | Bacteria | 2332 |
| 935 | nmdc:mga0sz30_61268_c1 | 3300050516 | Bacteria | 1608 |
| 936 | nmdc:mga0sz30_6501_c1 | 3300050516 | Bacteria | 1487 |
| 937 | Ga0495601_0007238 | 3300053077 | Bacteria | 6509 |
| 938 | Ga0495601_0313967 | 3300053077 | Bacteria | 1021 |
| 939 | Ga0495612_0033835 | 3300053078 | Bacteria | 2068 |
| 940 | Ga0495655_0117937 | 3300053083 | Bacteria | 805 |
| 941 | Ga0495595_0000638 | 3300053084 | Bacteria | 13317 |
| 942 | Ga0495619_0009871 | 3300053085 | Bacteria | 6017 |
| 943 | Ga0495619_0078792 | 3300053085 | Bacteria | 2215 |
| 944 | Ga0495619_0282095 | 3300053085 | Bacteria | 1151 |
| 945 | Ga0500578_0168757 | 3300053086 | Bacteria | 1354 |
| 946 | Ga0500643_000025 | 3300053087 | Bacteria | 259605 |
| 947 | Ga0500646_0015878 | 3300053090 | Bacteria | 1963 |
| 948 | Ga0500647_0016130 | 3300053091 | Bacteria | 3429 |
| 949 | Ga0500647_0067394 | 3300053091 | Bacteria | 1721 |
| 950 | Ga0500647_0091591 | 3300053091 | Bacteria | 1455 |
| 951 | Ga0500583_0023251 | 3300053092 | Bacteria | 2609 |
| 952 | Ga0500583_0202167 | 3300053092 | Bacteria | 987 |
| 953 | Ga0500566_0001527 | 3300053094 | Bacteria | 13595 |
| 954 | Ga0500566_0002901 | 3300053094 | Bacteria | 10225 |
| 955 | Ga0500566_0029361 | 3300053094 | Bacteria | 3212 |
| 956 | Ga0500566_0035605 | 3300053094 | Bacteria | 2892 |
| 957 | Ga0500566_0040394 | 3300053094 | Bacteria | 2696 |
| 958 | Ga0500640_000943 | 3300053095 | Bacteria | 8201 |
| 959 | Ga0500641_0002405 | 3300053096 | Bacteria | 6638 |
| 960 | Ga0500641_0017948 | 3300053096 | Bacteria | 2655 |
| 961 | Ga0500641_0019320 | 3300053096 | Bacteria | 2575 |
| 962 | Ga0500650_0030877 | 3300053098 | Bacteria | 2432 |
| 963 | Ga0500650_0188397 | 3300053098 | Bacteria | 943 |
| 964 | Ga0500555_004130 | 3300053103 | Bacteria | 4130 |
| 965 | Ga0500556_0007468 | 3300053104 | Bacteria | 3127 |
| 966 | Ga0500557_000001 | 3300053105 | Bacteria | 241298 |
| 967 | Ga0500562_007409 | 3300053108 | Bacteria | 2767 |
| 968 | Ga0500562_035216 | 3300053108 | Bacteria | 1326 |
| 969 | Ga0500569_003720 | 3300053109 | Bacteria | 3146 |
| 970 | Ga0500569_011892 | 3300053109 | Bacteria | 2091 |
| 971 | Ga0500572_000012 | 3300053111 | Bacteria | 56206 |
| 972 | Ga0500582_029976 | 3300053114 | Bacteria | 1653 |
| 973 | Ga0500591_054228 | 3300053115 | Bacteria | 1870 |
| 974 | Ga0500592_014648 | 3300053116 | Bacteria | 1257 |
| 975 | Ga0500593_084161 | 3300053117 | Bacteria | 1357 |
| 976 | Ga0500595_005116 | 3300053119 | Bacteria | 5755 |
| 977 | Ga0500595_013076 | 3300053119 | Bacteria | 3187 |
| 978 | Ga0500607_021112 | 3300053121 | Bacteria | 3671 |
| 979 | Ga0500608_014338 | 3300053122 | Bacteria | 3536 |
| 980 | Ga0500614_000718 | 3300053123 | Bacteria | 8478 |
| 981 | Ga0500642_0000077 | 3300053130 | Bacteria | 53422 |
| 982 | Ga0500642_0005483 | 3300053130 | Bacteria | 4096 |
| 983 | Ga0500642_0012050 | 3300053130 | Bacteria | 3121 |
| 984 | Ga0500642_0035098 | 3300053130 | Bacteria | 2126 |
| 985 | Ga0500642_0111763 | 3300053130 | Bacteria | 1276 |
| 986 | Ga0500652_103383 | 3300053131 | Bacteria | 1191 |
| 987 | Ga0500652_103690 | 3300053131 | Bacteria | 1189 |
| 988 | Ga0500655_012239 | 3300053133 | Bacteria | 1558 |
| 989 | Ga0500658_0017657 | 3300053134 | Bacteria | 2667 |
| 990 | Ga0500658_0100217 | 3300053134 | Bacteria | 1263 |
| 991 | Ga0500658_0164783 | 3300053134 | Bacteria | 1005 |
| 992 | Ga0500559_0006918 | 3300053136 | Bacteria | 5075 |
| 993 | Ga0500559_0013588 | 3300053136 | Bacteria | 3446 |
| 994 | Ga0500564_052566 | 3300053138 | Bacteria | 1861 |
| 995 | Ga0500568_0045403 | 3300053139 | Bacteria | 1749 |
| 996 | Ga0500573_0086678 | 3300053140 | Bacteria | 1773 |
| 997 | Ga0500577_0015534 | 3300053142 | Bacteria | 2380 |
| 998 | Ga0500589_052652 | 3300053147 | Bacteria | 1885 |
| 999 | Ga0500589_061089 | 3300053147 | Bacteria | 1727 |
| 1000 | Ga0500589_135538 | 3300053147 | Bacteria | 1022 |
| 1001 | Ga0500590_060119 | 3300053148 | Bacteria | 1911 |
| 1002 | Ga0500590_065456 | 3300053148 | Bacteria | 1817 |
| 1003 | Ga0500590_068255 | 3300053148 | Bacteria | 1772 |
| 1004 | Ga0500603_000044 | 3300053150 | Bacteria | 30278 |
| 1005 | Ga0500603_004597 | 3300053150 | Bacteria | 2956 |
| 1006 | Ga0500616_0083173 | 3300053153 | Bacteria | 1604 |
| 1007 | Ga0500620_001768 | 3300053155 | Bacteria | 4115 |
| 1008 | Ga0500622_0021327 | 3300053156 | Bacteria | 3439 |
| 1009 | Ga0500622_0094635 | 3300053156 | Bacteria | 1478 |
| 1010 | Ga0500622_0109746 | 3300053156 | Bacteria | 1349 |
| 1011 | Ga0500627_0012394 | 3300053158 | Bacteria | 3194 |
| 1012 | Ga0500627_0040336 | 3300053158 | Bacteria | 2003 |
| 1013 | Ga0500627_0130939 | 3300053158 | Bacteria | 1133 |
| 1014 | Ga0500630_004013 | 3300053159 | Bacteria | 7148 |
| 1015 | Ga0500633_0066471 | 3300053160 | Bacteria | 1279 |
| 1016 | Ga0500634_0086341 | 3300053161 | Bacteria | 1603 |
| 1017 | Ga0500638_005628 | 3300053162 | Bacteria | 5021 |
| 1018 | Ga0500638_022660 | 3300053162 | Bacteria | 2978 |
| 1019 | Ga0500638_029075 | 3300053162 | Bacteria | 2658 |
| 1020 | Ga0500638_048766 | 3300053162 | Bacteria | 2049 |
| 1021 | Ga0500638_089310 | 3300053162 | Bacteria | 1453 |
| 1022 | Ga0500638_178963 | 3300053162 | Bacteria | 917 |
| 1023 | Ga0500639_000004 | 3300053163 | Bacteria | 216921 |
| 1024 | Ga0500639_207576 | 3300053163 | Bacteria | 834 |
| 1025 | Ga0500637_0003368 | 3300053178 | Bacteria | 7368 |
| 1026 | Ga0500637_0190527 | 3300053178 | Bacteria | 1172 |
| 1027 | Ga0500576_093321 | 3300053725 | Bacteria | 1245 |
| 1028 | Ga0500657_015026 | 3300053728 | Bacteria | 3645 |
| 1029 | Ga0500625_003211 | 3300053729 | Bacteria | 6395 |
| 1030 | Ga0500645_063751 | 3300053730 | Bacteria | 1063 |
| 1031 | Ga0500609_004080 | 3300053731 | Bacteria | 2032 |
| 1032 | Ga0500596_000145 | 3300053735 | Bacteria | 10755 |
| 1033 | Ga0500596_003796 | 3300053735 | Bacteria | 2833 |
| 1034 | Ga0500599_002110 | 3300053736 | Bacteria | 2360 |
| 1035 | Ga0500599_008015 | 3300053736 | Bacteria | 1366 |
| 1036 | Ga0500601_000446 | 3300053737 | Bacteria | 6695 |
| 1037 | Ga0500601_002164 | 3300053737 | Bacteria | 2111 |
| 1038 | Ga0500661_000838 | 3300055283 | Bacteria | 5735 |
| 1039 | Ga0500661_007306 | 3300055283 | Bacteria | 2048 |
| 1040 | Ga0501082_0000327 | 3300060353 | Bacteria | 42286 |
| 1041 | Ga0466962_0095439 | 3300061719 | Bacteria | 1426 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053158 | Ga0500627_0012394 | Ga0500627_0012394_1070_1717 | 188 |
| 2 | 3300005436 | Ga0070713_100822162 | Ga0070713_1008221622 | 195 |
| 3 | 3300005544 | Ga0070686_100918697 | Ga0070686_1009186971 | 195 |
| 4 | 3300006048 | Ga0075363_100082056 | Ga0075363_1000820562 | 195 |
| 5 | 3300006051 | Ga0075364_10176103 | Ga0075364_101761032 | 195 |
| 6 | 3300006177 | Ga0075362_10107869 | Ga0075362_101078692 | 195 |
| 7 | 3300006195 | Ga0075366_10104305 | Ga0075366_101043052 | 195 |
| 8 | 3300046678 | Ga0495599_0273524 | Ga0495599_0273524_376_1005 | 195 |
| 9 | 3300048918 | Ga0496115_0740187 | Ga0496115_0740187_108_719 | 195 |
| 10 | 3300035691 | Ga0373931_0641833 | Ga0373931_0641833_73_675 | 200 |
| 11 | 3300049744 | Ga0501083_0089485 | Ga0501083_0089485_942_1625 | 200 |
| 12 | 3300060353 | Ga0501082_0000327 | Ga0501082_0000327_33132_33815 | 200 |
| 13 | 3300031235 | Ga0265330_10078568 | Ga0265330_100785682 | 203 |
| 14 | 3300031250 | Ga0265331_10200945 | Ga0265331_102009451 | 203 |
| 15 | 3300031247 | Ga0265340_10011504 | Ga0265340_100115044 | 207 |
| 16 | 3300031344 | Ga0265316_10049602 | Ga0265316_100496022 | 207 |
| 17 | 3300031712 | Ga0265342_10011923 | Ga0265342_100119239 | 207 |
| 18 | iso_pu_bacteria | 2775506901 | 2776258812 | 210 |
| 19 | 3300049742 | Ga0501080_0794965 | Ga0501080_0794965_170_808 | 211 |
| 20 | iso_pu_bacteria | 2513237087 | 2513591757 | 211 |
| 21 | iso_pu_bacteria | 2773857925 | 2774870240 | 211 |
| 22 | iso_pu_bacteria | 2894232714 | 2894242363 | 211 |
| 23 | iso_pu_bacteria | 2643221588 | 2643950774 | 213 |
| 24 | 3300005356 | Ga0070674_100279351 | Ga0070674_1002793512 | 214 |
| 25 | 3300009148 | Ga0105243_10301725 | Ga0105243_103017252 | 214 |
| 26 | 3300009553 | Ga0105249_10743862 | Ga0105249_107438622 | 214 |
| 27 | 3300025901 | Ga0207688_10079090 | Ga0207688_100790902 | 214 |
| 28 | 3300025935 | Ga0207709_10125286 | Ga0207709_101252862 | 214 |
| 29 | 3300026075 | Ga0207708_10301281 | Ga0207708_103012812 | 214 |
| 30 | iso_pu_bacteria | 2513237101 | 2513691597 | 214 |
| 31 | iso_pu_bacteria | 2524023210 | 2524467635 | 214 |
| 32 | iso_pu_bacteria | 2524023228 | 2524539931 | 214 |
| 33 | iso_pu_bacteria | 2721755755 | 2723845976 | 214 |
| 34 | iso_pu_bacteria | 2791355199 | 2793079692 | 214 |
| 35 | iso_pu_bacteria | 2874604998 | 2874609362 | 214 |
| 36 | iso_pu_bacteria | 2874628541 | 2874636500 | 214 |
| 37 | iso_pu_bacteria | 2876808645 | 2876817110 | 214 |
| 38 | iso_pu_bacteria | 2879110137 | 2879110420 | 214 |
| 39 | iso_pu_bacteria | 2885383462 | 2885392538 | 214 |
| 40 | iso_pu_bacteria | 2889033259 | 2889040842 | 214 |
| 41 | iso_pu_bacteria | 2904690495 | 2904696632 | 214 |
| 42 | iso_pu_bacteria | 2904699407 | 2904701957 | 214 |
| 43 | iso_pu_bacteria | 2908756301 | 2908761253 | 214 |
| 44 | iso_pu_bacteria | 2922361189 | 2922367935 | 214 |
| 45 | iso_pu_bacteria | 2922386360 | 2922392178 | 214 |
| 46 | iso_pu_bacteria | 8006933436 | 8006941841 | 214 |
| 47 | iso_pu_bacteria | 8006973647 | 8006981589 | 214 |
| 48 | iso_pu_bacteria | 8006984368 | 8006990495 | 214 |
| 49 | iso_pu_bacteria | 8056673599 | 8056680622 | 214 |
| 50 | 3300003203 | JGI25406J46586_10014356 | JGI25406J46586_100143561 | 215 |
| 51 | 3300003659 | JGI25404J52841_10006645 | JGI25404J52841_100066452 | 215 |
| 52 | 3300005329 | Ga0070683_100079587 | Ga0070683_1000795872 | 215 |
| 53 | 3300005330 | Ga0070690_100450707 | Ga0070690_1004507071 | 215 |
| 54 | 3300005331 | Ga0070670_100046591 | Ga0070670_1000465913 | 215 |
| 55 | 3300005338 | Ga0068868_100612619 | Ga0068868_1006126192 | 215 |
| 56 | 3300005354 | Ga0070675_100162118 | Ga0070675_1001621182 | 215 |
| 57 | 3300005356 | Ga0070674_100438268 | Ga0070674_1004382681 | 215 |
| 58 | 3300005466 | Ga0070685_10251561 | Ga0070685_102515611 | 215 |
| 59 | 3300005535 | Ga0070684_100234373 | Ga0070684_1002343733 | 215 |
| 60 | 3300005615 | Ga0070702_100375453 | Ga0070702_1003754532 | 215 |
| 61 | 3300005618 | Ga0068864_100107412 | Ga0068864_1001074122 | 215 |
| 62 | 3300005937 | Ga0081455_10008218 | Ga0081455_1000821810 | 215 |
| 63 | 3300005983 | Ga0081540_1001009 | Ga0081540_100100920 | 215 |
| 64 | 3300005983 | Ga0081540_1006403 | Ga0081540_10064039 | 215 |
| 65 | 3300005983 | Ga0081540_1021104 | Ga0081540_10211045 | 215 |
| 66 | 3300005985 | Ga0081539_10001416 | Ga0081539_1000141621 | 215 |
| 67 | 3300005985 | Ga0081539_10025700 | Ga0081539_100257001 | 215 |
| 68 | 3300006038 | Ga0075365_10087322 | Ga0075365_100873224 | 215 |
| 69 | 3300006177 | Ga0075362_10121203 | Ga0075362_101212031 | 215 |
| 70 | 3300007076 | Ga0075435_100460014 | Ga0075435_1004600142 | 215 |
| 71 | 3300009094 | Ga0111539_10010826 | Ga0111539_100108265 | 215 |
| 72 | 3300009545 | Ga0105237_10125043 | Ga0105237_101250433 | 215 |
| 73 | 3300009551 | Ga0105238_10035756 | Ga0105238_100357563 | 215 |
| 74 | 3300013307 | Ga0157372_10281861 | Ga0157372_102818613 | 215 |
| 75 | 3300014326 | Ga0157380_10545568 | Ga0157380_105455682 | 215 |
| 76 | 3300017792 | Ga0163161_10217268 | Ga0163161_102172681 | 215 |
| 77 | 3300025914 | Ga0207671_10108951 | Ga0207671_101089512 | 215 |
| 78 | 3300025923 | Ga0207681_10206176 | Ga0207681_102061762 | 215 |
| 79 | 3300025924 | Ga0207694_10168659 | Ga0207694_101686592 | 215 |
| 80 | 3300025925 | Ga0207650_10218404 | Ga0207650_102184042 | 215 |
| 81 | 3300025926 | Ga0207659_10163121 | Ga0207659_101631212 | 215 |
| 82 | 3300025938 | Ga0207704_10347613 | Ga0207704_103476132 | 215 |
| 83 | 3300025944 | Ga0207661_10090619 | Ga0207661_100906192 | 215 |
| 84 | 3300025944 | Ga0207661_10293056 | Ga0207661_102930561 | 215 |
| 85 | 3300026095 | Ga0207676_10229029 | Ga0207676_102290292 | 215 |
| 86 | 3300027907 | Ga0207428_10032809 | Ga0207428_100328094 | 215 |
| 87 | 3300028577 | Ga0265318_10127784 | Ga0265318_101277842 | 215 |
