F492063

General Info

Members Datasets Scaffolds Average Seq Length
1238 616 1100 193

Family's Representative Sequence

Representative Sequence 3300046474|Ga0495605_0001765|Ga0495605_0001765_671_1339
Length 222
Sequence VHKNILFAQNLARRIIRPSAIPARFREKLMSLVTVRKYKLDVEEIWHEGGPRLATPLQVAVGLAIVKNPFAGRYEADLLPFMAELRQLGTELSRRMIAALGGPERVEAYGKGAVVGEDGELEHGAVWHEAGGWAMREQLGSPKAIVPAAKTIGGVGTRLMIPLGHIQAAYVRSHFGTAEMVVWDGPKRDEIAFGLAMSTGGRVHARIGGLAAQDISANDGLR

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
3 2511231004 Pseudomonas sp. GM102 Isolate Nodule
4 2511231007 Pseudomonas sp. GM18 Isolate Nodule
5 2511231016 Pseudomonas sp. GM50 Isolate Nodule
6 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
7 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
8 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
9 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
10 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
11 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
12 2547132374 Acidovorax radicis N35 Isolate Unclassified
13 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
14 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
15 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
16 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
17 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
18 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
19 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
20 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
21 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
22 2643221570 Acidovorax sp. Root568 Isolate Unclassified
23 2643221596 Acidovorax sp. Root70 Isolate Unclassified
24 2643221609 Acidovorax sp. Root217 Isolate Unclassified
25 2643221611 Acidovorax sp. Root219 Isolate Unclassified
26 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
27 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
28 2643221652 Acidovorax sp. Root402 Isolate Unclassified
29 2643221658 Variovorax sp. Root411 Isolate Unclassified
30 2643221672 Variovorax sp. Root434 Isolate Unclassified
31 2643221717 Acidovorax sp. Root267 Isolate Unclassified
32 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
33 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
34 2738541277 Variovorax sp. GV051 Isolate Unclassified
35 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
36 2738543019 Variovorax sp. GV040 Isolate Unclassified
37 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
38 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
39 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
40 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
41 2818991446 Variovorax sp. 1180 Isolate Unclassified
42 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
43 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
44 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
45 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
46 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
47 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
48 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
49 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
50 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
51 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
52 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
53 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
54 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
55 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
56 2855730933 Achromobacter sp. HZ28 Isolate Nodule
57 2855767633 Achromobacter sp. HZ34 Isolate Nodule
58 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
59 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
60 2858950400 Achromobacter sp. K91 Isolate Unclassified
61 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
62 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
63 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
64 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
65 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
66 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
67 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
68 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
69 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
70 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
71 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
72 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
73 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
74 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
75 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
76 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
77 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
78 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
79 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
80 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
81 2899924645 Variovorax sp. 369 Isolate Unclassified
82 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
83 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
84 2904456579 Variovorax sp. 2002 Isolate Unclassified
85 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
86 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
87 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
88 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
89 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
90 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
91 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
92 2928037797 Variovorax sp. 1126 Isolate Unclassified
93 2928044640 Variovorax sp. 1128 Isolate Unclassified
94 2928051484 Variovorax sp. 1133 Isolate Unclassified
95 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
96 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
97 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
98 2929520902 Variovorax beijingensis 502 Isolate Unclassified
99 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
100 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
101 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
102 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
103 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
104 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
105 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
106 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
107 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
108 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
109 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
110 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
111 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
112 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
113 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
114 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
115 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
116 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
117 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
118 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
119 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
120 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
121 2941479691
122 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
123 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
124 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
125 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
126 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
127 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
128 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
129 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
130 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
131 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
132 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
133 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
134 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
135 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
136 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
137 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
138 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
139 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
140 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
141 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
142 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
143 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
144 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
145 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
146 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
147 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
148 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
149 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
150 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
151 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
152 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
153 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
154 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
155 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
156 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
157 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
158 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
159 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
160 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
161 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
162 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
163 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
164 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
165 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
166 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
167 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
168 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
169 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
170 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
171 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
172 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
173 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
174 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
175 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
176 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
177 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
178 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
179 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
180 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
181 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
182 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
183 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
184 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
185 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
186 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
187 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
188 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
189 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
190 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
191 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
192 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
193 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
194 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
195 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
196 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
197 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
198 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
199 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
200 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
201 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
202 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
203 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
204 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
205 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
206 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
207 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
208 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
209 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
210 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
211 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
212 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
213 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
214 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
215 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
216 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
217 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
218 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
219 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
220 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
221 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
222 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
223 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
224 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
225 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
226 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
227 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
228 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
229 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
230 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
231 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
232 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
233 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
234 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
235 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
236 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
237 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
238 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
239 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
240 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
241 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
242 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
243 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
244 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
245 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
246 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
247 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
248 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
249 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
250 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
251 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
252 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
253 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
254 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
255 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
256 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
257 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
258 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
259 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
260 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
261 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
262 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
263 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
264 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
265 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
266 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
267 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
309 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
311 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
314 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
315 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
316 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
319 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
320 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
321 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
322 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
323 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
324 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
325 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
326 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
327 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
328 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
329 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
330 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
331 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
332 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
333 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
334 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
335 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
336 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
337 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
338 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
339 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
340 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
341 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
342 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
343 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
344 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
345 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
346 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
347 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
348 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
349 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
350 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
351 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
352 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
353 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
354 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
355 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
356 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
357 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
358 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
359 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
360 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
361 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
362 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
363 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
364 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
365 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
366 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
367 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
368 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
369 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
370 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
371 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
372 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
373 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
374 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
375 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
376 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
377 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
378 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
379 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
380 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
381 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
382 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
383 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
384 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
385 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
386 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
387 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
388 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
389 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
390 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
391 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
392 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
393 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