| 88 | 3300031235 | Ga0265330_10124858 | Ga0265330_101248581 | 215 |
| 89 | 3300031249 | Ga0265339_10051301 | Ga0265339_100513012 | 215 |
| 90 | 3300031507 | Ga0307509_10431683 | Ga0307509_104316832 | 215 |
| 91 | 3300031824 | Ga0307413_10037092 | Ga0307413_100370922 | 215 |
| 92 | 3300031852 | Ga0307410_10183059 | Ga0307410_101830592 | 215 |
| 93 | 3300031901 | Ga0307406_10356982 | Ga0307406_103569822 | 215 |
| 94 | 3300031903 | Ga0307407_10159405 | Ga0307407_101594052 | 215 |
| 95 | 3300031995 | Ga0307409_100051841 | Ga0307409_1000518413 | 215 |
| 96 | 3300032004 | Ga0307414_10384567 | Ga0307414_103845672 | 215 |
| 97 | 3300032126 | Ga0307415_100249852 | Ga0307415_1002498522 | 215 |
| 98 | 3300035113 | Ga0373936_0056906 | Ga0373936_0056906_260_949 | 215 |
| 99 | 3300035113 | Ga0373936_0108226 | Ga0373936_0108226_144_818 | 215 |
| 100 | 3300035119 | Ga0373956_0157187 | Ga0373956_0157187_25_699 | 215 |
| 101 | 3300035692 | Ga0373935_0106653 | Ga0373935_0106653_384_1073 | 215 |
| 102 | 3300037068 | Ga0373925_0715220 | Ga0373925_0715220_57_800 | 215 |
| 103 | 3300039437 | Ga0436365_0074464 | Ga0436365_0074464_11901_12575 | 215 |
| 104 | 3300044901 | Ga0466960_0202229 | Ga0466960_0202229_382_1062 | 215 |
| 105 | 3300046455 | Ga0495603_0017171 | Ga0495603_0017171_588_1331 | 215 |
| 106 | 3300046517 | Ga0495630_0140306 | Ga0495630_0140306_539_1228 | 215 |
| 107 | 3300046535 | Ga0495586_0127770 | Ga0495586_0127770_359_1048 | 215 |
| 108 | 3300046642 | Ga0495634_0046756 | Ga0495634_0046756_1612_2301 | 215 |
| 109 | 3300046684 | Ga0495669_0042880 | Ga0495669_0042880_407_1150 | 215 |
| 110 | 3300047319 | Ga0495674_0024647 | Ga0495674_0024647_1527_2216 | 215 |
| 111 | 3300048903 | Ga0496100_0023430 | Ga0496100_0023430_2790_3473 | 215 |
| 112 | 3300049583 | Ga0501067_0055381 | Ga0501067_0055381_1085_1738 | 215 |
| 113 | 3300049588 | Ga0501072_0007745 | Ga0501072_0007745_682_1365 | 215 |
| 114 | 3300049744 | Ga0501083_0068093 | Ga0501083_0068093_140_823 | 215 |
| 115 | 3300049744 | Ga0501083_0068093 | Ga0501083_0068093_823_1491 | 215 |
| 116 | 3300050490 | nmdc:mga03n38_360865_c1 | nmdc:mga03n38_360865_c1_63_716 | 215 |
| 117 | 3300050492 | nmdc:mga0yw44_402985_c1 | nmdc:mga0yw44_402985_c1_14_667 | 215 |
| 118 | 3300050511 | nmdc:mga08y16_48697_c1 | nmdc:mga08y16_48697_c1_1551_2219 | 215 |
| 119 | 3300050513 | nmdc:mga0rr50_96907_c1 | nmdc:mga0rr50_96907_c1_1248_1901 | 215 |
| 120 | 3300053131 | Ga0500652_103383 | Ga0500652_103383_23_670 | 215 |
| 121 | iso_pu_bacteria | 2513237104 | 2513717679 | 215 |
| 122 | 3300003215 | JGI25153J46596_10001560 | JGI25153J46596_100015608 | 216 |
| 123 | 3300005330 | Ga0070690_100004427 | Ga0070690_1000044277 | 216 |
| 124 | 3300005343 | Ga0070687_100016286 | Ga0070687_1000162863 | 216 |
| 125 | 3300005617 | Ga0068859_101326218 | Ga0068859_1013262182 | 216 |
| 126 | 3300005842 | Ga0068858_100216246 | Ga0068858_1002162464 | 216 |
| 127 | 3300006038 | Ga0075365_10332486 | Ga0075365_103324862 | 216 |
| 128 | 3300006048 | Ga0075363_100019979 | Ga0075363_1000199792 | 216 |
| 129 | 3300006051 | Ga0075364_10009112 | Ga0075364_100091124 | 216 |
| 130 | 3300006051 | Ga0075364_10019087 | Ga0075364_100190872 | 216 |
| 131 | 3300006051 | Ga0075364_10065710 | Ga0075364_100657102 | 216 |
| 132 | 3300006177 | Ga0075362_10153885 | Ga0075362_101538852 | 216 |
| 133 | 3300006178 | Ga0075367_10019651 | Ga0075367_100196514 | 216 |
| 134 | 3300006186 | Ga0075369_10014996 | Ga0075369_100149963 | 216 |
| 135 | 3300006931 | Ga0097620_101326648 | Ga0097620_1013266481 | 216 |
| 136 | 3300013306 | Ga0163162_11243508 | Ga0163162_112435081 | 216 |
| 137 | 3300025297 | Ga0209758_1000569 | Ga0209758_100056912 | 216 |
| 138 | 3300025297 | Ga0209758_1029333 | Ga0209758_10293333 | 216 |
| 139 | 3300025918 | Ga0207662_10009080 | Ga0207662_100090803 | 216 |
| 140 | 3300025936 | Ga0207670_10139288 | Ga0207670_101392883 | 216 |
| 141 | 3300025960 | Ga0207651_10601399 | Ga0207651_106013991 | 216 |
| 142 | 3300026035 | Ga0207703_10508839 | Ga0207703_105088392 | 216 |
| 143 | 3300026088 | Ga0207641_10958158 | Ga0207641_109581581 | 216 |
| 144 | 3300031250 | Ga0265331_10085132 | Ga0265331_100851322 | 216 |
| 145 | 3300031344 | Ga0265316_10367120 | Ga0265316_103671202 | 216 |
| 146 | 3300035172 | Ga0373955_0000411 | Ga0373955_0000411_963_1637 | 216 |
| 147 | 3300035410 | Ga0373924_0002005 | Ga0373924_0002005_1306_1980 | 216 |
| 148 | 3300035695 | Ga0373927_0045109 | Ga0373927_0045109_1926_2600 | 216 |
| 149 | 3300035724 | Ga0373933_0023096 | Ga0373933_0023096_2720_3394 | 216 |
| 150 | 3300036401 | Ga0373937_0004238 | Ga0373937_0004238_6106_6780 | 216 |
| 151 | 3300037068 | Ga0373925_0032076 | Ga0373925_0032076_1389_2063 | 216 |
| 152 | 3300037466 | Ga0395898_0136215 | Ga0395898_0136215_966_1700 | 216 |
| 153 | 3300039437 | Ga0436365_1241914 | Ga0436365_1241914_339_1025 | 216 |
| 154 | 3300044658 | Ga0466972_0125706 | Ga0466972_0125706_148_804 | 216 |
| 155 | 3300044683 | Ga0466965_0447459 | Ga0466965_0447459_34_690 | 216 |
| 156 | 3300044735 | Ga0466968_0008843 | Ga0466968_0008843_1861_2517 | 216 |
| 157 | 3300044901 | Ga0466960_0003192 | Ga0466960_0003192_4529_5185 | 216 |
| 158 | 3300045051 | Ga0451576_0158291 | Ga0451576_0158291_97_774 | 216 |
| 159 | 3300046459 | Ga0495629_0001885 | Ga0495629_0001885_11105_11779 | 216 |
| 160 | 3300046462 | Ga0495651_0035747 | Ga0495651_0035747_63_737 | 216 |
| 161 | 3300046463 | Ga0495653_0000879 | Ga0495653_0000879_16355_17029 | 216 |
| 162 | 3300046477 | Ga0495664_0008104 | Ga0495664_0008104_3937_4611 | 216 |
| 163 | 3300046511 | Ga0495608_0003840 | Ga0495608_0003840_659_1333 | 216 |
| 164 | 3300046514 | Ga0495618_0006601 | Ga0495618_0006601_4685_5359 | 216 |
| 165 | 3300046516 | Ga0495628_0117976 | Ga0495628_0117976_468_1142 | 216 |
| 166 | 3300046529 | Ga0495652_0002357 | Ga0495652_0002357_8316_8990 | 216 |
| 167 | 3300046533 | Ga0495640_0007880 | Ga0495640_0007880_6592_7266 | 216 |
| 168 | 3300046535 | Ga0495586_0306647 | Ga0495586_0306647_54_740 | 216 |
| 169 | 3300046536 | Ga0495587_0117888 | Ga0495587_0117888_253_927 | 216 |
| 170 | 3300046543 | Ga0495645_0048088 | Ga0495645_0048088_1225_1899 | 216 |
| 171 | 3300046559 | Ga0495667_0006955 | Ga0495667_0006955_5089_5763 | 216 |
| 172 | 3300046642 | Ga0495634_0018119 | Ga0495634_0018119_1807_2481 | 216 |
| 173 | 3300046663 | Ga0495635_0001944 | Ga0495635_0001944_2183_2857 | 216 |
| 174 | 3300046678 | Ga0495599_0002950 | Ga0495599_0002950_5250_5924 | 216 |
| 175 | 3300046689 | Ga0495613_0459727 | Ga0495613_0459727_156_830 | 216 |
| 176 | 3300046809 | Ga0495600_0003365 | Ga0495600_0003365_5180_5854 | 216 |
| 177 | 3300047317 | Ga0495604_0000457 | Ga0495604_0000457_25074_25748 | 216 |
| 178 | 3300047319 | Ga0495674_0007544 | Ga0495674_0007544_3208_3882 | 216 |
| 179 | 3300047322 | Ga0495680_0000217 | Ga0495680_0000217_30754_31428 | 216 |
| 180 | 3300047471 | Ga0495684_0002844 | Ga0495684_0002844_10636_11310 | 216 |
| 181 | 3300048088 | Ga0495602_0002288 | Ga0495602_0002288_12314_12988 | 216 |
| 182 | 3300049744 | Ga0501083_0142831 | Ga0501083_0142831_403_1092 | 216 |
| 183 | 3300050489 | nmdc:mga03683_10210_c2 | nmdc:mga03683_10210_c2_520_1188 | 216 |
| 184 | 3300050489 | nmdc:mga03683_205030_c1 | nmdc:mga03683_205030_c1_18_695 | 216 |
| 185 | 3300050489 | nmdc:mga03683_45101_c1 | nmdc:mga03683_45101_c1_843_1520 | 216 |
| 186 | 3300050490 | nmdc:mga03n38_28615_c1 | nmdc:mga03n38_28615_c1_1227_1904 | 216 |
| 187 | 3300050491 | nmdc:mga00v17_223408_c1 | nmdc:mga00v17_223408_c1_47_724 | 216 |
| 188 | 3300050491 | nmdc:mga00v17_382_c1 | nmdc:mga00v17_382_c1_22387_23055 | 216 |
| 189 | 3300050491 | nmdc:mga00v17_450091_c1 | nmdc:mga00v17_450091_c1_71_748 | 216 |
| 190 | 3300050492 | nmdc:mga0yw44_128690_c1 | nmdc:mga0yw44_128690_c1_546_1223 | 216 |
| 191 | 3300050492 | nmdc:mga0yw44_226092_c1 | nmdc:mga0yw44_226092_c1_56_730 | 216 |
| 192 | 3300050493 | nmdc:mga0k408_132115_c1 | nmdc:mga0k408_132115_c1_737_1414 | 216 |
| 193 | 3300050493 | nmdc:mga0k408_151117_c1 | nmdc:mga0k408_151117_c1_679_1356 | 216 |
| 194 | 3300050493 | nmdc:mga0k408_435983_c1 | nmdc:mga0k408_435983_c1_82_759 | 216 |
| 195 | 3300050493 | nmdc:mga0k408_6329_c1 | nmdc:mga0k408_6329_c1_2531_3205 | 216 |
| 196 | 3300050493 | nmdc:mga0k408_66551_c1 | nmdc:mga0k408_66551_c1_672_1349 | 216 |
| 197 | 3300050494 | nmdc:mga06z11_14683_c1 | nmdc:mga06z11_14683_c1_1164_1841 | 216 |
| 198 | 3300050494 | nmdc:mga06z11_94200_c1 | nmdc:mga06z11_94200_c1_820_1497 | 216 |
| 199 | 3300050495 | nmdc:mga04h51_9231_c1 | nmdc:mga04h51_9231_c1_1365_2042 | 216 |
| 200 | 3300050496 | nmdc:mga07m45_16451_c1 | nmdc:mga07m45_16451_c1_210_887 | 216 |
| 201 | 3300050507 | nmdc:mga05p37_840970_c1 | nmdc:mga05p37_840970_c1_218_868 | 216 |
| 202 | 3300050516 | nmdc:mga0sz30_6501_c1 | nmdc:mga0sz30_6501_c1_373_1041 | 216 |
| 203 | 3300053077 | Ga0495601_0007238 | Ga0495601_0007238_1491_2165 | 216 |
| 204 | 3300053078 | Ga0495612_0033835 | Ga0495612_0033835_436_1110 | 216 |
| 205 | 3300053084 | Ga0495595_0000638 | Ga0495595_0000638_7357_8031 | 216 |
| 206 | 3300053085 | Ga0495619_0009871 | Ga0495619_0009871_5090_5764 | 216 |
| 207 | 3300053096 | Ga0500641_0002405 | Ga0500641_0002405_1195_1872 | 216 |
| 208 | 3300053098 | Ga0500650_0188397 | Ga0500650_0188397_66_752 | 216 |
| 209 | 3300053108 | Ga0500562_035216 | Ga0500562_035216_384_1061 | 216 |
| 210 | 3300053117 | Ga0500593_084161 | Ga0500593_084161_665_1333 | 216 |
| 211 | 3300053130 | Ga0500642_0005483 | Ga0500642_0005483_267_953 | 216 |
| 212 | 3300053131 | Ga0500652_103690 | Ga0500652_103690_277_963 | 216 |
| 213 | 3300053139 | Ga0500568_0045403 | Ga0500568_0045403_744_1412 | 216 |
| 214 | 3300053142 | Ga0500577_0015534 | Ga0500577_0015534_1596_2282 | 216 |
| 215 | 3300053158 | Ga0500627_0130939 | Ga0500627_0130939_434_1084 | 216 |
| 216 | iso_pu_bacteria | 2507262055 | 2507509588 | 216 |
| 217 | iso_pu_bacteria | 2508501009 | 2508543630 | 216 |
| 218 | iso_pu_bacteria | 2508501042 | 2508698579 | 216 |
| 219 | iso_pu_bacteria | 2511231028 | 2511400425 | 216 |
| 220 | iso_pu_bacteria | 2513237092 | 2513624595 | 216 |
| 221 | iso_pu_bacteria | 2513237094 | 2513638144 | 216 |
| 222 | iso_pu_bacteria | 2513237095 | 2513646397 | 216 |
| 223 | iso_pu_bacteria | 2513237102 | 2513700952 | 216 |
| 224 | iso_pu_bacteria | 2513237139 | 2513879419 | 216 |
| 225 | iso_pu_bacteria | 2513237161 | 2514016724 | 216 |
| 226 | iso_pu_bacteria | 2515154112 | 2515629060 | 216 |
| 227 | iso_pu_bacteria | 2517093001 | 2517103677 | 216 |
| 228 | iso_pu_bacteria | 2524023205 | 2524439657 | 216 |
| 229 | iso_pu_bacteria | 2528768022 | 2528853375 | 216 |
| 230 | iso_pu_bacteria | 2617270735 | 2617349094 | 216 |
| 231 | iso_pu_bacteria | 2617270741 | 2617376697 | 216 |
| 232 | iso_pu_bacteria | 2744054633 | 2745082112 | 216 |
| 233 | iso_pu_bacteria | 2791355196 | 2793060424 | 216 |
| 234 | iso_pu_bacteria | 2802429603 | 2805920317 | 216 |
| 235 | iso_pu_bacteria | 2816332527 | 2818240411 | 216 |
| 236 | iso_pu_bacteria | 2824600985 | 2824608979 | 216 |
| 237 | iso_pu_bacteria | 2824609381 | 2824610268 | 216 |
| 238 | iso_pu_bacteria | 2824617872 | 2824624358 | 216 |
| 239 | iso_pu_bacteria | 2824626560 | 2824630872 | 216 |
| 240 | iso_pu_bacteria | 2824635225 | 2824643300 | 216 |
| 241 | iso_pu_bacteria | 2824644064 | 2824651704 | 216 |
| 242 | iso_pu_bacteria | 2824653114 | 2824661251 | 216 |
| 243 | iso_pu_bacteria | 2824661429 | 2824666923 | 216 |
| 244 | iso_pu_bacteria | 2824671348 | 2824679436 | 216 |
| 245 | iso_pu_bacteria | 2824679649 | 2824686426 | 216 |
| 246 | iso_pu_bacteria | 2824687955 | 2824696046 | 216 |
| 247 | iso_pu_bacteria | 2824696289 | 2824703684 | 216 |
| 248 | iso_pu_bacteria | 2824704595 | 2824712155 | 216 |
| 249 | iso_pu_bacteria | 2824714736 | 2824721816 | 216 |
| 250 | iso_pu_bacteria | 2824723954 | 2824731691 | 216 |
| 251 | iso_pu_bacteria | 2824732956 | 2824740050 | 216 |
| 252 | iso_pu_bacteria | 2824746037 | 2824753765 | 216 |
| 253 | iso_pu_bacteria | 2824753945 | 2824759597 | 216 |
| 254 | iso_pu_bacteria | 2824763712 | 2824766724 | 216 |
| 255 | iso_pu_bacteria | 2824773399 | 2824773840 | 216 |