394 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
395 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
396 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
397 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
398 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
399 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
400 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
401 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
402 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
403 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
404 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
405 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
406 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
407 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
408 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
409 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
410 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
411 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
412 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
413 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
414 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
415 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
416 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
417 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
418 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
419 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
420 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
421 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
422 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
423 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
424 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
425 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
426 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
427 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
428 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
429 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
430 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
431 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
432 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
433 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
434 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
435 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
436 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
437 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
438 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
439 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
440 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
441 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
442 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
443 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
444 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
445 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
446 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
447 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
448 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
449 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
450 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
451 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
452 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
453 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
454 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
455 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
456 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
457 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
458 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
459 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
460 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
461 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
462 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
463 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
464 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
465 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
466 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
467 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
468 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
469 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
470 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
471 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
472 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
473 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
474 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
475 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
476 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
477 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
478 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
479 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
480 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
481 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
482 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
483 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
484 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
485 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
486 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
487 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
488 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
489 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
490 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
491 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
492 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
493 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
494 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
495 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
496 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
497 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
498 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
499 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
500 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
501 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
502 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
503 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
504 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
505 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
506 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
507 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
508 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
509 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
510 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
511 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
512 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
513 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
514 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
515 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
516 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
517 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
518 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
519 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
520 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
521 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
522 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
523 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
524 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
525 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
526 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
527 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
528 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
529 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
530 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
531 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
532 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
533 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
534 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
535 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
536 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
537 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
538 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
539 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
540 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
541 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
542 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
543 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
544 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
545 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
546 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
547 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
548 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
549 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
550 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
551 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
552 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
553 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
554 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
555 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
556 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
557 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
558 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
559 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
560 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
561 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
562 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
563 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
564 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
565 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
566 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
567 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
568 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
569 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
570 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
571 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
572 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
573 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
574 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
575 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
576 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
577 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
578 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
579 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
580 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
581 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
582 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
583 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
584 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
585 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
586 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
587 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
588 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
589 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
590 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
591 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
592 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
593 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
594 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
595 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
596 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
597 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
598 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
599 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
600 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
601 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
602 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
603 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
604 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
605 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
606 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
607 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
608 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
609 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
610 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
611 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
612 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
613 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
614 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
615 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
616 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.69
Metatranscriptomes 0.16
Isolates 11.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21
Nodule 5.49
Rhizoplane 3.07
Rhizosphere 57.92
Stem 0
Stem Tuber 0
Unclassified 12.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10018697 3300001989 Bacteria 2488
2 JGI24739J22299_10065880 3300001989 Bacteria 1135
3 JGI25150J39212_1014226 3300002774 Bacteria 1358
4 JGI25151J46595_10001862 3300003187 Bacteria 13516
5 JGI25151J46595_10005013 3300003187 Bacteria 6897
6 JGI25151J46595_10008704 3300003187 Bacteria 4858
7 JGI25406J46586_10006853 3300003203 Bacteria 5230
8 JGI25165J46597_1005063 3300003214 Bacteria 2625
9 JGI25153J46596_10000524 3300003215 Bacteria 24116
10 JGI25153J46596_10001612 3300003215 Bacteria 13376
11 rootH1_10006469 3300003316 Bacteria 3314
12 rootH2_10059534 3300003320 Bacteria 2270
13 rootH1_10032909 3300003323 Bacteria 3342
14 JGI25160J50197_1002408 3300003354 Bacteria 8720
15 JGI25160J50197_1017500 3300003354 Bacteria 2266
16 JGI25161J50226_1002478 3300003374 Bacteria 4703
17 Ga0006562J51391_1089446 3300003578 Bacteria 6060
18 Ga0006562J51391_1089447 3300003578 Bacteria 4110
19 Ga0055532_1000122 3300003758 Bacteria 79139
20 Ga0055527_1000078 3300003760 Bacteria 79672
21 Ga0055535_1000054 3300003761 Bacteria 131373
22 Ga0055535_1000458 3300003761 Bacteria 37664
23 Ga0055542_1000029 3300003762 Bacteria 248836
24 Ga0055542_1004543 3300003762 Bacteria 3338
25 Ga0055526_1000642 3300003771 Bacteria 27116
26 Ga0055526_1045218 3300003771 Bacteria 1055
27 Ga0055537_1000013 3300003773 Bacteria 133522
28 Ga0055537_1019911 3300003773 Bacteria 1031
29 Ga0055524_1004416 3300003775 Bacteria 6487
30 Ga0055536_1001113 3300003781 Bacteria 16866
31 Ga0055536_1001817 3300003781 Bacteria 12517
32 Ga0055536_1002156 3300003781 Bacteria 11218
33 Ga0055534_1000008 3300003784 Bacteria 211098
34 Ga0055534_1001246 3300003784 Bacteria 10524
35 Ga0055528_1004208 3300003790 Bacteria 6985
36 Ga0055528_1041222 3300003790 Bacteria 1031
37 Ga0055530_10000350 3300003791 Bacteria 41698
38 Ga0055540_1000017 3300003792 Bacteria 231465
39 Ga0055540_1000480 3300003792 Bacteria 30816
40 Ga0055540_1000596 3300003792 Bacteria 26129
41 Ga0055540_1001036 3300003792 Bacteria 17799
42 Ga0055531_10000034 3300003794 Bacteria 150210
43 Ga0055531_10000794 3300003794 Bacteria 26174
44 Ga0055531_10003334 3300003794 Bacteria 10278
45 Ga0055543_1000297 3300004625 Bacteria 35506
46 Ga0065165_1006954 3300005262 Bacteria 5735
47 Ga0065165_1009111 3300005262 Bacteria 4505
48 Ga0065714_10003761 3300005288 Bacteria 6572
49 Ga0065714_10064479 3300005288 Bacteria 55183
50 Ga0065714_10074291 3300005288 Bacteria 3058
51 Ga0065714_10074419 3300005288 Bacteria 3031
52 Ga0065714_10207112 3300005288 Bacteria 877
53 Ga0070658_10007776 3300005327 Bacteria 8640
54 Ga0070658_10089717 3300005327 Bacteria 2531
55 Ga0070683_100642390 3300005329 Bacteria 1016
56 Ga0070670_100061461 3300005331 Bacteria 3224
57 Ga0070682_100067873 3300005337 Bacteria 2272
58 Ga0070682_100418806 3300005337 Bacteria 1017
59 Ga0070668_100287766 3300005347 Bacteria 1374
60 Ga0070668_100557237 3300005347 Bacteria 998
61 Ga0070668_100759046 3300005347 Bacteria 859
62 Ga0070669_100205796 3300005353 Bacteria 1550
63 Ga0070675_100171954 3300005354 Bacteria 1869
64 Ga0070671_100026204 3300005355 Bacteria 4790
65 Ga0070674_100164048 3300005356 Bacteria 1688
66 Ga0070674_100182456 3300005356 Bacteria 1609
67 Ga0070673_100011258 3300005364 Bacteria 6100
68 Ga0070659_100089411 3300005366 Bacteria 2467
69 Ga0070667_100007828 3300005367 Bacteria 8862
70 Ga0070667_100055974 3300005367 Bacteria 3331
71 Ga0070709_10239711 3300005434 Bacteria 1302
72 Ga0070714_100394864 3300005435 Bacteria 1306
73 Ga0070663_100271830 3300005455 Bacteria 1348
74 Ga0070678_100172746 3300005456 Bacteria 1762
75 Ga0070662_100082922 3300005457 Bacteria 2392
76 Ga0070662_100917269 3300005457 Bacteria 748
77 Ga0068867_100003215 3300005459 Bacteria 11517
78 Ga0070685_10379590 3300005466 Bacteria 973
79 Ga0068853_100037228 3300005539 Bacteria 4140
80 Ga0068853_100161555 3300005539 Bacteria 2022
81 Ga0070672_100002432 3300005543 Bacteria 11807
82 Ga0070672_100148520 3300005543 Unclassified 1938
83 Ga0070672_100291448 3300005543 Unclassified 1382
84 Ga0070696_100270863 3300005546 Bacteria 1291
85 Ga0070665_100029762 3300005548 Bacteria 5495
86 Ga0070665_100091135 3300005548 Plasmid 3054
87 Ga0070665_100637408 3300005548 Bacteria 1079
88 Ga0070665_100717317 3300005548 Bacteria 1013
89 Ga0070665_101010375 3300005548 Bacteria 844
90 Ga0068855_100012150 3300005563 Bacteria 10404
91 Ga0068855_100023740 3300005563 Bacteria 7345
92 Ga0068857_100007525 3300005577 Bacteria 9371
93 Ga0068857_100190665 3300005577 Bacteria 1867
94 Ga0068857_101095876 3300005577 Bacteria 769
95 Ga0068856_100420179 3300005614 Bacteria 1357
96 Ga0068852_100036759 3300005616 Bacteria 4101
97 Ga0068859_100227938 3300005617 Bacteria 1951
98 Ga0068861_100072448 3300005719 Bacteria 2673
99 Ga0068861_100138851 3300005719 Bacteria 1981
100 Ga0068851_10011128 3300005834 Bacteria 4213
101 Ga0068863_100151684 3300005841 Bacteria 2217
102 Ga0068858_100843716 3300005842 Bacteria 895
103 Ga0068860_100550446 3300005843 Bacteria 1156
104 Ga0068862_100079023 3300005844 Bacteria 2851
105 Ga0068862_100104809 3300005844 Bacteria 2478
106 Ga0068862_100113857 3300005844 Bacteria 2377
107 Ga0068862_100409081 3300005844 Bacteria 1271
108 Ga0081455_10438662 3300005937 Bacteria 895
109 Ga0081538_10044611 3300005981 Bacteria 2762
110 Ga0081540_1000904 3300005983 Bacteria 26798
111 Ga0081540_1019975 3300005983 Bacteria 4047
112 Ga0081539_10006459 3300005985 Bacteria 11234
113 Ga0081539_10031065 3300005985 Bacteria 3300
114 Ga0075365_10007694 3300006038 Bacteria 6061
115 Ga0075365_10099933 3300006038 Bacteria 1985
116 Ga0075365_10331089 3300006038 Bacteria 1073
117 Ga0075368_10083080 3300006042 Bacteria 1305
118 Ga0075363_100078457 3300006048 Bacteria 1803
119 Ga0075363_100343408 3300006048 Bacteria 871
120 Ga0075364_10009966 3300006051 Bacteria 5719
121 Ga0075364_10069073 3300006051 Bacteria 2324
122 Ga0075364_10427925 3300006051 Bacteria 904
123 Ga0075432_10008151 3300006058 Bacteria 3572
124 Ga0075432_10023817 3300006058 Bacteria 2097
125 Ga0075432_10034676 3300006058 Bacteria 1753
126 Ga0075432_10037918 3300006058 Bacteria 1678
127 Ga0075362_10007473 3300006177 Bacteria 4141
128 Ga0075362_10022548 3300006177 Bacteria 2654
129 Ga0075362_10070372 3300006177 Bacteria 1597
130 Ga0075362_10084199 3300006177 Bacteria 1469
131 Ga0075362_10228658 3300006177 Bacteria 910
132 Ga0075367_10007939 3300006178 Bacteria 5470
133 Ga0075367_10350269 3300006178 Bacteria 932
134 Ga0075369_10130131 3300006186 Bacteria 1143
135 Ga0075369_10233287 3300006186 Bacteria 853
136 Ga0075366_10003598 3300006195 Bacteria 8207
137 Ga0075366_10013698 3300006195 Bacteria 4622
138 Ga0075366_10071240 3300006195 Bacteria 2071
139 Ga0075366_10090209 3300006195 Bacteria 1835
140 Ga0075366_10134002 3300006195 Bacteria 1496
141 Ga0075366_10135302 3300006195 Bacteria 1488
142 Ga0075366_10376457 3300006195 Bacteria 873
143 Ga0075370_10004534 3300006353 Bacteria 6762
144 Ga0075370_10006518 3300006353 Bacteria 5876
145 Ga0075370_10008423 3300006353 Bacteria 5308
146 Ga0075370_10015503 3300006353 Bacteria 4081
147 Ga0075370_10034794 3300006353 Bacteria 2825
148 Ga0075370_10037095 3300006353 Bacteria 2739
149 Ga0075370_10046470 3300006353 Bacteria 2457