| 256 | iso_pu_bacteria | 2838122688 | 2838128737 | 216 |
| 257 | iso_pu_bacteria | 2841941048 | 2841948461 | 216 |
| 258 | iso_pu_bacteria | 2841949485 | 2841956424 | 216 |
| 259 | iso_pu_bacteria | 2841957949 | 2841962385 | 216 |
| 260 | iso_pu_bacteria | 2841966195 | 2841967197 | 216 |
| 261 | iso_pu_bacteria | 2841974524 | 2841979403 | 216 |
| 262 | iso_pu_bacteria | 2841983080 | 2841989882 | 216 |
| 263 | iso_pu_bacteria | 2842038055 | 2842039990 | 216 |
| 264 | iso_pu_bacteria | 2842045827 | 2842047065 | 216 |
| 265 | iso_pu_bacteria | 2844315083 | 2844318162 | 216 |
| 266 | iso_pu_bacteria | 2847930680 | 2847935034 | 216 |
| 267 | iso_pu_bacteria | 2847939898 | 2847945591 | 216 |
| 268 | iso_pu_bacteria | 2849076700 | 2849080250 | 216 |
| 269 | iso_pu_bacteria | 2857509624 | 2857510386 | 216 |
| 270 | iso_pu_bacteria | 2874590934 | 2874595299 | 216 |
| 271 | iso_pu_bacteria | 2874612657 | 2874613260 | 216 |
| 272 | iso_pu_bacteria | 2874620515 | 2874626928 | 216 |
| 273 | iso_pu_bacteria | 2874645413 | 2874651138 | 216 |
| 274 | iso_pu_bacteria | 2876761206 | 2876761257 | 216 |
| 275 | iso_pu_bacteria | 2876771140 | 2876775235 | 216 |
| 276 | iso_pu_bacteria | 2876818435 | 2876824050 | 216 |
| 277 | iso_pu_bacteria | 2879074833 | 2879080678 | 216 |
| 278 | iso_pu_bacteria | 2879083081 | 2879086428 | 216 |
| 279 | iso_pu_bacteria | 2879099564 | 2879109481 | 216 |
| 280 | iso_pu_bacteria | 2879127579 | 2879134738 | 216 |
| 281 | iso_pu_bacteria | 2879142872 | 2879144198 | 216 |
| 282 | iso_pu_bacteria | 2881364244 | 2881366483 | 216 |
| 283 | iso_pu_bacteria | 2881665667 | 2881673036 | 216 |
| 284 | iso_pu_bacteria | 2885366525 | 2885373472 | 216 |
| 285 | iso_pu_bacteria | 2888378607 | 2888383007 | 216 |
| 286 | iso_pu_bacteria | 2888388044 | 2888394823 | 216 |
| 287 | iso_pu_bacteria | 2888419890 | 2888423470 | 216 |
| 288 | iso_pu_bacteria | 2903727486 | 2903734135 | 216 |
| 289 | iso_pu_bacteria | 2904666416 | 2904669629 | 216 |
| 290 | iso_pu_bacteria | 2904711408 | 2904716897 | 216 |
| 291 | iso_pu_bacteria | 2906602504 | 2906608420 | 216 |
| 292 | iso_pu_bacteria | 2906626472 | 2906628118 | 216 |
| 293 | iso_pu_bacteria | 2906643746 | 2906652418 | 216 |
| 294 | iso_pu_bacteria | 2908775508 | 2908779198 | 216 |
| 295 | iso_pu_bacteria | 2922368715 | 2922373185 | 216 |
| 296 | iso_pu_bacteria | 2922393267 | 2922395398 | 216 |
| 297 | iso_pu_bacteria | 2929615660 | 2929615760 | 216 |
| 298 | iso_pu_bacteria | 2929624759 | 2929630374 | 216 |
| 299 | iso_pu_bacteria | 2932784394 | 2932792019 | 216 |
| 300 | iso_pu_bacteria | 2932794094 | 2932796267 | 216 |
| 301 | iso_pu_bacteria | 2932801729 | 2932804428 | 216 |
| 302 | iso_pu_bacteria | 2932809354 | 2932814114 | 216 |
| 303 | iso_pu_bacteria | 2932818245 | 2932819398 | 216 |
| 304 | iso_pu_bacteria | 2932828146 | 2932833891 | 216 |
| 305 | iso_pu_bacteria | 2933577622 | 2933578953 | 216 |
| 306 | iso_pu_bacteria | 2935608549 | 2935611536 | 216 |
| 307 | iso_pu_bacteria | 2935616580 | 2935618577 | 216 |
| 308 | iso_pu_bacteria | 2935638405 | 2935644580 | 216 |
| 309 | iso_pu_bacteria | 2935648319 | 2935648907 | 216 |
| 310 | iso_pu_bacteria | 2935656913 | 2935657011 | 216 |
| 311 | iso_pu_bacteria | 2935665750 | 2935673529 | 216 |
| 312 | iso_pu_bacteria | 2935675223 | 2935678416 | 216 |
| 313 | iso_pu_bacteria | 2935684952 | 2935688155 | 216 |
| 314 | iso_pu_bacteria | 2935694250 | 2935698821 | 216 |
| 315 | iso_pu_bacteria | 2935703347 | 2935708435 | 216 |
| 316 | iso_pu_bacteria | 2935713505 | 2935715174 | 216 |
| 317 | iso_pu_bacteria | 2935722832 | 2935726261 | 216 |
| 318 | iso_pu_bacteria | 2935732158 | 2935733993 | 216 |
| 319 | iso_pu_bacteria | 2935741537 | 2935743372 | 216 |
| 320 | iso_pu_bacteria | 2935750917 | 2935754590 | 216 |
| 321 | iso_pu_bacteria | 2935760218 | 2935765369 | 216 |
| 322 | iso_pu_bacteria | 2935769743 | 2935777032 | 216 |
| 323 | iso_pu_bacteria | 2935777560 | 2935784106 | 216 |
| 324 | iso_pu_bacteria | 2935785616 | 2935790361 | 216 |
| 325 | iso_pu_bacteria | 2935793552 | 2935798944 | 216 |
| 326 | iso_pu_bacteria | 2935801545 | 2935805320 | 216 |
| 327 | iso_pu_bacteria | 2935810662 | 2935816618 | 216 |
| 328 | iso_pu_bacteria | 2935819856 | 2935821013 | 216 |
| 329 | iso_pu_bacteria | 2935827899 | 2935833671 | 216 |
| 330 | iso_pu_bacteria | 2935837841 | 2935839643 | 216 |
| 331 | iso_pu_bacteria | 2935847175 | 2935850727 | 216 |
| 332 | iso_pu_bacteria | 2935855204 | 2935856942 | 216 |
| 333 | iso_pu_bacteria | 2935864058 | 2935871228 | 216 |
| 334 | iso_pu_bacteria | 2935873716 | 2935876267 | 216 |
| 335 | iso_pu_bacteria | 2935883170 | 2935888839 | 216 |
| 336 | iso_pu_bacteria | 2935908558 | 2935913904 | 216 |
| 337 | iso_pu_bacteria | 2935916978 | 2935920106 | 216 |
| 338 | iso_pu_bacteria | 2935926038 | 2935930445 | 216 |
| 339 | iso_pu_bacteria | 2935934488 | 2935939582 | 216 |
| 340 | iso_pu_bacteria | 2935942939 | 2935946531 | 216 |
| 341 | iso_pu_bacteria | 2935951376 | 2935955630 | 216 |
| 342 | iso_pu_bacteria | 2935959822 | 2935964558 | 216 |
| 343 | iso_pu_bacteria | 2935967501 | 2935972660 | 216 |
| 344 | iso_pu_bacteria | 2935975950 | 2935981515 | 216 |
| 345 | iso_pu_bacteria | 2935984226 | 2935989088 | 216 |
| 346 | iso_pu_bacteria | 2935992306 | 2935997770 | 216 |
| 347 | iso_pu_bacteria | 2936002035 | 2936007281 | 216 |
| 348 | iso_pu_bacteria | 2936011229 | 2936011817 | 216 |
| 349 | iso_pu_bacteria | 2936019824 | 2936020412 | 216 |
| 350 | iso_pu_bacteria | 2936028420 | 2936029106 | 216 |
| 351 | iso_pu_bacteria | 2936037263 | 2936043120 | 216 |
| 352 | iso_pu_bacteria | 2936046547 | 2936047135 | 216 |
| 353 | iso_pu_bacteria | 2936055302 | 2936061365 | 216 |
| 354 | iso_pu_bacteria | 2940556831 | 2940560033 | 216 |
| 355 | iso_pu_bacteria | 2941531003 | 2941533911 | 216 |
| 356 | iso_pu_bacteria | 2941538514 | 2941540332 | 216 |
| 357 | iso_pu_bacteria | 3005483717 | 3005490002 | 216 |
| 358 | iso_pu_bacteria | 3005506211 | 3005511656 | 216 |
| 359 | iso_pu_bacteria | 3005587118 | 3005590307 | 216 |
| 360 | iso_pu_bacteria | 3005594810 | 3005598214 | 216 |
| 361 | iso_pu_bacteria | 3005710791 | 3005713931 | 216 |
| 362 | iso_pu_bacteria | 3005718088 | 3005721393 | 216 |
| 363 | iso_pu_bacteria | 8016511872 | 8016514538 | 216 |
| 364 | iso_pu_bacteria | 8016522445 | 8016530622 | 216 |
| 365 | iso_pu_bacteria | 8016530956 | 8016535903 | 216 |
| 366 | iso_pu_bacteria | 8016539877 | 8016540185 | 216 |
| 367 | iso_pu_bacteria | 8016548790 | 8016553050 | 216 |
| 368 | iso_pu_bacteria | 8016566248 | 8016574252 | 216 |
| 369 | iso_pu_bacteria | 8016575299 | 8016578351 | 216 |
| 370 | iso_pu_bacteria | 8016583857 | 8016591493 | 216 |
| 371 | iso_pu_bacteria | 8016595262 | 8016599278 | 216 |
| 372 | iso_pu_bacteria | 8016603502 | 8016611764 | 216 |
| 373 | iso_pu_bacteria | 8016613128 | 8016622038 | 216 |
| 374 | iso_pu_bacteria | 8016622563 | 8016627817 | 216 |
| 375 | iso_pu_bacteria | 8016630954 | 8016632131 | 216 |
| 376 | iso_pu_bacteria | 8017057580 | 8017061888 | 216 |
| 377 | iso_pu_bacteria | 8019530166 | 8019535630 | 216 |
| 378 | iso_pu_bacteria | 8019538911 | 8019543851 | 216 |
| 379 | iso_pu_bacteria | 8019547302 | 8019554926 | 216 |
| 380 | iso_pu_bacteria | 8019576017 | 8019581422 | 216 |
| 381 | iso_pu_bacteria | 8019586578 | 8019589050 | 216 |
| 382 | iso_pu_bacteria | 8019597564 | 8019602184 | 216 |
| 383 | iso_pu_bacteria | 8019629233 | 8019635495 | 216 |
| 384 | iso_pu_bacteria | 8019638758 | 8019644209 | 216 |
| 385 | iso_pu_bacteria | 8019648815 | 8019657261 | 216 |
| 386 | iso_pu_bacteria | 8019659431 | 8019663304 | 216 |
| 387 | iso_pu_bacteria | 8019668869 | 8019672922 | 216 |
| 388 | iso_pu_bacteria | 8019678201 | 8019683221 | 216 |
| 389 | iso_pu_bacteria | 8019687851 | 8019688925 | 216 |
| 390 | iso_pu_bacteria | 8055742211 | 8055747408 | 216 |
| 391 | iso_pu_bacteria | 8056967851 | 8056972518 | 216 |
| 392 | 3300005338 | Ga0068868_100064444 | Ga0068868_1000644443 | 217 |
| 393 | 3300005344 | Ga0070661_100054794 | Ga0070661_1000547943 | 217 |
| 394 | 3300005435 | Ga0070714_100014004 | Ga0070714_1000140043 | 217 |
| 395 | 3300005455 | Ga0070663_100014194 | Ga0070663_1000141944 | 217 |
| 396 | 3300005456 | Ga0070678_100186943 | Ga0070678_1001869432 | 217 |
| 397 | 3300005471 | Ga0070698_100686212 | Ga0070698_1006862122 | 217 |
| 398 | 3300005535 | Ga0070684_100169988 | Ga0070684_1001699884 | 217 |
| 399 | 3300005564 | Ga0070664_100037767 | Ga0070664_1000377673 | 217 |
| 400 | 3300005578 | Ga0068854_100026693 | Ga0068854_1000266936 | 217 |
| 401 | 3300005578 | Ga0068854_100405048 | Ga0068854_1004050482 | 217 |
| 402 | 3300005614 | Ga0068856_100003013 | Ga0068856_10000301316 | 217 |
| 403 | 3300005614 | Ga0068856_100229067 | Ga0068856_1002290672 | 217 |
| 404 | 3300005616 | Ga0068852_100159514 | Ga0068852_1001595142 | 217 |
| 405 | 3300005618 | Ga0068864_100023148 | Ga0068864_1000231486 | 217 |
| 406 | 3300005840 | Ga0068870_10094649 | Ga0068870_100946492 | 217 |
| 407 | 3300005985 | Ga0081539_10153426 | Ga0081539_101534262 | 217 |
| 408 | 3300006237 | Ga0097621_100175580 | Ga0097621_1001755802 | 217 |
| 409 | 3300006942 | Ga0099824_1006697 | Ga0099824_100669717 | 217 |
| 410 | 3300007076 | Ga0075435_100017984 | Ga0075435_1000179843 | 217 |
| 411 | 3300007265 | Ga0099794_10046548 | Ga0099794_100465483 | 217 |
| 412 | 3300007788 | Ga0099795_10010942 | Ga0099795_100109424 | 217 |
| 413 | 3300009101 | Ga0105247_10247390 | Ga0105247_102473902 | 217 |
| 414 | 3300009101 | Ga0105247_10266257 | Ga0105247_102662572 | 217 |
| 415 | 3300010375 | Ga0105239_10177285 | Ga0105239_101772852 | 217 |
| 416 | 3300011119 | Ga0105246_10300738 | Ga0105246_103007382 | 217 |
| 417 | 3300013296 | Ga0157374_10010340 | Ga0157374_100103406 | 217 |
| 418 | 3300013297 | Ga0157378_10196236 | Ga0157378_101962363 | 217 |
| 419 | 3300013306 | Ga0163162_10015299 | Ga0163162_100152996 | 217 |
| 420 | 3300013308 | Ga0157375_10025490 | Ga0157375_100254905 | 217 |
| 421 | 3300014325 | Ga0163163_10020877 | Ga0163163_100208772 | 217 |
| 422 | 3300014969 | Ga0157376_10002196 | Ga0157376_100021967 | 217 |
| 423 | 3300021358 | Ga0213873_10004067 | Ga0213873_100040673 | 217 |
| 424 | 3300021384 | Ga0213876_10002558 | Ga0213876_100025588 | 217 |
| 425 | 3300025900 | Ga0207710_10044680 | Ga0207710_100446802 | 217 |
| 426 | 3300025908 | Ga0207643_10085357 | Ga0207643_100853573 | 217 |
| 427 | 3300025909 | Ga0207705_10407268 | Ga0207705_104072681 | 217 |
| 428 | 3300025919 | Ga0207657_10475408 | Ga0207657_104754082 | 217 |
| 429 | 3300025920 | Ga0207649_10040728 | Ga0207649_100407283 | 217 |
| 430 | 3300025929 | Ga0207664_10106019 | Ga0207664_101060194 | 217 |
| 431 | 3300025931 | Ga0207644_10231862 | Ga0207644_102318622 | 217 |
| 432 | 3300025941 | Ga0207711_10665094 | Ga0207711_106650942 | 217 |
| 433 | 3300025945 | Ga0207679_10157649 | Ga0207679_101576492 | 217 |
| 434 | 3300025981 | Ga0207640_10361311 | Ga0207640_103613112 | 217 |
| 435 | 3300026067 | Ga0207678_10025740 | Ga0207678_100257404 | 217 |
| 436 | 3300026078 | Ga0207702_10000365 | Ga0207702_1000036527 | 217 |
| 437 | 3300026088 | Ga0207641_10232456 | Ga0207641_102324561 | 217 |
| 438 | 3300026095 | Ga0207676_10071416 | Ga0207676_100714164 | 217 |
| 439 | 3300026121 | Ga0207683_10044978 | Ga0207683_100449781 | 217 |
| 440 | 3300027671 | Ga0209588_1033615 | Ga0209588_10336151 | 217 |
| 441 | 3300031616 | Ga0307508_10292536 | Ga0307508_102925361 | 217 |
| 442 | 3300035724 | Ga0373933_0000276 | Ga0373933_0000276_11854_12513 | 217 |
| 443 | 3300039437 | Ga0436365_0871323 | Ga0436365_0871323_40806_41462 | 217 |
| 444 | 3300041505 | Ga0451849_1570337 | Ga0451849_1570337_108_761 | 217 |
| 445 | 3300041512 | Ga0451853_1014670 | Ga0451853_1014670_156_809 | 217 |
| 446 | 3300046476 | Ga0495662_0197053 | Ga0495662_0197053_42_695 | 217 |
| 447 | 3300046507 | Ga0495606_0276886 | Ga0495606_0276886_107_760 | 217 |
| 448 | 3300047321 | Ga0495676_0552137 | Ga0495676_0552137_64_717 | 217 |
| 449 | 3300048903 | Ga0496100_0051487 | Ga0496100_0051487_1320_1973 | 217 |
| 450 | 3300048904 | Ga0496101_0044574 | Ga0496101_0044574_887_1540 | 217 |
| 451 | 3300048905 | Ga0496102_0001372 | Ga0496102_0001372_2259_2912 | 217 |
| 452 | 3300048906 | Ga0496103_0021125 | Ga0496103_0021125_2618_3271 | 217 |
| 453 | 3300048907 | Ga0496104_0083890 | Ga0496104_0083890_807_1460 | 217 |
| 454 | 3300048908 | Ga0496105_0143125 | Ga0496105_0143125_1062_1715 | 217 |
| 455 | 3300048909 | Ga0496106_0006324 | Ga0496106_0006324_4625_5278 | 217 |
| 456 | 3300048909 | Ga0496106_0731540 | Ga0496106_0731540_64_720 | 217 |
| 457 | 3300048910 | Ga0496107_0006521 | Ga0496107_0006521_2733_3386 | 217 |
| 458 | 3300048911 | Ga0496108_0006613 | Ga0496108_0006613_677_1330 | 217 |
| 459 | 3300048912 | Ga0496109_0002448 | Ga0496109_0002448_8431_9084 | 217 |
| 460 | 3300048913 | Ga0496110_0112071 | Ga0496110_0112071_880_1533 | 217 |
| 461 | 3300048915 | Ga0496112_0010931 | Ga0496112_0010931_3464_4120 | 217 |
| 462 | 3300048915 | Ga0496112_0285231 | Ga0496112_0285231_38_691 | 217 |
| 463 | 3300048915 | Ga0496112_1105701 | Ga0496112_1105701_26_685 | 217 |
| 464 | 3300048916 | Ga0496113_0031029 | Ga0496113_0031029_198_851 | 217 |
| 465 | 3300048917 | Ga0496114_0067981 | Ga0496114_0067981_1304_1957 | 217 |
| 466 | 3300049569 | Ga0501032_0517313 | Ga0501032_0517313_17_673 | 217 |
| 467 | 3300049570 | Ga0501033_0036070 | Ga0501033_0036070_2075_2731 | 217 |
| 468 | 3300049571 | Ga0501034_0011050 | Ga0501034_0011050_6120_6776 | 217 |
| 469 | 3300049571 | Ga0501034_0316545 | Ga0501034_0316545_239_895 | 217 |
| 470 | 3300049572 | Ga0501036_0019092 | Ga0501036_0019092_2567_3223 | 217 |
| 471 | 3300049573 | Ga0501037_0047500 | Ga0501037_0047500_2003_2659 | 217 |
| 472 | 3300049574 | Ga0501038_0106772 | Ga0501038_0106772_171_827 | 217 |
| 473 | 3300049575 | Ga0501039_0227503 | Ga0501039_0227503_78_734 | 217 |
| 474 | 3300049575 | Ga0501039_0590222 | Ga0501039_0590222_202_858 | 217 |
| 475 | 3300049579 | Ga0501043_0046534 | Ga0501043_0046534_165_821 | 217 |
| 476 | 3300049579 | Ga0501043_0470337 | Ga0501043_0470337_137_793 | 217 |
| 477 | 3300049579 | Ga0501043_0671617 | Ga0501043_0671617_49_705 | 217 |
| 478 | 3300049581 | Ga0501047_0009309 | Ga0501047_0009309_7980_8636 | 217 |
| 479 | 3300049581 | Ga0501047_0430987 | Ga0501047_0430987_154_810 | 217 |
| 480 | 3300049582 | Ga0501048_0096016 | Ga0501048_0096016_1217_1873 | 217 |
| 481 | 3300049822 | Ga0501035_0047884 | Ga0501035_0047884_2434_3090 | 217 |
| 482 | 3300049822 | Ga0501035_0149430 | Ga0501035_0149430_1315_1971 | 217 |
| 483 | 3300049823 | Ga0501044_0083130 | Ga0501044_0083130_2345_3001 | 217 |
| 484 | 3300049823 | Ga0501044_0370651 | Ga0501044_0370651_194_850 | 217 |
| 485 | 3300050512 | nmdc:mga0n895_58986_c1 | nmdc:mga0n895_58986_c1_15_668 | 217 |
| 486 | 3300053085 | Ga0495619_0282095 | Ga0495619_0282095_258_1016 | 217 |
| 487 | 3300053091 | Ga0500647_0091591 | Ga0500647_0091591_730_1386 | 217 |
| 488 | 3300053094 | Ga0500566_0001527 | Ga0500566_0001527_12402_13058 | 217 |
| 489 | 3300053095 | Ga0500640_000943 | Ga0500640_000943_4322_4978 | 217 |
| 490 | 3300053111 | Ga0500572_000012 | Ga0500572_000012_38088_38744 | 217 |
| 491 | 3300053115 | Ga0500591_054228 | Ga0500591_054228_676_1332 | 217 |
| 492 | 3300053122 | Ga0500608_014338 | Ga0500608_014338_2407_3063 | 217 |
| 493 | 3300053123 | Ga0500614_000718 | Ga0500614_000718_4062_4718 | 217 |
| 494 | 3300053136 | Ga0500559_0006918 | Ga0500559_0006918_1927_2583 | 217 |
| 495 | 3300053148 | Ga0500590_060119 | Ga0500590_060119_389_1045 | 217 |
| 496 | 3300053150 | Ga0500603_000044 | Ga0500603_000044_28439_29095 | 217 |
| 497 | 3300053159 | Ga0500630_004013 | Ga0500630_004013_1807_2463 | 217 |
| 498 | 3300053162 | Ga0500638_048766 | Ga0500638_048766_986_1642 | 217 |
| 499 | 3300053163 | Ga0500639_000004 | Ga0500639_000004_80587_81243 | 217 |
| 500 | 3300053725 | Ga0500576_093321 | Ga0500576_093321_233_889 | 217 |
| 501 | 3300053735 | Ga0500596_000145 | Ga0500596_000145_2945_3601 | 217 |
| 502 | 3300053737 | Ga0500601_002164 | Ga0500601_002164_641_1297 | 217 |
| 503 | 3300002070 | JGI24750J21931_1016458 | JGI24750J21931_10164582 | 218 |
| 504 | 3300003215 | JGI25153J46596_10026655 | JGI25153J46596_100266552 | 218 |
| 505 | 3300003323 | rootH1_10253088 | rootH1_102530884 | 218 |
| 506 | 3300003354 | JGI25160J50197_1000471 | JGI25160J50197_100047116 | 218 |
| 507 | 3300003354 | JGI25160J50197_1003264 | JGI25160J50197_10032649 | 218 |
| 508 | 3300003354 | JGI25160J50197_1054240 | JGI25160J50197_10542401 | 218 |
| 509 | 3300003759 | Ga0055525_1007176 | Ga0055525_10071761 | 218 |
| 510 | 3300003771 | Ga0055526_1029520 | Ga0055526_10295201 | 218 |
| 511 | 3300003794 | Ga0055531_10023384 | Ga0055531_100233842 | 218 |
| 512 | 3300004625 | Ga0055543_1004797 | Ga0055543_10047974 | 218 |
| 513 | 3300005262 | Ga0065165_1000676 | Ga0065165_100067616 | 218 |
| 514 | 3300005262 | Ga0065165_1001028 | Ga0065165_100102815 | 218 |
| 515 | 3300005262 | Ga0065165_1004302 | Ga0065165_100430211 | 218 |
| 516 | 3300005262 | Ga0065165_1014933 | Ga0065165_10149332 | 218 |
| 517 | 3300005328 | Ga0070676_10389457 | Ga0070676_103894571 | 218 |
| 518 | 3300005331 | Ga0070670_100086065 | Ga0070670_1000860652 | 218 |
| 519 | 3300005334 | Ga0068869_100341008 | Ga0068869_1003410082 | 218 |
| 520 | 3300005336 | Ga0070680_100096083 | Ga0070680_1000960831 | 218 |
| 521 | 3300005337 | Ga0070682_100056399 | Ga0070682_1000563993 | 218 |
| 522 | 3300005337 | Ga0070682_100158735 | Ga0070682_1001587352 | 218 |
| 523 | 3300005338 | Ga0068868_100263019 | Ga0068868_1002630192 | 218 |
| 524 | 3300005338 | Ga0068868_101133988 | Ga0068868_1011339881 | 218 |
| 525 | 3300005339 | Ga0070660_100593344 | Ga0070660_1005933441 | 218 |
| 526 | 3300005340 | Ga0070689_100203772 | Ga0070689_1002037722 | 218 |
| 527 | 3300005344 | Ga0070661_100323028 | Ga0070661_1003230281 | 218 |
| 528 | 3300005344 | Ga0070661_100323533 | Ga0070661_1003235331 | 218 |
| 529 | 3300005347 | Ga0070668_100026677 | Ga0070668_1000266772 | 218 |
| 530 | 3300005347 | Ga0070668_100055646 | Ga0070668_1000556464 | 218 |
| 531 | 3300005347 | Ga0070668_100317109 | Ga0070668_1003171091 | 218 |
| 532 | 3300005347 | Ga0070668_100366112 | Ga0070668_1003661121 | 218 |
| 533 | 3300005347 | Ga0070668_100387535 | Ga0070668_1003875351 | 218 |
| 534 | 3300005347 | Ga0070668_100527265 | Ga0070668_1005272651 | 218 |
| 535 | 3300005347 | Ga0070668_100981033 | Ga0070668_1009810331 | 218 |
| 536 | 3300005353 | Ga0070669_100445269 | Ga0070669_1004452692 | 218 |
| 537 | 3300005355 | Ga0070671_100004070 | Ga0070671_10000407011 | 218 |
| 538 | 3300005356 | Ga0070674_100228264 | Ga0070674_1002282641 | 218 |
| 539 | 3300005364 | Ga0070673_100063368 | Ga0070673_1000633683 | 218 |
| 540 | 3300005364 | Ga0070673_100626823 | Ga0070673_1006268232 | 218 |
| 541 | 3300005366 | Ga0070659_100238690 | Ga0070659_1002386901 | 218 |
| 542 | 3300005367 | Ga0070667_100278053 | Ga0070667_1002780531 | 218 |
| 543 | 3300005367 | Ga0070667_100710206 | Ga0070667_1007102061 | 218 |
| 544 | 3300005367 | Ga0070667_100778232 | Ga0070667_1007782321 | 218 |
| 545 | 3300005367 | Ga0070667_101069845 | Ga0070667_1010698451 | 218 |
| 546 | 3300005434 | Ga0070709_10021834 | Ga0070709_100218345 | 218 |
| 547 | 3300005435 | Ga0070714_100029874 | Ga0070714_1000298742 | 218 |
| 548 | 3300005435 | Ga0070714_100126094 | Ga0070714_1001260944 | 218 |
| 549 | 3300005435 | Ga0070714_100200117 | Ga0070714_1002001172 | 218 |
| 550 | 3300005436 | Ga0070713_100012520 | Ga0070713_1000125206 | 218 |
| 551 | 3300005436 | Ga0070713_100034225 | Ga0070713_1000342252 | 218 |
| 552 | 3300005437 | Ga0070710_10061446 | Ga0070710_100614462 | 218 |
| 553 | 3300005437 | Ga0070710_10248827 | Ga0070710_102488271 | 218 |
| 554 | 3300005438 | Ga0070701_10273477 | Ga0070701_102734772 | 218 |
| 555 | 3300005439 | Ga0070711_100004721 | Ga0070711_1000047219 | 218 |
| 556 | 3300005455 | Ga0070663_100088773 | Ga0070663_1000887734 | 218 |
| 557 | 3300005455 | Ga0070663_100257800 | Ga0070663_1002578001 | 218 |
| 558 | 3300005456 | Ga0070678_100400338 | Ga0070678_1004003382 | 218 |
| 559 | 3300005457 | Ga0070662_100042888 | Ga0070662_1000428884 | 218 |
| 560 | 3300005457 | Ga0070662_100239802 | Ga0070662_1002398021 | 218 |
| 561 | 3300005458 | Ga0070681_10013643 | Ga0070681_100136434 | 218 |
| 562 | 3300005458 | Ga0070681_10348649 | Ga0070681_103486492 | 218 |
| 563 | 3300005458 | Ga0070681_10468245 | Ga0070681_104682451 | 218 |
| 564 | 3300005471 | Ga0070698_100588742 | Ga0070698_1005887421 | 218 |
| 565 | 3300005518 | Ga0070699_100238133 | Ga0070699_1002381332 | 218 |
| 566 | 3300005530 | Ga0070679_100114708 | Ga0070679_1001147081 | 218 |
| 567 | 3300005539 | Ga0068853_100067816 | Ga0068853_1000678164 | 218 |
| 568 | 3300005539 | Ga0068853_100077357 | Ga0068853_1000773571 | 218 |
| 569 | 3300005539 | Ga0068853_100145365 | Ga0068853_1001453652 | 218 |
| 570 | 3300005539 | Ga0068853_100433344 | Ga0068853_1004333442 | 218 |
| 571 | 3300005543 | Ga0070672_100193562 | Ga0070672_1001935621 | 218 |
| 572 | 3300005543 | Ga0070672_100418258 | Ga0070672_1004182581 | 218 |
| 573 | 3300005543 | Ga0070672_100560683 | Ga0070672_1005606832 | 218 |
| 574 | 3300005547 | Ga0070693_100058244 | Ga0070693_1000582442 | 218 |
| 575 | 3300005548 | Ga0070665_100005911 | Ga0070665_10000591112 | 218 |
| 576 | 3300005548 | Ga0070665_100050816 | Ga0070665_1000508165 | 218 |
| 577 | 3300005548 | Ga0070665_100195652 | Ga0070665_1001956524 | 218 |
| 578 | 3300005548 | Ga0070665_100654806 | Ga0070665_1006548062 | 218 |
| 579 | 3300005548 | Ga0070665_100858703 | Ga0070665_1008587032 | 218 |
| 580 | 3300005563 | Ga0068855_100044859 | Ga0068855_1000448594 | 218 |
| 581 | 3300005563 | Ga0068855_100309579 | Ga0068855_1003095793 | 218 |
| 582 | 3300005564 | Ga0070664_100323222 | Ga0070664_1003232221 | 218 |
| 583 | 3300005577 | Ga0068857_100359990 | Ga0068857_1003599901 | 218 |
| 584 | 3300005614 | Ga0068856_100056762 | Ga0068856_1000567622 | 218 |
| 585 | 3300005614 | Ga0068856_100256524 | Ga0068856_1002565243 | 218 |
| 586 | 3300005615 | Ga0070702_100032923 | Ga0070702_1000329233 | 218 |
| 587 | 3300005616 | Ga0068852_100037597 | Ga0068852_1000375974 | 218 |
| 588 | 3300005616 | Ga0068852_100616225 | Ga0068852_1006162252 | 218 |
| 589 | 3300005616 | Ga0068852_100792333 | Ga0068852_1007923331 | 218 |
| 590 | 3300005617 | Ga0068859_100040881 | Ga0068859_1000408815 | 218 |
| 591 | 3300005617 | Ga0068859_100327723 | Ga0068859_1003277231 | 218 |
| 592 | 3300005617 | Ga0068859_101123683 | Ga0068859_1011236832 | 218 |
| 593 | 3300005618 | Ga0068864_100470002 | Ga0068864_1004700022 | 218 |
| 594 | 3300005718 | Ga0068866_10237859 | Ga0068866_102378591 | 218 |
| 595 | 3300005719 | Ga0068861_100383509 | Ga0068861_1003835092 | 218 |
| 596 | 3300005719 | Ga0068861_100427563 | Ga0068861_1004275631 | 218 |
| 597 | 3300005840 | Ga0068870_10101180 | Ga0068870_101011801 | 218 |
| 598 | 3300005841 | Ga0068863_100155365 | Ga0068863_1001553653 | 218 |
| 599 | 3300005841 | Ga0068863_100337609 | Ga0068863_1003376092 | 218 |
| 600 | 3300005841 | Ga0068863_100387813 | Ga0068863_1003878132 | 218 |
| 601 | 3300005842 | Ga0068858_100385350 | Ga0068858_1003853501 | 218 |
| 602 | 3300005843 | Ga0068860_100115291 | Ga0068860_1001152914 | 218 |
| 603 | 3300005843 | Ga0068860_100191475 | Ga0068860_1001914753 | 218 |
| 604 | 3300005843 | Ga0068860_100287751 | Ga0068860_1002877512 | 218 |
| 605 | 3300005843 | Ga0068860_100393161 | Ga0068860_1003931612 | 218 |
| 606 | 3300005843 | Ga0068860_100625168 | Ga0068860_1006251681 | 218 |
| 607 | 3300005844 | Ga0068862_100506583 | Ga0068862_1005065832 | 218 |
| 608 | 3300005937 | Ga0081455_10035420 | Ga0081455_100354206 | 218 |
| 609 | 3300005937 | Ga0081455_10068340 | Ga0081455_100683404 | 218 |
| 610 | 3300005937 | Ga0081455_10082648 | Ga0081455_100826481 | 218 |
| 611 | 3300005983 | Ga0081540_1000565 | Ga0081540_100056518 | 218 |
| 612 | 3300005983 | Ga0081540_1005680 | Ga0081540_10056807 | 218 |
| 613 | 3300005983 | Ga0081540_1040102 | Ga0081540_10401023 | 218 |
| 614 | 3300005983 | Ga0081540_1045259 | Ga0081540_10452594 | 218 |
| 615 | 3300005983 | Ga0081540_1065883 | Ga0081540_10658831 | 218 |
| 616 | 3300005983 | Ga0081540_1085085 | Ga0081540_10850852 | 218 |
| 617 | 3300005985 | Ga0081539_10013324 | Ga0081539_100133244 | 218 |