150 Ga0075370_10064178 3300006353 Bacteria 2094
151 Ga0075370_10147610 3300006353 Bacteria 1377
152 Ga0075428_100247782 3300006844 Bacteria 1920
153 Ga0075428_100647073 3300006844 Bacteria 1127
154 Ga0075431_100366461 3300006847 Bacteria 1446
155 Ga0068865_100048958 3300006881 Bacteria 2911
156 Ga0068865_100103884 3300006881 Bacteria 2085
157 Ga0097620_100227952 3300006931 Bacteria 1951
158 Ga0099826_10009909 3300006948 Bacteria 7120
159 Ga0099826_10076909 3300006948 Bacteria 2095
160 Ga0105251_10001140 3300009011 Bacteria 23124
161 Ga0105244_10029744 3300009036 Bacteria 2914
162 Ga0105250_10012881 3300009092 Bacteria 3443
163 Ga0105240_10000593 3300009093 Bacteria 67263
164 Ga0105240_10013249 3300009093 Bacteria 11338
165 Ga0105240_10181781 3300009093 Bacteria 2481
166 Ga0111539_10000208 3300009094 Bacteria 69518
167 Ga0111539_11600060 3300009094 Bacteria 756
168 Ga0111539_11705122 3300009094 Bacteria 731
169 Ga0105245_10042336 3300009098 Bacteria 4063
170 Ga0105245_10224019 3300009098 Bacteria 1816
171 Ga0105245_10925507 3300009098 Bacteria 914
172 Ga0105247_10062041 3300009101 Bacteria 2319
173 Ga0105247_10118400 3300009101 Bacteria 1713
174 Ga0105247_10609766 3300009101 Bacteria 810
175 Ga0114129_11793092 3300009147 Bacteria 746
176 Ga0105243_10045708 3300009148 Bacteria 3442
177 Ga0105243_10340671 3300009148 Bacteria 1373
178 Ga0105243_11021701 3300009148 Bacteria 831
179 Ga0105241_10431693 3300009174 Bacteria 1162
180 Ga0105248_10218363 3300009177 Bacteria 2147
181 Ga0105248_10478889 3300009177 Bacteria 1403
182 Ga0105237_10002173 3300009545 Bacteria 24616
183 Ga0105237_10004597 3300009545 Bacteria 15930
184 Ga0105237_10042261 3300009545 Bacteria 4598
185 Ga0105237_10569171 3300009545 Bacteria 1140
186 Ga0105237_10750960 3300009545 Bacteria 982
187 Ga0105237_11438483 3300009545 Bacteria 696
188 Ga0105238_10898135 3300009551 Bacteria 904
189 Ga0105249_10043409 3300009553 Bacteria 4088
190 Ga0105249_10526106 3300009553 Bacteria 1230
191 Ga0105239_10203277 3300010375 Bacteria 2220
192 Ga0105246_10004906 3300011119 Bacteria 8152
193 Ga0105246_10083663 3300011119 Bacteria 2281
194 Ga0105246_10119114 3300011119 Bacteria 1953
195 Ga0157373_10002545 3300013100 Bacteria 13875
196 Ga0157373_10013430 3300013100 Bacteria 6007
197 Ga0157371_10037776 3300013102 Bacteria 3455
198 Ga0157370_10073112 3300013104 Bacteria 3235
199 Ga0157370_10081525 3300013104 Bacteria 3044
200 Ga0157369_10000059 3300013105 Bacteria 154283
201 Ga0157369_10006869 3300013105 Bacteria 13129
202 Ga0157374_10000044 3300013296 Bacteria 144848
203 Ga0163162_10131314 3300013306 Bacteria 2613
204 Ga0163162_10160588 3300013306 Bacteria 2369
205 Ga0163162_11104727 3300013306 Bacteria 898
206 Ga0157372_10837308 3300013307 Bacteria 1068
207 Ga0157375_10012536 3300013308 Bacteria 7524
208 Ga0157375_10023559 3300013308 Bacteria 5682
209 Ga0157375_10161067 3300013308 Bacteria 2385
210 Ga0157375_10542103 3300013308 Unclassified 1326
211 Ga0157375_11360151 3300013308 Bacteria 836
212 Ga0157380_10034099 3300014326 Bacteria 3925
213 Ga0182008_10037035 3300014497 Bacteria 2441
214 Ga0182008_10424475 3300014497 Bacteria 718
215 Ga0157379_10145085 3300014968 Bacteria 2140
216 Ga0182006_1063164 3300015261 Bacteria 1392
217 Ga0182006_1093053 3300015261 Bacteria 1081
218 Ga0182007_10029701 3300015262 Bacteria 1871
219 Ga0182007_10050873 3300015262 Bacteria 1367
220 Ga0182005_1000403 3300015265 Bacteria 23610
221 Ga0183362_10002 3300015683 Bacteria 1432711
222 Ga0163161_10001036 3300017792 Bacteria 21172
223 Ga0163161_10011465 3300017792 Bacteria 6150
224 Ga0163161_10051165 3300017792 Bacteria 2991
225 Ga0163161_10127690 3300017792 Bacteria 1916
226 Ga0163161_10211875 3300017792 Bacteria 1497
227 Ga0163161_10582355 3300017792 Bacteria 921
228 Ga0163161_10677115 3300017792 Bacteria 857
229 Ga0213873_10049182 3300021358 Bacteria 1111
230 Ga0213872_10036968 3300021361 Bacteria 2230
231 Ga0213871_10021859 3300021441 Bacteria 1598
232 Ga0209436_101898 3300025208 Bacteria 6743
233 Ga0209674_100130 3300025226 Bacteria 119638
234 Ga0209672_100036 3300025228 Bacteria 287801
235 Ga0209672_100488 3300025228 Bacteria 22061
236 Ga0209672_107059 3300025228 Bacteria 1766
237 Ga0209147_100066 3300025229 Bacteria 232474
238 Ga0209147_100494 3300025229 Bacteria 23316
239 Ga0209258_100018 3300025242 Bacteria 567561
240 Ga0209258_100085 3300025242 Bacteria 244731
241 Ga0207425_1000890 3300025245 Bacteria 14500
242 Ga0207425_1006777 3300025245 Bacteria 3097
243 Ga0209148_1000030 3300025254 Bacteria 567582
244 Ga0209148_1000198 3300025254 Bacteria 109136
245 Ga0209759_1000993 3300025256 Bacteria 19459
246 Ga0209129_1003720 3300025258 Bacteria 6456
247 Ga0209129_1004626 3300025258 Bacteria 5268
248 Ga0209233_1007634 3300025261 Bacteria 3409
249 Ga0209565_1000042 3300025263 Bacteria 239712
250 Ga0209565_1001579 3300025263 Bacteria 9706
251 Ga0209455_1000289 3300025272 Bacteria 53897
252 Ga0209673_1000071 3300025273 Bacteria 239966
253 Ga0209673_1000940 3300025273 Bacteria 36505
254 Ga0209673_1001066 3300025273 Bacteria 31244
255 Ga0209673_1004735 3300025273 Bacteria 7159
256 Ga0209130_1000230 3300025284 Bacteria 73335
257 Ga0209130_1008750 3300025284 Bacteria 2957
258 Ga0209130_1011217 3300025284 Bacteria 2410
259 Ga0209675_1000041 3300025291 Bacteria 239712
260 Ga0209675_1003973 3300025291 Bacteria 6754
261 Ga0209676_1000004 3300025292 Bacteria 1138360
262 Ga0209676_1000123 3300025292 Bacteria 195351
263 Ga0209676_1002561 3300025292 Bacteria 12580
264 Ga0209676_1012302 3300025292 Bacteria 3376
265 Ga0209025_1000040 3300025294 Bacteria 376228
266 Ga0209025_1000113 3300025294 Bacteria 218943
267 Ga0209025_1001177 3300025294 Bacteria 37045
268 Ga0209025_1010408 3300025294 Bacteria 6303
269 Ga0209025_1019267 3300025294 Bacteria 3802
270 Ga0209564_1000319 3300025295 Bacteria 93563
271 Ga0209564_1006998 3300025295 Bacteria 5916
272 Ga0209758_1000011 3300025297 Bacteria 1049685
273 Ga0209758_1000169 3300025297 Bacteria 149782
274 Ga0209758_1000359 3300025297 Bacteria 81559
275 Ga0209758_1004154 3300025297 Bacteria 12339
276 Ga0209758_1007868 3300025297 Bacteria 7093
277 Ga0209758_1022817 3300025297 Bacteria 2853
278 Ga0209758_1025357 3300025297 Bacteria 2605
279 Ga0209050_1000002 3300025298 Bacteria 1792849
280 Ga0209050_1000037 3300025298 Bacteria 415612
281 Ga0209050_1001339 3300025298 Bacteria 27306
282 Ga0209050_1001596 3300025298 Bacteria 23431
283 Ga0209050_1017511 3300025298 Bacteria 2850
284 Ga0209256_1000166 3300025299 Bacteria 133549
285 Ga0209256_1004821 3300025299 Bacteria 8181
286 Ga0207426_1000092 3300025302 Bacteria 278907
287 Ga0207426_1000325 3300025302 Bacteria 91634
288 Ga0207426_1000389 3300025302 Bacteria 75042
289 Ga0207426_1012504 3300025302 Bacteria 3184
290 Ga0207426_1049462 3300025302 Bacteria 1258
291 Ga0209051_1000002 3300025303 Bacteria 1631846
292 Ga0209051_1000040 3300025303 Bacteria 315055
293 Ga0209051_1000091 3300025303 Bacteria 173683
294 Ga0209051_1000128 3300025303 Bacteria 142159
295 Ga0209257_1000002 3300025304 Bacteria 1767052
296 Ga0209257_1000276 3300025304 Bacteria 116802
297 Ga0209257_1000640 3300025304 Bacteria 55997
298 Ga0209257_1001035 3300025304 Bacteria 37155
299 Ga0207656_10032702 3300025321 Bacteria 2161
300 Ga0207655_1003737 3300025728 Bacteria 11177
301 Ga0207642_10371339 3300025899 Bacteria 849
302 Ga0207710_10035905 3300025900 Bacteria 2183
303 Ga0207647_10167197 3300025904 Bacteria 1281
304 Ga0207645_10001280 3300025907 Bacteria 20687
305 Ga0207643_10036289 3300025908 Bacteria 2764
306 Ga0207643_10055747 3300025908 Bacteria 2248
307 Ga0207705_10007418 3300025909 Bacteria 8065
308 Ga0207705_10212823 3300025909 Bacteria 1466
309 Ga0207654_10741385 3300025911 Unclassified 707
310 Ga0207695_10000012 3300025913 Bacteria 840961
311 Ga0207695_10720704 3300025913 Bacteria 878
312 Ga0207671_10024648 3300025914 Bacteria 4519
313 Ga0207671_10201703 3300025914 Bacteria 1554
314 Ga0207663_10661450 3300025916 Bacteria 825
315 Ga0207657_10037373 3300025919 Bacteria 4336
316 Ga0207681_10264730 3300025923 Bacteria 1347
317 Ga0207694_10012851 3300025924 Bacteria 6305
318 Ga0207694_10352320 3300025924 Bacteria 1219
319 Ga0207650_10087320 3300025925 Bacteria 2376
320 Ga0207650_10294159 3300025925 Bacteria 1325
321 Ga0207659_10096692 3300025926 Bacteria 2217
322 Ga0207687_10083811 3300025927 Bacteria 2309
323 Ga0207687_10563955 3300025927 Bacteria 956
324 Ga0207644_10007662 3300025931 Bacteria 7041
325 Ga0207690_10045947 3300025932 Bacteria 2889
326 Ga0207706_10105226 3300025933 Bacteria 2483
327 Ga0207706_10176735 3300025933 Bacteria 1875
328 Ga0207709_10008456 3300025935 Bacteria 5693
329 Ga0207709_10098934 3300025935 Bacteria 1924
330 Ga0207709_10102873 3300025935 Bacteria 1892
331 Ga0207709_10399892 3300025935 Bacteria 1050
332 Ga0207670_10415282 3300025936 Bacteria 1078
333 Ga0207704_10051188 3300025938 Bacteria 2496
334 Ga0207704_10247933 3300025938 Bacteria 1335
335 Ga0207691_10001439 3300025940 Bacteria 23737
336 Ga0207691_10080660 3300025940 Bacteria 2926
337 Ga0207691_10401401 3300025940 Unclassified 1169
338 Ga0207711_10449388 3300025941 Bacteria 1200
339 Ga0207689_10044219 3300025942 Bacteria 3681
340 Ga0207679_10130143 3300025945 Bacteria 2018
341 Ga0207667_10009505 3300025949 Bacteria 11441
342 Ga0207667_10013355 3300025949 Bacteria 9401
343 Ga0207651_10116156 3300025960 Bacteria 2019
344 Ga0207712_10282574 3300025961 Bacteria 1355
345 Ga0207712_10321970 3300025961 Bacteria 1276
346 Ga0207668_11075075 3300025972 Bacteria 721
347 Ga0207640_11111296 3300025981 Bacteria 700
348 Ga0207658_10001632 3300025986 Bacteria 17203
349 Ga0207658_10025023 3300025986 Bacteria 4178
350 Ga0207658_10042856 3300025986 Bacteria 3286
351 Ga0207658_10103958 3300025986 Bacteria 2231
352 Ga0207677_10012746 3300026023 Bacteria 4848
353 Ga0207703_10043282 3300026035 Bacteria 3614
354 Ga0207639_10082559 3300026041 Bacteria 2548
355 Ga0207678_10008402 3300026067 Bacteria 9107
356 Ga0207678_10080588 3300026067 Bacteria 2787
357 Ga0207708_10153607 3300026075 Bacteria 1814
358 Ga0207641_10456416 3300026088 Bacteria 1236
359 Ga0207648_10073220 3300026089 Bacteria 2986
360 Ga0207648_10099462 3300026089 Bacteria 2547
361 Ga0207648_10321353 3300026089 Bacteria 1391
362 Ga0207648_10330196 3300026089 Unclassified 1372
363 Ga0207676_10199040 3300026095 Bacteria 1769
364 Ga0207674_10007877 3300026116 Bacteria 12381
365 Ga0207674_10162170 3300026116 Bacteria 2190
366 Ga0207674_10369866 3300026116 Bacteria 1386
367 Ga0207674_10414373 3300026116 Bacteria 1302
368 Ga0207675_100045243 3300026118 Bacteria 4112
369 Ga0207675_100184054 3300026118 Bacteria 2001
370 Ga0207675_100473096 3300026118 Bacteria 1244
371 Ga0207683_10051718 3300026121 Bacteria 3599
372 Ga0207683_10216873 3300026121 Bacteria 1743
373 Ga0207683_10580141 3300026121 Bacteria 1037
374 Ga0207698_10066687 3300026142 Bacteria 2834
375 Ga0209282_1039175 3300027666 Bacteria 2830
376 Ga0209966_1082362 3300027695 Bacteria 714
377 Ga0207428_10000016 3300027907 Bacteria 327690
378 Ga0207428_10002856 3300027907 Bacteria 17129
379 Ga0207428_10158713 3300027907 Bacteria 1718
380 Ga0207428_10195605 3300027907 Bacteria 1523
381 Ga0268266_10030056 3300028379 Bacteria 4616
382 Ga0268265_10007850 3300028380 Bacteria 7201
383 Ga0268265_10034773 3300028380 Bacteria 3676
384 Ga0268265_10045549 3300028380 Bacteria 3274
385 Ga0268265_10274687 3300028380 Bacteria 1505
386 Ga0268265_10533527 3300028380 Bacteria 1111
387 Ga0307517_10227876 3300028786 Unclassified 1123
388 Ga0307515_10000047 3300028794 Bacteria 291475
389 Ga0307515_10007012 3300028794 Bacteria 22381
390 Ga0307515_10067589 3300028794 Bacteria 4926
391 Ga0307515_10236450 3300028794 Bacteria 1607
392 Ga0265338_10691057 3300028800 Bacteria 705
393 Ga0265327_10128284 3300031251 Bacteria 1195
394 Ga0307513_10022346 3300031456 Bacteria 7439
395 Ga0307513_10041073 3300031456 Bacteria 5109
396 Ga0307513_10297615 3300031456 Bacteria 1382
397 Ga0307509_10011751 3300031507 Bacteria 10559
398 Ga0307408_100000338 3300031548 Bacteria 44357
399 Ga0307408_100003163 3300031548 Bacteria 11355
400 Ga0307408_100006210 3300031548 Bacteria 7936
401 Ga0307408_100030968 3300031548 Bacteria 3720
402 Ga0307408_100134386 3300031548 Bacteria 1933
403 Ga0307408_100258781 3300031548 Bacteria 1439
404 Ga0307408_100266481 3300031548 Bacteria 1420
405 Ga0307408_100605898 3300031548 Bacteria 974
406 Ga0307408_101111667 3300031548 Bacteria 733
407 Ga0307508_10103951 3300031616 Bacteria 2437
408 Ga0307508_10137671 3300031616 Bacteria 2045
409 Ga0307508_10140453 3300031616 Bacteria 2019
410 Ga0307514_10003247 3300031649 Bacteria 15881
411 Ga0316578_10212710 3300031728 Bacteria 1163
412 Ga0307516_10093460 3300031730 Bacteria 2833
413 Ga0307516_10314593 3300031730 Bacteria 1238
414 Ga0307516_10316330 3300031730 Bacteria 1233
415 Ga0307405_10011136 3300031731 Bacteria 4694
416 Ga0307405_10064598 3300031731 Bacteria 2327
417 Ga0307405_10203066 3300031731 Bacteria 1441
418 Ga0307405_10231812 3300031731 Bacteria 1362
419 Ga0307405_10321694 3300031731 Bacteria 1182
420 Ga0307405_10522895 3300031731 Bacteria 955
421 Ga0307405_11363096 3300031731 Bacteria 619
422 Ga0307413_10024029 3300031824 Bacteria 3314
423 Ga0307410_10129231 3300031852 Bacteria 1854
424 Ga0307406_10316912 3300031901 Bacteria 1205
425 Ga0307407_10053693 3300031903 Bacteria 2320
426 Ga0307412_10000332 3300031911 Bacteria 30021
427 Ga0307412_10003750 3300031911 Bacteria 8445
428 Ga0307412_10125723 3300031911 Bacteria 1854
429 Ga0307412_10157598 3300031911 Bacteria 1682
430 Ga0307412_10247862 3300031911 Bacteria 1381
431 Ga0307412_10267922 3300031911 Bacteria 1335
432 Ga0307412_11172917 3300031911 Bacteria 686
433 Ga0307416_100326925 3300032002 Bacteria 1539
434 Ga0307414_10042687 3300032004 Bacteria 3083
435 Ga0307414_10047247 3300032004 Bacteria 2961
436 Ga0307414_10109071 3300032004 Bacteria 2102
437 Ga0307414_10419560 3300032004 Bacteria 1166
438 Ga0307414_10570503 3300032004 Bacteria 1011
439 Ga0307414_10808311 3300032004 Bacteria 855
440 Ga0307411_10053082 3300032005 Bacteria 2653
441 Ga0307411_10378082 3300032005 Bacteria 1164
442 Ga0307510_10019174 3300033180 Bacteria 8026
443 Ga0316574_0000057 3300035398 Bacteria 29135
444 Ga0373937_0221108 3300036401 Bacteria 1783
445 Ga0373925_0725955 3300037068 Bacteria 819
446 Ga0395899_0000036 3300037312 Bacteria 289502
447 Ga0395900_0000071 3300037418 Bacteria 187816
448 Ga0395900_1047130 3300037418 Bacteria 735
449 Ga0395898_0000115 3300037466 Bacteria 211806
450 Ga0395905_0000775 3300037471 Bacteria 42024
451 Ga0395905_0008066 3300037471 Bacteria 10401
452 Ga0395905_0107358 3300037471 Bacteria 2621
453 Ga0395905_0141347 3300037471 Bacteria 2264
454 Ga0395905_0200233 3300037471 Bacteria 1872
455 Ga0395905_0210756 3300037471 Bacteria 1820
456 Ga0395905_0270247 3300037471 Bacteria 1586
457 Ga0395905_0506480 3300037471 Bacteria 1107
458 Ga0400483_055198 3300039062 Bacteria 1769
459 Ga0400483_099673 3300039062 Bacteria 1334
460 Ga0400483_137833 3300039062 Bacteria 3446
461 Ga0400483_269888 3300039062 Bacteria 1583
462 Ga0400483_281109 3300039062 Bacteria 4819
463 Ga0400483_289222 3300039062 Bacteria 1594
464 Ga0400489_52926 3300039093 Bacteria 62005
465 Ga0436360_1316722 3300039438 Bacteria 18203
466 Ga0436361_0159868 3300039447 Bacteria 4252
467 Ga0436362_0110582 3300039453 Bacteria 1353
468 Ga0439436_0017070 3300041404 Bacteria 2173
469 Ga0439438_000149 3300041405 Bacteria 31679
470 Ga0439438_002641 3300041405 Bacteria 7568
471 Ga0439439_0004298 3300041406 Bacteria 3203
472 Ga0439439_0013687 3300041406 Bacteria 1968
473 Ga0439447_002210 3300041407 Bacteria 7136
474 Ga0439447_011078 3300041407 Bacteria 2649
475 Ga0439466_0000719 3300041411 Bacteria 12515
476 Ga0439466_0000880 3300041411 Bacteria 11435
477 Ga0439466_0001876 3300041411 Bacteria 8228
478 Ga0439466_0034340 3300041411 Bacteria 1720
479 Ga0439466_0065578 3300041411 Bacteria 1164
480 Ga0439465_0008944 3300041413 Bacteria 3156
481 Ga0439465_0028833 3300041413 Bacteria 1762
482 Ga0439465_0034418 3300041413 Bacteria 1622
483 Ga0451797_0888364 3300041453 Bacteria 1234
484 Ga0451797_0995910 3300041453 Unclassified 1457
485 Ga0451795_1577188 3300041456 Bacteria 561
486 Ga0451833_0624708 3300041491 Bacteria 773
487 Ga0451837_1569949 3300041494 Bacteria 1281
488 Ga0451841_1366776 3300041498 Bacteria 1041
489 Ga0451843_0892095 3300041509 Bacteria 1023
490 Ga0451853_2345502 3300041512 Bacteria 1103
491 Ga0451853_2947663 3300041512 Bacteria 3248
492 Ga0451853_3268004 3300041512 Unclassified 1542
493 Ga0439431_0068524 3300041997 Bacteria 942
494 Ga0439433_0015099 3300041999 Bacteria 1704
495 Ga0439433_0026055 3300041999 Bacteria 1323
496 Ga0439441_029475 3300042001 Bacteria 1057
497 Ga0439445_0041332 3300042004 Bacteria 1226
498 Ga0439445_0054788 3300042004 Bacteria 1082
499 Ga0439445_0073960 3300042004 Bacteria 946
500 Ga0439432_009181 3300042006 Bacteria 3453
501 Ga0439432_065782 3300042006 Bacteria 1111
502 Ga0439432_065863 3300042006 Bacteria 1110
503 Ga0439432_089381 3300042006 Bacteria 928
504 Ga0439432_115781 3300042006 Bacteria 796
505 Ga0439449_0001049 3300042007 Bacteria 10892
506 Ga0439449_0002301 3300042007 Bacteria 7481
507 Ga0439449_0037568 3300042007 Bacteria 1801
508 Ga0439449_0076051 3300042007 Bacteria 1237
509 Ga0439451_001608 3300042009 Bacteria 4474
510 Ga0439452_000559 3300042010 Bacteria 19607
511 Ga0439452_012799 3300042010 Bacteria 2374
512 Ga0439452_049128 3300042010 Bacteria 971
513 Ga0439452_060499 3300042010 Bacteria 849
514 Ga0439454_016883 3300042011 Bacteria 1037
515 Ga0439456_053450 3300042013 Bacteria 884
516 Ga0439457_016994 3300042014 Bacteria 1618
517 Ga0439457_042931 3300042014 Bacteria 1009
518 Ga0439457_089934 3300042014 Bacteria 710
519 Ga0439462_0002063 3300042015 Bacteria 4613
520 Ga0439462_0004837 3300042015 Bacteria 3304
521 Ga0439462_0014489 3300042015 Bacteria 2027
522 Ga0450911_000107 3300042115 Bacteria 34252
523 Ga0450911_000519 3300042115 Bacteria 12154
524 Ga0450911_005372 3300042115 Bacteria 1998
525 Ga0450919_002690 3300042121 Bacteria 2290
526 Ga0450920_057459 3300042122 Bacteria 784
527 Ga0450921_015948 3300042123 Bacteria 679
528 Ga0450923_004062 3300042125 Bacteria 2271
529 Ga0450890_004088 3300042127 Bacteria 1915
530 Ga0450890_012527 3300042127 Bacteria 1101
531 Ga0450897_001641 3300042128 Bacteria 1552
532 Ga0450898_038517 3300042134 Bacteria 898
533 Ga0450899_006226 3300042135 Bacteria 1288
534 Ga0450902_005710 3300042137 Bacteria 1890
535 Ga0450902_038776 3300042137 Bacteria 809
536 Ga0450902_039672 3300042137 Bacteria 800
537 Ga0450903_001727 3300042138 Bacteria 4020
538 Ga0450903_007196 3300042138 Bacteria 1838
539 Ga0450905_000666 3300042142 Bacteria 4226
540 Ga0450906_005093 3300042145 Bacteria 2722
541 Ga0450910_031038 3300042147 Bacteria 839
542 Ga0439446_0005658 3300042156 Bacteria 3221
543 Ga0439446_0022901 3300042156 Bacteria 1773
544 Ga0439446_0044427 3300042156 Bacteria 1315
545 Ga0439446_0216493 3300042156 Bacteria 651
546 Ga0450908_001204 3300042184 Bacteria 5006
547 Ga0450908_003757 3300042184 Bacteria 2940
548 Ga0450909_007879 3300042185 Bacteria 1545
549 Ga0450909_008301 3300042185 Bacteria 1510
550 Ga0439434_0006459 3300042435 Bacteria 3425
551 Ga0439434_0103139 3300042435 Bacteria 920
552 Ga0439434_0224980 3300042435 Bacteria 637
553 Ga0439464_0015028 3300042439 Bacteria 2087
554 Ga0450893_0005302 3300042532 Bacteria 2067
555 Ga0451577_0003980 3300042876 Bacteria 15930
556 Ga0451577_0009290 3300042876 Bacteria 9478
557 Ga0451577_0074764 3300042876 Bacteria 3021
558 Ga0466969_0064826 3300044656 Bacteria 1767
559 Ga0466972_0025143 3300044658 Bacteria 2953
560 Ga0466972_0243067 3300044658 Bacteria 842
561 Ga0466981_0312141 3300044669 Bacteria 982
562 Ga0453683_0096128 3300044673 Bacteria 1859
563 Ga0453683_0100801 3300044673 Bacteria 1813
564 Ga0453683_0314629 3300044673 Bacteria 1003
565 Ga0466965_0040093 3300044683 Bacteria 2304
566 Ga0466966_0011494 3300044684 Bacteria 5872
567 Ga0466966_0071843 3300044684 Bacteria 2168
568 Ga0466961_0074502 3300044693 Bacteria 2153
569 Ga0466963_0035458 3300044694 Bacteria 3250
570 Ga0453684_0042329 3300044712 Bacteria 6141
571 Ga0466968_0000951 3300044735 Bacteria 10202
572 Ga0466970_0075377 3300044765 Bacteria 1817
573 Ga0466960_0024092 3300044901 Bacteria 2742
574 Ga0466959_0020980 3300045049 Bacteria 4816
575 Ga0451576_0056721 3300045051 Bacteria 4095