| 618 | 3300006028 | Ga0070717_10032963 | Ga0070717_100329634 | 218 |
| 619 | 3300006028 | Ga0070717_10419413 | Ga0070717_104194132 | 218 |
| 620 | 3300006038 | Ga0075365_10011750 | Ga0075365_100117504 | 218 |
| 621 | 3300006038 | Ga0075365_10015504 | Ga0075365_100155045 | 218 |
| 622 | 3300006038 | Ga0075365_10035365 | Ga0075365_100353652 | 218 |
| 623 | 3300006038 | Ga0075365_10106223 | Ga0075365_101062232 | 218 |
| 624 | 3300006038 | Ga0075365_10117466 | Ga0075365_101174661 | 218 |
| 625 | 3300006038 | Ga0075365_10125621 | Ga0075365_101256212 | 218 |
| 626 | 3300006038 | Ga0075365_10162133 | Ga0075365_101621332 | 218 |
| 627 | 3300006038 | Ga0075365_10364919 | Ga0075365_103649191 | 218 |
| 628 | 3300006042 | Ga0075368_10005658 | Ga0075368_100056583 | 218 |
| 629 | 3300006042 | Ga0075368_10012370 | Ga0075368_100123702 | 218 |
| 630 | 3300006042 | Ga0075368_10028085 | Ga0075368_100280853 | 218 |
| 631 | 3300006048 | Ga0075363_100000880 | Ga0075363_10000088010 | 218 |
| 632 | 3300006048 | Ga0075363_100156238 | Ga0075363_1001562382 | 218 |
| 633 | 3300006048 | Ga0075363_100222179 | Ga0075363_1002221792 | 218 |
| 634 | 3300006048 | Ga0075363_100363162 | Ga0075363_1003631621 | 218 |
| 635 | 3300006051 | Ga0075364_10095437 | Ga0075364_100954372 | 218 |
| 636 | 3300006051 | Ga0075364_10140052 | Ga0075364_101400522 | 218 |
| 637 | 3300006058 | Ga0075432_10110782 | Ga0075432_101107821 | 218 |
| 638 | 3300006173 | Ga0070716_100122791 | Ga0070716_1001227912 | 218 |
| 639 | 3300006175 | Ga0070712_100042726 | Ga0070712_1000427265 | 218 |
| 640 | 3300006177 | Ga0075362_10029004 | Ga0075362_100290042 | 218 |
| 641 | 3300006177 | Ga0075362_10042719 | Ga0075362_100427191 | 218 |
| 642 | 3300006177 | Ga0075362_10201582 | Ga0075362_102015822 | 218 |
| 643 | 3300006178 | Ga0075367_10025247 | Ga0075367_100252472 | 218 |
| 644 | 3300006178 | Ga0075367_10046062 | Ga0075367_100460621 | 218 |
| 645 | 3300006178 | Ga0075367_10060985 | Ga0075367_100609852 | 218 |
| 646 | 3300006178 | Ga0075367_10067004 | Ga0075367_100670042 | 218 |
| 647 | 3300006178 | Ga0075367_10191734 | Ga0075367_101917342 | 218 |
| 648 | 3300006186 | Ga0075369_10091439 | Ga0075369_100914391 | 218 |
| 649 | 3300006195 | Ga0075366_10042978 | Ga0075366_100429782 | 218 |
| 650 | 3300006195 | Ga0075366_10062328 | Ga0075366_100623282 | 218 |
| 651 | 3300006195 | Ga0075366_10122491 | Ga0075366_101224911 | 218 |
| 652 | 3300006195 | Ga0075366_10177709 | Ga0075366_101777091 | 218 |
| 653 | 3300006195 | Ga0075366_10234143 | Ga0075366_102341431 | 218 |
| 654 | 3300006195 | Ga0075366_10250692 | Ga0075366_102506922 | 218 |
| 655 | 3300006353 | Ga0075370_10033831 | Ga0075370_100338311 | 218 |
| 656 | 3300006353 | Ga0075370_10043409 | Ga0075370_100434092 | 218 |
| 657 | 3300006353 | Ga0075370_10052172 | Ga0075370_100521721 | 218 |
| 658 | 3300006353 | Ga0075370_10079942 | Ga0075370_100799421 | 218 |
| 659 | 3300006353 | Ga0075370_10096250 | Ga0075370_100962502 | 218 |
| 660 | 3300006358 | Ga0068871_100304461 | Ga0068871_1003044612 | 218 |
| 661 | 3300006358 | Ga0068871_100474964 | Ga0068871_1004749642 | 218 |
| 662 | 3300006844 | Ga0075428_100085520 | Ga0075428_1000855202 | 218 |
| 663 | 3300006847 | Ga0075431_100453439 | Ga0075431_1004534392 | 218 |
| 664 | 3300006871 | Ga0075434_100162290 | Ga0075434_1001622902 | 218 |
| 665 | 3300006914 | Ga0075436_100067047 | Ga0075436_1000670473 | 218 |
| 666 | 3300006931 | Ga0097620_100040883 | Ga0097620_1000408835 | 218 |
| 667 | 3300006931 | Ga0097620_100327726 | Ga0097620_1003277262 | 218 |
| 668 | 3300006931 | Ga0097620_101123610 | Ga0097620_1011236102 | 218 |
| 669 | 3300006941 | Ga0099825_1040584 | Ga0099825_10405841 | 218 |
| 670 | 3300006942 | Ga0099824_1015025 | Ga0099824_10150255 | 218 |
| 671 | 3300009092 | Ga0105250_10129780 | Ga0105250_101297802 | 218 |
| 672 | 3300009093 | Ga0105240_10025515 | Ga0105240_100255153 | 218 |
| 673 | 3300009093 | Ga0105240_10109631 | Ga0105240_101096313 | 218 |
| 674 | 3300009093 | Ga0105240_11111430 | Ga0105240_111114301 | 218 |
| 675 | 3300009094 | Ga0111539_10522638 | Ga0111539_105226381 | 218 |
| 676 | 3300009098 | Ga0105245_10040987 | Ga0105245_100409871 | 218 |
| 677 | 3300009098 | Ga0105245_10236260 | Ga0105245_102362602 | 218 |
| 678 | 3300009098 | Ga0105245_10317873 | Ga0105245_103178732 | 218 |
| 679 | 3300009101 | Ga0105247_10042883 | Ga0105247_100428834 | 218 |
| 680 | 3300009101 | Ga0105247_10199743 | Ga0105247_101997432 | 218 |
| 681 | 3300009101 | Ga0105247_10267345 | Ga0105247_102673451 | 218 |
| 682 | 3300009101 | Ga0105247_10371671 | Ga0105247_103716711 | 218 |
| 683 | 3300009147 | Ga0114129_10572337 | Ga0114129_105723372 | 218 |
| 684 | 3300009148 | Ga0105243_10071572 | Ga0105243_100715724 | 218 |
| 685 | 3300009148 | Ga0105243_10361040 | Ga0105243_103610401 | 218 |
| 686 | 3300009174 | Ga0105241_10118471 | Ga0105241_101184712 | 218 |
| 687 | 3300009174 | Ga0105241_10131433 | Ga0105241_101314332 | 218 |
| 688 | 3300009174 | Ga0105241_10299360 | Ga0105241_102993602 | 218 |
| 689 | 3300009177 | Ga0105248_10360990 | Ga0105248_103609902 | 218 |
| 690 | 3300009545 | Ga0105237_10008457 | Ga0105237_100084575 | 218 |
| 691 | 3300009545 | Ga0105237_10501605 | Ga0105237_105016052 | 218 |
| 692 | 3300009545 | Ga0105237_10636519 | Ga0105237_106365191 | 218 |
| 693 | 3300009551 | Ga0105238_10109774 | Ga0105238_101097742 | 218 |
| 694 | 3300009551 | Ga0105238_10146736 | Ga0105238_101467362 | 218 |
| 695 | 3300009551 | Ga0105238_10219790 | Ga0105238_102197903 | 218 |
| 696 | 3300009551 | Ga0105238_10230700 | Ga0105238_102307002 | 218 |
| 697 | 3300009551 | Ga0105238_10257525 | Ga0105238_102575252 | 218 |
| 698 | 3300009553 | Ga0105249_10340285 | Ga0105249_103402852 | 218 |
| 699 | 3300009553 | Ga0105249_10786915 | Ga0105249_107869151 | 218 |
| 700 | 3300009553 | Ga0105249_10966653 | Ga0105249_109666532 | 218 |
| 701 | 3300010375 | Ga0105239_10046697 | Ga0105239_100466976 | 218 |
| 702 | 3300010375 | Ga0105239_10050580 | Ga0105239_100505806 | 218 |
| 703 | 3300010375 | Ga0105239_10099732 | Ga0105239_100997322 | 218 |
| 704 | 3300010375 | Ga0105239_11035849 | Ga0105239_110358492 | 218 |
| 705 | 3300011119 | Ga0105246_10074369 | Ga0105246_100743694 | 218 |
| 706 | 3300011119 | Ga0105246_10281708 | Ga0105246_102817081 | 218 |
| 707 | 3300011119 | Ga0105246_10410575 | Ga0105246_104105752 | 218 |
| 708 | 3300013296 | Ga0157374_10102780 | Ga0157374_101027803 | 218 |
| 709 | 3300013296 | Ga0157374_10138060 | Ga0157374_101380603 | 218 |
| 710 | 3300013296 | Ga0157374_10745262 | Ga0157374_107452622 | 218 |
| 711 | 3300013297 | Ga0157378_10496673 | Ga0157378_104966732 | 218 |
| 712 | 3300013297 | Ga0157378_11594091 | Ga0157378_115940911 | 218 |
| 713 | 3300014325 | Ga0163163_10038915 | Ga0163163_100389152 | 218 |
| 714 | 3300014325 | Ga0163163_10119746 | Ga0163163_101197464 | 218 |
| 715 | 3300014325 | Ga0163163_10223609 | Ga0163163_102236092 | 218 |
| 716 | 3300014325 | Ga0163163_10762099 | Ga0163163_107620991 | 218 |
| 717 | 3300014969 | Ga0157376_10267181 | Ga0157376_102671812 | 218 |
| 718 | 3300017792 | Ga0163161_10095823 | Ga0163161_100958233 | 218 |
| 719 | 3300017792 | Ga0163161_10245871 | Ga0163161_102458712 | 218 |
| 720 | 3300017792 | Ga0163161_10305165 | Ga0163161_103051652 | 218 |
| 721 | 3300021320 | Ga0214544_1003958 | Ga0214544_10039582 | 218 |
| 722 | 3300021321 | Ga0214542_1000002 | Ga0214542_1000002413 | 218 |
| 723 | 3300021324 | Ga0214545_1000002 | Ga0214545_1000002307 | 218 |
| 724 | 3300021327 | Ga0214543_1000013 | Ga0214543_100001315 | 218 |
| 725 | 3300021384 | Ga0213876_10308640 | Ga0213876_103086401 | 218 |
| 726 | 3300021441 | Ga0213871_10001798 | Ga0213871_100017982 | 218 |
| 727 | 3300025230 | Ga0209563_108420 | Ga0209563_1084201 | 218 |
| 728 | 3300025253 | Ga0209677_103580 | Ga0209677_1035806 | 218 |
| 729 | 3300025254 | Ga0209148_1000319 | Ga0209148_100031965 | 218 |
| 730 | 3300025261 | Ga0209233_1001148 | Ga0209233_10011487 | 218 |
| 731 | 3300025261 | Ga0209233_1008818 | Ga0209233_10088182 | 218 |
| 732 | 3300025272 | Ga0209455_1003913 | Ga0209455_10039134 | 218 |
| 733 | 3300025272 | Ga0209455_1005042 | Ga0209455_10050424 | 218 |
| 734 | 3300025272 | Ga0209455_1006371 | Ga0209455_10063714 | 218 |
| 735 | 3300025273 | Ga0209673_1042772 | Ga0209673_10427722 | 218 |
| 736 | 3300025295 | Ga0209564_1006114 | Ga0209564_10061142 | 218 |
| 737 | 3300025297 | Ga0209758_1000100 | Ga0209758_1000100215 | 218 |
| 738 | 3300025297 | Ga0209758_1000138 | Ga0209758_1000138134 | 218 |
| 739 | 3300025297 | Ga0209758_1001091 | Ga0209758_100109122 | 218 |
| 740 | 3300025297 | Ga0209758_1001321 | Ga0209758_100132129 | 218 |
| 741 | 3300025297 | Ga0209758_1015098 | Ga0209758_10150981 | 218 |
| 742 | 3300025299 | Ga0209256_1016482 | Ga0209256_10164822 | 218 |
| 743 | 3300025302 | Ga0207426_1000575 | Ga0207426_100057515 | 218 |
| 744 | 3300025302 | Ga0207426_1000611 | Ga0207426_100061137 | 218 |
| 745 | 3300025302 | Ga0207426_1005308 | Ga0207426_10053087 | 218 |
| 746 | 3300025302 | Ga0207426_1052117 | Ga0207426_10521172 | 218 |
| 747 | 3300025302 | Ga0207426_1074254 | Ga0207426_10742541 | 218 |
| 748 | 3300025304 | Ga0209257_1002363 | Ga0209257_10023632 | 218 |
| 749 | 3300025304 | Ga0209257_1016653 | Ga0209257_10166532 | 218 |
| 750 | 3300025304 | Ga0209257_1019833 | Ga0209257_10198333 | 218 |
| 751 | 3300025315 | Ga0207697_10084198 | Ga0207697_100841981 | 218 |
| 752 | 3300025898 | Ga0207692_10050274 | Ga0207692_100502742 | 218 |
| 753 | 3300025898 | Ga0207692_10223243 | Ga0207692_102232432 | 218 |
| 754 | 3300025900 | Ga0207710_10041299 | Ga0207710_100412992 | 218 |
| 755 | 3300025900 | Ga0207710_10104578 | Ga0207710_101045782 | 218 |
| 756 | 3300025900 | Ga0207710_10294336 | Ga0207710_102943361 | 218 |
| 757 | 3300025901 | Ga0207688_10110472 | Ga0207688_101104721 | 218 |
| 758 | 3300025904 | Ga0207647_10046642 | Ga0207647_100466424 | 218 |
| 759 | 3300025906 | Ga0207699_10021053 | Ga0207699_100210536 | 218 |
| 760 | 3300025907 | Ga0207645_10053681 | Ga0207645_100536811 | 218 |
| 761 | 3300025907 | Ga0207645_10521149 | Ga0207645_105211491 | 218 |
| 762 | 3300025909 | Ga0207705_10367437 | Ga0207705_103674372 | 218 |
| 763 | 3300025911 | Ga0207654_10108977 | Ga0207654_101089771 | 218 |
| 764 | 3300025911 | Ga0207654_10119307 | Ga0207654_101193072 | 218 |
| 765 | 3300025911 | Ga0207654_10424303 | Ga0207654_104243031 | 218 |
| 766 | 3300025911 | Ga0207654_10732839 | Ga0207654_107328391 | 218 |
| 767 | 3300025912 | Ga0207707_10146318 | Ga0207707_101463184 | 218 |
| 768 | 3300025912 | Ga0207707_10413505 | Ga0207707_104135051 | 218 |
| 769 | 3300025913 | Ga0207695_10000342 | Ga0207695_1000034247 | 218 |
| 770 | 3300025914 | Ga0207671_10018432 | Ga0207671_100184325 | 218 |
| 771 | 3300025914 | Ga0207671_10055842 | Ga0207671_100558424 | 218 |
| 772 | 3300025914 | Ga0207671_10659809 | Ga0207671_106598091 | 218 |
| 773 | 3300025915 | Ga0207693_10012619 | Ga0207693_100126192 | 218 |
| 774 | 3300025915 | Ga0207693_10053523 | Ga0207693_100535231 | 218 |
| 775 | 3300025916 | Ga0207663_10294821 | Ga0207663_102948212 | 218 |
| 776 | 3300025919 | Ga0207657_10518817 | Ga0207657_105188172 | 218 |
| 777 | 3300025921 | Ga0207652_10021542 | Ga0207652_100215423 | 218 |
| 778 | 3300025921 | Ga0207652_10602962 | Ga0207652_106029621 | 218 |
| 779 | 3300025924 | Ga0207694_10050067 | Ga0207694_100500673 | 218 |
| 780 | 3300025924 | Ga0207694_10058879 | Ga0207694_100588792 | 218 |
| 781 | 3300025925 | Ga0207650_10506633 | Ga0207650_105066331 | 218 |
| 782 | 3300025925 | Ga0207650_10649668 | Ga0207650_106496682 | 218 |
| 783 | 3300025927 | Ga0207687_10007169 | Ga0207687_100071694 | 218 |
| 784 | 3300025927 | Ga0207687_10113616 | Ga0207687_101136161 | 218 |
| 785 | 3300025928 | Ga0207700_10034864 | Ga0207700_100348645 | 218 |
| 786 | 3300025928 | Ga0207700_10041545 | Ga0207700_100415454 | 218 |
| 787 | 3300025929 | Ga0207664_10423961 | Ga0207664_104239612 | 218 |
| 788 | 3300025931 | Ga0207644_10726381 | Ga0207644_107263811 | 218 |
| 789 | 3300025932 | Ga0207690_10294332 | Ga0207690_102943322 | 218 |
| 790 | 3300025933 | Ga0207706_10077308 | Ga0207706_100773082 | 218 |
| 791 | 3300025933 | Ga0207706_10099415 | Ga0207706_100994152 | 218 |
| 792 | 3300025933 | Ga0207706_10277211 | Ga0207706_102772111 | 218 |
| 793 | 3300025933 | Ga0207706_10364253 | Ga0207706_103642532 | 218 |
| 794 | 3300025933 | Ga0207706_10640314 | Ga0207706_106403141 | 218 |
| 795 | 3300025934 | Ga0207686_10169929 | Ga0207686_101699292 | 218 |
| 796 | 3300025937 | Ga0207669_10230111 | Ga0207669_102301112 | 218 |
| 797 | 3300025938 | Ga0207704_10610100 | Ga0207704_106101001 | 218 |
| 798 | 3300025939 | Ga0207665_10041812 | Ga0207665_100418124 | 218 |
| 799 | 3300025939 | Ga0207665_10101483 | Ga0207665_101014832 | 218 |
| 800 | 3300025940 | Ga0207691_10062798 | Ga0207691_100627984 | 218 |
| 801 | 3300025941 | Ga0207711_10800613 | Ga0207711_108006131 | 218 |
| 802 | 3300025942 | Ga0207689_10329768 | Ga0207689_103297682 | 218 |
| 803 | 3300025945 | Ga0207679_10398804 | Ga0207679_103988042 | 218 |
| 804 | 3300025945 | Ga0207679_10579505 | Ga0207679_105795052 | 218 |
| 805 | 3300025949 | Ga0207667_10087606 | Ga0207667_100876064 | 218 |
| 806 | 3300025949 | Ga0207667_10134941 | Ga0207667_101349412 | 218 |
| 807 | 3300025949 | Ga0207667_10749069 | Ga0207667_107490692 | 218 |
| 808 | 3300025960 | Ga0207651_10096535 | Ga0207651_100965353 | 218 |
| 809 | 3300025961 | Ga0207712_10273374 | Ga0207712_102733742 | 218 |
| 810 | 3300025961 | Ga0207712_10468502 | Ga0207712_104685021 | 218 |
| 811 | 3300025972 | Ga0207668_10050571 | Ga0207668_100505712 | 218 |
| 812 | 3300025972 | Ga0207668_10094403 | Ga0207668_100944033 | 218 |
| 813 | 3300025972 | Ga0207668_10261856 | Ga0207668_102618562 | 218 |
| 814 | 3300025972 | Ga0207668_10302464 | Ga0207668_103024642 | 218 |
| 815 | 3300025981 | Ga0207640_10447573 | Ga0207640_104475732 | 218 |
| 816 | 3300025981 | Ga0207640_10496898 | Ga0207640_104968982 | 218 |
| 817 | 3300025981 | Ga0207640_10538620 | Ga0207640_105386201 | 218 |
| 818 | 3300025986 | Ga0207658_10078350 | Ga0207658_100783502 | 218 |
| 819 | 3300025986 | Ga0207658_10079444 | Ga0207658_100794442 | 218 |
| 820 | 3300025986 | Ga0207658_10156056 | Ga0207658_101560562 | 218 |
| 821 | 3300026023 | Ga0207677_10334582 | Ga0207677_103345821 | 218 |
| 822 | 3300026035 | Ga0207703_10068579 | Ga0207703_100685793 | 218 |
| 823 | 3300026035 | Ga0207703_10108068 | Ga0207703_101080682 | 218 |
| 824 | 3300026035 | Ga0207703_10290027 | Ga0207703_102900271 | 218 |
| 825 | 3300026067 | Ga0207678_10020589 | Ga0207678_100205898 | 218 |
| 826 | 3300026067 | Ga0207678_10064623 | Ga0207678_100646234 | 218 |
| 827 | 3300026067 | Ga0207678_10064668 | Ga0207678_100646681 | 218 |
| 828 | 3300026067 | Ga0207678_10070693 | Ga0207678_100706934 | 218 |
| 829 | 3300026067 | Ga0207678_10267080 | Ga0207678_102670801 | 218 |
| 830 | 3300026075 | Ga0207708_10306518 | Ga0207708_103065181 | 218 |
| 831 | 3300026075 | Ga0207708_10379312 | Ga0207708_103793122 | 218 |
| 832 | 3300026078 | Ga0207702_10410380 | Ga0207702_104103802 | 218 |
| 833 | 3300026088 | Ga0207641_10579918 | Ga0207641_105799181 | 218 |
| 834 | 3300026088 | Ga0207641_10638652 | Ga0207641_106386521 | 218 |
| 835 | 3300026088 | Ga0207641_10877230 | Ga0207641_108772302 | 218 |
| 836 | 3300026089 | Ga0207648_10043577 | Ga0207648_100435774 | 218 |
| 837 | 3300026095 | Ga0207676_10329485 | Ga0207676_103294852 | 218 |
| 838 | 3300026095 | Ga0207676_10479854 | Ga0207676_104798542 | 218 |
| 839 | 3300026095 | Ga0207676_10596069 | Ga0207676_105960692 | 218 |
| 840 | 3300026095 | Ga0207676_10681464 | Ga0207676_106814642 | 218 |
| 841 | 3300026116 | Ga0207674_10045583 | Ga0207674_100455836 | 218 |
| 842 | 3300026116 | Ga0207674_10708110 | Ga0207674_107081102 | 218 |
| 843 | 3300026118 | Ga0207675_100283259 | Ga0207675_1002832591 | 218 |
| 844 | 3300026118 | Ga0207675_100449173 | Ga0207675_1004491731 | 218 |
| 845 | 3300026121 | Ga0207683_10056308 | Ga0207683_100563083 | 218 |
| 846 | 3300026121 | Ga0207683_10269411 | Ga0207683_102694112 | 218 |
| 847 | 3300026121 | Ga0207683_10635355 | Ga0207683_106353551 | 218 |
| 848 | 3300026142 | Ga0207698_10132848 | Ga0207698_101328482 | 218 |
| 849 | 3300026142 | Ga0207698_10531214 | Ga0207698_105312141 | 218 |
| 850 | 3300027296 | Ga0209389_1000092 | Ga0209389_10000925 | 218 |
| 851 | 3300027296 | Ga0209389_1002136 | Ga0209389_100213614 | 218 |
| 852 | 3300027357 | Ga0209589_1000115 | Ga0209589_10001155 | 218 |
| 853 | 3300027361 | Ga0209489_100340 | Ga0209489_1003405 | 218 |
| 854 | 3300027361 | Ga0209489_109127 | Ga0209489_1091272 | 218 |
| 855 | 3300027363 | Ga0209700_100117 | Ga0209700_100117114 | 218 |
| 856 | 3300027866 | Ga0209813_10004007 | Ga0209813_100040074 | 218 |
| 857 | 3300027866 | Ga0209813_10037770 | Ga0209813_100377703 | 218 |
| 858 | 3300028379 | Ga0268266_10002227 | Ga0268266_1000222727 | 218 |
| 859 | 3300028379 | Ga0268266_10034535 | Ga0268266_100345356 | 218 |
| 860 | 3300028379 | Ga0268266_10085947 | Ga0268266_100859471 | 218 |
| 861 | 3300028380 | Ga0268265_10026937 | Ga0268265_100269374 | 218 |
| 862 | 3300028380 | Ga0268265_10107968 | Ga0268265_101079681 | 218 |
| 863 | 3300028380 | Ga0268265_10189532 | Ga0268265_101895322 | 218 |
| 864 | 3300028380 | Ga0268265_10406584 | Ga0268265_104065842 | 218 |
| 865 | 3300028380 | Ga0268265_10605595 | Ga0268265_106055952 | 218 |
| 866 | 3300028381 | Ga0268264_10659322 | Ga0268264_106593221 | 218 |
| 867 | 3300028786 | Ga0307517_10176597 | Ga0307517_101765971 | 218 |
| 868 | 3300028786 | Ga0307517_10231704 | Ga0307517_102317041 | 218 |
| 869 | 3300030521 | Ga0307511_10052383 | Ga0307511_100523831 | 218 |
| 870 | 3300031249 | Ga0265339_10011623 | Ga0265339_100116236 | 218 |
| 871 | 3300031507 | Ga0307509_10101865 | Ga0307509_101018653 | 218 |
| 872 | 3300031507 | Ga0307509_10134654 | Ga0307509_101346541 | 218 |
| 873 | 3300031507 | Ga0307509_10629332 | Ga0307509_106293321 | 218 |
| 874 | 3300031548 | Ga0307408_100549942 | Ga0307408_1005499421 | 218 |
| 875 | 3300031616 | Ga0307508_10420005 | Ga0307508_104200052 | 218 |
| 876 | 3300031730 | Ga0307516_10104028 | Ga0307516_101040282 | 218 |
| 877 | 3300031730 | Ga0307516_10166562 | Ga0307516_101665623 | 218 |
| 878 | 3300031731 | Ga0307405_10172869 | Ga0307405_101728692 | 218 |
| 879 | 3300031824 | Ga0307413_10135965 | Ga0307413_101359651 | 218 |
| 880 | 3300031824 | Ga0307413_10319439 | Ga0307413_103194391 | 218 |
| 881 | 3300031903 | Ga0307407_10040269 | Ga0307407_100402691 | 218 |
| 882 | 3300031903 | Ga0307407_10293913 | Ga0307407_102939131 | 218 |
| 883 | 3300031911 | Ga0307412_10298454 | Ga0307412_102984541 | 218 |
| 884 | 3300031995 | Ga0307409_100030635 | Ga0307409_1000306353 | 218 |
| 885 | 3300031995 | Ga0307409_100653531 | Ga0307409_1006535312 | 218 |
| 886 | 3300032005 | Ga0307411_10018506 | Ga0307411_100185065 | 218 |
| 887 | 3300032005 | Ga0307411_10356091 | Ga0307411_103560911 | 218 |
| 888 | 3300032126 | Ga0307415_100164140 | Ga0307415_1001641402 | 218 |
| 889 | 3300032126 | Ga0307415_100212714 | Ga0307415_1002127142 | 218 |
| 890 | 3300033179 | Ga0307507_10045182 | Ga0307507_100451825 | 218 |
| 891 | 3300033180 | Ga0307510_10006740 | Ga0307510_100067405 | 218 |
| 892 | 3300033180 | Ga0307510_10030910 | Ga0307510_100309102 | 218 |
| 893 | 3300033180 | Ga0307510_10154786 | Ga0307510_101547861 | 218 |
| 894 | 3300033180 | Ga0307510_10367787 | Ga0307510_103677871 | 218 |
| 895 | 3300035116 | Ga0373945_0216318 | Ga0373945_0216318_67_726 | 218 |
| 896 | 3300035118 | Ga0373954_0247191 | Ga0373954_0247191_52_714 | 218 |
| 897 | 3300035692 | Ga0373935_0032588 | Ga0373935_0032588_1513_2172 | 218 |
| 898 | 3300035695 | Ga0373927_0002098 | Ga0373927_0002098_12024_12683 | 218 |
| 899 | 3300035695 | Ga0373927_0096108 | Ga0373927_0096108_732_1388 | 218 |
| 900 | 3300035725 | Ga0373947_0203298 | Ga0373947_0203298_608_1264 | 218 |
| 901 | 3300037068 | Ga0373925_0384840 | Ga0373925_0384840_163_819 | 218 |
| 902 | 3300037418 | Ga0395900_0000601 | Ga0395900_0000601_26521_27183 | 218 |
| 903 | 3300037418 | Ga0395900_0663087 | Ga0395900_0663087_86_748 | 218 |
| 904 | 3300037466 | Ga0395898_0950447 | Ga0395898_0950447_104_766 | 218 |
| 905 | 3300037471 | Ga0395905_0042342 | Ga0395905_0042342_1018_1728 | 218 |
| 906 | 3300037471 | Ga0395905_0047738 | Ga0395905_0047738_742_1404 | 218 |
| 907 | 3300037471 | Ga0395905_0523900 | Ga0395905_0523900_31_687 | 218 |
| 908 | 3300038443 | Ga0395901_0174292 | Ga0395901_0174292_801_1511 | 218 |
| 909 | 3300038443 | Ga0395901_0402113 | Ga0395901_0402113_672_1334 | 218 |
| 910 | 3300038443 | Ga0395901_0612358 | Ga0395901_0612358_277_939 | 218 |
| 911 | 3300038443 | Ga0395901_0763651 | Ga0395901_0763651_287_943 | 218 |
| 912 | 3300039437 | Ga0436365_0491407 | Ga0436365_0491407_223_885 | 218 |
| 913 | 3300039437 | Ga0436365_0604857 | Ga0436365_0604857_1578_2237 | 218 |
| 914 | 3300039437 | Ga0436365_1832438 | Ga0436365_1832438_2434_3093 | 218 |
| 915 | 3300039438 | Ga0436360_0800369 | Ga0436360_0800369_152_811 | 218 |
| 916 | 3300039450 | Ga0436363_0702677 | Ga0436363_0702677_15_674 | 218 |
| 917 | 3300041441 | Ga0451787_680561 | Ga0451787_680561_106_762 | 218 |
| 918 | 3300041451 | Ga0451791_1330780 | Ga0451791_1330780_163_903 | 218 |
| 919 | 3300041492 | Ga0451835_0281011 | Ga0451835_0281011_184_846 | 218 |
| 920 | 3300041494 | Ga0451837_0572566 | Ga0451837_0572566_339_1001 | 218 |
| 921 | 3300041494 | Ga0451837_1293921 | Ga0451837_1293921_490_1146 | 218 |
| 922 | 3300041512 | Ga0451853_0256934 | Ga0451853_0256934_531_1187 | 218 |
| 923 | 3300041512 | Ga0451853_3570517 | Ga0451853_3570517_354_1016 | 218 |
| 924 | 3300044656 | Ga0466969_0017894 | Ga0466969_0017894_726_1388 | 218 |
| 925 | 3300044658 | Ga0466972_0000206 | Ga0466972_0000206_27439_28101 | 218 |
| 926 | 3300044683 | Ga0466965_0028858 | Ga0466965_0028858_1121_1783 | 218 |
| 927 | 3300044684 | Ga0466966_0000872 | Ga0466966_0000872_4465_5127 | 218 |
| 928 | 3300044693 | Ga0466961_0000082 | Ga0466961_0000082_5330_5992 | 218 |
| 929 | 3300044694 | Ga0466963_0156208 | Ga0466963_0156208_481_1143 | 218 |
| 930 | 3300044712 | Ga0453684_0095053 | Ga0453684_0095053_741_1415 | 218 |
| 931 | 3300044842 | Ga0466957_0045023 | Ga0466957_0045023_1486_2145 | 218 |
| 932 | 3300044842 | Ga0466957_0073127 | Ga0466957_0073127_527_1189 | 218 |
| 933 | 3300044842 | Ga0466957_0145247 | Ga0466957_0145247_727_1386 | 218 |
| 934 | 3300044842 | Ga0466957_0263932 | Ga0466957_0263932_195_854 | 218 |
| 935 | 3300044901 | Ga0466960_0231571 | Ga0466960_0231571_132_794 | 218 |
| 936 | 3300045049 | Ga0466959_0007074 | Ga0466959_0007074_6663_7322 | 218 |
| 937 | 3300045049 | Ga0466959_0021459 | Ga0466959_0021459_2347_3009 | 218 |
| 938 | 3300045976 | Ga0466967_0244666 | Ga0466967_0244666_245_904 | 218 |
| 939 | 3300046452 | Ga0495617_039527 | Ga0495617_039527_275_931 | 218 |
| 940 | 3300046454 | Ga0495592_0176376 | Ga0495592_0176376_758_1420 | 218 |
| 941 | 3300046455 | Ga0495603_0014808 | Ga0495603_0014808_334_990 | 218 |
| 942 | 3300046455 | Ga0495603_0015277 | Ga0495603_0015277_3959_4615 | 218 |
| 943 | 3300046455 | Ga0495603_0028524 | Ga0495603_0028524_342_998 | 218 |
| 944 | 3300046457 | Ga0495590_0046719 | Ga0495590_0046719_316_972 | 218 |
| 945 | 3300046459 | Ga0495629_0002653 | Ga0495629_0002653_2050_2712 | 218 |
| 946 | 3300046459 | Ga0495629_0126465 | Ga0495629_0126465_350_1012 | 218 |
| 947 | 3300046459 | Ga0495629_0153510 | Ga0495629_0153510_328_984 | 218 |
| 948 | 3300046460 | Ga0495638_0135790 | Ga0495638_0135790_518_1174 | 218 |
| 949 | 3300046460 | Ga0495638_0203855 | Ga0495638_0203855_133_789 | 218 |
| 950 | 3300046461 | Ga0495641_0078631 | Ga0495641_0078631_802_1458 | 218 |
| 951 | 3300046461 | Ga0495641_0144547 | Ga0495641_0144547_75_737 | 218 |
| 952 | 3300046461 | Ga0495641_0206240 | Ga0495641_0206240_121_777 | 218 |
| 953 | 3300046462 | Ga0495651_0099543 | Ga0495651_0099543_721_1377 | 218 |
| 954 | 3300046462 | Ga0495651_0235834 | Ga0495651_0235834_69_731 | 218 |
| 955 | 3300046462 | Ga0495651_0388564 | Ga0495651_0388564_97_759 | 218 |
| 956 | 3300046463 | Ga0495653_0270486 | Ga0495653_0270486_195_857 | 218 |
| 957 | 3300046471 | Ga0495650_0148975 | Ga0495650_0148975_54_710 | 218 |
| 958 | 3300046474 | Ga0495605_0031470 | Ga0495605_0031470_268_924 | 218 |
| 959 | 3300046475 | Ga0495639_0355492 | Ga0495639_0355492_14_676 | 218 |