576 Ga0466958_0051662 3300045836 Bacteria 2489
577 Ga0466967_0453901 3300045976 Bacteria 1253
578 Ga0495617_058726 3300046452 Bacteria 1274
579 Ga0495617_065748 3300046452 Bacteria 1195
580 Ga0495617_119958 3300046452 Bacteria 847
581 Ga0495627_004299 3300046453 Bacteria 5991
582 Ga0495603_0016851 3300046455 Bacteria 4422
583 Ga0495590_0037979 3300046457 Bacteria 1678
584 Ga0495590_0047821 3300046457 Bacteria 1492
585 Ga0495590_0257338 3300046457 Bacteria 650
586 Ga0495591_053412 3300046458 Bacteria 1096
587 Ga0495629_0106493 3300046459 Bacteria 1956
588 Ga0495629_0351712 3300046459 Bacteria 1005
589 Ga0495638_0010696 3300046460 Bacteria 6355
590 Ga0495638_0013625 3300046460 Bacteria 5524
591 Ga0495638_0021932 3300046460 Bacteria 4198
592 Ga0495638_0036835 3300046460 Bacteria 3114
593 Ga0495638_0041685 3300046460 Bacteria 2902
594 Ga0495638_0065953 3300046460 Bacteria 2226
595 Ga0495638_0077439 3300046460 Bacteria 2024
596 Ga0495638_0078445 3300046460 Bacteria 2009
597 Ga0495638_0249677 3300046460 Bacteria 978
598 Ga0495650_0000531 3300046471 Bacteria 55413
599 Ga0495650_0039260 3300046471 Bacteria 2044
600 Ga0495605_0000551 3300046474 Bacteria 30680
601 Ga0495605_0001579 3300046474 Bacteria 14779
602 Ga0495605_0001765 3300046474 Bacteria 13878
603 Ga0495605_0004117 3300046474 Bacteria 8575
604 Ga0495605_0010517 3300046474 Bacteria 5176
605 Ga0495605_0076161 3300046474 Bacteria 1576
606 Ga0495639_0007550 3300046475 Bacteria 4671
607 Ga0495639_0249743 3300046475 Bacteria 877
608 Ga0495584_0000086 3300046491 Bacteria 64500
609 Ga0495584_0007969 3300046491 Bacteria 5505
610 Ga0495584_0012121 3300046491 Bacteria 4406
611 Ga0495584_0017233 3300046491 Bacteria 3681
612 Ga0495584_0224178 3300046491 Bacteria 955
613 Ga0495585_0001557 3300046492 Bacteria 17787
614 Ga0495585_0009499 3300046492 Bacteria 5829
615 Ga0495585_0072199 3300046492 Bacteria 1881
616 Ga0495607_0000747 3300046501 Bacteria 31132
617 Ga0495607_0001090 3300046501 Bacteria 24784
618 Ga0495607_0003073 3300046501 Bacteria 12974
619 Ga0495607_0009909 3300046501 Bacteria 6421
620 Ga0495607_0035678 3300046501 Bacteria 3006
621 Ga0495583_0000708 3300046506 Bacteria 42814
622 Ga0495583_0000982 3300046506 Bacteria 32675
623 Ga0495583_0082715 3300046506 Bacteria 1393
624 Ga0495583_0141801 3300046506 Bacteria 1000
625 Ga0495606_0197486 3300046507 Bacteria 1149
626 Ga0495606_0522893 3300046507 Unclassified 595
627 Ga0495610_0000306 3300046512 Bacteria 51770
628 Ga0495610_0000638 3300046512 Bacteria 34430
629 Ga0495610_0015531 3300046512 Bacteria 4420
630 Ga0495610_0122868 3300046512 Bacteria 1136
631 Ga0495610_0184185 3300046512 Bacteria 866
632 Ga0495616_0000281 3300046513 Bacteria 41179
633 Ga0495616_0001237 3300046513 Bacteria 17959
634 Ga0495616_0005083 3300046513 Bacteria 8180
635 Ga0495616_0007365 3300046513 Bacteria 6583
636 Ga0495616_0028885 3300046513 Bacteria 2932
637 Ga0495616_0079579 3300046513 Bacteria 1570
638 Ga0495618_0086391 3300046514 Bacteria 2006
639 Ga0495620_0060005 3300046515 Bacteria 1587
640 Ga0495620_0132975 3300046515 Bacteria 975
641 Ga0495630_0045714 3300046517 Bacteria 3272
642 Ga0495631_0000242 3300046518 Bacteria 37711
643 Ga0495631_0004732 3300046518 Bacteria 7191
644 Ga0495631_0005056 3300046518 Bacteria 6948
645 Ga0495631_0182346 3300046518 Bacteria 899
646 Ga0495632_0000166 3300046519 Bacteria 68543
647 Ga0495632_0004954 3300046519 Bacteria 8923
648 Ga0495632_0008738 3300046519 Bacteria 6176
649 Ga0495632_0013043 3300046519 Bacteria 4762
650 Ga0495632_0040763 3300046519 Bacteria 2336
651 Ga0495637_0000138 3300046520 Bacteria 55120
652 Ga0495637_0001577 3300046520 Bacteria 13234
653 Ga0495637_0002576 3300046520 Bacteria 9967
654 Ga0495637_0004154 3300046520 Bacteria 7534
655 Ga0495643_0002007 3300046522 Bacteria 16984
656 Ga0495643_0028069 3300046522 Bacteria 3158
657 Ga0495643_0077100 3300046522 Bacteria 1742
658 Ga0495644_0004518 3300046523 Bacteria 5467
659 Ga0495644_0219185 3300046523 Bacteria 735
660 Ga0495648_0000758 3300046524 Bacteria 34444
661 Ga0495648_0007082 3300046524 Bacteria 9029
662 Ga0495648_0030444 3300046524 Bacteria 3568
663 Ga0495648_0058557 3300046524 Bacteria 2303
664 Ga0495648_0082523 3300046524 Bacteria 1824
665 Ga0495648_0159990 3300046524 Bacteria 1165
666 Ga0495663_0085087 3300046525 Bacteria 1024
667 Ga0495642_0000016 3300046528 Bacteria 114282
668 Ga0495642_0006163 3300046528 Bacteria 4603
669 Ga0495642_0102078 3300046528 Bacteria 1221
670 Ga0495654_0010482 3300046530 Bacteria 5040
671 Ga0495654_0015115 3300046530 Bacteria 4102
672 Ga0495654_0054824 3300046530 Bacteria 1932
673 Ga0495654_0060406 3300046530 Bacteria 1822
674 Ga0495654_0071796 3300046530 Bacteria 1640
675 Ga0495654_0114819 3300046530 Bacteria 1225
676 Ga0495587_0043008 3300046536 Bacteria 2692
677 Ga0495598_0146856 3300046537 Bacteria 820
678 Ga0495609_0000072 3300046538 Bacteria 125273
679 Ga0495609_0000186 3300046538 Bacteria 62251
680 Ga0495609_0000319 3300046538 Bacteria 43061
681 Ga0495609_0004779 3300046538 Bacteria 7312
682 Ga0495609_0024806 3300046538 Bacteria 2749
683 Ga0495609_0056433 3300046538 Bacteria 1740
684 Ga0495621_0004761 3300046539 Bacteria 3849
685 Ga0495597_0015611 3300046542 Bacteria 3593
686 Ga0495597_0073252 3300046542 Bacteria 1472
687 Ga0495597_0148182 3300046542 Bacteria 964
688 Ga0495597_0179086 3300046542 Bacteria 857
689 Ga0495622_0000516 3300046557 Bacteria 23599
690 Ga0495622_0004427 3300046557 Bacteria 6524
691 Ga0495622_0022143 3300046557 Bacteria 2961
692 Ga0495622_0040433 3300046557 Bacteria 2170
693 Ga0495633_0196555 3300046558 Bacteria 926
694 Ga0495633_0267223 3300046558 Bacteria 779
695 Ga0495667_0316718 3300046559 Unclassified 987
696 Ga0495656_0086891 3300046615 Bacteria 1423
697 Ga0495668_0009126 3300046616 Bacteria 6115
698 Ga0495668_0025995 3300046616 Bacteria 3324
699 Ga0495668_0189293 3300046616 Bacteria 1127
700 Ga0495611_0005135 3300046648 Bacteria 5611
701 Ga0495611_0006017 3300046648 Bacteria 5176
702 Ga0495611_0040807 3300046648 Bacteria 2069
703 Ga0495625_0000056 3300046660 Bacteria 186024
704 Ga0495625_0000718 3300046660 Bacteria 46602
705 Ga0495625_0001903 3300046660 Bacteria 23588
706 Ga0495625_0010231 3300046660 Bacteria 7779
707 Ga0495625_0017472 3300046660 Bacteria 5617
708 Ga0495625_0023716 3300046660 Bacteria 4683
709 Ga0495625_0096571 3300046660 Bacteria 2035
710 Ga0495625_0160130 3300046660 Bacteria 1508
711 Ga0495625_0261943 3300046660 Bacteria 1118
712 Ga0495625_0281433 3300046660 Unclassified 1070
713 Ga0495659_0000823 3300046664 Bacteria 11031
714 Ga0495659_0002449 3300046664 Bacteria 5988
715 Ga0495659_0010990 3300046664 Bacteria 2916
716 Ga0495661_0000914 3300046665 Bacteria 27086
717 Ga0495661_0019746 3300046665 Bacteria 4411
718 Ga0495661_0054705 3300046665 Bacteria 2395
719 Ga0495661_0176764 3300046665 Bacteria 1134
720 Ga0495661_0180352 3300046665 Bacteria 1120
721 Ga0495661_0182034 3300046665 Bacteria 1113
722 Ga0495661_0191544 3300046665 Bacteria 1076
723 Ga0495661_0273566 3300046665 Bacteria 854
724 Ga0495588_0004546 3300046674 Bacteria 6133
725 Ga0495588_0008467 3300046674 Bacteria 4724
726 Ga0495588_0011119 3300046674 Bacteria 4214
727 Ga0495588_0100156 3300046674 Bacteria 1522
728 Ga0495588_0236984 3300046674 Bacteria 962
729 Ga0495623_0389317 3300046679 Bacteria 752
730 Ga0495658_0002773 3300046683 Bacteria 8793
731 Ga0495658_0195514 3300046683 Bacteria 1259
732 Ga0495669_0002831 3300046684 Bacteria 7120
733 Ga0495669_0142317 3300046684 Unclassified 1132
734 Ga0495669_0245696 3300046684 Bacteria 859
735 Ga0495670_0000171 3300046691 Bacteria 28803
736 Ga0495670_0054312 3300046691 Bacteria 2006
737 Ga0495670_0081649 3300046691 Bacteria 1647
738 Ga0495670_0283702 3300046691 Bacteria 886
739 Ga0495670_0347943 3300046691 Bacteria 797
740 Ga0495671_0000138 3300046692 Bacteria 64535
741 Ga0495671_0002242 3300046692 Bacteria 12287
742 Ga0495671_0005515 3300046692 Bacteria 7401
743 Ga0495671_0012417 3300046692 Bacteria 4653
744 Ga0495671_0051767 3300046692 Bacteria 2042
745 Ga0495671_0058017 3300046692 Bacteria 1915
746 Ga0495671_0240173 3300046692 Bacteria 875
747 Ga0495649_0012557 3300046694 Bacteria 4920
748 Ga0495649_0030917 3300046694 Bacteria 2955
749 Ga0495649_0158504 3300046694 Bacteria 1187
750 Ga0495649_0295799 3300046694 Bacteria 825
751 Ga0495589_0000045 3300046794 Bacteria 123922
752 Ga0495589_0000282 3300046794 Bacteria 41422
753 Ga0495589_0003117 3300046794 Bacteria 9071
754 Ga0495600_0193891 3300046809 Bacteria 1306
755 Ga0495660_0002784 3300046810 Bacteria 11024
756 Ga0495604_0402876 3300047317 Bacteria 901
757 Ga0495636_0000276 3300047318 Bacteria 20170
758 Ga0495636_0008252 3300047318 Bacteria 4111
759 Ga0495672_0000312 3300047320 Bacteria 64934
760 Ga0495672_0000357 3300047320 Bacteria 58589
761 Ga0495672_0026485 3300047320 Bacteria 3700
762 Ga0495676_0023524 3300047321 Bacteria 5347
763 Ga0495680_0017133 3300047322 Bacteria 6199
764 Ga0495680_0105538 3300047322 Bacteria 2095
765 Ga0495680_0155626 3300047322 Bacteria 1663
766 Ga0495683_0005825 3300047323 Bacteria 6781
767 Ga0495683_0067043 3300047323 Bacteria 1767
768 Ga0495683_0082837 3300047323 Bacteria 1562
769 Ga0495687_000050 3300047443 Bacteria 200856
770 Ga0495687_000538 3300047443 Bacteria 45144
771 Ga0495687_000622 3300047443 Bacteria 40986
772 Ga0495687_001285 3300047443 Bacteria 23621
773 Ga0495687_072901 3300047443 Bacteria 1370
774 Ga0495675_0000123 3300047444 Bacteria 55312
775 Ga0495677_0000111 3300047445 Bacteria 40961
776 Ga0495677_0000135 3300047445 Bacteria 35127
777 Ga0495677_0000306 3300047445 Bacteria 21272
778 Ga0495677_0041519 3300047445 Bacteria 1683
779 Ga0495677_0265775 3300047445 Bacteria 672
780 Ga0495679_010958 3300047446 Bacteria 3528
781 Ga0495685_000137 3300047447 Bacteria 25064
782 Ga0495685_005785 3300047447 Bacteria 4039
783 Ga0495673_0000138 3300047469 Bacteria 130703
784 Ga0495673_0000354 3300047469 Bacteria 57082
785 Ga0495673_0010358 3300047469 Bacteria 5076
786 Ga0495673_0016053 3300047469 Bacteria 3840
787 Ga0495673_0061433 3300047469 Bacteria 1608
788 Ga0495681_0000195 3300047470 Bacteria 51032
789 Ga0495681_0003860 3300047470 Bacteria 10362
790 Ga0495681_0021183 3300047470 Bacteria 3507
791 Ga0495681_0027946 3300047470 Bacteria 2911
792 Ga0495681_0078561 3300047470 Bacteria 1478
793 Ga0495686_0007048 3300047472 Bacteria 8480
794 Ga0495686_0106765 3300047472 Bacteria 1683
795 Ga0495686_0113577 3300047472 Bacteria 1622
796 Ga0495686_0123045 3300047472 Bacteria 1544
797 Ga0495686_0188213 3300047472 Bacteria 1191
798 Ga0495593_0010956 3300047673 Bacteria 5222
799 Ga0495593_0011378 3300047673 Bacteria 5111
800 Ga0495614_0007845 3300048089 Bacteria 4745
801 Ga0495626_0000419 3300048091 Bacteria 43563
802 Ga0495626_0006306 3300048091 Bacteria 6765
803 Ga0495626_0024118 3300048091 Bacteria 2984
804 Ga0496100_0017439 3300048903 Bacteria 4238
805 Ga0496100_0207754 3300048903 Bacteria 1431
806 Ga0496101_0003286 3300048904 Bacteria 10053
807 Ga0496101_0386344 3300048904 Bacteria 1101
808 Ga0496102_0007804 3300048905 Bacteria 9149
809 Ga0496102_0071315 3300048905 Bacteria 3190
810 Ga0496102_0354338 3300048905 Unclassified 1382
811 Ga0496103_0071738 3300048906 Bacteria 2168
812 Ga0496104_0015096 3300048907 Bacteria 6990
813 Ga0496104_0177785 3300048907 Bacteria 2038
814 Ga0496104_0259168 3300048907 Bacteria 1652
815 Ga0496105_0007115 3300048908 Bacteria 8632
816 Ga0496105_0213036 3300048908 Bacteria 1574
817 Ga0496106_0015648 3300048909 Bacteria 5611
818 Ga0496107_0024141 3300048910 Bacteria 4300
819 Ga0496107_0543935 3300048910 Bacteria 860
820 Ga0496108_0014037 3300048911 Bacteria 6535
821 Ga0496108_0068863 3300048911 Bacteria 2986
822 Ga0496108_0486924 3300048911 Bacteria 1077
823 Ga0496109_0017981 3300048912 Bacteria 6206
824 Ga0496110_0005924 3300048913 Bacteria 9619
825 Ga0496110_0140364 3300048913 Bacteria 2184
826 Ga0496110_0327469 3300048913 Bacteria 1395
827 Ga0496111_0038181 3300048914 Bacteria 3440
828 Ga0496111_0183508 3300048914 Bacteria 1555
829 Ga0496112_0355190 3300048915 Bacteria 1408
830 Ga0496113_0328794 3300048916 Bacteria 1226
831 Ga0496114_0006664 3300048917 Bacteria 9100
832 Ga0496114_0028641 3300048917 Bacteria 4572
833 Ga0496116_0017188 3300048919 Bacteria 5627
834 Ga0496116_0036642 3300048919 Bacteria 3429
835 Ga0496116_0144503 3300048919 Bacteria 1332
836 Ga0496117_0000237 3300048920 Bacteria 104534
837 Ga0496117_0002997 3300048920 Bacteria 20327
838 Ga0496117_0073041 3300048920 Bacteria 2290
839 Ga0496117_0181909 3300048920 Bacteria 1207
840 Ga0496117_0223416 3300048920 Bacteria 1046
841 Ga0496118_0000280 3300048921 Bacteria 89951
842 Ga0496118_0002137 3300048921 Bacteria 27581
843 Ga0496118_0030679 3300048921 Bacteria 4478
844 Ga0496118_0068011 3300048921 Bacteria 2589
845 Ga0496118_0113460 3300048921 Bacteria 1790
846 Ga0496118_0120580 3300048921 Bacteria 1711
847 Ga0496118_0203001 3300048921 Bacteria 1172
848 Ga0496119_0000107 3300048922 Bacteria 116784
849 Ga0496119_0076860 3300048922 Bacteria 1936
850 Ga0496120_0000011 3300048923 Bacteria 365549
851 Ga0496120_0007054 3300048923 Bacteria 8439
852 Ga0496121_0000159 3300048924 Bacteria 147049
853 Ga0496121_0000313 3300048924 Bacteria 100952
854 Ga0496121_0006818 3300048924 Bacteria 13984
855 Ga0496121_0009067 3300048924 Bacteria 11522
856 Ga0496121_0011908 3300048924 Bacteria 9573
857 Ga0496121_0075887 3300048924 Bacteria 2683
858 Ga0496121_0113847 3300048924 Bacteria 2057
859 Ga0496121_0201409 3300048924 Bacteria 1418
860 Ga0496121_0358330 3300048924 Bacteria 969
861 Ga0496122_0000137 3300048925 Bacteria 170016
862 Ga0496122_0002198 3300048925 Bacteria 28484
863 Ga0496122_0014590 3300048925 Bacteria 7585
864 Ga0496122_0031976 3300048925 Bacteria 4362
865 Ga0496122_0070087 3300048925 Bacteria 2507
866 Ga0496122_0082993 3300048925 Bacteria 2224
867 Ga0496122_0094941 3300048925 Bacteria 2017
868 Ga0496123_0000022 3300048926 Bacteria 361832
869 Ga0496123_0000314 3300048926 Bacteria 92927
870 Ga0496123_0006452 3300048926 Bacteria 11355
871 Ga0496123_0011999 3300048926 Bacteria 7432
872 Ga0496123_0024975 3300048926 Bacteria 4520
873 Ga0496123_0035309 3300048926 Bacteria 3564
874 Ga0496123_0149149 3300048926 Bacteria 1265
875 Ga0496123_0232325 3300048926 Bacteria 922
876 Ga0496124_0009311 3300048927 Bacteria 10124
877 Ga0496124_0019956 3300048927 Bacteria 6215
878 Ga0496124_0031748 3300048927 Bacteria 4672
879 Ga0496124_0061504 3300048927 Bacteria 3147
880 Ga0496124_0275523 3300048927 Bacteria 1229
881 Ga0496124_0316751 3300048927 Bacteria 1119
882 Ga0496125_0000005 3300048928 Bacteria 827598
883 Ga0496125_0001361 3300048928 Bacteria 36000
884 Ga0496125_0005506 3300048928 Bacteria 14036
885 Ga0496125_0007561 3300048928 Bacteria 11538
886 Ga0496125_0008142 3300048928 Bacteria 11037
887 Ga0496125_0068383 3300048928 Bacteria 2795
888 Ga0496125_0201736 3300048928 Bacteria 1301
889 Ga0496125_0301838 3300048928 Bacteria 980
890 Ga0496126_0003367 3300048929 Bacteria 20272
891 Ga0496126_0014664 3300048929 Bacteria 7912
892 Ga0496126_0030841 3300048929 Bacteria 5075
893 Ga0496126_0110468 3300048929 Bacteria 2395
894 Ga0496126_0165925 3300048929 Bacteria 1885
895 Ga0496126_0200925 3300048929 Bacteria 1683
896 Ga0496126_0364906 3300048929 Bacteria 1179
897 Ga0496126_0440425 3300048929 Bacteria 1050
898 Ga0495678_103588 3300049459 Bacteria 983
899 Ga0495682_0000057 3300049460 Bacteria 102695
900 Ga0495682_0000150 3300049460 Bacteria 59591
901 Ga0495682_0002187 3300049460 Bacteria 9464
902 Ga0495682_0050060 3300049460 Bacteria 1521
903 Ga0501292_015697 3300049515 Bacteria 1186
904 Ga0501031_0200272 3300049568 Bacteria 1303
905 Ga0501031_0486151 3300049568 Bacteria 796
906 Ga0501032_0001083 3300049569 Bacteria 21774
907 Ga0501032_0074944 3300049569 Bacteria 2254
908 Ga0501032_0126711 3300049569 Bacteria 1686
909 Ga0501033_0007007 3300049570 Bacteria 8800
910 Ga0501033_0033057 3300049570 Bacteria 3884
911 Ga0501033_0054336 3300049570 Bacteria 2963
912 Ga0501033_0125314 3300049570 Bacteria 1863
913 Ga0501033_0560450 3300049570 Bacteria 786
914 Ga0501034_0023042 3300049571 Bacteria 6345
915 Ga0501034_0106313 3300049571 Bacteria 2799
916 Ga0501036_0001511 3300049572 Bacteria 17940
917 Ga0501036_0057761 3300049572 Bacteria 3287
918 Ga0501037_0117943 3300049573 Bacteria 1910
919 Ga0501037_0537767 3300049573 Bacteria 790
920 Ga0501038_0002514 3300049574 Bacteria 17083
921 Ga0501038_0105098 3300049574 Bacteria 2346
922 Ga0501039_0019851 3300049575 Bacteria 5151
923 Ga0501039_0108305 3300049575 Bacteria 2172
924 Ga0501039_0770585 3300049575 Bacteria 751
925 Ga0501042_0210718 3300049578 Bacteria 1402
926 Ga0501043_0017574 3300049579 Bacteria 5607
927 Ga0501043_0081669 3300049579 Bacteria 2540
928 Ga0501043_0360780 3300049579 Bacteria 1103
929 Ga0501046_0002922 3300049580 Bacteria 15807
930 Ga0501046_0163552 3300049580 Bacteria 1673
931 Ga0501047_0053686 3300049581 Bacteria 3897
932 Ga0501047_0127817 3300049581 Bacteria 2421
933 Ga0501047_0153961 3300049581 Bacteria 2173
934 Ga0501047_0473360 3300049581 Bacteria 1081
935 Ga0501048_0033726 3300049582 Bacteria 3697
936 Ga0501067_0007502 3300049583 Bacteria 6060
937 Ga0501067_0126497 3300049583 Bacteria 1422
938 Ga0501068_0026008 3300049584 Bacteria 3445
939 Ga0501069_0000699 3300049585 Bacteria 15622
940 Ga0501070_0015536 3300049586 Bacteria 6403
941 Ga0501070_0160074 3300049586 Bacteria 1856
942 Ga0501072_0359312 3300049588 Bacteria 1156
943 Ga0501072_1042017 3300049588 Bacteria 637
944 Ga0501073_0006072 3300049589 Bacteria 9010
945 Ga0501073_0025165 3300049589 Bacteria 4271
946 Ga0501074_0001430 3300049590 Bacteria 15941
947 Ga0501074_0272193 3300049590 Bacteria 1204
948 Ga0501077_0224463 3300049593 Bacteria 1194
949 Ga0501079_0525770 3300049741 Bacteria 930
950 Ga0501080_0001937 3300049742 Bacteria 17876
951 Ga0501080_0025505 3300049742 Bacteria 5487
952 Ga0501080_0260589 3300049742 Bacteria 1580
953 Ga0501081_0699858 3300049743 Bacteria 761
954 Ga0501083_0002912 3300049744 Bacteria 11857
955 Ga0501083_0059671 3300049744 Bacteria 2551
956 Ga0501265_023190 3300049762 Bacteria 853
957 Ga0501266_000054 3300049763 Bacteria 18170
958 Ga0501035_0010721 3300049822 Bacteria 8485
959 Ga0501035_0015990 3300049822 Bacteria 6925
960 Ga0501035_0242035 3300049822 Bacteria 1534
961 Ga0501035_0343841 3300049822 Bacteria 1249
962 Ga0501035_0388426 3300049822 Bacteria 1163
963 Ga0501044_0003491 3300049823 Bacteria 17698
964 Ga0501044_0018003 3300049823 Bacteria 7574
965 Ga0501044_0036069 3300049823 Bacteria 5175
966 Ga0501044_0044768 3300049823 Bacteria 4590
967 Ga0501044_0103215 3300049823 Bacteria 2866
968 Ga0501044_0360559 3300049823 Bacteria 1372
969 nmdc:mga03683_1809_c1 3300050489 Bacteria 6485
970 nmdc:mga03683_67614_c1 3300050489 Bacteria 1521
971 nmdc:mga03683_9357_c1 3300050489 Bacteria 3480
972 nmdc:mga03n38_11169_c1 3300050490 Bacteria 3337
973 nmdc:mga03n38_38252_c1 3300050490 Bacteria 2074
974 nmdc:mga0yw44_192791_c1 3300050492 Bacteria 1344
975 nmdc:mga0yw44_507445_c1 3300050492 Bacteria 818
976 nmdc:mga0k408_109735_c1 3300050493 Bacteria 1631
977 nmdc:mga0k408_120711_c1 3300050493 Bacteria 1552
978 nmdc:mga0k408_18454_c1 3300050493 Bacteria 3895
979 nmdc:mga0k408_23802_c1 3300050493 Bacteria 3459
980 nmdc:mga0k408_35539_c1 3300050493 Bacteria 1814
981 nmdc:mga0k408_416683_c1 3300050493 Bacteria 799
982 nmdc:mga0k408_76875_c1 3300050493 Bacteria 1952
983 nmdc:mga06z11_307568_c1 3300050494 Bacteria 943
984 nmdc:mga06z11_77995_c1 3300050494 Bacteria 1770
985 nmdc:mga04h51_66560_c1 3300050495 Bacteria 1248
986 nmdc:mga07m45_12949_c1 3300050496 Bacteria 4414
987 nmdc:mga07m45_130141_c1 3300050496 Bacteria 1456
988 nmdc:mga07m45_13252_c1 3300050496 Bacteria 4370
989 nmdc:mga07m45_20630_c1 3300050496 Bacteria 3581
990 nmdc:mga07m45_21476_c1 3300050496 Bacteria 3516
991 nmdc:mga07m45_23144_c1 3300050496 Bacteria 3394
992 nmdc:mga07m45_24181_c1 3300050496 Bacteria 3326
993 nmdc:mga07m45_273212_c1 3300050496 Bacteria 983
994 nmdc:mga07m45_432249_c1 3300050496 Bacteria 764
995 nmdc:mga05p37_241795_c1 3300050507 Bacteria 2170
996 nmdc:mga09592_434381_c1 3300050508 Bacteria 1133
997 nmdc:mga06r32_349326_c1 3300050510 Bacteria 1463
998 nmdc:mga08y16_26_c1 3300050511 Bacteria 223965
999 nmdc:mga08y16_545867_c1 3300050511 Bacteria 1173
1000 nmdc:mga0sz30_25497_c1 3300050516 Bacteria 2417
1001 Ga0500610_0000357 3300053079 Bacteria 13812
1002 Ga0495655_0113866 3300053083 Bacteria 816
1003 Ga0500643_008621 3300053087 Bacteria 3992
1004 Ga0500643_083135 3300053087 Bacteria 878
1005 Ga0500644_0017141 3300053088 Bacteria 2097
1006 Ga0500644_0071631 3300053088 Bacteria 1250
1007 Ga0500644_0096275 3300053088 Bacteria 1117
1008 Ga0500581_018544 3300053089 Bacteria 3503
1009 Ga0500646_0013403 3300053090 Bacteria 2121
1010 Ga0500647_0143965 3300053091 Bacteria 1116
1011 Ga0500651_0000063 3300053093 Bacteria 70772
1012 Ga0500651_0000517 3300053093 Bacteria 19898
1013 Ga0500651_0013292 3300053093 Bacteria 5013
1014 Ga0500566_0000689 3300053094 Bacteria 19009
1015 Ga0500566_0001144 3300053094 Bacteria 15405
1016 Ga0500566_0016607 3300053094 Bacteria 4321
1017 Ga0500566_0140632 3300053094 Bacteria 1281
1018 Ga0500641_0005940 3300053096 Bacteria 4324
1019 Ga0500641_0008971 3300053096 Bacteria 3584
1020 Ga0500641_0061765 3300053096 Bacteria 1561
1021 Ga0500650_0053857 3300053098 Bacteria 1872
1022 Ga0500555_015335 3300053103 Bacteria 2210
1023 Ga0500555_071813 3300053103 Bacteria 913
1024 Ga0500556_0000015 3300053104 Bacteria 202598
1025 Ga0500557_000020 3300053105 Bacteria 91933
1026 Ga0500562_009386 3300053108 Bacteria 2475
1027 Ga0500571_000022 3300053110 Bacteria 56973
1028 Ga0500593_000228 3300053117 Bacteria 23190
1029 Ga0500593_084365 3300053117 Bacteria 1355
1030 Ga0500594_0009959 3300053118 Bacteria 2197
1031 Ga0500595_000931 3300053119 Bacteria 16565
1032 Ga0500607_003093 3300053121 Bacteria 12498
1033 Ga0500607_021201 3300053121 Bacteria 3664
1034 Ga0500607_060974 3300053121 Bacteria 1976
1035 Ga0500608_002235 3300053122 Bacteria 6992
1036 Ga0500608_007502 3300053122 Bacteria 4520
1037 Ga0500608_077610 3300053122 Bacteria 1572
1038 Ga0500614_019107 3300053123 Bacteria 1566
1039 Ga0500618_003999 3300053125 Bacteria 4862
1040 Ga0500618_017814 3300053125 Bacteria 1763
1041 Ga0500618_042342 3300053125 Bacteria 1043
1042 Ga0500626_014123 3300053128 Bacteria 3454
1043 Ga0500642_0000019 3300053130 Bacteria 159944
1044 Ga0500642_0000057 3300053130 Bacteria 67011
1045 Ga0500642_0000414 3300053130 Bacteria 13963
1046 Ga0500652_000710 3300053131 Bacteria 11310
1047 Ga0500658_0000125 3300053134 Bacteria 36384
1048 Ga0500658_0000804 3300053134 Bacteria 12998
1049 Ga0500658_0184649 3300053134 Bacteria 950
1050 Ga0500559_0001410 3300053136 Bacteria 13642
1051 Ga0500559_0004516 3300053136 Bacteria 6582
1052 Ga0500559_0013619 3300053136 Bacteria 3442
1053 Ga0500559_0141020 3300053136 Bacteria 1128
1054 Ga0500561_0033666 3300053137 Bacteria 1311
1055 Ga0500564_013358 3300053138 Bacteria 3674
1056 Ga0500568_0001840 3300053139 Bacteria 13074
1057 Ga0500568_0004520 3300053139 Bacteria 7413
1058 Ga0500568_0084708 3300053139 Bacteria 1200
1059 Ga0500574_000185 3300053141 Bacteria 7291
1060 Ga0500577_0083842 3300053142 Bacteria 1276
1061 Ga0500577_0103967 3300053142 Bacteria 1165
1062 Ga0500577_0262348 3300053142 Bacteria 751
1063 Ga0500588_0072342 3300053146 Bacteria 1134
1064 Ga0500589_001817 3300053147 Bacteria 6711
1065 Ga0500589_240926 3300053147 Bacteria 669
1066 Ga0500590_012511 3300053148 Bacteria 4327
1067 Ga0500590_199967 3300053148 Bacteria 847
1068 Ga0500604_0023917 3300053151 Bacteria 1745
1069 Ga0500604_0095012 3300053151 Bacteria 977
1070 Ga0500604_0150525 3300053151 Bacteria 790
1071 Ga0500616_0000041 3300053153 Bacteria 359328
1072 Ga0500616_0000997 3300053153 Bacteria 30619
1073 Ga0500616_0071225 3300053153 Bacteria 1771
1074 Ga0500616_0087061 3300053153 Bacteria 1556
1075 Ga0500619_023270 3300053154 Bacteria 1808
1076 Ga0500622_0000586 3300053156 Bacteria 33061
1077 Ga0500622_0005571 3300053156 Bacteria 7518
1078 Ga0500622_0093100 3300053156 Bacteria 1493
1079 Ga0500622_0112652 3300053156 Bacteria 1328
1080 Ga0500627_0001017 3300053158 Bacteria 7642
1081 Ga0500627_0146239 3300053158 Bacteria 1067
1082 Ga0500633_0058392 3300053160 Bacteria 1351
1083 Ga0500634_0011762 3300053161 Bacteria 4530
1084 Ga0500634_0012245 3300053161 Bacteria 4462
1085 Ga0500634_0037133 3300053161 Bacteria 2651
1086 Ga0500638_000424 3300053162 Bacteria 10110
1087 Ga0500638_255907 3300053162 Bacteria 701
1088 Ga0500636_0000173 3300053177 Bacteria 34092
1089 Ga0500636_0029967 3300053177 Bacteria 3216
1090 Ga0500636_0346786 3300053177 Bacteria 710
1091 Ga0500625_096378 3300053729 Bacteria 1252
1092 Ga0500609_004995 3300053731 Bacteria 1815
1093 Ga0500601_000125 3300053737 Bacteria 15831
1094 Ga0501084_0027930 3300054114 Bacteria 4715
1095 Ga0501084_0052633 3300054114 Bacteria 3406
1096 Ga0500661_021286 3300055283 Bacteria 1152
1097 Ga0590071_028360 3300059421 Bacteria 1330
1098 Ga0501082_0021724 3300060353 Bacteria 5532
1099 Ga0501082_0089709 3300060353 Bacteria 2654
1100 Ga0530510_0507035 3300061734 Bacteria 915

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041456 Ga0451795_1577188 Ga0451795_1577188_10_504 163
2 3300006195 Ga0075366_10003598 Ga0075366_100035988 177
3 3300050493 nmdc:mga0k408_23802_c1 nmdc:mga0k408_23802_c1_1952_2530 177
4 3300014497 Ga0182008_10424475 Ga0182008_104244751 178
5 3300046507 Ga0495606_0522893 Ga0495606_0522893_14_556 179
6 3300005327 Ga0070658_10089717 Ga0070658_100897172 186
7 3300005337 Ga0070682_100067873 Ga0070682_1000678732 186
8 3300005455 Ga0070663_100271830 Ga0070663_1002718302 186
9 3300025919 Ga0207657_10037373 Ga0207657_100373733 186
10 3300048907 Ga0496104_0259168 Ga0496104_0259168_148_765 186
11 iso_pu_bacteria 2874628541 2874635162 187
12 iso_pu_bacteria 2883577096 2883581384 187
13 iso_pu_bacteria 2508501042 2508692549 188
14 iso_pu_bacteria 2513237161 2514009567 188
15 iso_pu_bacteria 2517093001 2517104018 188
16 iso_pu_bacteria 2547132374 2548498503 188
17 iso_pu_bacteria 2599185214 2599627604 188
18 iso_pu_bacteria 2599185226 2599677174 188
19 iso_pu_bacteria 2599185227 2599685345 188
20 iso_pu_bacteria 2599185229 2599697094 188
21 iso_pu_bacteria 2599185292 2599907523 188
22 iso_pu_bacteria 2617270735 2617346664 188
23 iso_pu_bacteria 2643221570 2643867336 188
24 iso_pu_bacteria 2643221596 2643992024 188
25 iso_pu_bacteria 2643221609 2644061712 188
26 iso_pu_bacteria 2643221611 2644070453 188
27 iso_pu_bacteria 2643221628 2644158767 188
28 iso_pu_bacteria 2643221652 2644295746 188
29 iso_pu_bacteria 2643221658 2644325795 188
30 iso_pu_bacteria 2643221672 2644399662 188
31 iso_pu_bacteria 2643221717 2644646307 188
32 iso_pu_bacteria 2721755755 2723842854 188
33 iso_pu_bacteria 2738541277 2738722563 188
34 iso_pu_bacteria 2738543019 2739283134 188
35 iso_pu_bacteria 2791355196 2793064482 188
36 iso_pu_bacteria 2818991446 2819600853 188
37 iso_pu_bacteria 2824773399 2824777415 188
38 iso_pu_bacteria 2831265667 2831267559 188
39 iso_pu_bacteria 2838054893 2838056050 188
40 iso_pu_bacteria 2838054893 2838061312 188
41 iso_pu_bacteria 2838122688 2838128928 188
42 iso_pu_bacteria 2841966195 2841972179 188
43 iso_pu_bacteria 2841983080 2841986303 188
44 iso_pu_bacteria 2842038055 2842040521 188
45 iso_pu_bacteria 2842045827 2842046533 188
46 iso_pu_bacteria 2855730933 2855736474 188
47 iso_pu_bacteria 2855767633 2855773411 188
48 iso_pu_bacteria 2857537821 2857540102 188
49 iso_pu_bacteria 2874612657 2874614710 188
50 iso_pu_bacteria 2874620515 2874622217 188
51 iso_pu_bacteria 2881412998 2881418633 188
52 iso_pu_bacteria 2885192300 2885197082 188
53 iso_pu_bacteria 2899924645 2899931597 188
54 iso_pu_bacteria 2904449895 2904453839 188
55 iso_pu_bacteria 2904456579 2904462314 188
56 iso_pu_bacteria 2904666416 2904667829 188
57 iso_pu_bacteria 2928037797 2928042978 188
58 iso_pu_bacteria 2928044640 2928050363 188
59 iso_pu_bacteria 2928051484 2928056606 188
60 iso_pu_bacteria 2928064002 2928068933 188
61 iso_pu_bacteria 2928084124 2928088783 188
62 iso_pu_bacteria 2928115317 2928117535 188
63 iso_pu_bacteria 2929520902 2929525039 188
64 iso_pu_bacteria 2935648319 2935654248 188
65 iso_pu_bacteria 2935656913 2935663059 188
66 iso_pu_bacteria 2935984226 2935986608 188
67 iso_pu_bacteria 2936011229 2936017215 188
68 iso_pu_bacteria 2936019824 2936025717 188
69 iso_pu_bacteria 2936028420 2936034628 188
70 iso_pu_bacteria 2936046547 2936052685 188
71 iso_pu_bacteria 2941479691 2941483002 188
72 iso_pu_bacteria 2945945610 2945948672 188
73 iso_pu_bacteria 2945972063 2945972545 188
74 3300005347 Ga0070668_100557237 Ga0070668_1005572372 189
75 3300005543 Ga0070672_100148520 Ga0070672_1001485203 189
76 3300013102 Ga0157371_10037776 Ga0157371_100377762 189
77 3300013308 Ga0157375_10161067 Ga0157375_101610673 189
78 3300048929 Ga0496126_0165925 Ga0496126_0165925_672_1241 189
79 iso_pu_bacteria 2511231004 2511257825 189
80 iso_pu_bacteria 2511231007 2511274665 189
81 iso_pu_bacteria 2511231016 2511328671 189
82 iso_pu_bacteria 2513237139 2513878183 189
83 iso_pu_bacteria 2515154123 2515689200 189
84 iso_pu_bacteria 2582581314 2585320614 189
85 iso_pu_bacteria 2599185305 2599958575 189
86 iso_pu_bacteria 2599185318 2600038742 189
87 iso_pu_bacteria 2643221623 2644133709 189
88 iso_pu_bacteria 2675903515 2678263272 189
89 iso_pu_bacteria 2738541317 2738944740 189
90 iso_pu_bacteria 2744054620 2745009603 189
91 iso_pu_bacteria 2775507049 2776910820 189
92 iso_pu_bacteria 2802429603 2805919188 189
93 iso_pu_bacteria 2824671348 2824675912 189
94 iso_pu_bacteria 2824687955 2824692107 189
95 iso_pu_bacteria 2824696289 2824700462 189
96 iso_pu_bacteria 2841941048 2841944918 189
97 iso_pu_bacteria 2841949485 2841953349 189
98 iso_pu_bacteria 2841974524 2841978068 189
99 iso_pu_bacteria 2857524615 2857524698 189
100 iso_pu_bacteria 2858950400 2858952529 189
101 iso_pu_bacteria 2874604998 2874606479 189
102 iso_pu_bacteria 2876808645 2876813085 189
103 iso_pu_bacteria 2879110137 2879119201 189
104 iso_pu_bacteria 2885270888 2885275507 189
105 iso_pu_bacteria 2889033259 2889033820 189
106 iso_pu_bacteria 2893066018 2893069218 189
107 iso_pu_bacteria 2899803654 2899805120 189
108 iso_pu_bacteria 2900634093 2900642104 189
109 iso_pu_bacteria 2913036834 2913039003 189
110 iso_pu_bacteria 2913308742 2913309361 189
111 iso_pu_bacteria 2919073203 2919078582 189
112 iso_pu_bacteria 2919481497 2919483883 189
113 iso_pu_bacteria 2922361189 2922367240 189
114 iso_pu_bacteria 2931369376 2931370012 189
115 iso_pu_bacteria 2931396565 2931402054 189
116 iso_pu_bacteria 2933016740 2933022702 189
117 iso_pu_bacteria 3005483717 3005485803 189
118 iso_pu_bacteria 3005587118 3005588788 189
119 iso_pu_bacteria 3007419365 3007423625 189
120 iso_pu_bacteria 8005658619 8005661373 189
121 iso_pu_bacteria 8006964411 8006966168 189
122 iso_pu_bacteria 8021120328 8021127618 189
123 iso_pu_bacteria 8054558443 8054563673 189
124 iso_pu_bacteria 8054563764 8054564364 189
125 iso_pu_bacteria 8056143049 8056146817 189
126 iso_pu_bacteria 8056673599 8056675082 189
127 3300005337 Ga0070682_100418806 Ga0070682_1004188062 190
128 3300005347 Ga0070668_100287766 Ga0070668_1002877662 190
129 3300005347 Ga0070668_100759046 Ga0070668_1007590462 190
130 3300005719 Ga0068861_100138851 Ga0068861_1001388513 190
131 3300005842 Ga0068858_100843716 Ga0068858_1008437162 190
132 3300005843 Ga0068860_100550446 Ga0068860_1005504462 190
133 3300005844 Ga0068862_100079023 Ga0068862_1000790233 190
134 3300005937 Ga0081455_10438662 Ga0081455_104386622 190
135 3300009093 Ga0105240_10181781 Ga0105240_101817813 190
136 3300009094 Ga0111539_11705122 Ga0111539_117051222 190
137 3300009098 Ga0105245_10042336 Ga0105245_100423364 190
138 3300009101 Ga0105247_10062041 Ga0105247_100620412 190
139 3300009177 Ga0105248_10218363 Ga0105248_102183632 190
140 3300009545 Ga0105237_11438483 Ga0105237_114384831 190
141 3300009553 Ga0105249_10043409 Ga0105249_100434094 190
142 3300010375 Ga0105239_10203277 Ga0105239_102032772 190
143 3300013306 Ga0163162_11104727 Ga0163162_111047272 190
144 3300025297 Ga0209758_1000169 Ga0209758_100016936 190
145 3300025297 Ga0209758_1025357 Ga0209758_10253572 190
146 3300025298 Ga0209050_1017511 Ga0209050_10175112 190
147 3300025304 Ga0209257_1000640 Ga0209257_100064038 190
148 3300025916 Ga0207663_10661450 Ga0207663_106614501 190
149 3300025923 Ga0207681_10264730 Ga0207681_102647302 190
150 3300025925 Ga0207650_10294159 Ga0207650_102941592 190
151 3300025941 Ga0207711_10449388 Ga0207711_104493882 190
152 3300025961 Ga0207712_10321970 Ga0207712_103219702 190
153 3300025972 Ga0207668_11075075 Ga0207668_110750752 190
154 3300026035 Ga0207703_10043282 Ga0207703_100432824 190
155 3300026095 Ga0207676_10199040 Ga0207676_101990403 190
156 3300026118 Ga0207675_100184054 Ga0207675_1001840542 190
157 3300028380 Ga0268265_10007850 Ga0268265_100078507 190
158 3300028380 Ga0268265_10274687 Ga0268265_102746872 190
159 3300028786 Ga0307517_10227876 Ga0307517_102278761 190
160 3300031456 Ga0307513_10022346 Ga0307513_100223463 190
161 3300031616 Ga0307508_10140453 Ga0307508_101404531 190
162 3300031730 Ga0307516_10093460 Ga0307516_100934604 190
163 3300042001 Ga0439441_029475 Ga0439441_029475_214_789 190
164 3300042006 Ga0439432_065863 Ga0439432_065863_324_899 190
165 3300042011 Ga0439454_016883 Ga0439454_016883_388_963 190
166 3300042135 Ga0450899_006226 Ga0450899_006226_304_879 190
167 3300042137 Ga0450902_039672 Ga0450902_039672_36_611 190
168 3300042138 Ga0450903_007196 Ga0450903_007196_627_1202 190
169 3300042156 Ga0439446_0005658 Ga0439446_0005658_154_729 190
170 3300042185 Ga0450909_007879 Ga0450909_007879_254_829 190
171 3300042439 Ga0439464_0015028 Ga0439464_0015028_948_1523 190
172 3300046457 Ga0495590_0257338 Ga0495590_0257338_60_635 190
173 3300046460 Ga0495638_0077439 Ga0495638_0077439_1337_1912 190
174 3300047472 Ga0495686_0113577 Ga0495686_0113577_508_1083 190
175 3300047472 Ga0495686_0188213 Ga0495686_0188213_60_635 190
176 3300048903 Ga0496100_0207754 Ga0496100_0207754_480_1055 190
177 3300048905 Ga0496102_0071315 Ga0496102_0071315_1328_1903 190
178 3300048911 Ga0496108_0068863 Ga0496108_0068863_2273_2848 190
179 3300048913 Ga0496110_0327469 Ga0496110_0327469_376_951 190
180 3300048920 Ga0496117_0000237 Ga0496117_0000237_41375_41950 190
181 3300048921 Ga0496118_0000280 Ga0496118_0000280_34635_35210 190
182 3300048922 Ga0496119_0000107 Ga0496119_0000107_74078_74653 190
183 3300048923 Ga0496120_0000011 Ga0496120_0000011_42174_42749 190
184 3300049573 Ga0501037_0117943 Ga0501037_0117943_1196_1771 190
185 3300049574 Ga0501038_0105098 Ga0501038_0105098_1189_1764 190
186 3300049575 Ga0501039_0108305 Ga0501039_0108305_781_1356 190
187 3300049579 Ga0501043_0081669 Ga0501043_0081669_1146_1721 190
188 3300049580 Ga0501046_0163552 Ga0501046_0163552_526_1101 190
189 3300049581 Ga0501047_0153961 Ga0501047_0153961_771_1346 190
190 3300049581 Ga0501047_0473360 Ga0501047_0473360_432_1007 190
191 3300049584 Ga0501068_0026008 Ga0501068_0026008_2631_3206 190
192 3300049588 Ga0501072_0359312 Ga0501072_0359312_269_844 190
193 3300049589 Ga0501073_0025165 Ga0501073_0025165_2295_2870 190
194 3300049590 Ga0501074_0272193 Ga0501074_0272193_100_675 190
195 3300049593 Ga0501077_0224463 Ga0501077_0224463_446_1021 190
196 3300049741 Ga0501079_0525770 Ga0501079_0525770_46_621 190
197 3300049742 Ga0501080_0025505 Ga0501080_0025505_3853_4428 190
198 3300049744 Ga0501083_0059671 Ga0501083_0059671_1234_1809 190
199 3300049822 Ga0501035_0388426 Ga0501035_0388426_520_1095 190
200 3300049823 Ga0501044_0036069 Ga0501044_0036069_2084_2659 190
201 3300049823 Ga0501044_0103215 Ga0501044_0103215_132_707 190
202 3300049823 Ga0501044_0360559 Ga0501044_0360559_782_1357 190
203 3300050511 nmdc:mga08y16_545867_c1 nmdc:mga08y16_545867_c1_295_870 190
204 3300053093 Ga0500651_0013292 Ga0500651_0013292_809_1384 190
205 3300053094 Ga0500566_0140632 Ga0500566_0140632_435_1010 190
206 3300053096 Ga0500641_0005940 Ga0500641_0005940_1884_2459 190
207 3300053103 Ga0500555_015335 Ga0500555_015335_457_1032 190
208 3300053118 Ga0500594_0009959 Ga0500594_0009959_956_1531 190
209 3300053119 Ga0500595_000931 Ga0500595_000931_133_708 190
210 3300053130 Ga0500642_0000414 Ga0500642_0000414_11403_11978 190
211 3300053134 Ga0500658_0184649 Ga0500658_0184649_202_777 190
212 3300053139 Ga0500568_0004520 Ga0500568_0004520_2449_3024 190
213 3300053142 Ga0500577_0083842 Ga0500577_0083842_459_1034 190
214 3300053142 Ga0500577_0262348 Ga0500577_0262348_124_699 190
215 3300053151 Ga0500604_0023917 Ga0500604_0023917_76_651 190
216 3300053151 Ga0500604_0095012 Ga0500604_0095012_166_741 190
217 3300053153 Ga0500616_0000997 Ga0500616_0000997_6814_7389 190
218 3300053731 Ga0500609_004995 Ga0500609_004995_384_959 190
219 3300054114 Ga0501084_0052633 Ga0501084_0052633_1185_1760 190
220 3300060353 Ga0501082_0089709 Ga0501082_0089709_2056_2631 190
221 iso_pu_bacteria 2906626472 2906632319 190
222 3300001989 JGI24739J22299_10065880 JGI24739J22299_100658802 191
223 3300002774 JGI25150J39212_1014226 JGI25150J39212_10142262 191
224 3300003187 JGI25151J46595_10001862 JGI25151J46595_1000186212 191
225 3300003187 JGI25151J46595_10005013 JGI25151J46595_100050133 191
226 3300003187 JGI25151J46595_10008704 JGI25151J46595_100087042 191
227 3300003214 JGI25165J46597_1005063 JGI25165J46597_10050633 191
228 3300003215 JGI25153J46596_10000524 JGI25153J46596_1000052420 191
229 3300003215 JGI25153J46596_10001612 JGI25153J46596_100016128 191
230 3300003316 rootH1_10006469 rootH1_100064691 191
231 3300003323 rootH1_10032909 rootH1_100329094 191
232 3300003354 JGI25160J50197_1002408 JGI25160J50197_10024086 191
233 3300003354 JGI25160J50197_1017500 JGI25160J50197_10175002 191
234 3300003374 JGI25161J50226_1002478 JGI25161J50226_10024785 191
235 3300003578 Ga0006562J51391_1089446 Ga0006562J51391_10894465 191
236 3300003578 Ga0006562J51391_1089447 Ga0006562J51391_10894474 191
237 3300003761 Ga0055535_1000458 Ga0055535_10004584 191
238 3300003762 Ga0055542_1000029 Ga0055542_1000029184 191
239 3300003771 Ga0055526_1000642 Ga0055526_100064226 191
240 3300003771 Ga0055526_1045218 Ga0055526_10452182 191
241 3300003773 Ga0055537_1000013 Ga0055537_10000135 191
242 3300003773 Ga0055537_1019911 Ga0055537_10199112 191
243 3300003775 Ga0055524_1004416 Ga0055524_10044165 191
244 3300003781 Ga0055536_1001113 Ga0055536_10011135 191
245 3300003781 Ga0055536_1001817 Ga0055536_10018179 191
246 3300003781 Ga0055536_1002156 Ga0055536_10021564 191
247 3300003784 Ga0055534_1000008 Ga0055534_1000008195 191
248 3300003784 Ga0055534_1001246 Ga0055534_100124615 191
249 3300003790 Ga0055528_1004208 Ga0055528_10042085 191
250 3300003790 Ga0055528_1041222 Ga0055528_10412222 191
251 3300003791 Ga0055530_10000350 Ga0055530_1000035036 191
252 3300003792 Ga0055540_1000480 Ga0055540_100048020 191
253 3300003792 Ga0055540_1000596 Ga0055540_100059625 191
254 3300003792 Ga0055540_1001036 Ga0055540_10010368 191
255 3300003794 Ga0055531_10000034 Ga0055531_1000003410 191
256 3300003794 Ga0055531_10000794 Ga0055531_100007946 191
257 3300003794 Ga0055531_10003334 Ga0055531_1000333410 191
258 3300004625 Ga0055543_1000297 Ga0055543_100029733 191
259 3300005262 Ga0065165_1006954 Ga0065165_10069543 191
260 3300005262 Ga0065165_1009111 Ga0065165_10091113 191
261 3300005288 Ga0065714_10074419 Ga0065714_100744193 191
262 3300005288 Ga0065714_10207112 Ga0065714_102071121 191
263 3300005366 Ga0070659_100089411 Ga0070659_1000894112 191
264 3300005367 Ga0070667_100007828 Ga0070667_1000078284 191
265 3300005456 Ga0070678_100172746 Ga0070678_1001727462 191
266 3300005457 Ga0070662_100917269 Ga0070662_1009172691 191
267 3300005466 Ga0070685_10379590 Ga0070685_103795902 191
268 3300005539 Ga0068853_100161555 Ga0068853_1001615552 191
269 3300005548 Ga0070665_100029762 Ga0070665_1000297625 191
270 3300005548 Ga0070665_100637408 Ga0070665_1006374082 191
271 3300005548 Ga0070665_101010375 Ga0070665_1010103752 191
272 3300005563 Ga0068855_100012150 Ga0068855_1000121507 191
273 3300005577 Ga0068857_100190665 Ga0068857_1001906652 191
274 3300005577 Ga0068857_101095876 Ga0068857_1010958761 191
275 3300005614 Ga0068856_100420179 Ga0068856_1004201792 191
276 3300005616 Ga0068852_100036759 Ga0068852_1000367592 191
277 3300005834 Ga0068851_10011128 Ga0068851_100111284 191
278 3300005841 Ga0068863_100151684 Ga0068863_1001516842 191
279 3300005844 Ga0068862_100104809 Ga0068862_1001048093 191
280 3300005983 Ga0081540_1019975 Ga0081540_10199752 191
281 3300006042 Ga0075368_10083080 Ga0075368_100830801 191
282 3300006048 Ga0075363_100078457 Ga0075363_1000784573 191
283 3300006048 Ga0075363_100343408 Ga0075363_1003434082 191
284 3300006051 Ga0075364_10009966 Ga0075364_100099663 191
285 3300006051 Ga0075364_10069073 Ga0075364_100690733 191
286 3300006051 Ga0075364_10427925 Ga0075364_104279251 191
287 3300006058 Ga0075432_10023817 Ga0075432_100238172 191
288 3300006177 Ga0075362_10007473 Ga0075362_100074734 191
289 3300006177 Ga0075362_10022548 Ga0075362_100225482 191
290 3300006177 Ga0075362_10228658 Ga0075362_102286582 191
291 3300006178 Ga0075367_10007939 Ga0075367_100079396 191
292 3300006178 Ga0075367_10350269 Ga0075367_103502691 191
293 3300006186 Ga0075369_10130131 Ga0075369_101301312 191
294 3300006186 Ga0075369_10233287 Ga0075369_102332871 191
295 3300006195 Ga0075366_10013698 Ga0075366_100136983 191
296 3300006195 Ga0075366_10071240 Ga0075366_100712402 191
297 3300006195 Ga0075366_10090209 Ga0075366_100902092 191
298 3300006195 Ga0075366_10376457 Ga0075366_103764571 191
299 3300006353 Ga0075370_10004534 Ga0075370_100045348 191
300 3300006353 Ga0075370_10006518 Ga0075370_100065184 191
301 3300006353 Ga0075370_10008423 Ga0075370_100084235 191
302 3300006353 Ga0075370_10034794 Ga0075370_100347942 191
303 3300006353 Ga0075370_10046470 Ga0075370_100464702 191
304 3300006353 Ga0075370_10064178 Ga0075370_100641782 191
305 3300006353 Ga0075370_10147610 Ga0075370_101476101 191
306 3300006948 Ga0099826_10009909 Ga0099826_100099095 191
307 3300006948 Ga0099826_10076909 Ga0099826_100769092 191
308 3300009093 Ga0105240_10000593 Ga0105240_1000059320 191
309 3300009148 Ga0105243_10045708 Ga0105243_100457083 191
310 3300009148 Ga0105243_11021701 Ga0105243_110217011 191
311 3300009545 Ga0105237_10004597 Ga0105237_100045977 191
312 3300009551 Ga0105238_10898135 Ga0105238_108981352 191
313 3300011119 Ga0105246_10083663 Ga0105246_100836633 191
314 3300013100 Ga0157373_10013430 Ga0157373_100134308 191
315 3300013104 Ga0157370_10081525 Ga0157370_100815253 191
316 3300013105 Ga0157369_10006869 Ga0157369_1000686911 191
317 3300013306 Ga0163162_10160588 Ga0163162_101605882 191
318 3300014497 Ga0182008_10037035 Ga0182008_100370354 191
319 3300015261 Ga0182006_1063164 Ga0182006_10631642 191
320 3300015261 Ga0182006_1093053 Ga0182006_10930531 191
321 3300015262 Ga0182007_10029701 Ga0182007_100297012 191
322 3300015262 Ga0182007_10050873 Ga0182007_100508732 191
323 3300015683 Ga0183362_10002 Ga0183362_1000236 191
324 3300017792 Ga0163161_10001036 Ga0163161_1000103618 191
325 3300017792 Ga0163161_10011465 Ga0163161_100114654 191
326 3300017792 Ga0163161_10051165 Ga0163161_100511652 191
327 3300017792 Ga0163161_10127690 Ga0163161_101276902 191
328 3300021358 Ga0213873_10049182 Ga0213873_100491821 191
329 3300021441 Ga0213871_10021859 Ga0213871_100218592 191
330 3300025208 Ga0209436_101898 Ga0209436_1018983 191
331 3300025228 Ga0209672_107059 Ga0209672_1070591 191
332 3300025229 Ga0209147_100494 Ga0209147_10049410 191
333 3300025242 Ga0209258_100018 Ga0209258_100018360 191
334 3300025245 Ga0207425_1000890 Ga0207425_10008906 191
335 3300025245 Ga0207425_1006777 Ga0207425_10067773 191
336 3300025254 Ga0209148_1000030 Ga0209148_1000030360 191
337 3300025258 Ga0209129_1003720 Ga0209129_10037206 191
338 3300025258 Ga0209129_1004626 Ga0209129_10046262 191
339 3300025261 Ga0209233_1007634 Ga0209233_10076344 191
340 3300025263 Ga0209565_1000042 Ga0209565_1000042194 191
341 3300025263 Ga0209565_1001579 Ga0209565_100157913 191
342 3300025273 Ga0209673_1000071 Ga0209673_100007134 191
343 3300025273 Ga0209673_1000940 Ga0209673_100094011 191
344 3300025273 Ga0209673_1001066 Ga0209673_100106626 191
345 3300025273 Ga0209673_1004735 Ga0209673_10047355 191
346 3300025284 Ga0209130_1000230 Ga0209130_100023047 191
347 3300025284 Ga0209130_1011217 Ga0209130_10112172 191
348 3300025291 Ga0209675_1000041 Ga0209675_100004133 191
349 3300025291 Ga0209675_1003973 Ga0209675_10039737 191
350 3300025292 Ga0209676_1000004 Ga0209676_100000476 191
351 3300025292 Ga0209676_1000123 Ga0209676_100012321 191
352 3300025292 Ga0209676_1012302 Ga0209676_10123023 191
353 3300025294 Ga0209025_1000040 Ga0209025_1000040159 191
354 3300025294 Ga0209025_1000113 Ga0209025_100011360 191
355 3300025294 Ga0209025_1001177 Ga0209025_100117712 191
356 3300025294 Ga0209025_1010408 Ga0209025_10104082 191
357 3300025294 Ga0209025_1019267 Ga0209025_10192673 191
358 3300025295 Ga0209564_1000319 Ga0209564_100031961 191
359 3300025295 Ga0209564_1006998 Ga0209564_10069982 191
360 3300025297 Ga0209758_1000011 Ga0209758_1000011178 191
361 3300025297 Ga0209758_1000359 Ga0209758_100035935 191
362 3300025297 Ga0209758_1004154 Ga0209758_100415410 191
363 3300025297 Ga0209758_1007868 Ga0209758_10078683 191
364 3300025297 Ga0209758_1022817 Ga0209758_10228172 191
365 3300025298 Ga0209050_1000002 Ga0209050_1000002586 191
366 3300025298 Ga0209050_1001339 Ga0209050_100133917 191
367 3300025298 Ga0209050_1001596 Ga0209050_100159612 191
368 3300025299 Ga0209256_1000166 Ga0209256_100016662 191
369 3300025299 Ga0209256_1004821 Ga0209256_10048216 191
370 3300025302 Ga0207426_1000325 Ga0207426_100032565 191
371 3300025302 Ga0207426_1000389 Ga0207426_10003892 191
372 3300025302 Ga0207426_1012504 Ga0207426_10125044 191
373 3300025302 Ga0207426_1049462 Ga0207426_10494622 191
374 3300025303 Ga0209051_1000002 Ga0209051_1000002354 191
375 3300025303 Ga0209051_1000091 Ga0209051_100009121 191
376 3300025303 Ga0209051_1000128 Ga0209051_100012854 191
377 3300025304 Ga0209257_1000002 Ga0209257_1000002495 191
378 3300025304 Ga0209257_1000276 Ga0209257_100027610 191
379 3300025304 Ga0209257_1001035 Ga0209257_100103515 191
380 3300025321 Ga0207656_10032702 Ga0207656_100327022 191
381 3300025913 Ga0207695_10000012 Ga0207695_10000012631 191
382 3300025914 Ga0207671_10201703 Ga0207671_102017032 191
383 3300025924 Ga0207694_10352320 Ga0207694_103523202 191
384 3300025933 Ga0207706_10176735 Ga0207706_101767353 191
385 3300025935 Ga0207709_10098934 Ga0207709_100989342 191
386 3300025935 Ga0207709_10102873 Ga0207709_101028732 191
387 3300025949 Ga0207667_10013355 Ga0207667_100133556 191
388 3300025986 Ga0207658_10042856 Ga0207658_100428561 191
389 3300025986 Ga0207658_10103958 Ga0207658_101039582 191
390 3300026041 Ga0207639_10082559 Ga0207639_100825592 191
391 3300026088 Ga0207641_10456416 Ga0207641_104564162 191
392 3300026089 Ga0207648_10073220 Ga0207648_100732203 191
393 3300026116 Ga0207674_10162170 Ga0207674_101621703 191
394 3300026116 Ga0207674_10369866 Ga0207674_103698662 191
395 3300026121 Ga0207683_10580141 Ga0207683_105801412 191
396 3300027666 Ga0209282_1039175 Ga0209282_10391753 191
397 3300027907 Ga0207428_10195605 Ga0207428_101956052 191
398 3300028379 Ga0268266_10030056 Ga0268266_100300565 191
399 3300028380 Ga0268265_10034773 Ga0268265_100347732 191
400 3300028794 Ga0307515_10000047 Ga0307515_10000047182 191
401 3300028794 Ga0307515_10067589 Ga0307515_100675895 191
402 3300031251 Ga0265327_10128284 Ga0265327_101282842 191
403 3300031456 Ga0307513_10041073 Ga0307513_100410732 191
404 3300031548 Ga0307408_100030968 Ga0307408_1000309685 191
405 3300031548 Ga0307408_100134386 Ga0307408_1001343862 191
406 3300031548 Ga0307408_100258781 Ga0307408_1002587812 191
407 3300031548 Ga0307408_100605898 Ga0307408_1006058982 191
408 3300031548 Ga0307408_101111667 Ga0307408_1011116672 191
409 3300031649 Ga0307514_10003247 Ga0307514_1000324722 191
410 3300031731 Ga0307405_10011136 Ga0307405_100111364 191
411 3300031731 Ga0307405_10064598 Ga0307405_100645984 191
412 3300031731 Ga0307405_10203066 Ga0307405_102030662 191
413 3300031731 Ga0307405_10231812 Ga0307405_102318122 191
414 3300031731 Ga0307405_11363096 Ga0307405_113630961 191
415 3300031901 Ga0307406_10316912 Ga0307406_103169122 191
416 3300031911 Ga0307412_10003750 Ga0307412_100037507 191
417 3300031911 Ga0307412_10157598 Ga0307412_101575982 191
418 3300031911 Ga0307412_10247862 Ga0307412_102478622 191
419 3300031911 Ga0307412_10267922 Ga0307412_102679222 191
420 3300032002 Ga0307416_100326925 Ga0307416_1003269252 191
421 3300032004 Ga0307414_10042687 Ga0307414_100426874 191
422 3300032004 Ga0307414_10047247 Ga0307414_100472473 191
423 3300032004 Ga0307414_10109071 Ga0307414_101090711 191
424 3300032004 Ga0307414_10419560 Ga0307414_104195601 191
425 3300032004 Ga0307414_10570503 Ga0307414_105705031 191
426 3300032005 Ga0307411_10053082 Ga0307411_100530823 191
427 3300032005 Ga0307411_10378082 Ga0307411_103780822 191
428 3300037471 Ga0395905_0008066 Ga0395905_0008066_844_1422 191
429 3300037471 Ga0395905_0107358 Ga0395905_0107358_88_666 191
430 3300037471 Ga0395905_0270247 Ga0395905_0270247_27_605 191
431 3300037471 Ga0395905_0506480 Ga0395905_0506480_36_614 191
432 3300039093 Ga0400489_52926 Ga0400489_52926_12646_13224 191
433 3300039438 Ga0436360_1316722 Ga0436360_1316722_8548_9126 191
434 3300039447 Ga0436361_0159868 Ga0436361_0159868_859_1437 191
435 3300039453 Ga0436362_0110582 Ga0436362_0110582_70_648 191
436 3300041404 Ga0439436_0017070 Ga0439436_0017070_106_684 191
437 3300041406 Ga0439439_0004298 Ga0439439_0004298_1771_2349 191
438 3300041406 Ga0439439_0013687 Ga0439439_0013687_221_799 191
439 3300041411 Ga0439466_0034340 Ga0439466_0034340_1093_1671 191
440 3300041411 Ga0439466_0065578 Ga0439466_0065578_112_690 191
441 3300041413 Ga0439465_0028833 Ga0439465_0028833_1107_1685 191
442 3300041413 Ga0439465_0034418 Ga0439465_0034418_633_1211 191
443 3300041453 Ga0451797_0888364 Ga0451797_0888364_199_777 191
444 3300041453 Ga0451797_0995910 Ga0451797_0995910_461_1039 191
445 3300041491 Ga0451833_0624708 Ga0451833_0624708_162_740 191
446 3300041498 Ga0451841_1366776 Ga0451841_1366776_76_654 191
447 3300041512 Ga0451853_3268004 Ga0451853_3268004_613_1191 191
448 3300041999 Ga0439433_0026055 Ga0439433_0026055_490_1068 191
449 3300042004 Ga0439445_0041332 Ga0439445_0041332_225_803 191
450 3300042004 Ga0439445_0054788 Ga0439445_0054788_166_744 191
451 3300042006 Ga0439432_009181 Ga0439432_009181_2859_3437 191
452 3300042007 Ga0439449_0001049 Ga0439449_0001049_2431_3009 191
453 3300042007 Ga0439449_0037568 Ga0439449_0037568_951_1529 191
454 3300042007 Ga0439449_0076051 Ga0439449_0076051_638_1216 191
455 3300042010 Ga0439452_060499 Ga0439452_060499_209_787 191
456 3300042014 Ga0439457_016994 Ga0439457_016994_490_1068 191
457 3300042014 Ga0439457_042931 Ga0439457_042931_71_649 191
458 3300042014 Ga0439457_089934 Ga0439457_089934_111_689 191
459 3300042015 Ga0439462_0002063 Ga0439462_0002063_3212_3790 191
460 3300042015 Ga0439462_0004837 Ga0439462_0004837_260_838 191
461 3300042115 Ga0450911_000107 Ga0450911_000107_13611_14189 191
462 3300042115 Ga0450911_000519 Ga0450911_000519_8711_9289 191
463 3300042121 Ga0450919_002690 Ga0450919_002690_1611_2189 191
464 3300042122 Ga0450920_057459 Ga0450920_057459_87_665 191
465 3300042125 Ga0450923_004062 Ga0450923_004062_245_823 191
466 3300042127 Ga0450890_012527 Ga0450890_012527_111_689 191
467 3300042128 Ga0450897_001641 Ga0450897_001641_913_1491 191
468 3300042134 Ga0450898_038517 Ga0450898_038517_33_611 191
469 3300042145 Ga0450906_005093 Ga0450906_005093_197_775 191
470 3300042147 Ga0450910_031038 Ga0450910_031038_27_605 191
471 3300042156 Ga0439446_0022901 Ga0439446_0022901_946_1524 191
472 3300042156 Ga0439446_0216493 Ga0439446_0216493_30_608 191
473 3300042184 Ga0450908_001204 Ga0450908_001204_1759_2337 191
474 3300042184 Ga0450908_003757 Ga0450908_003757_705_1283 191
475 3300042435 Ga0439434_0006459 Ga0439434_0006459_1213_1791 191
476 3300042435 Ga0439434_0103139 Ga0439434_0103139_328_906 191
477 3300042435 Ga0439434_0224980 Ga0439434_0224980_23_601 191
478 3300042876 Ga0451577_0003980 Ga0451577_0003980_8371_8949 191
479 3300042876 Ga0451577_0009290 Ga0451577_0009290_6309_6887 191
480 3300042876 Ga0451577_0074764 Ga0451577_0074764_2115_2693 191
481 3300044658 Ga0466972_0025143 Ga0466972_0025143_2081_2659 191
482 3300044658 Ga0466972_0243067 Ga0466972_0243067_101_679 191
483 3300044673 Ga0453683_0096128 Ga0453683_0096128_156_734 191
484 3300044673 Ga0453683_0100801 Ga0453683_0100801_134_712 191
485 3300044673 Ga0453683_0314629 Ga0453683_0314629_137_715 191
486 3300044683 Ga0466965_0040093 Ga0466965_0040093_44_622 191
487 3300044712 Ga0453684_0042329 Ga0453684_0042329_1484_2062 191
488 3300044735 Ga0466968_0000951 Ga0466968_0000951_3589_4167 191
489 3300044901 Ga0466960_0024092 Ga0466960_0024092_384_962 191
490 3300045051 Ga0451576_0056721 Ga0451576_0056721_3052_3630 191
491 3300046453 Ga0495627_004299 Ga0495627_004299_5292_5870 191
492 3300046459 Ga0495629_0351712 Ga0495629_0351712_311_889 191
493 3300046460 Ga0495638_0036835 Ga0495638_0036835_1092_1670 191
494 3300046475 Ga0495639_0007550 Ga0495639_0007550_3909_4511 191
495 3300046506 Ga0495583_0082715 Ga0495583_0082715_652_1230 191
496 3300046512 Ga0495610_0015531 Ga0495610_0015531_1950_2528 191
497 3300046513 Ga0495616_0001237 Ga0495616_0001237_3709_4287 191
498 3300046514 Ga0495618_0086391 Ga0495618_0086391_1250_1852 191
499 3300046515 Ga0495620_0060005 Ga0495620_0060005_297_875 191
500 3300046515 Ga0495620_0132975 Ga0495620_0132975_205_783 191
501 3300046518 Ga0495631_0000242 Ga0495631_0000242_4940_5518 191
502 3300046520 Ga0495637_0002576 Ga0495637_0002576_5317_5895 191
503 3300046522 Ga0495643_0077100 Ga0495643_0077100_767_1345 191
504 3300046524 Ga0495648_0082523 Ga0495648_0082523_909_1487 191
505 3300046528 Ga0495642_0102078 Ga0495642_0102078_484_1086 191
506 3300046530 Ga0495654_0060406 Ga0495654_0060406_683_1261 191
507 3300046539 Ga0495621_0004761 Ga0495621_0004761_192_770 191
508 3300046557 Ga0495622_0040433 Ga0495622_0040433_1374_1952 191
509 3300046559 Ga0495667_0316718 Ga0495667_0316718_22_648 191
510 3300046660 Ga0495625_0000056 Ga0495625_0000056_18706_19284 191
511 3300046660 Ga0495625_0261943 Ga0495625_0261943_201_779 191
512 3300046665 Ga0495661_0273566 Ga0495661_0273566_131_709 191
513 3300046674 Ga0495588_0004546 Ga0495588_0004546_1499_2077 191
514 3300046674 Ga0495588_0011119 Ga0495588_0011119_1318_1896 191
515 3300046674 Ga0495588_0100156 Ga0495588_0100156_222_800 191
516 3300046674 Ga0495588_0236984 Ga0495588_0236984_368_946 191
517 3300046683 Ga0495658_0002773 Ga0495658_0002773_1497_2075 191
518 3300046683 Ga0495658_0195514 Ga0495658_0195514_206_784 191
519 3300046684 Ga0495669_0245696 Ga0495669_0245696_214_816 191
520 3300046691 Ga0495670_0347943 Ga0495670_0347943_55_633 191
521 3300046692 Ga0495671_0002242 Ga0495671_0002242_5180_5758 191
522 3300047317 Ga0495604_0402876 Ga0495604_0402876_250_852 191
523 3300047321 Ga0495676_0023524 Ga0495676_0023524_3032_3610 191
524 3300047445 Ga0495677_0265775 Ga0495677_0265775_54_656 191
525 3300047673 Ga0495593_0011378 Ga0495593_0011378_4056_4634 191
526 3300048089 Ga0495614_0007845 Ga0495614_0007845_3984_4562 191
527 3300048903 Ga0496100_0017439 Ga0496100_0017439_815_1417 191
528 3300048904 Ga0496101_0003286 Ga0496101_0003286_1015_1617 191
529 3300048904 Ga0496101_0386344 Ga0496101_0386344_383_961 191
530 3300048905 Ga0496102_0007804 Ga0496102_0007804_4304_4906 191
531 3300048905 Ga0496102_0354338 Ga0496102_0354338_628_1254 191
532 3300048906 Ga0496103_0071738 Ga0496103_0071738_1212_1814 191
533 3300048907 Ga0496104_0015096 Ga0496104_0015096_4173_4775 191
534 3300048907 Ga0496104_0177785 Ga0496104_0177785_1110_1730 191
535 3300048908 Ga0496105_0007115 Ga0496105_0007115_3506_4108 191
536 3300048908 Ga0496105_0213036 Ga0496105_0213036_110_730 191
537 3300048909 Ga0496106_0015648 Ga0496106_0015648_1862_2464 191
538 3300048910 Ga0496107_0024141 Ga0496107_0024141_3387_3989 191
539 3300048910 Ga0496107_0543935 Ga0496107_0543935_108_686 191
540 3300048911 Ga0496108_0014037 Ga0496108_0014037_2938_3558 191
541 3300048911 Ga0496108_0486924 Ga0496108_0486924_440_1042 191
542 3300048912 Ga0496109_0017981 Ga0496109_0017981_2444_3064 191
543 3300048913 Ga0496110_0005924 Ga0496110_0005924_5983_6603 191
544 3300048913 Ga0496110_0140364 Ga0496110_0140364_1227_1829 191
545 3300048914 Ga0496111_0038181 Ga0496111_0038181_1420_2040 191
546 3300048914 Ga0496111_0183508 Ga0496111_0183508_561_1163 191
547 3300048915 Ga0496112_0355190 Ga0496112_0355190_480_1082 191
548 3300048916 Ga0496113_0328794 Ga0496113_0328794_331_951 191
549 3300048917 Ga0496114_0006664 Ga0496114_0006664_4579_5181 191
550 3300048917 Ga0496114_0028641 Ga0496114_0028641_119_697 191
551 3300048919 Ga0496116_0017188 Ga0496116_0017188_1229_1807 191
552 3300048919 Ga0496116_0036642 Ga0496116_0036642_2376_2954 191
553 3300048920 Ga0496117_0002997 Ga0496117_0002997_19701_20279 191
554 3300048920 Ga0496117_0181909 Ga0496117_0181909_585_1163 191
555 3300048921 Ga0496118_0002137 Ga0496118_0002137_19701_20279 191
556 3300048921 Ga0496118_0030679 Ga0496118_0030679_3719_4297 191
557 3300048921 Ga0496118_0120580 Ga0496118_0120580_709_1287 191
558 3300048923 Ga0496120_0007054 Ga0496120_0007054_3776_4354 191
559 3300048924 Ga0496121_0000159 Ga0496121_0000159_2888_3466 191
560 3300048924 Ga0496121_0009067 Ga0496121_0009067_476_1054 191
561 3300048924 Ga0496121_0011908 Ga0496121_0011908_6991_7569 191
562 3300048924 Ga0496121_0201409 Ga0496121_0201409_338_916 191
563 3300048925 Ga0496122_0002198 Ga0496122_0002198_23794_24372 191
564 3300048925 Ga0496122_0031976 Ga0496122_0031976_1986_2564 191
565 3300048925 Ga0496122_0082993 Ga0496122_0082993_709_1287 191
566 3300048925 Ga0496122_0094941 Ga0496122_0094941_129_707 191
567 3300048926 Ga0496123_0000314 Ga0496123_0000314_7502_8080 191
568 3300048926 Ga0496123_0006452 Ga0496123_0006452_3487_4065 191
569 3300048926 Ga0496123_0011999 Ga0496123_0011999_5882_6457 191
570 3300048926 Ga0496123_0035309 Ga0496123_0035309_1558_2136 191
571 3300048926 Ga0496123_0149149 Ga0496123_0149149_656_1234 191
572 3300048926 Ga0496123_0232325 Ga0496123_0232325_268_846 191
573 3300048927 Ga0496124_0009311 Ga0496124_0009311_7462_8040 191
574 3300048927 Ga0496124_0019956 Ga0496124_0019956_497_1075 191
575 3300048927 Ga0496124_0275523 Ga0496124_0275523_358_936 191
576 3300048927 Ga0496124_0316751 Ga0496124_0316751_77_652 191
577 3300048928 Ga0496125_0000005 Ga0496125_0000005_588917_589495 191
578 3300048928 Ga0496125_0001361 Ga0496125_0001361_19968_20546 191
579 3300048928 Ga0496125_0007561 Ga0496125_0007561_2453_3031 191
580 3300048928 Ga0496125_0008142 Ga0496125_0008142_9277_9855 191
581 3300048928 Ga0496125_0068383 Ga0496125_0068383_590_1168 191
582 3300048928 Ga0496125_0201736 Ga0496125_0201736_136_714 191
583 3300048928 Ga0496125_0301838 Ga0496125_0301838_219_797 191
584 3300048929 Ga0496126_0030841 Ga0496126_0030841_678_1256 191
585 3300048929 Ga0496126_0110468 Ga0496126_0110468_1446_2024 191
586 3300049515 Ga0501292_015697 Ga0501292_015697_87_665 191
587 3300049568 Ga0501031_0486151 Ga0501031_0486151_208_786 191
588 3300049569 Ga0501032_0001083 Ga0501032_0001083_9526_10104 191
589 3300049570 Ga0501033_0007007 Ga0501033_0007007_4167_4745 191
590 3300049571 Ga0501034_0023042 Ga0501034_0023042_1965_2543 191
591 3300049572 Ga0501036_0001511 Ga0501036_0001511_5909_6487 191
592 3300049574 Ga0501038_0002514 Ga0501038_0002514_15732_16310 191
593 3300049575 Ga0501039_0019851 Ga0501039_0019851_723_1301 191
594 3300049578 Ga0501042_0210718 Ga0501042_0210718_254_832 191
595 3300049579 Ga0501043_0017574 Ga0501043_0017574_352_930 191
596 3300049580 Ga0501046_0002922 Ga0501046_0002922_4110_4688 191
597 3300049581 Ga0501047_0053686 Ga0501047_0053686_1700_2278 191
598 3300049582 Ga0501048_0033726 Ga0501048_0033726_10_588 191
599 3300049583 Ga0501067_0007502 Ga0501067_0007502_169_747 191
600 3300049585 Ga0501069_0000699 Ga0501069_0000699_4255_4833 191
601 3300049586 Ga0501070_0015536 Ga0501070_0015536_3989_4567 191
602 3300049588 Ga0501072_1042017 Ga0501072_1042017_21_599 191
603 3300049589 Ga0501073_0006072 Ga0501073_0006072_2181_2759 191
604 3300049590 Ga0501074_0001430 Ga0501074_0001430_4038_4616 191
605 3300049742 Ga0501080_0001937 Ga0501080_0001937_11573_12151 191
606 3300049743 Ga0501081_0699858 Ga0501081_0699858_74_655 191
607 3300049744 Ga0501083_0002912 Ga0501083_0002912_7166_7744 191
608 3300049762 Ga0501265_023190 Ga0501265_023190_77_655 191
609 3300049763 Ga0501266_000054 Ga0501266_000054_5655_6233 191
610 3300049822 Ga0501035_0010721 Ga0501035_0010721_3803_4381 191
611 3300049823 Ga0501044_0003491 Ga0501044_0003491_9656_10234 191
612 3300050489 nmdc:mga03683_1809_c1 nmdc:mga03683_1809_c1_3959_4537 191
613 3300050489 nmdc:mga03683_9357_c1 nmdc:mga03683_9357_c1_1142_1720 191
614 3300050490 nmdc:mga03n38_11169_c1 nmdc:mga03n38_11169_c1_82_693 191
615 3300050490 nmdc:mga03n38_38252_c1 nmdc:mga03n38_38252_c1_1072_1650 191
616 3300050492 nmdc:mga0yw44_507445_c1 nmdc:mga0yw44_507445_c1_11_589 191
617 3300050493 nmdc:mga0k408_109735_c1 nmdc:mga0k408_109735_c1_924_1502 191
618 3300050493 nmdc:mga0k408_18454_c1 nmdc:mga0k408_18454_c1_1293_1871 191
619 3300050493 nmdc:mga0k408_35539_c1 nmdc:mga0k408_35539_c1_778_1356 191
620 3300050493 nmdc:mga0k408_416683_c1 nmdc:mga0k408_416683_c1_67_645 191
621 3300050495 nmdc:mga04h51_66560_c1 nmdc:mga04h51_66560_c1_169_747 191
622 3300050496 nmdc:mga07m45_12949_c1 nmdc:mga07m45_12949_c1_1977_2555 191
623 3300050496 nmdc:mga07m45_130141_c1 nmdc:mga07m45_130141_c1_774_1352 191
624 3300050496 nmdc:mga07m45_20630_c1 nmdc:mga07m45_20630_c1_1113_1691 191
625 3300050496 nmdc:mga07m45_21476_c1 nmdc:mga07m45_21476_c1_1569_2147 191
626 3300050496 nmdc:mga07m45_23144_c1 nmdc:mga07m45_23144_c1_627_1205 191
627 3300050496 nmdc:mga07m45_273212_c1 nmdc:mga07m45_273212_c1_316_918 191
628 3300050496 nmdc:mga07m45_432249_c1 nmdc:mga07m45_432249_c1_36_614 191
629 3300050516 nmdc:mga0sz30_25497_c1 nmdc:mga0sz30_25497_c1_1828_2406 191
630 3300053079 Ga0500610_0000357 Ga0500610_0000357_3673_4251 191
631 3300053083 Ga0495655_0113866 Ga0495655_0113866_44_622 191
632 3300053087 Ga0500643_008621 Ga0500643_008621_2654_3232 191
633 3300053087 Ga0500643_083135 Ga0500643_083135_87_665 191
634 3300053088 Ga0500644_0096275 Ga0500644_0096275_148_726 191
635 3300053091 Ga0500647_0143965 Ga0500647_0143965_43_621 191
636 3300053093 Ga0500651_0000063 Ga0500651_0000063_33555_34133 191
637 3300053093 Ga0500651_0000517 Ga0500651_0000517_1974_2552 191
638 3300053094 Ga0500566_0016607 Ga0500566_0016607_1289_1867 191
639 3300053103 Ga0500555_071813 Ga0500555_071813_11_589 191
640 3300053108 Ga0500562_009386 Ga0500562_009386_1103_1681 191
641 3300053110 Ga0500571_000022 Ga0500571_000022_42700_43278 191
642 3300053117 Ga0500593_000228 Ga0500593_000228_8682_9260 191
643 3300053121 Ga0500607_003093 Ga0500607_003093_6751_7329 191
644 3300053121 Ga0500607_021201 Ga0500607_021201_1070_1648 191
645 3300053122 Ga0500608_077610 Ga0500608_077610_959_1537 191
646 3300053125 Ga0500618_042342 Ga0500618_042342_237_815 191
647 3300053128 Ga0500626_014123 Ga0500626_014123_1468_2046 191
648 3300053134 Ga0500658_0000125 Ga0500658_0000125_30380_30958 191
649 3300053134 Ga0500658_0000804 Ga0500658_0000804_6974_7552 191
650 3300053136 Ga0500559_0013619 Ga0500559_0013619_590_1168 191
651 3300053137 Ga0500561_0033666 Ga0500561_0033666_115_693 191
652 3300053138 Ga0500564_013358 Ga0500564_013358_2361_2939 191
653 3300053139 Ga0500568_0001840 Ga0500568_0001840_10687_11265 191
654 3300053141 Ga0500574_000185 Ga0500574_000185_3087_3665 191
655 3300053153 Ga0500616_0071225 Ga0500616_0071225_729_1307 191
656 3300053154 Ga0500619_023270 Ga0500619_023270_1103_1681 191
657 3300053158 Ga0500627_0001017 Ga0500627_0001017_1409_1987 191
658 3300053161 Ga0500634_0011762 Ga0500634_0011762_457_1035 191
659 3300053161 Ga0500634_0012245 Ga0500634_0012245_677_1255 191
660 3300053162 Ga0500638_000424 Ga0500638_000424_1033_1611 191
661 3300053177 Ga0500636_0029967 Ga0500636_0029967_1457_2035 191
662 3300053729 Ga0500625_096378 Ga0500625_096378_183_761 191
663 3300053737 Ga0500601_000125 Ga0500601_000125_11195_11773 191
664 3300054114 Ga0501084_0027930 Ga0501084_0027930_3232_3810 191
665 3300060353 Ga0501082_0021724 Ga0501082_0021724_978_1556 191
666 3300003758 Ga0055532_1000122 Ga0055532_100012241 192
667 3300003760 Ga0055527_1000078 Ga0055527_100007842 192
668 3300003761 Ga0055535_1000054 Ga0055535_100005442 192
669 3300003762 Ga0055542_1004543 Ga0055542_10045431 192
670 3300003792 Ga0055540_1000017 Ga0055540_100001732 192
671 3300005288 Ga0065714_10003761 Ga0065714_100037611 192
672 3300005288 Ga0065714_10064479 Ga0065714_1006447913 192
673 3300005288 Ga0065714_10074291 Ga0065714_100742914 192
674 3300005327 Ga0070658_10007776 Ga0070658_100077765 192
675 3300005331 Ga0070670_100061461 Ga0070670_1000614613 192
676 3300005354 Ga0070675_100171954 Ga0070675_1001719542 192
677 3300005355 Ga0070671_100026204 Ga0070671_1000262044 192
678 3300005356 Ga0070674_100164048 Ga0070674_1001640482 192
679 3300005364 Ga0070673_100011258 Ga0070673_1000112586 192
680 3300005367 Ga0070667_100055974 Ga0070667_1000559743 192
681 3300005435 Ga0070714_100394864 Ga0070714_1003948642 192
682 3300005457 Ga0070662_100082922 Ga0070662_1000829223 192
683 3300005459 Ga0068867_100003215 Ga0068867_1000032155 192
684 3300005543 Ga0070672_100002432 Ga0070672_1000024325 192
685 3300005543 Ga0070672_100291448 Ga0070672_1002914482 192
686 3300005548 Ga0070665_100091135 Ga0070665_1000911354 192
687 3300005563 Ga0068855_100023740 Ga0068855_1000237402 192
688 3300005577 Ga0068857_100007525 Ga0068857_1000075255 192
689 3300005617 Ga0068859_100227938 Ga0068859_1002279382 192
690 3300005844 Ga0068862_100113857 Ga0068862_1001138573 192
691 3300005981 Ga0081538_10044611 Ga0081538_100446112 192
692 3300005983 Ga0081540_1000904 Ga0081540_100090426 192
693 3300005985 Ga0081539_10006459 Ga0081539_100064592 192
694 3300005985 Ga0081539_10031065 Ga0081539_100310652 192
695 3300006038 Ga0075365_10007694 Ga0075365_100076942 192
696 3300006038 Ga0075365_10099933 Ga0075365_100999333 192
697 3300006038 Ga0075365_10331089 Ga0075365_103310892 192
698 3300006058 Ga0075432_10008151 Ga0075432_100081512 192
699 3300006058 Ga0075432_10034676 Ga0075432_100346762 192
700 3300006058 Ga0075432_10037918 Ga0075432_100379182 192
701 3300006177 Ga0075362_10070372 Ga0075362_100703722 192
702 3300006177 Ga0075362_10084199 Ga0075362_100841992 192
703 3300006195 Ga0075366_10134002 Ga0075366_101340023 192
704 3300006195 Ga0075366_10135302 Ga0075366_101353022 192
705 3300006353 Ga0075370_10015503 Ga0075370_100155032 192
706 3300006353 Ga0075370_10037095 Ga0075370_100370952 192
707 3300006881 Ga0068865_100048958 Ga0068865_1000489583 192
708 3300006931 Ga0097620_100227952 Ga0097620_1002279522 192
709 3300009011 Ga0105251_10001140 Ga0105251_100011408 192
710 3300009036 Ga0105244_10029744 Ga0105244_100297443 192
711 3300009092 Ga0105250_10012881 Ga0105250_100128812 192
712 3300009093 Ga0105240_10013249 Ga0105240_100132494 192
713 3300009098 Ga0105245_10224019 Ga0105245_102240192 192
714 3300009098 Ga0105245_10925507 Ga0105245_109255071 192
715 3300009101 Ga0105247_10118400 Ga0105247_101184003 192
716 3300009101 Ga0105247_10609766 Ga0105247_106097661 192
717 3300009147 Ga0114129_11793092 Ga0114129_117930921 192
718 3300009148 Ga0105243_10340671 Ga0105243_103406712 192
719 3300009174 Ga0105241_10431693 Ga0105241_104316931 192
720 3300009177 Ga0105248_10478889 Ga0105248_104788892 192
721 3300009545 Ga0105237_10002173 Ga0105237_100021739 192
722 3300009545 Ga0105237_10042261 Ga0105237_100422614 192
723 3300009545 Ga0105237_10750960 Ga0105237_107509602 192
724 3300011119 Ga0105246_10004906 Ga0105246_100049067 192
725 3300011119 Ga0105246_10119114 Ga0105246_101191143 192
726 3300013100 Ga0157373_10002545 Ga0157373_100025458 192
727 3300013104 Ga0157370_10073112 Ga0157370_100731123 192
728 3300013105 Ga0157369_10000059 Ga0157369_1000005991 192
729 3300013296 Ga0157374_10000044 Ga0157374_1000004441 192
730 3300013306 Ga0163162_10131314 Ga0163162_101313142 192
731 3300013307 Ga0157372_10837308 Ga0157372_108373082 192
732 3300013308 Ga0157375_10012536 Ga0157375_100125363 192
733 3300013308 Ga0157375_10023559 Ga0157375_100235591 192
734 3300013308 Ga0157375_10542103 Ga0157375_105421032 192
735 3300013308 Ga0157375_11360151 Ga0157375_113601512 192
736 3300014968 Ga0157379_10145085 Ga0157379_101450852 192
737 3300015265 Ga0182005_1000403 Ga0182005_10004038 192
738 3300017792 Ga0163161_10211875 Ga0163161_102118752 192
739 3300017792 Ga0163161_10582355 Ga0163161_105823552 192
740 3300017792 Ga0163161_10677115 Ga0163161_106771152 192
741 3300025226 Ga0209674_100130 Ga0209674_10013077 192
742 3300025228 Ga0209672_100036 Ga0209672_10003640 192
743 3300025228 Ga0209672_100488 Ga0209672_10048814 192
744 3300025229 Ga0209147_100066 Ga0209147_10006640 192
745 3300025242 Ga0209258_100085 Ga0209258_10008540 192
746 3300025254 Ga0209148_1000198 Ga0209148_100019840 192
747 3300025256 Ga0209759_1000993 Ga0209759_10009935 192
748 3300025272 Ga0209455_1000289 Ga0209455_100028914 192
749 3300025292 Ga0209676_1002561 Ga0209676_10025615 192
750 3300025298 Ga0209050_1000037 Ga0209050_1000037171 192
751 3300025303 Ga0209051_1000040 Ga0209051_1000040172 192
752 3300025728 Ga0207655_1003737 Ga0207655_100373710 192
753 3300025899 Ga0207642_10371339 Ga0207642_103713392 192
754 3300025900 Ga0207710_10035905 Ga0207710_100359051 192
755 3300025904 Ga0207647_10167197 Ga0207647_101671972 192
756 3300025907 Ga0207645_10001280 Ga0207645_100012805 192
757 3300025908 Ga0207643_10036289 Ga0207643_100362893 192
758 3300025908 Ga0207643_10055747 Ga0207643_100557473 192
759 3300025909 Ga0207705_10007418 Ga0207705_100074187 192
760 3300025909 Ga0207705_10212823 Ga0207705_102128232 192
761 3300025911 Ga0207654_10741385 Ga0207654_107413851 192
762 3300025913 Ga0207695_10720704 Ga0207695_107207041 192
763 3300025914 Ga0207671_10024648 Ga0207671_100246482 192
764 3300025925 Ga0207650_10087320 Ga0207650_100873203 192
765 3300025926 Ga0207659_10096692 Ga0207659_100966923 192
766 3300025927 Ga0207687_10083811 Ga0207687_100838112 192
767 3300025927 Ga0207687_10563955 Ga0207687_105639552 192
768 3300025931 Ga0207644_10007662 Ga0207644_100076624 192
769 3300025932 Ga0207690_10045947 Ga0207690_100459471 192
770 3300025933 Ga0207706_10105226 Ga0207706_101052263 192
771 3300025935 Ga0207709_10008456 Ga0207709_100084562 192
772 3300025935 Ga0207709_10399892 Ga0207709_103998922 192
773 3300025936 Ga0207670_10415282 Ga0207670_104152822 192
774 3300025938 Ga0207704_10051188 Ga0207704_100511882 192
775 3300025938 Ga0207704_10247933 Ga0207704_102479332 192
776 3300025940 Ga0207691_10001439 Ga0207691_1000143919 192
777 3300025940 Ga0207691_10080660 Ga0207691_100806602 192
778 3300025940 Ga0207691_10401401 Ga0207691_104014012 192
779 3300025942 Ga0207689_10044219 Ga0207689_100442192 192
780 3300025945 Ga0207679_10130143 Ga0207679_101301432 192
781 3300025949 Ga0207667_10009505 Ga0207667_100095054 192
782 3300025960 Ga0207651_10116156 Ga0207651_101161563 192
783 3300025981 Ga0207640_11111296 Ga0207640_111112962 192
784 3300025986 Ga0207658_10001632 Ga0207658_100016323 192
785 3300025986 Ga0207658_10025023 Ga0207658_100250233 192
786 3300026023 Ga0207677_10012746 Ga0207677_100127464 192
787 3300026067 Ga0207678_10008402 Ga0207678_100084023 192
788 3300026067 Ga0207678_10080588 Ga0207678_100805883 192
789 3300026075 Ga0207708_10153607 Ga0207708_101536073 192
790 3300026089 Ga0207648_10099462 Ga0207648_100994623 192
791 3300026089 Ga0207648_10321353 Ga0207648_103213531 192
792 3300026089 Ga0207648_10330196 Ga0207648_103301962 192
793 3300026116 Ga0207674_10007877 Ga0207674_100078775 192
794 3300026116 Ga0207674_10414373 Ga0207674_104143732 192
795 3300026118 Ga0207675_100473096 Ga0207675_1004730962 192
796 3300026121 Ga0207683_10051718 Ga0207683_100517183 192
797 3300026121 Ga0207683_10216873 Ga0207683_102168732 192
798 3300026142 Ga0207698_10066687 Ga0207698_100666872 192
799 3300027695 Ga0209966_1082362 Ga0209966_10823621 192
800 3300027907 Ga0207428_10002856 Ga0207428_1000285611 192
801 3300027907 Ga0207428_10158713 Ga0207428_101587132 192
802 3300028380 Ga0268265_10045549 Ga0268265_100455493 192
803 3300028794 Ga0307515_10236450 Ga0307515_102364502 192
804 3300031507 Ga0307509_10011751 Ga0307509_1001175110 192
805 3300031548 Ga0307408_100000338 Ga0307408_10000033810 192
806 3300031548 Ga0307408_100003163 Ga0307408_1000031636 192
807 3300031548 Ga0307408_100006210 Ga0307408_1000062109 192
808 3300031616 Ga0307508_10137671 Ga0307508_101376712 192
809 3300031730 Ga0307516_10314593 Ga0307516_103145932 192
810 3300031731 Ga0307405_10321694 Ga0307405_103216942 192
811 3300031731 Ga0307405_10522895 Ga0307405_105228951 192
812 3300031852 Ga0307410_10129231 Ga0307410_101292312 192
813 3300031911 Ga0307412_10000332 Ga0307412_1000033217 192
814 3300031911 Ga0307412_10125723 Ga0307412_101257233 192
815 3300031911 Ga0307412_11172917 Ga0307412_111729171 192
816 3300032004 Ga0307414_10808311 Ga0307414_108083112 192
817 3300033180 Ga0307510_10019174 Ga0307510_100191743 192
818 3300037312 Ga0395899_0000036 Ga0395899_0000036_60338_60919 192
819 3300037418 Ga0395900_0000071 Ga0395900_0000071_60338_60919 192
820 3300037466 Ga0395898_0000115 Ga0395898_0000115_46677_47258 192
821 3300041405 Ga0439438_000149 Ga0439438_000149_23751_24332 192
822 3300041405 Ga0439438_002641 Ga0439438_002641_4480_5061 192
823 3300041407 Ga0439447_002210 Ga0439447_002210_3966_4547 192
824 3300041407 Ga0439447_011078 Ga0439447_011078_1217_1798 192
825 3300041411 Ga0439466_0000719 Ga0439466_0000719_11611_12192 192
826 3300041411 Ga0439466_0000880 Ga0439466_0000880_9508_10089 192
827 3300041411 Ga0439466_0001876 Ga0439466_0001876_6487_7068 192
828 3300041494 Ga0451837_1569949 Ga0451837_1569949_271_873 192
829 3300041509 Ga0451843_0892095 Ga0451843_0892095_118_699 192
830 3300041512 Ga0451853_2345502 Ga0451853_2345502_161_772 192
831 3300041512 Ga0451853_2947663 Ga0451853_2947663_711_1292 192
832 3300041997 Ga0439431_0068524 Ga0439431_0068524_99_680 192
833 3300041999 Ga0439433_0015099 Ga0439433_0015099_471_1052 192
834 3300042004 Ga0439445_0073960 Ga0439445_0073960_31_612 192
835 3300042006 Ga0439432_065782 Ga0439432_065782_140_721 192
836 3300042006 Ga0439432_115781 Ga0439432_115781_120_701 192
837 3300042007 Ga0439449_0002301 Ga0439449_0002301_1681_2262 192
838 3300042009 Ga0439451_001608 Ga0439451_001608_1358_1939 192
839 3300042010 Ga0439452_000559 Ga0439452_000559_13216_13797 192
840 3300042010 Ga0439452_012799 Ga0439452_012799_696_1277 192
841 3300042010 Ga0439452_049128 Ga0439452_049128_276_857 192
842 3300042115 Ga0450911_005372 Ga0450911_005372_130_711 192
843 3300042123 Ga0450921_015948 Ga0450921_015948_49_630 192
844 3300042127 Ga0450890_004088 Ga0450890_004088_1122_1703 192
845 3300042137 Ga0450902_005710 Ga0450902_005710_221_802 192
846 3300042137 Ga0450902_038776 Ga0450902_038776_190_771 192
847 3300042138 Ga0450903_001727 Ga0450903_001727_1847_2428 192
848 3300042142 Ga0450905_000666 Ga0450905_000666_3575_4156 192
849 3300042156 Ga0439446_0044427 Ga0439446_0044427_113_694 192
850 3300042185 Ga0450909_008301 Ga0450909_008301_284_865 192
851 3300042532 Ga0450893_0005302 Ga0450893_0005302_75_656 192
852 3300044656 Ga0466969_0064826 Ga0466969_0064826_1081_1731 192
853 3300044669 Ga0466981_0312141 Ga0466981_0312141_253_834 192
854 3300044684 Ga0466966_0011494 Ga0466966_0011494_3545_4195 192
855 3300044684 Ga0466966_0071843 Ga0466966_0071843_486_1094 192
856 3300044693 Ga0466961_0074502 Ga0466961_0074502_829_1479 192
857 3300044694 Ga0466963_0035458 Ga0466963_0035458_51_659 192
858 3300044765 Ga0466970_0075377 Ga0466970_0075377_37_618 192
859 3300045049 Ga0466959_0020980 Ga0466959_0020980_3019_3669 192
860 3300045836 Ga0466958_0051662 Ga0466958_0051662_1265_1873 192
861 3300046452 Ga0495617_058726 Ga0495617_058726_591_1172 192
862 3300046452 Ga0495617_065748 Ga0495617_065748_156_737 192
863 3300046452 Ga0495617_119958 Ga0495617_119958_207_788 192
864 3300046455 Ga0495603_0016851 Ga0495603_0016851_2384_2965 192
865 3300046457 Ga0495590_0037979 Ga0495590_0037979_254_835 192
866 3300046457 Ga0495590_0047821 Ga0495590_0047821_28_609 192
867 3300046458 Ga0495591_053412 Ga0495591_053412_28_609 192
868 3300046459 Ga0495629_0106493 Ga0495629_0106493_778_1395 192
869 3300046460 Ga0495638_0010696 Ga0495638_0010696_693_1274 192
870 3300046460 Ga0495638_0021932 Ga0495638_0021932_334_915 192
871 3300046460 Ga0495638_0041685 Ga0495638_0041685_1286_1867 192
872 3300046460 Ga0495638_0065953 Ga0495638_0065953_1495_2076 192
873 3300046460 Ga0495638_0078445 Ga0495638_0078445_168_749 192
874 3300046460 Ga0495638_0249677 Ga0495638_0249677_247_828 192
875 3300046471 Ga0495650_0000531 Ga0495650_0000531_36234_36815 192
876 3300046471 Ga0495650_0039260 Ga0495650_0039260_897_1478 192
877 3300046474 Ga0495605_0000551 Ga0495605_0000551_11880_12461 192
878 3300046474 Ga0495605_0001579 Ga0495605_0001579_10294_10875 192
879 3300046474 Ga0495605_0001765 Ga0495605_0001765_671_1339 192
880 3300046474 Ga0495605_0004117 Ga0495605_0004117_7306_7887 192
881 3300046474 Ga0495605_0010517 Ga0495605_0010517_921_1502 192
882 3300046474 Ga0495605_0076161 Ga0495605_0076161_913_1494 192
883 3300046475 Ga0495639_0249743 Ga0495639_0249743_149_730 192
884 3300046491 Ga0495584_0000086 Ga0495584_0000086_46632_47213 192
885 3300046491 Ga0495584_0007969 Ga0495584_0007969_24_692 192
886 3300046491 Ga0495584_0012121 Ga0495584_0012121_2160_2741 192
887 3300046491 Ga0495584_0017233 Ga0495584_0017233_2635_3216 192
888 3300046491 Ga0495584_0224178 Ga0495584_0224178_236_817 192
889 3300046492 Ga0495585_0001557 Ga0495585_0001557_6535_7116 192
890 3300046492 Ga0495585_0009499 Ga0495585_0009499_337_918 192
891 3300046492 Ga0495585_0072199 Ga0495585_0072199_843_1448 192
892 3300046501 Ga0495607_0000747 Ga0495607_0000747_21987_22568 192
893 3300046501 Ga0495607_0001090 Ga0495607_0001090_21400_22068 192
894 3300046501 Ga0495607_0003073 Ga0495607_0003073_4141_4722 192
895 3300046501 Ga0495607_0009909 Ga0495607_0009909_572_1153 192
896 3300046501 Ga0495607_0035678 Ga0495607_0035678_1938_2519 192
897 3300046506 Ga0495583_0000708 Ga0495583_0000708_28083_28664 192
898 3300046506 Ga0495583_0000982 Ga0495583_0000982_21950_22531 192
899 3300046506 Ga0495583_0141801 Ga0495583_0141801_40_621 192
900 3300046507 Ga0495606_0197486 Ga0495606_0197486_515_1096 192
901 3300046512 Ga0495610_0000306 Ga0495610_0000306_3475_4056 192
902 3300046512 Ga0495610_0000638 Ga0495610_0000638_29290_29871 192
903 3300046512 Ga0495610_0122868 Ga0495610_0122868_354_935 192
904 3300046512 Ga0495610_0184185 Ga0495610_0184185_193_774 192
905 3300046513 Ga0495616_0000281 Ga0495616_0000281_2960_3628 192
906 3300046513 Ga0495616_0005083 Ga0495616_0005083_4770_5351 192
907 3300046513 Ga0495616_0007365 Ga0495616_0007365_2517_3098 192
908 3300046513 Ga0495616_0028885 Ga0495616_0028885_1483_2064 192
909 3300046513 Ga0495616_0079579 Ga0495616_0079579_955_1536 192
910 3300046517 Ga0495630_0045714 Ga0495630_0045714_1817_2398 192
911 3300046518 Ga0495631_0004732 Ga0495631_0004732_5404_5985 192
912 3300046518 Ga0495631_0005056 Ga0495631_0005056_5818_6399 192
913 3300046518 Ga0495631_0182346 Ga0495631_0182346_163_744 192
914 3300046519 Ga0495632_0000166 Ga0495632_0000166_44516_45097 192
915 3300046519 Ga0495632_0004954 Ga0495632_0004954_5315_5896 192
916 3300046519 Ga0495632_0008738 Ga0495632_0008738_2591_3172 192
917 3300046519 Ga0495632_0013043 Ga0495632_0013043_175_756 192
918 3300046519 Ga0495632_0040763 Ga0495632_0040763_474_1055 192
919 3300046520 Ga0495637_0000138 Ga0495637_0000138_31958_32539 192
920 3300046520 Ga0495637_0001577 Ga0495637_0001577_10257_10838 192
921 3300046520 Ga0495637_0004154 Ga0495637_0004154_5686_6267 192
922 3300046522 Ga0495643_0002007 Ga0495643_0002007_4178_4759 192
923 3300046522 Ga0495643_0028069 Ga0495643_0028069_2161_2742 192
924 3300046523 Ga0495644_0004518 Ga0495644_0004518_569_1150 192
925 3300046523 Ga0495644_0219185 Ga0495644_0219185_109_690 192
926 3300046524 Ga0495648_0000758 Ga0495648_0000758_31303_31884 192
927 3300046524 Ga0495648_0007082 Ga0495648_0007082_7202_7783 192
928 3300046524 Ga0495648_0030444 Ga0495648_0030444_384_965 192
929 3300046524 Ga0495648_0058557 Ga0495648_0058557_1689_2270 192
930 3300046524 Ga0495648_0159990 Ga0495648_0159990_437_1018 192
931 3300046525 Ga0495663_0085087 Ga0495663_0085087_296_877 192
932 3300046528 Ga0495642_0000016 Ga0495642_0000016_65941_66522 192
933 3300046528 Ga0495642_0006163 Ga0495642_0006163_2736_3404 192
934 3300046530 Ga0495654_0010482 Ga0495654_0010482_2535_3116 192
935 3300046530 Ga0495654_0015115 Ga0495654_0015115_2982_3563 192
936 3300046530 Ga0495654_0054824 Ga0495654_0054824_1003_1584 192
937 3300046530 Ga0495654_0114819 Ga0495654_0114819_538_1119 192
938 3300046536 Ga0495587_0043008 Ga0495587_0043008_1848_2429 192
939 3300046537 Ga0495598_0146856 Ga0495598_0146856_214_795 192
940 3300046538 Ga0495609_0000072 Ga0495609_0000072_47082_47663 192
941 3300046538 Ga0495609_0000186 Ga0495609_0000186_41821_42402 192
942 3300046538 Ga0495609_0000319 Ga0495609_0000319_37552_38220 192
943 3300046538 Ga0495609_0004779 Ga0495609_0004779_5058_5639 192
944 3300046538 Ga0495609_0024806 Ga0495609_0024806_1229_1810 192
945 3300046538 Ga0495609_0056433 Ga0495609_0056433_958_1539 192
946 3300046542 Ga0495597_0015611 Ga0495597_0015611_213_794 192
947 3300046542 Ga0495597_0073252 Ga0495597_0073252_485_1066 192
948 3300046542 Ga0495597_0148182 Ga0495597_0148182_157_738 192
949 3300046542 Ga0495597_0179086 Ga0495597_0179086_216_797 192
950 3300046557 Ga0495622_0000516 Ga0495622_0000516_21868_22449 192
951 3300046557 Ga0495622_0004427 Ga0495622_0004427_1320_1901 192
952 3300046557 Ga0495622_0022143 Ga0495622_0022143_166_747 192
953 3300046558 Ga0495633_0196555 Ga0495633_0196555_245_826 192
954 3300046558 Ga0495633_0267223 Ga0495633_0267223_46_627 192
955 3300046615 Ga0495656_0086891 Ga0495656_0086891_133_714 192
956 3300046616 Ga0495668_0009126 Ga0495668_0009126_4935_5516 192
957 3300046616 Ga0495668_0025995 Ga0495668_0025995_2152_2733 192
958 3300046616 Ga0495668_0189293 Ga0495668_0189293_70_675 192
959 3300046648 Ga0495611_0005135 Ga0495611_0005135_801_1382 192
960 3300046648 Ga0495611_0006017 Ga0495611_0006017_4241_4822 192
961 3300046648 Ga0495611_0040807 Ga0495611_0040807_837_1418 192
962 3300046660 Ga0495625_0000718 Ga0495625_0000718_31288_31869 192
963 3300046660 Ga0495625_0001903 Ga0495625_0001903_3222_3803 192
964 3300046660 Ga0495625_0010231 Ga0495625_0010231_2352_2933 192
965 3300046660 Ga0495625_0017472 Ga0495625_0017472_3880_4461 192
966 3300046660 Ga0495625_0023716 Ga0495625_0023716_262_843 192
967 3300046660 Ga0495625_0096571 Ga0495625_0096571_642_1223 192
968 3300046660 Ga0495625_0160130 Ga0495625_0160130_647_1228 192
969 3300046660 Ga0495625_0281433 Ga0495625_0281433_386_967 192
970 3300046664 Ga0495659_0000823 Ga0495659_0000823_9173_9754 192
971 3300046664 Ga0495659_0002449 Ga0495659_0002449_5093_5674 192
972 3300046664 Ga0495659_0010990 Ga0495659_0010990_1531_2112 192
973 3300046665 Ga0495661_0000914 Ga0495661_0000914_23459_24127 192
974 3300046665 Ga0495661_0019746 Ga0495661_0019746_1116_1697 192
975 3300046665 Ga0495661_0054705 Ga0495661_0054705_1071_1652 192
976 3300046665 Ga0495661_0176764 Ga0495661_0176764_71_652 192
977 3300046665 Ga0495661_0180352 Ga0495661_0180352_153_734 192
978 3300046665 Ga0495661_0182034 Ga0495661_0182034_303_884 192
979 3300046665 Ga0495661_0191544 Ga0495661_0191544_269_850 192
980 3300046674 Ga0495588_0008467 Ga0495588_0008467_1116_1697 192
981 3300046679 Ga0495623_0389317 Ga0495623_0389317_141_722 192
982 3300046684 Ga0495669_0002831 Ga0495669_0002831_5627_6208 192
983 3300046684 Ga0495669_0142317 Ga0495669_0142317_458_1039 192
984 3300046691 Ga0495670_0000171 Ga0495670_0000171_16045_16626 192
985 3300046691 Ga0495670_0054312 Ga0495670_0054312_625_1206 192
986 3300046691 Ga0495670_0081649 Ga0495670_0081649_799_1380 192
987 3300046691 Ga0495670_0283702 Ga0495670_0283702_284_865 192
988 3300046692 Ga0495671_0000138 Ga0495671_0000138_17288_17869 192
989 3300046692 Ga0495671_0005515 Ga0495671_0005515_4845_5423 192
990 3300046692 Ga0495671_0012417 Ga0495671_0012417_748_1329 192
991 3300046692 Ga0495671_0051767 Ga0495671_0051767_1027_1608 192
992 3300046692 Ga0495671_0058017 Ga0495671_0058017_964_1545 192
993 3300046692 Ga0495671_0240173 Ga0495671_0240173_265_846 192
994 3300046694 Ga0495649_0012557 Ga0495649_0012557_456_1037 192
995 3300046694 Ga0495649_0030917 Ga0495649_0030917_1637_2218 192
996 3300046694 Ga0495649_0158504 Ga0495649_0158504_138_719 192
997 3300046694 Ga0495649_0295799 Ga0495649_0295799_121_702 192
998 3300046794 Ga0495589_0000045 Ga0495589_0000045_119971_120552 192
999 3300046794 Ga0495589_0000282 Ga0495589_0000282_3203_3871 192
1000 3300046794 Ga0495589_0003117 Ga0495589_0003117_6264_6845 192
1001 3300046809 Ga0495600_0193891 Ga0495600_0193891_415_996 192
1002 3300046810 Ga0495660_0002784 Ga0495660_0002784_4518_5099 192
1003 3300047318 Ga0495636_0000276 Ga0495636_0000276_2518_3099 192
1004 3300047318 Ga0495636_0008252 Ga0495636_0008252_2161_2742 192
1005 3300047320 Ga0495672_0000312 Ga0495672_0000312_58519_59100 192
1006 3300047320 Ga0495672_0000357 Ga0495672_0000357_17683_18264 192
1007 3300047320 Ga0495672_0026485 Ga0495672_0026485_47_628 192
1008 3300047322 Ga0495680_0017133 Ga0495680_0017133_4100_4681 192
1009 3300047322 Ga0495680_0105538 Ga0495680_0105538_1276_1857 192
1010 3300047322 Ga0495680_0155626 Ga0495680_0155626_27_608 192
1011 3300047323 Ga0495683_0005825 Ga0495683_0005825_3995_4576 192
1012 3300047323 Ga0495683_0067043 Ga0495683_0067043_909_1490 192
1013 3300047323 Ga0495683_0082837 Ga0495683_0082837_24_605 192
1014 3300047443 Ga0495687_000050 Ga0495687_000050_136483_137064 192
1015 3300047443 Ga0495687_000538 Ga0495687_000538_30276_30857 192
1016 3300047443 Ga0495687_000622 Ga0495687_000622_37552_38220 192
1017 3300047443 Ga0495687_001285 Ga0495687_001285_7953_8534 192
1018 3300047443 Ga0495687_072901 Ga0495687_072901_55_636 192
1019 3300047444 Ga0495675_0000123 Ga0495675_0000123_5473_6054 192
1020 3300047445 Ga0495677_0000111 Ga0495677_0000111_37552_38220 192
1021 3300047445 Ga0495677_0000135 Ga0495677_0000135_15955_16536 192
1022 3300047445 Ga0495677_0000306 Ga0495677_0000306_6511_7092 192
1023 3300047445 Ga0495677_0041519 Ga0495677_0041519_624_1205 192
1024 3300047446 Ga0495679_010958 Ga0495679_010958_354_935 192
1025 3300047447 Ga0495685_000137 Ga0495685_000137_16166_16747 192
1026 3300047447 Ga0495685_005785 Ga0495685_005785_1526_2107 192
1027 3300047469 Ga0495673_0000138 Ga0495673_0000138_122532_123113 192
1028 3300047469 Ga0495673_0000354 Ga0495673_0000354_4799_5380 192
1029 3300047469 Ga0495673_0010358 Ga0495673_0010358_3785_4366 192
1030 3300047469 Ga0495673_0016053 Ga0495673_0016053_199_780 192
1031 3300047469 Ga0495673_0061433 Ga0495673_0061433_331_912 192
1032 3300047470 Ga0495681_0000195 Ga0495681_0000195_14932_15513 192
1033 3300047470 Ga0495681_0003860 Ga0495681_0003860_6502_7083 192
1034 3300047470 Ga0495681_0021183 Ga0495681_0021183_2495_3076 192
1035 3300047470 Ga0495681_0027946 Ga0495681_0027946_828_1409 192
1036 3300047470 Ga0495681_0078561 Ga0495681_0078561_402_983 192
1037 3300047472 Ga0495686_0007048 Ga0495686_0007048_6308_6889 192
1038 3300047472 Ga0495686_0106765 Ga0495686_0106765_481_1062 192
1039 3300047472 Ga0495686_0123045 Ga0495686_0123045_783_1364 192
1040 3300047673 Ga0495593_0010956 Ga0495593_0010956_2566_3147 192
1041 3300048091 Ga0495626_0000419 Ga0495626_0000419_39725_40306 192
1042 3300048091 Ga0495626_0006306 Ga0495626_0006306_2227_2808 192
1043 3300048091 Ga0495626_0024118 Ga0495626_0024118_1148_1816 192
1044 3300048919 Ga0496116_0144503 Ga0496116_0144503_633_1214 192
1045 3300048920 Ga0496117_0073041 Ga0496117_0073041_959_1540 192
1046 3300048920 Ga0496117_0223416 Ga0496117_0223416_328_909 192
1047 3300048921 Ga0496118_0068011 Ga0496118_0068011_1107_1688 192
1048 3300048921 Ga0496118_0113460 Ga0496118_0113460_191_772 192
1049 3300048921 Ga0496118_0203001 Ga0496118_0203001_112_693 192
1050 3300048922 Ga0496119_0076860 Ga0496119_0076860_1202_1783 192
1051 3300048924 Ga0496121_0000313 Ga0496121_0000313_56404_56985 192
1052 3300048924 Ga0496121_0006818 Ga0496121_0006818_3814_4395 192
1053 3300048924 Ga0496121_0075887 Ga0496121_0075887_444_1025 192
1054 3300048924 Ga0496121_0113847 Ga0496121_0113847_509_1090 192
1055 3300048925 Ga0496122_0000137 Ga0496122_0000137_140035_140616 192
1056 3300048925 Ga0496122_0014590 Ga0496122_0014590_3722_4303 192
1057 3300048925 Ga0496122_0070087 Ga0496122_0070087_561_1142 192
1058 3300048926 Ga0496123_0000022 Ga0496123_0000022_27924_28505 192
1059 3300048926 Ga0496123_0024975 Ga0496123_0024975_1220_1801 192
1060 3300048927 Ga0496124_0031748 Ga0496124_0031748_629_1210 192
1061 3300048927 Ga0496124_0061504 Ga0496124_0061504_223_804 192
1062 3300048928 Ga0496125_0005506 Ga0496125_0005506_8979_9560 192
1063 3300048929 Ga0496126_0003367 Ga0496126_0003367_14279_14860 192
1064 3300048929 Ga0496126_0014664 Ga0496126_0014664_4350_4931 192
1065 3300048929 Ga0496126_0200925 Ga0496126_0200925_363_944 192
1066 3300048929 Ga0496126_0440425 Ga0496126_0440425_225_806 192
1067 3300049459 Ga0495678_103588 Ga0495678_103588_225_806 192
1068 3300049460 Ga0495682_0000057 Ga0495682_0000057_60824_61405 192
1069 3300049460 Ga0495682_0000150 Ga0495682_0000150_55491_56072 192
1070 3300049460 Ga0495682_0002187 Ga0495682_0002187_5217_5798 192
1071 3300049460 Ga0495682_0050060 Ga0495682_0050060_342_923 192
1072 3300049569 Ga0501032_0074944 Ga0501032_0074944_702_1283 192
1073 3300049570 Ga0501033_0125314 Ga0501033_0125314_1076_1657 192
1074 3300049575 Ga0501039_0770585 Ga0501039_0770585_91_672 192
1075 3300049583 Ga0501067_0126497 Ga0501067_0126497_167_748 192
1076 3300050489 nmdc:mga03683_67614_c1 nmdc:mga03683_67614_c1_448_1029 192
1077 3300050492 nmdc:mga0yw44_192791_c1 nmdc:mga0yw44_192791_c1_62_646 192
1078 3300050493 nmdc:mga0k408_120711_c1 nmdc:mga0k408_120711_c1_912_1493 192
1079 3300050493 nmdc:mga0k408_76875_c1 nmdc:mga0k408_76875_c1_1113_1694 192
1080 3300050494 nmdc:mga06z11_307568_c1 nmdc:mga06z11_307568_c1_212_793 192
1081 3300050494 nmdc:mga06z11_77995_c1 nmdc:mga06z11_77995_c1_60_641 192
1082 3300050496 nmdc:mga07m45_13252_c1 nmdc:mga07m45_13252_c1_1716_2297 192
1083 3300050496 nmdc:mga07m45_24181_c1 nmdc:mga07m45_24181_c1_2420_3001 192
1084 3300053088 Ga0500644_0071631 Ga0500644_0071631_267_848 192
1085 3300053089 Ga0500581_018544 Ga0500581_018544_491_1072 192
1086 3300053090 Ga0500646_0013403 Ga0500646_0013403_259_840 192
1087 3300053094 Ga0500566_0000689 Ga0500566_0000689_12436_13017 192
1088 3300053094 Ga0500566_0001144 Ga0500566_0001144_9112_9693 192
1089 3300053096 Ga0500641_0008971 Ga0500641_0008971_1132_1713 192
1090 3300053096 Ga0500641_0061765 Ga0500641_0061765_220_801 192
1091 3300053098 Ga0500650_0053857 Ga0500650_0053857_271_852 192
1092 3300053104 Ga0500556_0000015 Ga0500556_0000015_151852_152433 192
1093 3300053105 Ga0500557_000020 Ga0500557_000020_73572_74165 192
1094 3300053117 Ga0500593_084365 Ga0500593_084365_622_1203 192
1095 3300053121 Ga0500607_060974 Ga0500607_060974_647_1228 192
1096 3300053122 Ga0500608_002235 Ga0500608_002235_141_722 192
1097 3300053123 Ga0500614_019107 Ga0500614_019107_587_1168 192
1098 3300053125 Ga0500618_003999 Ga0500618_003999_3455_4036 192
1099 3300053130 Ga0500642_0000019 Ga0500642_0000019_69850_70431 192
1100 3300053130 Ga0500642_0000057 Ga0500642_0000057_51447_52040 192
1101 3300053131 Ga0500652_000710 Ga0500652_000710_5300_5881 192
1102 3300053136 Ga0500559_0001410 Ga0500559_0001410_4830_5411 192
1103 3300053136 Ga0500559_0141020 Ga0500559_0141020_33_614 192
1104 3300053142 Ga0500577_0103967 Ga0500577_0103967_43_624 192
1105 3300053146 Ga0500588_0072342 Ga0500588_0072342_204_785 192
1106 3300053147 Ga0500589_001817 Ga0500589_001817_205_786 192
1107 3300053147 Ga0500589_240926 Ga0500589_240926_57_638 192
1108 3300053148 Ga0500590_012511 Ga0500590_012511_1886_2467 192
1109 3300053148 Ga0500590_199967 Ga0500590_199967_69_650 192
1110 3300053151 Ga0500604_0150525 Ga0500604_0150525_147_728 192
1111 3300053153 Ga0500616_0000041 Ga0500616_0000041_77735_78316 192
1112 3300053156 Ga0500622_0005571 Ga0500622_0005571_5177_5758 192
1113 3300053156 Ga0500622_0093100 Ga0500622_0093100_76_657 192
1114 3300053156 Ga0500622_0112652 Ga0500622_0112652_332_913 192
1115 3300053158 Ga0500627_0146239 Ga0500627_0146239_96_677 192
1116 3300053160 Ga0500633_0058392 Ga0500633_0058392_193_774 192
1117 3300053161 Ga0500634_0037133 Ga0500634_0037133_597_1178 192
1118 3300053162 Ga0500638_255907 Ga0500638_255907_88_669 192
1119 3300053177 Ga0500636_0000173 Ga0500636_0000173_10071_10652 192
1120 3300053177 Ga0500636_0346786 Ga0500636_0346786_115_696 192
1121 3300055283 Ga0500661_021286 Ga0500661_021286_410_991 192
1122 3300061734 Ga0530510_0507035 Ga0530510_0507035_167_748 192
1123 iso_pu_bacteria 2507262055 2507507784 192
1124 iso_pu_bacteria 2513237101 2513696353 192
1125 iso_pu_bacteria 2515154112 2515626692 192
1126 iso_pu_bacteria 2874590934 2874598893 192
1127 iso_pu_bacteria 2874645413 2874650659 192
1128 iso_pu_bacteria 2876771140 2876778932 192
1129 iso_pu_bacteria 2876818435 2876824173 192
1130 iso_pu_bacteria 2879074833 2879082725 192
1131 iso_pu_bacteria 2879127579 2879132114 192
1132 iso_pu_bacteria 2879142872 2879148359 192
1133 iso_pu_bacteria 2935608549 2935609705 192
1134 iso_pu_bacteria 2935819856 2935822867 192
1135 iso_pu_bacteria 2935847175 2935848449 192
1136 iso_pu_bacteria 2935908558 2935909747 192
1137 iso_pu_bacteria 2935916978 2935917471 192
1138 iso_pu_bacteria 2935926038 2935927228 192
1139 iso_pu_bacteria 2935934488 2935936928 192
1140 iso_pu_bacteria 2935942939 2935944769 192
1141 iso_pu_bacteria 2935951376 2935953206 192
1142 iso_pu_bacteria 2935967501 2935970046 192
1143 iso_pu_bacteria 2935975950 2935980333 192
1144 iso_pu_bacteria 2936055302 2936062032 192
1145 iso_pu_bacteria 8019638758 8019646462 192
1146 iso_pu_bacteria 8019668869 8019670859 192
1147 iso_pu_bacteria 8019678201 8019685338 192
1148 iso_pu_bacteria 8019687851 8019690936 192
1149 3300003203 JGI25406J46586_10006853 JGI25406J46586_100068535 193
1150 3300003320 rootH2_10059534 rootH2_100595342 193
1151 3300005353 Ga0070669_100205796 Ga0070669_1002057963 193
1152 3300005356 Ga0070674_100182456 Ga0070674_1001824562 193
1153 3300005434 Ga0070709_10239711 Ga0070709_102397111 193
1154 3300005546 Ga0070696_100270863 Ga0070696_1002708632 193
1155 3300005719 Ga0068861_100072448 Ga0068861_1000724483 193
1156 3300005844 Ga0068862_100409081 Ga0068862_1004090813 193
1157 3300006844 Ga0075428_100247782 Ga0075428_1002477822 193
1158 3300006844 Ga0075428_100647073 Ga0075428_1006470732 193
1159 3300006847 Ga0075431_100366461 Ga0075431_1003664613 193
1160 3300006881 Ga0068865_100103884 Ga0068865_1001038843 193
1161 3300009094 Ga0111539_10000208 Ga0111539_1000020815 193
1162 3300009094 Ga0111539_11600060 Ga0111539_116000602 193
1163 3300009553 Ga0105249_10526106 Ga0105249_105261062 193
1164 3300014326 Ga0157380_10034099 Ga0157380_100340994 193
1165 3300025284 Ga0209130_1008750 Ga0209130_10087502 193
1166 3300025961 Ga0207712_10282574 Ga0207712_102825743 193
1167 3300026118 Ga0207675_100045243 Ga0207675_1000452434 193
1168 3300027907 Ga0207428_10000016 Ga0207428_10000016191 193
1169 3300028380 Ga0268265_10533527 Ga0268265_105335272 193
1170 3300028794 Ga0307515_10007012 Ga0307515_1000701221 193
1171 3300028800 Ga0265338_10691057 Ga0265338_106910571 193
1172 3300031456 Ga0307513_10297615 Ga0307513_102976151 193
1173 3300031548 Ga0307408_100266481 Ga0307408_1002664812 193
1174 3300031728 Ga0316578_10212710 Ga0316578_102127102 193
1175 3300031730 Ga0307516_10316330 Ga0307516_103163301 193
1176 3300031824 Ga0307413_10024029 Ga0307413_100240293 193
1177 3300031903 Ga0307407_10053693 Ga0307407_100536933 193
1178 3300035398 Ga0316574_0000057 Ga0316574_0000057_9112_9699 193
1179 3300036401 Ga0373937_0221108 Ga0373937_0221108_292_876 193
1180 3300037068 Ga0373925_0725955 Ga0373925_0725955_208_792 193
1181 3300037418 Ga0395900_1047130 Ga0395900_1047130_55_639 193
1182 3300037471 Ga0395905_0000775 Ga0395905_0000775_39132_39734 193
1183 3300037471 Ga0395905_0141347 Ga0395905_0141347_1005_1589 193
1184 3300037471 Ga0395905_0200233 Ga0395905_0200233_857_1441 193
1185 3300037471 Ga0395905_0210756 Ga0395905_0210756_380_964 193
1186 3300039062 Ga0400483_055198 Ga0400483_055198_855_1439 193
1187 3300039062 Ga0400483_099673 Ga0400483_099673_602_1186 193
1188 3300039062 Ga0400483_137833 Ga0400483_137833_1582_2166 193
1189 3300039062 Ga0400483_269888 Ga0400483_269888_189_773 193
1190 3300039062 Ga0400483_281109 Ga0400483_281109_1242_1841 193
1191 3300039062 Ga0400483_289222 Ga0400483_289222_52_636 193
1192 3300041413 Ga0439465_0008944 Ga0439465_0008944_2382_2966 193
1193 3300042006 Ga0439432_089381 Ga0439432_089381_93_677 193
1194 3300042013 Ga0439456_053450 Ga0439456_053450_91_672 193
1195 3300042015 Ga0439462_0014489 Ga0439462_0014489_1375_1959 193
1196 3300045976 Ga0466967_0453901 Ga0466967_0453901_365_970 193
1197 3300046460 Ga0495638_0013625 Ga0495638_0013625_172_756 193
1198 3300046530 Ga0495654_0071796 Ga0495654_0071796_61_645 193
1199 3300048924 Ga0496121_0358330 Ga0496121_0358330_327_920 193
1200 3300049568 Ga0501031_0200272 Ga0501031_0200272_444_1028 193
1201 3300049569 Ga0501032_0126711 Ga0501032_0126711_273_857 193
1202 3300049570 Ga0501033_0054336 Ga0501033_0054336_305_889 193
1203 3300049570 Ga0501033_0560450 Ga0501033_0560450_127_720 193
1204 3300049571 Ga0501034_0106313 Ga0501034_0106313_425_1009 193
1205 3300049572 Ga0501036_0057761 Ga0501036_0057761_1656_2240 193
1206 3300049573 Ga0501037_0537767 Ga0501037_0537767_85_681 193
1207 3300049579 Ga0501043_0360780 Ga0501043_0360780_128_712 193
1208 3300049581 Ga0501047_0127817 Ga0501047_0127817_480_1064 193
1209 3300049586 Ga0501070_0160074 Ga0501070_0160074_704_1288 193
1210 3300049742 Ga0501080_0260589 Ga0501080_0260589_918_1502 193
1211 3300049822 Ga0501035_0343841 Ga0501035_0343841_318_902 193
1212 3300049823 Ga0501044_0018003 Ga0501044_0018003_6675_7259 193
1213 3300050507 nmdc:mga05p37_241795_c1 nmdc:mga05p37_241795_c1_124_705 193
1214 3300050508 nmdc:mga09592_434381_c1 nmdc:mga09592_434381_c1_261_842 193
1215 3300050510 nmdc:mga06r32_349326_c1 nmdc:mga06r32_349326_c1_595_1191 193
1216 3300050511 nmdc:mga08y16_26_c1 nmdc:mga08y16_26_c1_12870_13451 193
1217 3300053088 Ga0500644_0017141 Ga0500644_0017141_454_1038 193
1218 3300053122 Ga0500608_007502 Ga0500608_007502_1376_1960 193
1219 3300053125 Ga0500618_017814 Ga0500618_017814_303_887 193
1220 3300053136 Ga0500559_0004516 Ga0500559_0004516_2535_3128 193
1221 3300053139 Ga0500568_0084708 Ga0500568_0084708_389_973 193
1222 3300053153 Ga0500616_0087061 Ga0500616_0087061_138_722 193
1223 3300053156 Ga0500622_0000586 Ga0500622_0000586_28259_28843 193
1224 3300059421 Ga0590071_028360 Ga0590071_028360_629_1210 193
1225 3300001989 JGI24739J22299_10018697 JGI24739J22299_100186973 194
1226 3300005329 Ga0070683_100642390 Ga0070683_1006423902 194
1227 3300005539 Ga0068853_100037228 Ga0068853_1000372283 194
1228 3300005548 Ga0070665_100717317 Ga0070665_1007173172 194
1229 3300009545 Ga0105237_10569171 Ga0105237_105691712 194
1230 3300021361 Ga0213872_10036968 Ga0213872_100369682 194
1231 3300025302 Ga0207426_1000092 Ga0207426_100009274 194
1232 3300025924 Ga0207694_10012851 Ga0207694_100128513 194
1233 3300031616 Ga0307508_10103951 Ga0307508_101039511 194
1234 3300048929 Ga0496126_0364906 Ga0496126_0364906_56_640 194
1235 3300049570 Ga0501033_0033057 Ga0501033_0033057_943_1527 194
1236 3300049822 Ga0501035_0015990 Ga0501035_0015990_5546_6130 194
1237 3300049822 Ga0501035_0242035 Ga0501035_0242035_537_1121 194
1238 3300049823 Ga0501044_0044768 Ga0501044_0044768_1792_2376 194

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06684

AA_synth

Amino acid synthesis

35

208

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
3byq-assembly1.cif.gz_B crystal structure of a duf1185 family protein (bb2672) from bordetella bronchiseptica rb50 at 1.70 a resolution 0.9575 1 193
3byq-assembly1.cif.gz_B crystal structure of a duf1185 family protein (bb2672) from bordetella bronchiseptica rb50 at 1.70 a resolution 0.9527 1 193
2qtp-assembly1.cif.gz_A crystal structure of a duf1185 family protein (spo0826) from silicibacter pomeroyi dss-3 at 2.10 a resolution 0.9198 5 171
2qtp-assembly1.cif.gz_A crystal structure of a duf1185 family protein (spo0826) from silicibacter pomeroyi dss-3 at 2.10 a resolution 0.9138 5 171
5avm-assembly3.cif.gz_E crystal structures of 5-aminoimidazole ribonucleotide (air) synthetase, purm, from thermus thermophilus 0.5982 52 170
ID Description Score Start End Superfamily
3byqA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;BB2672 0.954 4 193 3.30.1330.110
3byqA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;BB2672 0.9389 4 193 3.30.1330.110
2qtpA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;BB2672 0.9181 5 171 3.30.1330.110
2qtpA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;BB2672 0.912 5 171 3.30.1330.110
2aagB00 Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor 0.6437 86 125 3.30.429.10
ID Description Score Start End GO Terms
AF-A0A529X5A4-F1-model_v4 deleted 0.999 1 114
AF-A0A440UUX6-F1-model_v4 Amino acid synthesis family protein 0.9926 1 95
AF-A0A166RNT4-F1-model_v4 Peptide synthetase 0.9906 1 173
AF-A0A529X5A4-F1-model_v4 deleted 0.9903 1 114
AF-A0A442WN23-F1-model_v4 Uncharacterized protein 0.9831 1 193

Feature Viewer

pLDDT pTM Quality
93.09 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map