| 960 | 3300046477 | Ga0495664_0021339 | Ga0495664_0021339_1110_1772 | 218 |
| 961 | 3300046491 | Ga0495584_0068683 | Ga0495584_0068683_83_739 | 218 |
| 962 | 3300046492 | Ga0495585_0155823 | Ga0495585_0155823_165_821 | 218 |
| 963 | 3300046492 | Ga0495585_0290776 | Ga0495585_0290776_32_688 | 218 |
| 964 | 3300046499 | Ga0495594_0055814 | Ga0495594_0055814_169_825 | 218 |
| 965 | 3300046499 | Ga0495594_0079549 | Ga0495594_0079549_306_962 | 218 |
| 966 | 3300046507 | Ga0495606_0029541 | Ga0495606_0029541_739_1404 | 218 |
| 967 | 3300046507 | Ga0495606_0169363 | Ga0495606_0169363_249_905 | 218 |
| 968 | 3300046511 | Ga0495608_0148802 | Ga0495608_0148802_19_681 | 218 |
| 969 | 3300046512 | Ga0495610_0017594 | Ga0495610_0017594_674_1336 | 218 |
| 970 | 3300046512 | Ga0495610_0029933 | Ga0495610_0029933_396_1058 | 218 |
| 971 | 3300046514 | Ga0495618_0160778 | Ga0495618_0160778_478_1140 | 218 |
| 972 | 3300046516 | Ga0495628_0394550 | Ga0495628_0394550_196_852 | 218 |
| 973 | 3300046518 | Ga0495631_0052606 | Ga0495631_0052606_694_1350 | 218 |
| 974 | 3300046518 | Ga0495631_0092298 | Ga0495631_0092298_448_1104 | 218 |
| 975 | 3300046518 | Ga0495631_0204183 | Ga0495631_0204183_73_735 | 218 |
| 976 | 3300046519 | Ga0495632_0171491 | Ga0495632_0171491_39_695 | 218 |
| 977 | 3300046520 | Ga0495637_0083951 | Ga0495637_0083951_480_1136 | 218 |
| 978 | 3300046522 | Ga0495643_0010420 | Ga0495643_0010420_924_1586 | 218 |
| 979 | 3300046522 | Ga0495643_0206504 | Ga0495643_0206504_211_873 | 218 |
| 980 | 3300046524 | Ga0495648_0140085 | Ga0495648_0140085_442_1104 | 218 |
| 981 | 3300046524 | Ga0495648_0197564 | Ga0495648_0197564_12_674 | 218 |
| 982 | 3300046525 | Ga0495663_0086352 | Ga0495663_0086352_30_686 | 218 |
| 983 | 3300046526 | Ga0495666_0057087 | Ga0495666_0057087_313_969 | 218 |
| 984 | 3300046529 | Ga0495652_0009665 | Ga0495652_0009665_501_1163 | 218 |
| 985 | 3300046529 | Ga0495652_0099942 | Ga0495652_0099942_1328_1990 | 218 |
| 986 | 3300046533 | Ga0495640_0067035 | Ga0495640_0067035_1195_1857 | 218 |
| 987 | 3300046536 | Ga0495587_0054380 | Ga0495587_0054380_616_1278 | 218 |
| 988 | 3300046537 | Ga0495598_0011296 | Ga0495598_0011296_57_713 | 218 |
| 989 | 3300046538 | Ga0495609_0161423 | Ga0495609_0161423_156_818 | 218 |
| 990 | 3300046542 | Ga0495597_0069708 | Ga0495597_0069708_524_1180 | 218 |
| 991 | 3300046543 | Ga0495645_0017952 | Ga0495645_0017952_1031_1693 | 218 |
| 992 | 3300046557 | Ga0495622_0009657 | Ga0495622_0009657_3101_3760 | 218 |
| 993 | 3300046557 | Ga0495622_0026851 | Ga0495622_0026851_351_1007 | 218 |
| 994 | 3300046558 | Ga0495633_0203505 | Ga0495633_0203505_58_714 | 218 |
| 995 | 3300046558 | Ga0495633_0265777 | Ga0495633_0265777_40_696 | 218 |
| 996 | 3300046559 | Ga0495667_0104195 | Ga0495667_0104195_590_1252 | 218 |
| 997 | 3300046615 | Ga0495656_0113224 | Ga0495656_0113224_420_1076 | 218 |
| 998 | 3300046616 | Ga0495668_0075590 | Ga0495668_0075590_472_1134 | 218 |
| 999 | 3300046616 | Ga0495668_0378673 | Ga0495668_0378673_60_722 | 218 |
| 1000 | 3300046642 | Ga0495634_0133738 | Ga0495634_0133738_407_1069 | 218 |
| 1001 | 3300046642 | Ga0495634_0203128 | Ga0495634_0203128_100_762 | 218 |
| 1002 | 3300046648 | Ga0495611_0061325 | Ga0495611_0061325_707_1363 | 218 |
| 1003 | 3300046648 | Ga0495611_0158424 | Ga0495611_0158424_181_837 | 218 |
| 1004 | 3300046660 | Ga0495625_0137529 | Ga0495625_0137529_382_1047 | 218 |
| 1005 | 3300046660 | Ga0495625_0234816 | Ga0495625_0234816_211_867 | 218 |
| 1006 | 3300046663 | Ga0495635_0025751 | Ga0495635_0025751_2170_2832 | 218 |
| 1007 | 3300046663 | Ga0495635_0053641 | Ga0495635_0053641_242_898 | 218 |
| 1008 | 3300046663 | Ga0495635_0231441 | Ga0495635_0231441_568_1230 | 218 |
| 1009 | 3300046665 | Ga0495661_0199581 | Ga0495661_0199581_293_949 | 218 |
| 1010 | 3300046675 | Ga0495657_0020674 | Ga0495657_0020674_3415_4077 | 218 |
| 1011 | 3300046675 | Ga0495657_0144563 | Ga0495657_0144563_312_974 | 218 |
| 1012 | 3300046678 | Ga0495599_0052690 | Ga0495599_0052690_653_1315 | 218 |
| 1013 | 3300046679 | Ga0495623_0179442 | Ga0495623_0179442_415_1077 | 218 |
| 1014 | 3300046680 | Ga0495646_0061759 | Ga0495646_0061759_391_1053 | 218 |
| 1015 | 3300046684 | Ga0495669_0030370 | Ga0495669_0030370_715_1371 | 218 |
| 1016 | 3300046684 | Ga0495669_0030629 | Ga0495669_0030629_1307_1972 | 218 |
| 1017 | 3300046684 | Ga0495669_0084520 | Ga0495669_0084520_491_1147 | 218 |
| 1018 | 3300046689 | Ga0495613_0100144 | Ga0495613_0100144_1357_2019 | 218 |
| 1019 | 3300046690 | Ga0495624_0027748 | Ga0495624_0027748_1383_2045 | 218 |
| 1020 | 3300046691 | Ga0495670_0098099 | Ga0495670_0098099_229_885 | 218 |
| 1021 | 3300046694 | Ga0495649_0008929 | Ga0495649_0008929_4135_4797 | 218 |
| 1022 | 3300046694 | Ga0495649_0052228 | Ga0495649_0052228_785_1447 | 218 |
| 1023 | 3300046794 | Ga0495589_0149827 | Ga0495589_0149827_12_668 | 218 |
| 1024 | 3300046809 | Ga0495600_0106542 | Ga0495600_0106542_816_1478 | 218 |
| 1025 | 3300046809 | Ga0495600_0141242 | Ga0495600_0141242_273_935 | 218 |
| 1026 | 3300047315 | Ga0495581_0383317 | Ga0495581_0383317_42_698 | 218 |
| 1027 | 3300047317 | Ga0495604_0130086 | Ga0495604_0130086_658_1320 | 218 |
| 1028 | 3300047318 | Ga0495636_0128587 | Ga0495636_0128587_307_963 | 218 |
| 1029 | 3300047319 | Ga0495674_0613683 | Ga0495674_0613683_169_828 | 218 |
| 1030 | 3300047321 | Ga0495676_0019047 | Ga0495676_0019047_304_960 | 218 |
| 1031 | 3300047321 | Ga0495676_0112128 | Ga0495676_0112128_395_1057 | 218 |
| 1032 | 3300047322 | Ga0495680_0022651 | Ga0495680_0022651_391_1053 | 218 |
| 1033 | 3300047322 | Ga0495680_0298674 | Ga0495680_0298674_104_760 | 218 |
| 1034 | 3300047323 | Ga0495683_0054061 | Ga0495683_0054061_1222_1884 | 218 |
| 1035 | 3300047323 | Ga0495683_0197169 | Ga0495683_0197169_119_775 | 218 |
| 1036 | 3300047443 | Ga0495687_099628 | Ga0495687_099628_332_994 | 218 |
| 1037 | 3300047444 | Ga0495675_0047405 | Ga0495675_0047405_1537_2199 | 218 |
| 1038 | 3300047445 | Ga0495677_0092107 | Ga0495677_0092107_118_783 | 218 |
| 1039 | 3300047447 | Ga0495685_117094 | Ga0495685_117094_161_817 | 218 |
| 1040 | 3300047469 | Ga0495673_0081202 | Ga0495673_0081202_53_715 | 218 |
| 1041 | 3300047469 | Ga0495673_0119301 | Ga0495673_0119301_326_988 | 218 |
| 1042 | 3300047471 | Ga0495684_0085268 | Ga0495684_0085268_1531_2193 | 218 |
| 1043 | 3300047472 | Ga0495686_0120872 | Ga0495686_0120872_517_1179 | 218 |
| 1044 | 3300047472 | Ga0495686_0191603 | Ga0495686_0191603_96_752 | 218 |
| 1045 | 3300047472 | Ga0495686_0218363 | Ga0495686_0218363_279_941 | 218 |
| 1046 | 3300047673 | Ga0495593_0333521 | Ga0495593_0333521_16_675 | 218 |
| 1047 | 3300048088 | Ga0495602_0032241 | Ga0495602_0032241_3166_3828 | 218 |
| 1048 | 3300048088 | Ga0495602_0064976 | Ga0495602_0064976_1588_2250 | 218 |
| 1049 | 3300048088 | Ga0495602_0445247 | Ga0495602_0445247_53_709 | 218 |
| 1050 | 3300048091 | Ga0495626_0177712 | Ga0495626_0177712_103_759 | 218 |
| 1051 | 3300048903 | Ga0496100_0200841 | Ga0496100_0200841_318_980 | 218 |
| 1052 | 3300048903 | Ga0496100_0623037 | Ga0496100_0623037_151_807 | 218 |
| 1053 | 3300048904 | Ga0496101_0218071 | Ga0496101_0218071_671_1333 | 218 |
| 1054 | 3300048904 | Ga0496101_0233495 | Ga0496101_0233495_496_1152 | 218 |
| 1055 | 3300048904 | Ga0496101_0361738 | Ga0496101_0361738_22_678 | 218 |
| 1056 | 3300048905 | Ga0496102_0055829 | Ga0496102_0055829_1682_2344 | 218 |
| 1057 | 3300048905 | Ga0496102_0163510 | Ga0496102_0163510_1323_1985 | 218 |
| 1058 | 3300048905 | Ga0496102_0247053 | Ga0496102_0247053_444_1100 | 218 |
| 1059 | 3300048905 | Ga0496102_0805369 | Ga0496102_0805369_157_819 | 218 |
| 1060 | 3300048905 | Ga0496102_1167607 | Ga0496102_1167607_16_672 | 218 |
| 1061 | 3300048906 | Ga0496103_0028309 | Ga0496103_0028309_1072_1734 | 218 |
| 1062 | 3300048906 | Ga0496103_0157565 | Ga0496103_0157565_158_820 | 218 |
| 1063 | 3300048906 | Ga0496103_0204195 | Ga0496103_0204195_266_922 | 218 |
| 1064 | 3300048906 | Ga0496103_0211040 | Ga0496103_0211040_183_845 | 218 |
| 1065 | 3300048907 | Ga0496104_0000871 | Ga0496104_0000871_14499_15161 | 218 |
| 1066 | 3300048907 | Ga0496104_0194151 | Ga0496104_0194151_492_1154 | 218 |
| 1067 | 3300048907 | Ga0496104_0330228 | Ga0496104_0330228_467_1123 | 218 |
| 1068 | 3300048907 | Ga0496104_0645881 | Ga0496104_0645881_257_919 | 218 |
| 1069 | 3300048908 | Ga0496105_0000692 | Ga0496105_0000692_9319_9981 | 218 |
| 1070 | 3300048908 | Ga0496105_0230470 | Ga0496105_0230470_697_1359 | 218 |
| 1071 | 3300048909 | Ga0496106_0000664 | Ga0496106_0000664_15609_16268 | 218 |
| 1072 | 3300048909 | Ga0496106_0587978 | Ga0496106_0587978_214_870 | 218 |
| 1073 | 3300048909 | Ga0496106_0696044 | Ga0496106_0696044_82_738 | 218 |
| 1074 | 3300048909 | Ga0496106_0892161 | Ga0496106_0892161_14_676 | 218 |
| 1075 | 3300048910 | Ga0496107_0146548 | Ga0496107_0146548_944_1600 | 218 |
| 1076 | 3300048911 | Ga0496108_0070787 | Ga0496108_0070787_1222_1884 | 218 |
| 1077 | 3300048912 | Ga0496109_0034450 | Ga0496109_0034450_1326_1988 | 218 |
| 1078 | 3300048912 | Ga0496109_0135370 | Ga0496109_0135370_1559_2221 | 218 |
| 1079 | 3300048912 | Ga0496109_0194775 | Ga0496109_0194775_1186_1848 | 218 |
| 1080 | 3300048912 | Ga0496109_0314130 | Ga0496109_0314130_790_1446 | 218 |
| 1081 | 3300048912 | Ga0496109_0454049 | Ga0496109_0454049_214_870 | 218 |
| 1082 | 3300048913 | Ga0496110_0127948 | Ga0496110_0127948_136_798 | 218 |
| 1083 | 3300048914 | Ga0496111_0125268 | Ga0496111_0125268_711_1373 | 218 |
| 1084 | 3300048914 | Ga0496111_0196659 | Ga0496111_0196659_704_1360 | 218 |
| 1085 | 3300048915 | Ga0496112_0118517 | Ga0496112_0118517_1570_2226 | 218 |
| 1086 | 3300048915 | Ga0496112_0189733 | Ga0496112_0189733_981_1643 | 218 |
| 1087 | 3300048915 | Ga0496112_0655315 | Ga0496112_0655315_156_818 | 218 |
| 1088 | 3300048916 | Ga0496113_0047634 | Ga0496113_0047634_2096_2758 | 218 |
| 1089 | 3300048916 | Ga0496113_0108554 | Ga0496113_0108554_1431_2093 | 218 |
| 1090 | 3300048916 | Ga0496113_0457124 | Ga0496113_0457124_77_733 | 218 |
| 1091 | 3300048916 | Ga0496113_0467667 | Ga0496113_0467667_333_995 | 218 |
| 1092 | 3300048917 | Ga0496114_0029973 | Ga0496114_0029973_3431_4087 | 218 |
| 1093 | 3300048917 | Ga0496114_0086355 | Ga0496114_0086355_581_1243 | 218 |
| 1094 | 3300048917 | Ga0496114_0780164 | Ga0496114_0780164_130_786 | 218 |
| 1095 | 3300048918 | Ga0496115_0030017 | Ga0496115_0030017_2792_3448 | 218 |
| 1096 | 3300048918 | Ga0496115_0295273 | Ga0496115_0295273_90_752 | 218 |
| 1097 | 3300048919 | Ga0496116_0087144 | Ga0496116_0087144_365_1027 | 218 |
| 1098 | 3300048919 | Ga0496116_0287207 | Ga0496116_0287207_73_735 | 218 |
| 1099 | 3300048920 | Ga0496117_0019802 | Ga0496117_0019802_3680_4339 | 218 |
| 1100 | 3300048920 | Ga0496117_0050066 | Ga0496117_0050066_1449_2111 | 218 |
| 1101 | 3300048920 | Ga0496117_0105509 | Ga0496117_0105509_399_1058 | 218 |
| 1102 | 3300048920 | Ga0496117_0234664 | Ga0496117_0234664_311_973 | 218 |
| 1103 | 3300048920 | Ga0496117_0266350 | Ga0496117_0266350_109_771 | 218 |
| 1104 | 3300048920 | Ga0496117_0306254 | Ga0496117_0306254_165_821 | 218 |
| 1105 | 3300048922 | Ga0496119_0011575 | Ga0496119_0011575_3063_3725 | 218 |
| 1106 | 3300048922 | Ga0496119_0068346 | Ga0496119_0068346_744_1406 | 218 |
| 1107 | 3300048922 | Ga0496119_0080029 | Ga0496119_0080029_1018_1680 | 218 |
| 1108 | 3300048923 | Ga0496120_0011179 | Ga0496120_0011179_4821_5483 | 218 |
| 1109 | 3300048923 | Ga0496120_0036361 | Ga0496120_0036361_866_1528 | 218 |
| 1110 | 3300048924 | Ga0496121_0000077 | Ga0496121_0000077_185852_186511 | 218 |
| 1111 | 3300048924 | Ga0496121_0035309 | Ga0496121_0035309_1317_1979 | 218 |
| 1112 | 3300048924 | Ga0496121_0057403 | Ga0496121_0057403_286_942 | 218 |
| 1113 | 3300048924 | Ga0496121_0097925 | Ga0496121_0097925_998_1660 | 218 |
| 1114 | 3300048924 | Ga0496121_0191974 | Ga0496121_0191974_249_905 | 218 |
| 1115 | 3300048925 | Ga0496122_0261989 | Ga0496122_0261989_65_727 | 218 |
| 1116 | 3300048927 | Ga0496124_0006148 | Ga0496124_0006148_1098_1757 | 218 |
| 1117 | 3300048927 | Ga0496124_0061614 | Ga0496124_0061614_632_1294 | 218 |
| 1118 | 3300048927 | Ga0496124_0123553 | Ga0496124_0123553_1270_1926 | 218 |
| 1119 | 3300048927 | Ga0496124_0197513 | Ga0496124_0197513_13_675 | 218 |
| 1120 | 3300048927 | Ga0496124_0298006 | Ga0496124_0298006_392_1048 | 218 |
| 1121 | 3300048928 | Ga0496125_0036626 | Ga0496125_0036626_3169_3831 | 218 |
| 1122 | 3300048928 | Ga0496125_0054822 | Ga0496125_0054822_384_1043 | 218 |
| 1123 | 3300048928 | Ga0496125_0123585 | Ga0496125_0123585_1132_1791 | 218 |
| 1124 | 3300048928 | Ga0496125_0151714 | Ga0496125_0151714_22_678 | 218 |
| 1125 | 3300048929 | Ga0496126_0030696 | Ga0496126_0030696_608_1270 | 218 |
| 1126 | 3300048929 | Ga0496126_0050756 | Ga0496126_0050756_314_970 | 218 |
| 1127 | 3300048929 | Ga0496126_0051484 | Ga0496126_0051484_1502_2161 | 218 |
| 1128 | 3300048929 | Ga0496126_0117956 | Ga0496126_0117956_1252_1908 | 218 |
| 1129 | 3300048929 | Ga0496126_0291410 | Ga0496126_0291410_146_802 | 218 |
| 1130 | 3300049583 | Ga0501067_0028816 | Ga0501067_0028816_1476_2132 | 218 |
| 1131 | 3300049585 | Ga0501069_0074327 | Ga0501069_0074327_456_1112 | 218 |
| 1132 | 3300050489 | nmdc:mga03683_147630_c1 | nmdc:mga03683_147630_c1_336_992 | 218 |
| 1133 | 3300050489 | nmdc:mga03683_24601_c1 | nmdc:mga03683_24601_c1_782_1438 | 218 |
| 1134 | 3300050489 | nmdc:mga03683_55649_c1 | nmdc:mga03683_55649_c1_309_971 | 218 |
| 1135 | 3300050489 | nmdc:mga03683_76077_c1 | nmdc:mga03683_76077_c1_388_1116 | 218 |
| 1136 | 3300050491 | nmdc:mga00v17_147044_c1 | nmdc:mga00v17_147044_c1_649_1311 | 218 |
| 1137 | 3300050491 | nmdc:mga00v17_165496_c1 | nmdc:mga00v17_165496_c1_293_955 | 218 |
| 1138 | 3300050491 | nmdc:mga00v17_171065_c1 | nmdc:mga00v17_171065_c1_671_1327 | 218 |
| 1139 | 3300050491 | nmdc:mga00v17_289368_c1 | nmdc:mga00v17_289368_c1_206_862 | 218 |
| 1140 | 3300050492 | nmdc:mga0yw44_107801_c1 | nmdc:mga0yw44_107801_c1_502_1164 | 218 |
| 1141 | 3300050492 | nmdc:mga0yw44_13081_c1 | nmdc:mga0yw44_13081_c1_3239_3901 | 218 |
| 1142 | 3300050492 | nmdc:mga0yw44_133499_c1 | nmdc:mga0yw44_133499_c1_330_992 | 218 |
| 1143 | 3300050492 | nmdc:mga0yw44_156254_c1 | nmdc:mga0yw44_156254_c1_402_1064 | 218 |
| 1144 | 3300050492 | nmdc:mga0yw44_201211_c1 | nmdc:mga0yw44_201211_c1_590_1246 | 218 |
| 1145 | 3300050492 | nmdc:mga0yw44_455425_c1 | nmdc:mga0yw44_455425_c1_41_697 | 218 |
| 1146 | 3300050492 | nmdc:mga0yw44_631947_c1 | nmdc:mga0yw44_631947_c1_44_700 | 218 |
| 1147 | 3300050492 | nmdc:mga0yw44_75748_c1 | nmdc:mga0yw44_75748_c1_1129_1791 | 218 |
| 1148 | 3300050492 | nmdc:mga0yw44_85138_c1 | nmdc:mga0yw44_85138_c1_330_986 | 218 |
| 1149 | 3300050493 | nmdc:mga0k408_106791_c1 | nmdc:mga0k408_106791_c1_686_1342 | 218 |
| 1150 | 3300050493 | nmdc:mga0k408_148275_c1 | nmdc:mga0k408_148275_c1_251_907 | 218 |
| 1151 | 3300050493 | nmdc:mga0k408_194317_c1 | nmdc:mga0k408_194317_c1_159_821 | 218 |
| 1152 | 3300050493 | nmdc:mga0k408_252961_c1 | nmdc:mga0k408_252961_c1_120_776 | 218 |
| 1153 | 3300050493 | nmdc:mga0k408_253828_c1 | nmdc:mga0k408_253828_c1_260_916 | 218 |
| 1154 | 3300050493 | nmdc:mga0k408_43563_c1 | nmdc:mga0k408_43563_c1_345_1001 | 218 |
| 1155 | 3300050493 | nmdc:mga0k408_60180_c2 | nmdc:mga0k408_60180_c2_992_1654 | 218 |
| 1156 | 3300050493 | nmdc:mga0k408_92784_c1 | nmdc:mga0k408_92784_c1_108_764 | 218 |
| 1157 | 3300050494 | nmdc:mga06z11_10788_c1 | nmdc:mga06z11_10788_c1_728_1384 | 218 |
| 1158 | 3300050494 | nmdc:mga06z11_197373_c1 | nmdc:mga06z11_197373_c1_302_958 | 218 |
| 1159 | 3300050494 | nmdc:mga06z11_221692_c1 | nmdc:mga06z11_221692_c1_70_726 | 218 |
| 1160 | 3300050494 | nmdc:mga06z11_62309_c1 | nmdc:mga06z11_62309_c1_699_1361 | 218 |
| 1161 | 3300050495 | nmdc:mga04h51_150696_c1 | nmdc:mga04h51_150696_c1_93_755 | 218 |
| 1162 | 3300050495 | nmdc:mga04h51_64585_c1 | nmdc:mga04h51_64585_c1_537_1193 | 218 |
| 1163 | 3300050496 | nmdc:mga07m45_16139_c1 | nmdc:mga07m45_16139_c1_2157_2819 | 218 |
| 1164 | 3300050496 | nmdc:mga07m45_23084_c1 | nmdc:mga07m45_23084_c1_1106_1762 | 218 |
| 1165 | 3300050496 | nmdc:mga07m45_262509_c1 | nmdc:mga07m45_262509_c1_135_791 | 218 |
| 1166 | 3300050507 | nmdc:mga05p37_139821_c1 | nmdc:mga05p37_139821_c1_1587_2243 | 218 |
| 1167 | 3300050510 | nmdc:mga06r32_442075_c1 | nmdc:mga06r32_442075_c1_551_1207 | 218 |
| 1168 | 3300050511 | nmdc:mga08y16_508048_c1 | nmdc:mga08y16_508048_c1_37_765 | 218 |
| 1169 | 3300050513 | nmdc:mga0rr50_73302_c1 | nmdc:mga0rr50_73302_c1_914_1570 | 218 |
| 1170 | 3300050516 | nmdc:mga0sz30_147496_c1 | nmdc:mga0sz30_147496_c1_29_685 | 218 |
| 1171 | 3300050516 | nmdc:mga0sz30_14861_c1 | nmdc:mga0sz30_14861_c1_1035_1709 | 218 |
| 1172 | 3300050516 | nmdc:mga0sz30_61268_c1 | nmdc:mga0sz30_61268_c1_741_1403 | 218 |
| 1173 | 3300053077 | Ga0495601_0313967 | Ga0495601_0313967_90_752 | 218 |
| 1174 | 3300053083 | Ga0495655_0117937 | Ga0495655_0117937_100_756 | 218 |
| 1175 | 3300053085 | Ga0495619_0078792 | Ga0495619_0078792_997_1659 | 218 |
| 1176 | 3300053086 | Ga0500578_0168757 | Ga0500578_0168757_87_752 | 218 |
| 1177 | 3300053087 | Ga0500643_000025 | Ga0500643_000025_1089_1751 | 218 |
| 1178 | 3300053090 | Ga0500646_0015878 | Ga0500646_0015878_875_1531 | 218 |
| 1179 | 3300053091 | Ga0500647_0016130 | Ga0500647_0016130_2612_3274 | 218 |
| 1180 | 3300053091 | Ga0500647_0067394 | Ga0500647_0067394_1009_1668 | 218 |
| 1181 | 3300053092 | Ga0500583_0023251 | Ga0500583_0023251_1161_1823 | 218 |
| 1182 | 3300053092 | Ga0500583_0202167 | Ga0500583_0202167_217_873 | 218 |
| 1183 | 3300053094 | Ga0500566_0002901 | Ga0500566_0002901_5360_6022 | 218 |
| 1184 | 3300053094 | Ga0500566_0029361 | Ga0500566_0029361_576_1235 | 218 |
| 1185 | 3300053094 | Ga0500566_0035605 | Ga0500566_0035605_393_1055 | 218 |
| 1186 | 3300053094 | Ga0500566_0040394 | Ga0500566_0040394_124_780 | 218 |
| 1187 | 3300053096 | Ga0500641_0017948 | Ga0500641_0017948_579_1235 | 218 |
| 1188 | 3300053096 | Ga0500641_0019320 | Ga0500641_0019320_428_1084 | 218 |
| 1189 | 3300053098 | Ga0500650_0030877 | Ga0500650_0030877_1012_1668 | 218 |
| 1190 | 3300053103 | Ga0500555_004130 | Ga0500555_004130_564_1226 | 218 |
| 1191 | 3300053104 | Ga0500556_0007468 | Ga0500556_0007468_1357_2019 | 218 |
| 1192 | 3300053105 | Ga0500557_000001 | Ga0500557_000001_182660_183322 | 218 |
| 1193 | 3300053108 | Ga0500562_007409 | Ga0500562_007409_364_1026 | 218 |
| 1194 | 3300053109 | Ga0500569_003720 | Ga0500569_003720_1198_1860 | 218 |
| 1195 | 3300053109 | Ga0500569_011892 | Ga0500569_011892_693_1355 | 218 |
| 1196 | 3300053114 | Ga0500582_029976 | Ga0500582_029976_804_1460 | 218 |
| 1197 | 3300053116 | Ga0500592_014648 | Ga0500592_014648_340_1002 | 218 |
| 1198 | 3300053119 | Ga0500595_005116 | Ga0500595_005116_2657_3313 | 218 |
| 1199 | 3300053119 | Ga0500595_013076 | Ga0500595_013076_1009_1665 | 218 |
| 1200 | 3300053121 | Ga0500607_021112 | Ga0500607_021112_1749_2411 | 218 |
| 1201 | 3300053130 | Ga0500642_0000077 | Ga0500642_0000077_37777_38439 | 218 |
| 1202 | 3300053130 | Ga0500642_0012050 | Ga0500642_0012050_331_993 | 218 |
| 1203 | 3300053130 | Ga0500642_0035098 | Ga0500642_0035098_407_1069 | 218 |
| 1204 | 3300053130 | Ga0500642_0111763 | Ga0500642_0111763_317_973 | 218 |
| 1205 | 3300053133 | Ga0500655_012239 | Ga0500655_012239_86_748 | 218 |
| 1206 | 3300053134 | Ga0500658_0017657 | Ga0500658_0017657_1884_2540 | 218 |
| 1207 | 3300053134 | Ga0500658_0100217 | Ga0500658_0100217_555_1217 | 218 |
| 1208 | 3300053134 | Ga0500658_0164783 | Ga0500658_0164783_321_983 | 218 |
| 1209 | 3300053136 | Ga0500559_0013588 | Ga0500559_0013588_819_1481 | 218 |
| 1210 | 3300053138 | Ga0500564_052566 | Ga0500564_052566_859_1521 | 218 |
| 1211 | 3300053140 | Ga0500573_0086678 | Ga0500573_0086678_737_1396 | 218 |
| 1212 | 3300053147 | Ga0500589_052652 | Ga0500589_052652_1191_1847 | 218 |
| 1213 | 3300053147 | Ga0500589_061089 | Ga0500589_061089_739_1401 | 218 |
| 1214 | 3300053147 | Ga0500589_135538 | Ga0500589_135538_326_982 | 218 |
| 1215 | 3300053148 | Ga0500590_065456 | Ga0500590_065456_869_1531 | 218 |
| 1216 | 3300053148 | Ga0500590_068255 | Ga0500590_068255_610_1266 | 218 |
| 1217 | 3300053150 | Ga0500603_004597 | Ga0500603_004597_44_703 | 218 |
| 1218 | 3300053153 | Ga0500616_0083173 | Ga0500616_0083173_792_1454 | 218 |
| 1219 | 3300053155 | Ga0500620_001768 | Ga0500620_001768_2514_3176 | 218 |
| 1220 | 3300053156 | Ga0500622_0021327 | Ga0500622_0021327_1826_2488 | 218 |
| 1221 | 3300053156 | Ga0500622_0094635 | Ga0500622_0094635_287_949 | 218 |
| 1222 | 3300053156 | Ga0500622_0109746 | Ga0500622_0109746_533_1189 | 218 |
| 1223 | 3300053158 | Ga0500627_0040336 | Ga0500627_0040336_952_1614 | 218 |
| 1224 | 3300053160 | Ga0500633_0066471 | Ga0500633_0066471_143_805 | 218 |
| 1225 | 3300053161 | Ga0500634_0086341 | Ga0500634_0086341_40_702 | 218 |
| 1226 | 3300053162 | Ga0500638_005628 | Ga0500638_005628_1082_1738 | 218 |
| 1227 | 3300053162 | Ga0500638_022660 | Ga0500638_022660_38_700 | 218 |
| 1228 | 3300053162 | Ga0500638_029075 | Ga0500638_029075_1294_1950 | 218 |
| 1229 | 3300053162 | Ga0500638_089310 | Ga0500638_089310_605_1267 | 218 |
| 1230 | 3300053162 | Ga0500638_178963 | Ga0500638_178963_11_670 | 218 |
| 1231 | 3300053163 | Ga0500639_207576 | Ga0500639_207576_88_750 | 218 |
| 1232 | 3300053178 | Ga0500637_0003368 | Ga0500637_0003368_1766_2422 | 218 |
| 1233 | 3300053178 | Ga0500637_0190527 | Ga0500637_0190527_320_982 | 218 |
| 1234 | 3300053728 | Ga0500657_015026 | Ga0500657_015026_833_1492 | 218 |
| 1235 | 3300053729 | Ga0500625_003211 | Ga0500625_003211_4059_4721 | 218 |
| 1236 | 3300053730 | Ga0500645_063751 | Ga0500645_063751_241_903 | 218 |
| 1237 | 3300053731 | Ga0500609_004080 | Ga0500609_004080_1209_1871 | 218 |
| 1238 | 3300053735 | Ga0500596_003796 | Ga0500596_003796_639_1298 | 218 |
| 1239 | 3300053736 | Ga0500599_002110 | Ga0500599_002110_1603_2265 | 218 |
| 1240 | 3300053736 | Ga0500599_008015 | Ga0500599_008015_294_956 | 218 |
| 1241 | 3300053737 | Ga0500601_000446 | Ga0500601_000446_4256_4918 | 218 |
| 1242 | 3300055283 | Ga0500661_000838 | Ga0500661_000838_1868_2524 | 218 |
| 1243 | 3300055283 | Ga0500661_007306 | Ga0500661_007306_1339_2001 | 218 |
| 1244 | 3300061719 | Ga0466962_0095439 | Ga0466962_0095439_703_1365 | 218 |
| 1245 | iso_pu_bacteria | 8006994254 | 8006996247 | 218 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4mp4-assembly1.cif.gz_B | crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure | 0.8853 | 2 | 205 |
| 4mp4-assembly2.cif.gz_C-2 | crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure | 0.8841 | 2 | 205 |
| 4mp4-assembly2.cif.gz_C-2 | crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure | 0.8631 | 2 | 205 |
| 4isd-assembly2.cif.gz_C | crystal structure of glutathione transferase homolog from burkholderia gl bgr1, target efi-501803, with bound glutathione | 0.8434 | 2 | 205 |
| 3bby-assembly1.cif.gz_A-2 | crystal structure of glutathione s-transferase (np_416804.1) from escherichia coli k12 at 1.85 a resolution | 0.8394 | 2 | 205 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_B6U5S1_5_83_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9003 | 1 | 87 | 3.40.30.10 |
| af_B6U5S1_5_83_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8897 | 1 | 87 | 3.40.30.10 |
| 3ljrB01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8807 | 2 | 81 | 3.40.30.10 |
| 1v2aB01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8747 | 3 | 80 | 3.40.30.10 |
| af_A0A0B5EC52_24_99_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.873 | 12 | 82 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-F7QP79-F1-model_v4 | Glutathione S-transferase (EC 2.5.1.18) | 0.9942 | 2 | 218 |
GO:0004364
GO:0006559 GO:0006749 GO:0016034 |
| AF-A0A844TFJ1-F1-model_v4 | Glutathione S-transferase | 0.9934 | 2 | 218 |
GO:0004364
GO:0006559 GO:0006749 GO:0016034 |
| AF-A0A844TFJ1-F1-model_v4 | Glutathione S-transferase | 0.9844 | 2 | 218 |
GO:0004364
GO:0006559 GO:0006749 GO:0016034 |
| AF-A0A1Q7VK14-F1-model_v4 | GST N-terminal domain-containing protein | 0.9805 | 1 | 216 |
GO:0004364
GO:0006559 GO:0006749 GO:0016034 |
| AF-A0A177M8Y9-F1-model_v4 | Glutathione S-transferase | 0.9802 | 2 | 216 |
GO:0004364
GO:0006559 GO:0006749 GO:0016034 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar