F492063
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1238 | 616 | 1100 | 193 |
Family's Representative Sequence
| Representative Sequence | 3300046474|Ga0495605_0001765|Ga0495605_0001765_671_1339 |
| Length | 222 |
| Sequence | VHKNILFAQNLARRIIRPSAIPARFREKLMSLVTVRKYKLDVEEIWHEGGPRLATPLQVAVGLAIVKNPFAGRYEADLLPFMAELRQLGTELSRRMIAALGGPERVEAYGKGAVVGEDGELEHGAVWHEAGGWAMREQLGSPKAIVPAAKTIGGVGTRLMIPLGHIQAAYVRSHFGTAEMVVWDGPKRDEIAFGLAMSTGGRVHARIGGLAAQDISANDGLR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 3 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 4 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 5 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 6 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 7 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 8 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 9 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 10 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 11 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 12 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 13 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 14 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 15 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 16 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 17 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 18 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 19 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 20 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 21 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 22 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 23 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 24 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 25 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 26 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 27 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 28 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 29 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 30 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 31 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 32 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 33 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 34 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 35 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 36 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 37 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 38 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 39 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 40 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 41 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 42 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 43 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 44 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 45 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 46 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 47 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 48 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 49 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 50 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 51 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 52 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 53 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 54 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 55 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 56 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 57 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 58 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 59 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 60 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 61 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 62 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 63 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 64 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 65 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 66 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 67 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 68 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 69 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 70 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 71 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 72 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 73 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 74 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 75 | 2883577096 | Roseococcus sp. SYP-B2431 | Isolate | Rhizosphere |
| 76 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 77 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 78 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 79 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 80 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 81 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 82 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 83 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 84 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 85 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 86 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 87 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 88 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 89 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 90 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 91 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 92 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 93 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 94 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 95 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 96 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 97 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 98 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 99 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 100 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 101 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 102 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 103 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 104 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 105 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 106 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 107 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 108 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 109 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 110 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 111 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 112 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 113 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 114 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 115 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 116 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 117 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 118 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 119 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 120 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 121 | 2941479691 | |||
| 122 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 123 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 124 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 125 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 126 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 127 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 128 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 129 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 130 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 131 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 132 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 133 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 134 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 135 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 136 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 137 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 138 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 139 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 140 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 141 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 142 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 143 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 144 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 145 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 146 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 147 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 148 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 149 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 150 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 151 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 152 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 153 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 154 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 155 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 156 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 157 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 158 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 159 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 160 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 161 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 162 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 163 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 164 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 165 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 166 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 167 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 168 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 169 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 170 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 171 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 172 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 173 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 174 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 175 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 176 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 177 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 178 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 179 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 180 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 181 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 182 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 183 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 184 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 185 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 186 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 187 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 188 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 189 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 190 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 191 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 192 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 193 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 194 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 195 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 196 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 197 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 198 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 199 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 200 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 201 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 202 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 203 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 204 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 205 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 206 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 208 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 209 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 210 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 211 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 212 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 214 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 215 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 217 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 218 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 219 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 220 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 221 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 222 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 223 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 224 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 225 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 226 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 227 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 228 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 229 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 230 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 231 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 232 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 233 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 234 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 235 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 236 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 237 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 238 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 239 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 240 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 241 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 242 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 243 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 244 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 245 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 246 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 247 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 248 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 249 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 250 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 251 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 252 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 253 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 254 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 255 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 256 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 257 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 258 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 259 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 260 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 261 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 262 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 263 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 264 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 265 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 266 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 267 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 314 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 316 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 319 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 320 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 321 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 322 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 323 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 324 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 325 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 326 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 327 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 328 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 329 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 330 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 331 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 332 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 333 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 334 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 335 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 336 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 337 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 338 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 339 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 340 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 341 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 342 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 343 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 344 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 345 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 346 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 347 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 348 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 349 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 350 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 351 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 352 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 353 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 354 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 355 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 356 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 357 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 358 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 359 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 360 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 361 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 362 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 363 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 364 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 365 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 366 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 367 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 368 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 369 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 370 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 371 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 372 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 373 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 374 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 375 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 376 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 377 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 378 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 379 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 380 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 381 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 382 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 383 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 384 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 385 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 386 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 387 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 388 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 389 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 390 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 391 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 392 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 393 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 394 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 395 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 396 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 397 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 398 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 399 | 3300044669 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E | Metagenome | Unclassified |
| 400 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 401 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 402 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 403 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 404 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 405 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 406 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 407 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 408 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 409 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 410 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 411 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 412 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 413 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 484 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 485 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 486 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 487 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 488 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 489 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 490 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 491 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 492 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 493 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 494 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 495 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 496 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 497 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 498 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 499 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 500 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 501 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 502 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 503 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 504 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 505 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 506 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 507 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 508 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 509 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 512 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 513 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 514 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 515 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 516 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 517 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 518 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 519 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 520 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 521 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 522 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 523 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 524 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 525 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 526 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 527 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 528 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 529 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 530 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 531 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 532 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 533 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 534 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 535 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 536 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 537 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 538 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 539 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 540 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 541 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 542 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 543 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 544 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 545 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 546 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 547 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 548 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 549 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 550 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 551 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 552 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 553 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 554 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 556 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 557 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 558 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 559 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 560 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 561 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 562 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 563 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 564 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 565 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 566 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 567 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 568 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 569 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 570 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 571 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 572 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 573 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 574 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 575 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 576 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 577 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 578 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 579 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 580 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 581 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 582 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 583 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 584 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 585 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 586 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 587 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 588 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 589 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 590 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 591 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 592 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 593 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 594 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 595 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 596 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 597 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 598 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 599 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 600 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 601 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 602 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 603 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 604 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 605 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 606 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 607 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 608 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 609 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 610 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 611 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 612 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 613 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 614 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
| 615 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 616 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.69 |
| Metatranscriptomes | 0.16 |
| Isolates | 11.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 21 |
| Nodule | 5.49 |
| Rhizoplane | 3.07 |
| Rhizosphere | 57.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.52 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10018697 | 3300001989 | Bacteria | 2488 |
| 2 | JGI24739J22299_10065880 | 3300001989 | Bacteria | 1135 |
| 3 | JGI25150J39212_1014226 | 3300002774 | Bacteria | 1358 |
| 4 | JGI25151J46595_10001862 | 3300003187 | Bacteria | 13516 |
| 5 | JGI25151J46595_10005013 | 3300003187 | Bacteria | 6897 |
| 6 | JGI25151J46595_10008704 | 3300003187 | Bacteria | 4858 |
| 7 | JGI25406J46586_10006853 | 3300003203 | Bacteria | 5230 |
| 8 | JGI25165J46597_1005063 | 3300003214 | Bacteria | 2625 |
| 9 | JGI25153J46596_10000524 | 3300003215 | Bacteria | 24116 |
| 10 | JGI25153J46596_10001612 | 3300003215 | Bacteria | 13376 |
| 11 | rootH1_10006469 | 3300003316 | Bacteria | 3314 |
| 12 | rootH2_10059534 | 3300003320 | Bacteria | 2270 |
| 13 | rootH1_10032909 | 3300003323 | Bacteria | 3342 |
| 14 | JGI25160J50197_1002408 | 3300003354 | Bacteria | 8720 |
| 15 | JGI25160J50197_1017500 | 3300003354 | Bacteria | 2266 |
| 16 | JGI25161J50226_1002478 | 3300003374 | Bacteria | 4703 |
| 17 | Ga0006562J51391_1089446 | 3300003578 | Bacteria | 6060 |
| 18 | Ga0006562J51391_1089447 | 3300003578 | Bacteria | 4110 |
| 19 | Ga0055532_1000122 | 3300003758 | Bacteria | 79139 |
| 20 | Ga0055527_1000078 | 3300003760 | Bacteria | 79672 |
| 21 | Ga0055535_1000054 | 3300003761 | Bacteria | 131373 |
| 22 | Ga0055535_1000458 | 3300003761 | Bacteria | 37664 |
| 23 | Ga0055542_1000029 | 3300003762 | Bacteria | 248836 |
| 24 | Ga0055542_1004543 | 3300003762 | Bacteria | 3338 |
| 25 | Ga0055526_1000642 | 3300003771 | Bacteria | 27116 |
| 26 | Ga0055526_1045218 | 3300003771 | Bacteria | 1055 |
| 27 | Ga0055537_1000013 | 3300003773 | Bacteria | 133522 |
| 28 | Ga0055537_1019911 | 3300003773 | Bacteria | 1031 |
| 29 | Ga0055524_1004416 | 3300003775 | Bacteria | 6487 |
| 30 | Ga0055536_1001113 | 3300003781 | Bacteria | 16866 |
| 31 | Ga0055536_1001817 | 3300003781 | Bacteria | 12517 |
| 32 | Ga0055536_1002156 | 3300003781 | Bacteria | 11218 |
| 33 | Ga0055534_1000008 | 3300003784 | Bacteria | 211098 |
| 34 | Ga0055534_1001246 | 3300003784 | Bacteria | 10524 |
| 35 | Ga0055528_1004208 | 3300003790 | Bacteria | 6985 |
| 36 | Ga0055528_1041222 | 3300003790 | Bacteria | 1031 |
| 37 | Ga0055530_10000350 | 3300003791 | Bacteria | 41698 |
| 38 | Ga0055540_1000017 | 3300003792 | Bacteria | 231465 |
| 39 | Ga0055540_1000480 | 3300003792 | Bacteria | 30816 |
| 40 | Ga0055540_1000596 | 3300003792 | Bacteria | 26129 |
| 41 | Ga0055540_1001036 | 3300003792 | Bacteria | 17799 |
| 42 | Ga0055531_10000034 | 3300003794 | Bacteria | 150210 |
| 43 | Ga0055531_10000794 | 3300003794 | Bacteria | 26174 |
| 44 | Ga0055531_10003334 | 3300003794 | Bacteria | 10278 |
| 45 | Ga0055543_1000297 | 3300004625 | Bacteria | 35506 |
| 46 | Ga0065165_1006954 | 3300005262 | Bacteria | 5735 |
| 47 | Ga0065165_1009111 | 3300005262 | Bacteria | 4505 |
| 48 | Ga0065714_10003761 | 3300005288 | Bacteria | 6572 |
| 49 | Ga0065714_10064479 | 3300005288 | Bacteria | 55183 |
| 50 | Ga0065714_10074291 | 3300005288 | Bacteria | 3058 |
| 51 | Ga0065714_10074419 | 3300005288 | Bacteria | 3031 |
| 52 | Ga0065714_10207112 | 3300005288 | Bacteria | 877 |
| 53 | Ga0070658_10007776 | 3300005327 | Bacteria | 8640 |
| 54 | Ga0070658_10089717 | 3300005327 | Bacteria | 2531 |
| 55 | Ga0070683_100642390 | 3300005329 | Bacteria | 1016 |
| 56 | Ga0070670_100061461 | 3300005331 | Bacteria | 3224 |
| 57 | Ga0070682_100067873 | 3300005337 | Bacteria | 2272 |
| 58 | Ga0070682_100418806 | 3300005337 | Bacteria | 1017 |
| 59 | Ga0070668_100287766 | 3300005347 | Bacteria | 1374 |
| 60 | Ga0070668_100557237 | 3300005347 | Bacteria | 998 |
| 61 | Ga0070668_100759046 | 3300005347 | Bacteria | 859 |
| 62 | Ga0070669_100205796 | 3300005353 | Bacteria | 1550 |
| 63 | Ga0070675_100171954 | 3300005354 | Bacteria | 1869 |
| 64 | Ga0070671_100026204 | 3300005355 | Bacteria | 4790 |
| 65 | Ga0070674_100164048 | 3300005356 | Bacteria | 1688 |
| 66 | Ga0070674_100182456 | 3300005356 | Bacteria | 1609 |
| 67 | Ga0070673_100011258 | 3300005364 | Bacteria | 6100 |
| 68 | Ga0070659_100089411 | 3300005366 | Bacteria | 2467 |
| 69 | Ga0070667_100007828 | 3300005367 | Bacteria | 8862 |
| 70 | Ga0070667_100055974 | 3300005367 | Bacteria | 3331 |
| 71 | Ga0070709_10239711 | 3300005434 | Bacteria | 1302 |
| 72 | Ga0070714_100394864 | 3300005435 | Bacteria | 1306 |
| 73 | Ga0070663_100271830 | 3300005455 | Bacteria | 1348 |
| 74 | Ga0070678_100172746 | 3300005456 | Bacteria | 1762 |
| 75 | Ga0070662_100082922 | 3300005457 | Bacteria | 2392 |
| 76 | Ga0070662_100917269 | 3300005457 | Bacteria | 748 |
| 77 | Ga0068867_100003215 | 3300005459 | Bacteria | 11517 |
| 78 | Ga0070685_10379590 | 3300005466 | Bacteria | 973 |
| 79 | Ga0068853_100037228 | 3300005539 | Bacteria | 4140 |
| 80 | Ga0068853_100161555 | 3300005539 | Bacteria | 2022 |
| 81 | Ga0070672_100002432 | 3300005543 | Bacteria | 11807 |
| 82 | Ga0070672_100148520 | 3300005543 | Unclassified | 1938 |
| 83 | Ga0070672_100291448 | 3300005543 | Unclassified | 1382 |
| 84 | Ga0070696_100270863 | 3300005546 | Bacteria | 1291 |
| 85 | Ga0070665_100029762 | 3300005548 | Bacteria | 5495 |
| 86 | Ga0070665_100091135 | 3300005548 | Plasmid | 3054 |
| 87 | Ga0070665_100637408 | 3300005548 | Bacteria | 1079 |
| 88 | Ga0070665_100717317 | 3300005548 | Bacteria | 1013 |
| 89 | Ga0070665_101010375 | 3300005548 | Bacteria | 844 |
| 90 | Ga0068855_100012150 | 3300005563 | Bacteria | 10404 |
| 91 | Ga0068855_100023740 | 3300005563 | Bacteria | 7345 |
| 92 | Ga0068857_100007525 | 3300005577 | Bacteria | 9371 |
| 93 | Ga0068857_100190665 | 3300005577 | Bacteria | 1867 |
| 94 | Ga0068857_101095876 | 3300005577 | Bacteria | 769 |
| 95 | Ga0068856_100420179 | 3300005614 | Bacteria | 1357 |
| 96 | Ga0068852_100036759 | 3300005616 | Bacteria | 4101 |
| 97 | Ga0068859_100227938 | 3300005617 | Bacteria | 1951 |
| 98 | Ga0068861_100072448 | 3300005719 | Bacteria | 2673 |
| 99 | Ga0068861_100138851 | 3300005719 | Bacteria | 1981 |
| 100 | Ga0068851_10011128 | 3300005834 | Bacteria | 4213 |
| 101 | Ga0068863_100151684 | 3300005841 | Bacteria | 2217 |
| 102 | Ga0068858_100843716 | 3300005842 | Bacteria | 895 |
| 103 | Ga0068860_100550446 | 3300005843 | Bacteria | 1156 |
| 104 | Ga0068862_100079023 | 3300005844 | Bacteria | 2851 |
| 105 | Ga0068862_100104809 | 3300005844 | Bacteria | 2478 |
| 106 | Ga0068862_100113857 | 3300005844 | Bacteria | 2377 |
| 107 | Ga0068862_100409081 | 3300005844 | Bacteria | 1271 |
| 108 | Ga0081455_10438662 | 3300005937 | Bacteria | 895 |
| 109 | Ga0081538_10044611 | 3300005981 | Bacteria | 2762 |
| 110 | Ga0081540_1000904 | 3300005983 | Bacteria | 26798 |
| 111 | Ga0081540_1019975 | 3300005983 | Bacteria | 4047 |
| 112 | Ga0081539_10006459 | 3300005985 | Bacteria | 11234 |
| 113 | Ga0081539_10031065 | 3300005985 | Bacteria | 3300 |
| 114 | Ga0075365_10007694 | 3300006038 | Bacteria | 6061 |
| 115 | Ga0075365_10099933 | 3300006038 | Bacteria | 1985 |
| 116 | Ga0075365_10331089 | 3300006038 | Bacteria | 1073 |
| 117 | Ga0075368_10083080 | 3300006042 | Bacteria | 1305 |
| 118 | Ga0075363_100078457 | 3300006048 | Bacteria | 1803 |
| 119 | Ga0075363_100343408 | 3300006048 | Bacteria | 871 |
| 120 | Ga0075364_10009966 | 3300006051 | Bacteria | 5719 |
| 121 | Ga0075364_10069073 | 3300006051 | Bacteria | 2324 |
| 122 | Ga0075364_10427925 | 3300006051 | Bacteria | 904 |
| 123 | Ga0075432_10008151 | 3300006058 | Bacteria | 3572 |
| 124 | Ga0075432_10023817 | 3300006058 | Bacteria | 2097 |
| 125 | Ga0075432_10034676 | 3300006058 | Bacteria | 1753 |
| 126 | Ga0075432_10037918 | 3300006058 | Bacteria | 1678 |
| 127 | Ga0075362_10007473 | 3300006177 | Bacteria | 4141 |
| 128 | Ga0075362_10022548 | 3300006177 | Bacteria | 2654 |
| 129 | Ga0075362_10070372 | 3300006177 | Bacteria | 1597 |
| 130 | Ga0075362_10084199 | 3300006177 | Bacteria | 1469 |
| 131 | Ga0075362_10228658 | 3300006177 | Bacteria | 910 |
| 132 | Ga0075367_10007939 | 3300006178 | Bacteria | 5470 |
| 133 | Ga0075367_10350269 | 3300006178 | Bacteria | 932 |
| 134 | Ga0075369_10130131 | 3300006186 | Bacteria | 1143 |
| 135 | Ga0075369_10233287 | 3300006186 | Bacteria | 853 |
| 136 | Ga0075366_10003598 | 3300006195 | Bacteria | 8207 |
| 137 | Ga0075366_10013698 | 3300006195 | Bacteria | 4622 |
| 138 | Ga0075366_10071240 | 3300006195 | Bacteria | 2071 |
| 139 | Ga0075366_10090209 | 3300006195 | Bacteria | 1835 |
| 140 | Ga0075366_10134002 | 3300006195 | Bacteria | 1496 |
| 141 | Ga0075366_10135302 | 3300006195 | Bacteria | 1488 |
| 142 | Ga0075366_10376457 | 3300006195 | Bacteria | 873 |
| 143 | Ga0075370_10004534 | 3300006353 | Bacteria | 6762 |
| 144 | Ga0075370_10006518 | 3300006353 | Bacteria | 5876 |
| 145 | Ga0075370_10008423 | 3300006353 | Bacteria | 5308 |
| 146 | Ga0075370_10015503 | 3300006353 | Bacteria | 4081 |
| 147 | Ga0075370_10034794 | 3300006353 | Bacteria | 2825 |
| 148 | Ga0075370_10037095 | 3300006353 | Bacteria | 2739 |
| 149 | Ga0075370_10046470 | 3300006353 | Bacteria | 2457 |
| 150 | Ga0075370_10064178 | 3300006353 | Bacteria | 2094 |
| 151 | Ga0075370_10147610 | 3300006353 | Bacteria | 1377 |
| 152 | Ga0075428_100247782 | 3300006844 | Bacteria | 1920 |
| 153 | Ga0075428_100647073 | 3300006844 | Bacteria | 1127 |
| 154 | Ga0075431_100366461 | 3300006847 | Bacteria | 1446 |
| 155 | Ga0068865_100048958 | 3300006881 | Bacteria | 2911 |
| 156 | Ga0068865_100103884 | 3300006881 | Bacteria | 2085 |
| 157 | Ga0097620_100227952 | 3300006931 | Bacteria | 1951 |
| 158 | Ga0099826_10009909 | 3300006948 | Bacteria | 7120 |
| 159 | Ga0099826_10076909 | 3300006948 | Bacteria | 2095 |
| 160 | Ga0105251_10001140 | 3300009011 | Bacteria | 23124 |
| 161 | Ga0105244_10029744 | 3300009036 | Bacteria | 2914 |
| 162 | Ga0105250_10012881 | 3300009092 | Bacteria | 3443 |
| 163 | Ga0105240_10000593 | 3300009093 | Bacteria | 67263 |
| 164 | Ga0105240_10013249 | 3300009093 | Bacteria | 11338 |
| 165 | Ga0105240_10181781 | 3300009093 | Bacteria | 2481 |
| 166 | Ga0111539_10000208 | 3300009094 | Bacteria | 69518 |
| 167 | Ga0111539_11600060 | 3300009094 | Bacteria | 756 |
| 168 | Ga0111539_11705122 | 3300009094 | Bacteria | 731 |
| 169 | Ga0105245_10042336 | 3300009098 | Bacteria | 4063 |
| 170 | Ga0105245_10224019 | 3300009098 | Bacteria | 1816 |
| 171 | Ga0105245_10925507 | 3300009098 | Bacteria | 914 |
| 172 | Ga0105247_10062041 | 3300009101 | Bacteria | 2319 |
| 173 | Ga0105247_10118400 | 3300009101 | Bacteria | 1713 |
| 174 | Ga0105247_10609766 | 3300009101 | Bacteria | 810 |
| 175 | Ga0114129_11793092 | 3300009147 | Bacteria | 746 |
| 176 | Ga0105243_10045708 | 3300009148 | Bacteria | 3442 |
| 177 | Ga0105243_10340671 | 3300009148 | Bacteria | 1373 |
| 178 | Ga0105243_11021701 | 3300009148 | Bacteria | 831 |
| 179 | Ga0105241_10431693 | 3300009174 | Bacteria | 1162 |
| 180 | Ga0105248_10218363 | 3300009177 | Bacteria | 2147 |
| 181 | Ga0105248_10478889 | 3300009177 | Bacteria | 1403 |
| 182 | Ga0105237_10002173 | 3300009545 | Bacteria | 24616 |
| 183 | Ga0105237_10004597 | 3300009545 | Bacteria | 15930 |
| 184 | Ga0105237_10042261 | 3300009545 | Bacteria | 4598 |
| 185 | Ga0105237_10569171 | 3300009545 | Bacteria | 1140 |
| 186 | Ga0105237_10750960 | 3300009545 | Bacteria | 982 |
| 187 | Ga0105237_11438483 | 3300009545 | Bacteria | 696 |
| 188 | Ga0105238_10898135 | 3300009551 | Bacteria | 904 |
| 189 | Ga0105249_10043409 | 3300009553 | Bacteria | 4088 |
| 190 | Ga0105249_10526106 | 3300009553 | Bacteria | 1230 |
| 191 | Ga0105239_10203277 | 3300010375 | Bacteria | 2220 |
| 192 | Ga0105246_10004906 | 3300011119 | Bacteria | 8152 |
| 193 | Ga0105246_10083663 | 3300011119 | Bacteria | 2281 |
| 194 | Ga0105246_10119114 | 3300011119 | Bacteria | 1953 |
| 195 | Ga0157373_10002545 | 3300013100 | Bacteria | 13875 |
| 196 | Ga0157373_10013430 | 3300013100 | Bacteria | 6007 |
| 197 | Ga0157371_10037776 | 3300013102 | Bacteria | 3455 |
| 198 | Ga0157370_10073112 | 3300013104 | Bacteria | 3235 |
| 199 | Ga0157370_10081525 | 3300013104 | Bacteria | 3044 |
| 200 | Ga0157369_10000059 | 3300013105 | Bacteria | 154283 |
| 201 | Ga0157369_10006869 | 3300013105 | Bacteria | 13129 |
| 202 | Ga0157374_10000044 | 3300013296 | Bacteria | 144848 |
| 203 | Ga0163162_10131314 | 3300013306 | Bacteria | 2613 |
| 204 | Ga0163162_10160588 | 3300013306 | Bacteria | 2369 |
| 205 | Ga0163162_11104727 | 3300013306 | Bacteria | 898 |
| 206 | Ga0157372_10837308 | 3300013307 | Bacteria | 1068 |
| 207 | Ga0157375_10012536 | 3300013308 | Bacteria | 7524 |
| 208 | Ga0157375_10023559 | 3300013308 | Bacteria | 5682 |
| 209 | Ga0157375_10161067 | 3300013308 | Bacteria | 2385 |
| 210 | Ga0157375_10542103 | 3300013308 | Unclassified | 1326 |
| 211 | Ga0157375_11360151 | 3300013308 | Bacteria | 836 |
| 212 | Ga0157380_10034099 | 3300014326 | Bacteria | 3925 |
| 213 | Ga0182008_10037035 | 3300014497 | Bacteria | 2441 |
| 214 | Ga0182008_10424475 | 3300014497 | Bacteria | 718 |
| 215 | Ga0157379_10145085 | 3300014968 | Bacteria | 2140 |
| 216 | Ga0182006_1063164 | 3300015261 | Bacteria | 1392 |
| 217 | Ga0182006_1093053 | 3300015261 | Bacteria | 1081 |
| 218 | Ga0182007_10029701 | 3300015262 | Bacteria | 1871 |
| 219 | Ga0182007_10050873 | 3300015262 | Bacteria | 1367 |
| 220 | Ga0182005_1000403 | 3300015265 | Bacteria | 23610 |
| 221 | Ga0183362_10002 | 3300015683 | Bacteria | 1432711 |
| 222 | Ga0163161_10001036 | 3300017792 | Bacteria | 21172 |
| 223 | Ga0163161_10011465 | 3300017792 | Bacteria | 6150 |
| 224 | Ga0163161_10051165 | 3300017792 | Bacteria | 2991 |
| 225 | Ga0163161_10127690 | 3300017792 | Bacteria | 1916 |
| 226 | Ga0163161_10211875 | 3300017792 | Bacteria | 1497 |
| 227 | Ga0163161_10582355 | 3300017792 | Bacteria | 921 |
| 228 | Ga0163161_10677115 | 3300017792 | Bacteria | 857 |
| 229 | Ga0213873_10049182 | 3300021358 | Bacteria | 1111 |
| 230 | Ga0213872_10036968 | 3300021361 | Bacteria | 2230 |
| 231 | Ga0213871_10021859 | 3300021441 | Bacteria | 1598 |
| 232 | Ga0209436_101898 | 3300025208 | Bacteria | 6743 |
| 233 | Ga0209674_100130 | 3300025226 | Bacteria | 119638 |
| 234 | Ga0209672_100036 | 3300025228 | Bacteria | 287801 |
| 235 | Ga0209672_100488 | 3300025228 | Bacteria | 22061 |
| 236 | Ga0209672_107059 | 3300025228 | Bacteria | 1766 |
| 237 | Ga0209147_100066 | 3300025229 | Bacteria | 232474 |
| 238 | Ga0209147_100494 | 3300025229 | Bacteria | 23316 |
| 239 | Ga0209258_100018 | 3300025242 | Bacteria | 567561 |
| 240 | Ga0209258_100085 | 3300025242 | Bacteria | 244731 |
| 241 | Ga0207425_1000890 | 3300025245 | Bacteria | 14500 |
| 242 | Ga0207425_1006777 | 3300025245 | Bacteria | 3097 |
| 243 | Ga0209148_1000030 | 3300025254 | Bacteria | 567582 |
| 244 | Ga0209148_1000198 | 3300025254 | Bacteria | 109136 |
| 245 | Ga0209759_1000993 | 3300025256 | Bacteria | 19459 |
| 246 | Ga0209129_1003720 | 3300025258 | Bacteria | 6456 |
| 247 | Ga0209129_1004626 | 3300025258 | Bacteria | 5268 |
| 248 | Ga0209233_1007634 | 3300025261 | Bacteria | 3409 |
| 249 | Ga0209565_1000042 | 3300025263 | Bacteria | 239712 |
| 250 | Ga0209565_1001579 | 3300025263 | Bacteria | 9706 |
| 251 | Ga0209455_1000289 | 3300025272 | Bacteria | 53897 |
| 252 | Ga0209673_1000071 | 3300025273 | Bacteria | 239966 |
| 253 | Ga0209673_1000940 | 3300025273 | Bacteria | 36505 |
| 254 | Ga0209673_1001066 | 3300025273 | Bacteria | 31244 |
| 255 | Ga0209673_1004735 | 3300025273 | Bacteria | 7159 |
| 256 | Ga0209130_1000230 | 3300025284 | Bacteria | 73335 |
| 257 | Ga0209130_1008750 | 3300025284 | Bacteria | 2957 |
| 258 | Ga0209130_1011217 | 3300025284 | Bacteria | 2410 |
| 259 | Ga0209675_1000041 | 3300025291 | Bacteria | 239712 |
| 260 | Ga0209675_1003973 | 3300025291 | Bacteria | 6754 |
| 261 | Ga0209676_1000004 | 3300025292 | Bacteria | 1138360 |
| 262 | Ga0209676_1000123 | 3300025292 | Bacteria | 195351 |
| 263 | Ga0209676_1002561 | 3300025292 | Bacteria | 12580 |
| 264 | Ga0209676_1012302 | 3300025292 | Bacteria | 3376 |
| 265 | Ga0209025_1000040 | 3300025294 | Bacteria | 376228 |
| 266 | Ga0209025_1000113 | 3300025294 | Bacteria | 218943 |
| 267 | Ga0209025_1001177 | 3300025294 | Bacteria | 37045 |
| 268 | Ga0209025_1010408 | 3300025294 | Bacteria | 6303 |
| 269 | Ga0209025_1019267 | 3300025294 | Bacteria | 3802 |
| 270 | Ga0209564_1000319 | 3300025295 | Bacteria | 93563 |
| 271 | Ga0209564_1006998 | 3300025295 | Bacteria | 5916 |
| 272 | Ga0209758_1000011 | 3300025297 | Bacteria | 1049685 |
| 273 | Ga0209758_1000169 | 3300025297 | Bacteria | 149782 |
| 274 | Ga0209758_1000359 | 3300025297 | Bacteria | 81559 |
| 275 | Ga0209758_1004154 | 3300025297 | Bacteria | 12339 |
| 276 | Ga0209758_1007868 | 3300025297 | Bacteria | 7093 |
| 277 | Ga0209758_1022817 | 3300025297 | Bacteria | 2853 |
| 278 | Ga0209758_1025357 | 3300025297 | Bacteria | 2605 |
| 279 | Ga0209050_1000002 | 3300025298 | Bacteria | 1792849 |
| 280 | Ga0209050_1000037 | 3300025298 | Bacteria | 415612 |
| 281 | Ga0209050_1001339 | 3300025298 | Bacteria | 27306 |
| 282 | Ga0209050_1001596 | 3300025298 | Bacteria | 23431 |
| 283 | Ga0209050_1017511 | 3300025298 | Bacteria | 2850 |
| 284 | Ga0209256_1000166 | 3300025299 | Bacteria | 133549 |
| 285 | Ga0209256_1004821 | 3300025299 | Bacteria | 8181 |
| 286 | Ga0207426_1000092 | 3300025302 | Bacteria | 278907 |
| 287 | Ga0207426_1000325 | 3300025302 | Bacteria | 91634 |
| 288 | Ga0207426_1000389 | 3300025302 | Bacteria | 75042 |
| 289 | Ga0207426_1012504 | 3300025302 | Bacteria | 3184 |
| 290 | Ga0207426_1049462 | 3300025302 | Bacteria | 1258 |
| 291 | Ga0209051_1000002 | 3300025303 | Bacteria | 1631846 |
| 292 | Ga0209051_1000040 | 3300025303 | Bacteria | 315055 |
| 293 | Ga0209051_1000091 | 3300025303 | Bacteria | 173683 |
| 294 | Ga0209051_1000128 | 3300025303 | Bacteria | 142159 |
| 295 | Ga0209257_1000002 | 3300025304 | Bacteria | 1767052 |
| 296 | Ga0209257_1000276 | 3300025304 | Bacteria | 116802 |
| 297 | Ga0209257_1000640 | 3300025304 | Bacteria | 55997 |
| 298 | Ga0209257_1001035 | 3300025304 | Bacteria | 37155 |
| 299 | Ga0207656_10032702 | 3300025321 | Bacteria | 2161 |
| 300 | Ga0207655_1003737 | 3300025728 | Bacteria | 11177 |
| 301 | Ga0207642_10371339 | 3300025899 | Bacteria | 849 |
| 302 | Ga0207710_10035905 | 3300025900 | Bacteria | 2183 |
| 303 | Ga0207647_10167197 | 3300025904 | Bacteria | 1281 |
| 304 | Ga0207645_10001280 | 3300025907 | Bacteria | 20687 |
| 305 | Ga0207643_10036289 | 3300025908 | Bacteria | 2764 |
| 306 | Ga0207643_10055747 | 3300025908 | Bacteria | 2248 |
| 307 | Ga0207705_10007418 | 3300025909 | Bacteria | 8065 |
| 308 | Ga0207705_10212823 | 3300025909 | Bacteria | 1466 |
| 309 | Ga0207654_10741385 | 3300025911 | Unclassified | 707 |
| 310 | Ga0207695_10000012 | 3300025913 | Bacteria | 840961 |
| 311 | Ga0207695_10720704 | 3300025913 | Bacteria | 878 |
| 312 | Ga0207671_10024648 | 3300025914 | Bacteria | 4519 |
| 313 | Ga0207671_10201703 | 3300025914 | Bacteria | 1554 |
| 314 | Ga0207663_10661450 | 3300025916 | Bacteria | 825 |
| 315 | Ga0207657_10037373 | 3300025919 | Bacteria | 4336 |
| 316 | Ga0207681_10264730 | 3300025923 | Bacteria | 1347 |
| 317 | Ga0207694_10012851 | 3300025924 | Bacteria | 6305 |
| 318 | Ga0207694_10352320 | 3300025924 | Bacteria | 1219 |
| 319 | Ga0207650_10087320 | 3300025925 | Bacteria | 2376 |
| 320 | Ga0207650_10294159 | 3300025925 | Bacteria | 1325 |
| 321 | Ga0207659_10096692 | 3300025926 | Bacteria | 2217 |
| 322 | Ga0207687_10083811 | 3300025927 | Bacteria | 2309 |
| 323 | Ga0207687_10563955 | 3300025927 | Bacteria | 956 |
| 324 | Ga0207644_10007662 | 3300025931 | Bacteria | 7041 |
| 325 | Ga0207690_10045947 | 3300025932 | Bacteria | 2889 |
| 326 | Ga0207706_10105226 | 3300025933 | Bacteria | 2483 |
| 327 | Ga0207706_10176735 | 3300025933 | Bacteria | 1875 |
| 328 | Ga0207709_10008456 | 3300025935 | Bacteria | 5693 |
| 329 | Ga0207709_10098934 | 3300025935 | Bacteria | 1924 |
| 330 | Ga0207709_10102873 | 3300025935 | Bacteria | 1892 |
| 331 | Ga0207709_10399892 | 3300025935 | Bacteria | 1050 |
| 332 | Ga0207670_10415282 | 3300025936 | Bacteria | 1078 |
| 333 | Ga0207704_10051188 | 3300025938 | Bacteria | 2496 |
| 334 | Ga0207704_10247933 | 3300025938 | Bacteria | 1335 |
| 335 | Ga0207691_10001439 | 3300025940 | Bacteria | 23737 |
| 336 | Ga0207691_10080660 | 3300025940 | Bacteria | 2926 |
| 337 | Ga0207691_10401401 | 3300025940 | Unclassified | 1169 |
| 338 | Ga0207711_10449388 | 3300025941 | Bacteria | 1200 |
| 339 | Ga0207689_10044219 | 3300025942 | Bacteria | 3681 |
| 340 | Ga0207679_10130143 | 3300025945 | Bacteria | 2018 |
| 341 | Ga0207667_10009505 | 3300025949 | Bacteria | 11441 |
| 342 | Ga0207667_10013355 | 3300025949 | Bacteria | 9401 |
| 343 | Ga0207651_10116156 | 3300025960 | Bacteria | 2019 |
| 344 | Ga0207712_10282574 | 3300025961 | Bacteria | 1355 |
| 345 | Ga0207712_10321970 | 3300025961 | Bacteria | 1276 |
| 346 | Ga0207668_11075075 | 3300025972 | Bacteria | 721 |
| 347 | Ga0207640_11111296 | 3300025981 | Bacteria | 700 |
| 348 | Ga0207658_10001632 | 3300025986 | Bacteria | 17203 |
| 349 | Ga0207658_10025023 | 3300025986 | Bacteria | 4178 |
| 350 | Ga0207658_10042856 | 3300025986 | Bacteria | 3286 |
| 351 | Ga0207658_10103958 | 3300025986 | Bacteria | 2231 |
| 352 | Ga0207677_10012746 | 3300026023 | Bacteria | 4848 |
| 353 | Ga0207703_10043282 | 3300026035 | Bacteria | 3614 |
| 354 | Ga0207639_10082559 | 3300026041 | Bacteria | 2548 |
| 355 | Ga0207678_10008402 | 3300026067 | Bacteria | 9107 |
| 356 | Ga0207678_10080588 | 3300026067 | Bacteria | 2787 |
| 357 | Ga0207708_10153607 | 3300026075 | Bacteria | 1814 |
| 358 | Ga0207641_10456416 | 3300026088 | Bacteria | 1236 |
| 359 | Ga0207648_10073220 | 3300026089 | Bacteria | 2986 |
| 360 | Ga0207648_10099462 | 3300026089 | Bacteria | 2547 |
| 361 | Ga0207648_10321353 | 3300026089 | Bacteria | 1391 |
| 362 | Ga0207648_10330196 | 3300026089 | Unclassified | 1372 |
| 363 | Ga0207676_10199040 | 3300026095 | Bacteria | 1769 |
| 364 | Ga0207674_10007877 | 3300026116 | Bacteria | 12381 |
| 365 | Ga0207674_10162170 | 3300026116 | Bacteria | 2190 |
| 366 | Ga0207674_10369866 | 3300026116 | Bacteria | 1386 |
| 367 | Ga0207674_10414373 | 3300026116 | Bacteria | 1302 |
| 368 | Ga0207675_100045243 | 3300026118 | Bacteria | 4112 |
| 369 | Ga0207675_100184054 | 3300026118 | Bacteria | 2001 |
| 370 | Ga0207675_100473096 | 3300026118 | Bacteria | 1244 |
| 371 | Ga0207683_10051718 | 3300026121 | Bacteria | 3599 |
| 372 | Ga0207683_10216873 | 3300026121 | Bacteria | 1743 |
| 373 | Ga0207683_10580141 | 3300026121 | Bacteria | 1037 |
| 374 | Ga0207698_10066687 | 3300026142 | Bacteria | 2834 |
| 375 | Ga0209282_1039175 | 3300027666 | Bacteria | 2830 |
| 376 | Ga0209966_1082362 | 3300027695 | Bacteria | 714 |
| 377 | Ga0207428_10000016 | 3300027907 | Bacteria | 327690 |
| 378 | Ga0207428_10002856 | 3300027907 | Bacteria | 17129 |
| 379 | Ga0207428_10158713 | 3300027907 | Bacteria | 1718 |
| 380 | Ga0207428_10195605 | 3300027907 | Bacteria | 1523 |
| 381 | Ga0268266_10030056 | 3300028379 | Bacteria | 4616 |
| 382 | Ga0268265_10007850 | 3300028380 | Bacteria | 7201 |
| 383 | Ga0268265_10034773 | 3300028380 | Bacteria | 3676 |
| 384 | Ga0268265_10045549 | 3300028380 | Bacteria | 3274 |
| 385 | Ga0268265_10274687 | 3300028380 | Bacteria | 1505 |
| 386 | Ga0268265_10533527 | 3300028380 | Bacteria | 1111 |
| 387 | Ga0307517_10227876 | 3300028786 | Unclassified | 1123 |
| 388 | Ga0307515_10000047 | 3300028794 | Bacteria | 291475 |
| 389 | Ga0307515_10007012 | 3300028794 | Bacteria | 22381 |
| 390 | Ga0307515_10067589 | 3300028794 | Bacteria | 4926 |
| 391 | Ga0307515_10236450 | 3300028794 | Bacteria | 1607 |
| 392 | Ga0265338_10691057 | 3300028800 | Bacteria | 705 |
| 393 | Ga0265327_10128284 | 3300031251 | Bacteria | 1195 |
| 394 | Ga0307513_10022346 | 3300031456 | Bacteria | 7439 |
| 395 | Ga0307513_10041073 | 3300031456 | Bacteria | 5109 |
| 396 | Ga0307513_10297615 | 3300031456 | Bacteria | 1382 |
| 397 | Ga0307509_10011751 | 3300031507 | Bacteria | 10559 |
| 398 | Ga0307408_100000338 | 3300031548 | Bacteria | 44357 |
| 399 | Ga0307408_100003163 | 3300031548 | Bacteria | 11355 |
| 400 | Ga0307408_100006210 | 3300031548 | Bacteria | 7936 |
| 401 | Ga0307408_100030968 | 3300031548 | Bacteria | 3720 |
| 402 | Ga0307408_100134386 | 3300031548 | Bacteria | 1933 |
| 403 | Ga0307408_100258781 | 3300031548 | Bacteria | 1439 |
| 404 | Ga0307408_100266481 | 3300031548 | Bacteria | 1420 |
| 405 | Ga0307408_100605898 | 3300031548 | Bacteria | 974 |
| 406 | Ga0307408_101111667 | 3300031548 | Bacteria | 733 |
| 407 | Ga0307508_10103951 | 3300031616 | Bacteria | 2437 |
| 408 | Ga0307508_10137671 | 3300031616 | Bacteria | 2045 |
| 409 | Ga0307508_10140453 | 3300031616 | Bacteria | 2019 |
| 410 | Ga0307514_10003247 | 3300031649 | Bacteria | 15881 |
| 411 | Ga0316578_10212710 | 3300031728 | Bacteria | 1163 |
| 412 | Ga0307516_10093460 | 3300031730 | Bacteria | 2833 |
| 413 | Ga0307516_10314593 | 3300031730 | Bacteria | 1238 |
| 414 | Ga0307516_10316330 | 3300031730 | Bacteria | 1233 |
| 415 | Ga0307405_10011136 | 3300031731 | Bacteria | 4694 |
| 416 | Ga0307405_10064598 | 3300031731 | Bacteria | 2327 |
| 417 | Ga0307405_10203066 | 3300031731 | Bacteria | 1441 |
| 418 | Ga0307405_10231812 | 3300031731 | Bacteria | 1362 |
| 419 | Ga0307405_10321694 | 3300031731 | Bacteria | 1182 |
| 420 | Ga0307405_10522895 | 3300031731 | Bacteria | 955 |
| 421 | Ga0307405_11363096 | 3300031731 | Bacteria | 619 |
| 422 | Ga0307413_10024029 | 3300031824 | Bacteria | 3314 |
| 423 | Ga0307410_10129231 | 3300031852 | Bacteria | 1854 |
| 424 | Ga0307406_10316912 | 3300031901 | Bacteria | 1205 |
| 425 | Ga0307407_10053693 | 3300031903 | Bacteria | 2320 |
| 426 | Ga0307412_10000332 | 3300031911 | Bacteria | 30021 |
| 427 | Ga0307412_10003750 | 3300031911 | Bacteria | 8445 |
| 428 | Ga0307412_10125723 | 3300031911 | Bacteria | 1854 |
| 429 | Ga0307412_10157598 | 3300031911 | Bacteria | 1682 |
| 430 | Ga0307412_10247862 | 3300031911 | Bacteria | 1381 |
| 431 | Ga0307412_10267922 | 3300031911 | Bacteria | 1335 |
| 432 | Ga0307412_11172917 | 3300031911 | Bacteria | 686 |
| 433 | Ga0307416_100326925 | 3300032002 | Bacteria | 1539 |
| 434 | Ga0307414_10042687 | 3300032004 | Bacteria | 3083 |
| 435 | Ga0307414_10047247 | 3300032004 | Bacteria | 2961 |
| 436 | Ga0307414_10109071 | 3300032004 | Bacteria | 2102 |
| 437 | Ga0307414_10419560 | 3300032004 | Bacteria | 1166 |
| 438 | Ga0307414_10570503 | 3300032004 | Bacteria | 1011 |
| 439 | Ga0307414_10808311 | 3300032004 | Bacteria | 855 |
| 440 | Ga0307411_10053082 | 3300032005 | Bacteria | 2653 |
| 441 | Ga0307411_10378082 | 3300032005 | Bacteria | 1164 |
| 442 | Ga0307510_10019174 | 3300033180 | Bacteria | 8026 |
| 443 | Ga0316574_0000057 | 3300035398 | Bacteria | 29135 |
| 444 | Ga0373937_0221108 | 3300036401 | Bacteria | 1783 |
| 445 | Ga0373925_0725955 | 3300037068 | Bacteria | 819 |
| 446 | Ga0395899_0000036 | 3300037312 | Bacteria | 289502 |
| 447 | Ga0395900_0000071 | 3300037418 | Bacteria | 187816 |
| 448 | Ga0395900_1047130 | 3300037418 | Bacteria | 735 |
| 449 | Ga0395898_0000115 | 3300037466 | Bacteria | 211806 |
| 450 | Ga0395905_0000775 | 3300037471 | Bacteria | 42024 |
| 451 | Ga0395905_0008066 | 3300037471 | Bacteria | 10401 |
| 452 | Ga0395905_0107358 | 3300037471 | Bacteria | 2621 |
| 453 | Ga0395905_0141347 | 3300037471 | Bacteria | 2264 |
| 454 | Ga0395905_0200233 | 3300037471 | Bacteria | 1872 |
| 455 | Ga0395905_0210756 | 3300037471 | Bacteria | 1820 |
| 456 | Ga0395905_0270247 | 3300037471 | Bacteria | 1586 |
| 457 | Ga0395905_0506480 | 3300037471 | Bacteria | 1107 |
| 458 | Ga0400483_055198 | 3300039062 | Bacteria | 1769 |
| 459 | Ga0400483_099673 | 3300039062 | Bacteria | 1334 |
| 460 | Ga0400483_137833 | 3300039062 | Bacteria | 3446 |
| 461 | Ga0400483_269888 | 3300039062 | Bacteria | 1583 |
| 462 | Ga0400483_281109 | 3300039062 | Bacteria | 4819 |
| 463 | Ga0400483_289222 | 3300039062 | Bacteria | 1594 |
| 464 | Ga0400489_52926 | 3300039093 | Bacteria | 62005 |
| 465 | Ga0436360_1316722 | 3300039438 | Bacteria | 18203 |
| 466 | Ga0436361_0159868 | 3300039447 | Bacteria | 4252 |
| 467 | Ga0436362_0110582 | 3300039453 | Bacteria | 1353 |
| 468 | Ga0439436_0017070 | 3300041404 | Bacteria | 2173 |
| 469 | Ga0439438_000149 | 3300041405 | Bacteria | 31679 |
| 470 | Ga0439438_002641 | 3300041405 | Bacteria | 7568 |
| 471 | Ga0439439_0004298 | 3300041406 | Bacteria | 3203 |
| 472 | Ga0439439_0013687 | 3300041406 | Bacteria | 1968 |
| 473 | Ga0439447_002210 | 3300041407 | Bacteria | 7136 |
| 474 | Ga0439447_011078 | 3300041407 | Bacteria | 2649 |
| 475 | Ga0439466_0000719 | 3300041411 | Bacteria | 12515 |
| 476 | Ga0439466_0000880 | 3300041411 | Bacteria | 11435 |
| 477 | Ga0439466_0001876 | 3300041411 | Bacteria | 8228 |
| 478 | Ga0439466_0034340 | 3300041411 | Bacteria | 1720 |
| 479 | Ga0439466_0065578 | 3300041411 | Bacteria | 1164 |
| 480 | Ga0439465_0008944 | 3300041413 | Bacteria | 3156 |
| 481 | Ga0439465_0028833 | 3300041413 | Bacteria | 1762 |
| 482 | Ga0439465_0034418 | 3300041413 | Bacteria | 1622 |
| 483 | Ga0451797_0888364 | 3300041453 | Bacteria | 1234 |
| 484 | Ga0451797_0995910 | 3300041453 | Unclassified | 1457 |
| 485 | Ga0451795_1577188 | 3300041456 | Bacteria | 561 |
| 486 | Ga0451833_0624708 | 3300041491 | Bacteria | 773 |
| 487 | Ga0451837_1569949 | 3300041494 | Bacteria | 1281 |
| 488 | Ga0451841_1366776 | 3300041498 | Bacteria | 1041 |
| 489 | Ga0451843_0892095 | 3300041509 | Bacteria | 1023 |
| 490 | Ga0451853_2345502 | 3300041512 | Bacteria | 1103 |
| 491 | Ga0451853_2947663 | 3300041512 | Bacteria | 3248 |
| 492 | Ga0451853_3268004 | 3300041512 | Unclassified | 1542 |
| 493 | Ga0439431_0068524 | 3300041997 | Bacteria | 942 |
| 494 | Ga0439433_0015099 | 3300041999 | Bacteria | 1704 |
| 495 | Ga0439433_0026055 | 3300041999 | Bacteria | 1323 |
| 496 | Ga0439441_029475 | 3300042001 | Bacteria | 1057 |
| 497 | Ga0439445_0041332 | 3300042004 | Bacteria | 1226 |
| 498 | Ga0439445_0054788 | 3300042004 | Bacteria | 1082 |
| 499 | Ga0439445_0073960 | 3300042004 | Bacteria | 946 |
| 500 | Ga0439432_009181 | 3300042006 | Bacteria | 3453 |
| 501 | Ga0439432_065782 | 3300042006 | Bacteria | 1111 |
| 502 | Ga0439432_065863 | 3300042006 | Bacteria | 1110 |
| 503 | Ga0439432_089381 | 3300042006 | Bacteria | 928 |
| 504 | Ga0439432_115781 | 3300042006 | Bacteria | 796 |
| 505 | Ga0439449_0001049 | 3300042007 | Bacteria | 10892 |
| 506 | Ga0439449_0002301 | 3300042007 | Bacteria | 7481 |
| 507 | Ga0439449_0037568 | 3300042007 | Bacteria | 1801 |
| 508 | Ga0439449_0076051 | 3300042007 | Bacteria | 1237 |
| 509 | Ga0439451_001608 | 3300042009 | Bacteria | 4474 |
| 510 | Ga0439452_000559 | 3300042010 | Bacteria | 19607 |
| 511 | Ga0439452_012799 | 3300042010 | Bacteria | 2374 |
| 512 | Ga0439452_049128 | 3300042010 | Bacteria | 971 |
| 513 | Ga0439452_060499 | 3300042010 | Bacteria | 849 |
| 514 | Ga0439454_016883 | 3300042011 | Bacteria | 1037 |
| 515 | Ga0439456_053450 | 3300042013 | Bacteria | 884 |
| 516 | Ga0439457_016994 | 3300042014 | Bacteria | 1618 |
| 517 | Ga0439457_042931 | 3300042014 | Bacteria | 1009 |
| 518 | Ga0439457_089934 | 3300042014 | Bacteria | 710 |
| 519 | Ga0439462_0002063 | 3300042015 | Bacteria | 4613 |
| 520 | Ga0439462_0004837 | 3300042015 | Bacteria | 3304 |
| 521 | Ga0439462_0014489 | 3300042015 | Bacteria | 2027 |
| 522 | Ga0450911_000107 | 3300042115 | Bacteria | 34252 |
| 523 | Ga0450911_000519 | 3300042115 | Bacteria | 12154 |
| 524 | Ga0450911_005372 | 3300042115 | Bacteria | 1998 |
| 525 | Ga0450919_002690 | 3300042121 | Bacteria | 2290 |
| 526 | Ga0450920_057459 | 3300042122 | Bacteria | 784 |
| 527 | Ga0450921_015948 | 3300042123 | Bacteria | 679 |
| 528 | Ga0450923_004062 | 3300042125 | Bacteria | 2271 |
| 529 | Ga0450890_004088 | 3300042127 | Bacteria | 1915 |
| 530 | Ga0450890_012527 | 3300042127 | Bacteria | 1101 |
| 531 | Ga0450897_001641 | 3300042128 | Bacteria | 1552 |
| 532 | Ga0450898_038517 | 3300042134 | Bacteria | 898 |
| 533 | Ga0450899_006226 | 3300042135 | Bacteria | 1288 |
| 534 | Ga0450902_005710 | 3300042137 | Bacteria | 1890 |
| 535 | Ga0450902_038776 | 3300042137 | Bacteria | 809 |
| 536 | Ga0450902_039672 | 3300042137 | Bacteria | 800 |
| 537 | Ga0450903_001727 | 3300042138 | Bacteria | 4020 |
| 538 | Ga0450903_007196 | 3300042138 | Bacteria | 1838 |
| 539 | Ga0450905_000666 | 3300042142 | Bacteria | 4226 |
| 540 | Ga0450906_005093 | 3300042145 | Bacteria | 2722 |
| 541 | Ga0450910_031038 | 3300042147 | Bacteria | 839 |
| 542 | Ga0439446_0005658 | 3300042156 | Bacteria | 3221 |
| 543 | Ga0439446_0022901 | 3300042156 | Bacteria | 1773 |
| 544 | Ga0439446_0044427 | 3300042156 | Bacteria | 1315 |
| 545 | Ga0439446_0216493 | 3300042156 | Bacteria | 651 |
| 546 | Ga0450908_001204 | 3300042184 | Bacteria | 5006 |
| 547 | Ga0450908_003757 | 3300042184 | Bacteria | 2940 |
| 548 | Ga0450909_007879 | 3300042185 | Bacteria | 1545 |
| 549 | Ga0450909_008301 | 3300042185 | Bacteria | 1510 |
| 550 | Ga0439434_0006459 | 3300042435 | Bacteria | 3425 |
| 551 | Ga0439434_0103139 | 3300042435 | Bacteria | 920 |
| 552 | Ga0439434_0224980 | 3300042435 | Bacteria | 637 |
| 553 | Ga0439464_0015028 | 3300042439 | Bacteria | 2087 |
| 554 | Ga0450893_0005302 | 3300042532 | Bacteria | 2067 |
| 555 | Ga0451577_0003980 | 3300042876 | Bacteria | 15930 |
| 556 | Ga0451577_0009290 | 3300042876 | Bacteria | 9478 |
| 557 | Ga0451577_0074764 | 3300042876 | Bacteria | 3021 |
| 558 | Ga0466969_0064826 | 3300044656 | Bacteria | 1767 |
| 559 | Ga0466972_0025143 | 3300044658 | Bacteria | 2953 |
| 560 | Ga0466972_0243067 | 3300044658 | Bacteria | 842 |
| 561 | Ga0466981_0312141 | 3300044669 | Bacteria | 982 |
| 562 | Ga0453683_0096128 | 3300044673 | Bacteria | 1859 |
| 563 | Ga0453683_0100801 | 3300044673 | Bacteria | 1813 |
| 564 | Ga0453683_0314629 | 3300044673 | Bacteria | 1003 |
| 565 | Ga0466965_0040093 | 3300044683 | Bacteria | 2304 |
| 566 | Ga0466966_0011494 | 3300044684 | Bacteria | 5872 |
| 567 | Ga0466966_0071843 | 3300044684 | Bacteria | 2168 |
| 568 | Ga0466961_0074502 | 3300044693 | Bacteria | 2153 |
| 569 | Ga0466963_0035458 | 3300044694 | Bacteria | 3250 |
| 570 | Ga0453684_0042329 | 3300044712 | Bacteria | 6141 |
| 571 | Ga0466968_0000951 | 3300044735 | Bacteria | 10202 |
| 572 | Ga0466970_0075377 | 3300044765 | Bacteria | 1817 |
| 573 | Ga0466960_0024092 | 3300044901 | Bacteria | 2742 |
| 574 | Ga0466959_0020980 | 3300045049 | Bacteria | 4816 |
| 575 | Ga0451576_0056721 | 3300045051 | Bacteria | 4095 |
| 576 | Ga0466958_0051662 | 3300045836 | Bacteria | 2489 |
| 577 | Ga0466967_0453901 | 3300045976 | Bacteria | 1253 |
| 578 | Ga0495617_058726 | 3300046452 | Bacteria | 1274 |
| 579 | Ga0495617_065748 | 3300046452 | Bacteria | 1195 |
| 580 | Ga0495617_119958 | 3300046452 | Bacteria | 847 |
| 581 | Ga0495627_004299 | 3300046453 | Bacteria | 5991 |
| 582 | Ga0495603_0016851 | 3300046455 | Bacteria | 4422 |
| 583 | Ga0495590_0037979 | 3300046457 | Bacteria | 1678 |
| 584 | Ga0495590_0047821 | 3300046457 | Bacteria | 1492 |
| 585 | Ga0495590_0257338 | 3300046457 | Bacteria | 650 |
| 586 | Ga0495591_053412 | 3300046458 | Bacteria | 1096 |
| 587 | Ga0495629_0106493 | 3300046459 | Bacteria | 1956 |
| 588 | Ga0495629_0351712 | 3300046459 | Bacteria | 1005 |
| 589 | Ga0495638_0010696 | 3300046460 | Bacteria | 6355 |
| 590 | Ga0495638_0013625 | 3300046460 | Bacteria | 5524 |
| 591 | Ga0495638_0021932 | 3300046460 | Bacteria | 4198 |
| 592 | Ga0495638_0036835 | 3300046460 | Bacteria | 3114 |
| 593 | Ga0495638_0041685 | 3300046460 | Bacteria | 2902 |
| 594 | Ga0495638_0065953 | 3300046460 | Bacteria | 2226 |
| 595 | Ga0495638_0077439 | 3300046460 | Bacteria | 2024 |
| 596 | Ga0495638_0078445 | 3300046460 | Bacteria | 2009 |
| 597 | Ga0495638_0249677 | 3300046460 | Bacteria | 978 |
| 598 | Ga0495650_0000531 | 3300046471 | Bacteria | 55413 |
| 599 | Ga0495650_0039260 | 3300046471 | Bacteria | 2044 |
| 600 | Ga0495605_0000551 | 3300046474 | Bacteria | 30680 |
| 601 | Ga0495605_0001579 | 3300046474 | Bacteria | 14779 |
| 602 | Ga0495605_0001765 | 3300046474 | Bacteria | 13878 |
| 603 | Ga0495605_0004117 | 3300046474 | Bacteria | 8575 |
| 604 | Ga0495605_0010517 | 3300046474 | Bacteria | 5176 |
| 605 | Ga0495605_0076161 | 3300046474 | Bacteria | 1576 |
| 606 | Ga0495639_0007550 | 3300046475 | Bacteria | 4671 |
| 607 | Ga0495639_0249743 | 3300046475 | Bacteria | 877 |
| 608 | Ga0495584_0000086 | 3300046491 | Bacteria | 64500 |
| 609 | Ga0495584_0007969 | 3300046491 | Bacteria | 5505 |
| 610 | Ga0495584_0012121 | 3300046491 | Bacteria | 4406 |
| 611 | Ga0495584_0017233 | 3300046491 | Bacteria | 3681 |
| 612 | Ga0495584_0224178 | 3300046491 | Bacteria | 955 |
| 613 | Ga0495585_0001557 | 3300046492 | Bacteria | 17787 |
| 614 | Ga0495585_0009499 | 3300046492 | Bacteria | 5829 |
| 615 | Ga0495585_0072199 | 3300046492 | Bacteria | 1881 |
| 616 | Ga0495607_0000747 | 3300046501 | Bacteria | 31132 |
| 617 | Ga0495607_0001090 | 3300046501 | Bacteria | 24784 |
| 618 | Ga0495607_0003073 | 3300046501 | Bacteria | 12974 |
| 619 | Ga0495607_0009909 | 3300046501 | Bacteria | 6421 |
| 620 | Ga0495607_0035678 | 3300046501 | Bacteria | 3006 |
| 621 | Ga0495583_0000708 | 3300046506 | Bacteria | 42814 |
| 622 | Ga0495583_0000982 | 3300046506 | Bacteria | 32675 |
| 623 | Ga0495583_0082715 | 3300046506 | Bacteria | 1393 |
| 624 | Ga0495583_0141801 | 3300046506 | Bacteria | 1000 |
| 625 | Ga0495606_0197486 | 3300046507 | Bacteria | 1149 |
| 626 | Ga0495606_0522893 | 3300046507 | Unclassified | 595 |
| 627 | Ga0495610_0000306 | 3300046512 | Bacteria | 51770 |
| 628 | Ga0495610_0000638 | 3300046512 | Bacteria | 34430 |
| 629 | Ga0495610_0015531 | 3300046512 | Bacteria | 4420 |
| 630 | Ga0495610_0122868 | 3300046512 | Bacteria | 1136 |
| 631 | Ga0495610_0184185 | 3300046512 | Bacteria | 866 |
| 632 | Ga0495616_0000281 | 3300046513 | Bacteria | 41179 |
| 633 | Ga0495616_0001237 | 3300046513 | Bacteria | 17959 |
| 634 | Ga0495616_0005083 | 3300046513 | Bacteria | 8180 |
| 635 | Ga0495616_0007365 | 3300046513 | Bacteria | 6583 |
| 636 | Ga0495616_0028885 | 3300046513 | Bacteria | 2932 |
| 637 | Ga0495616_0079579 | 3300046513 | Bacteria | 1570 |
| 638 | Ga0495618_0086391 | 3300046514 | Bacteria | 2006 |
| 639 | Ga0495620_0060005 | 3300046515 | Bacteria | 1587 |
| 640 | Ga0495620_0132975 | 3300046515 | Bacteria | 975 |
| 641 | Ga0495630_0045714 | 3300046517 | Bacteria | 3272 |
| 642 | Ga0495631_0000242 | 3300046518 | Bacteria | 37711 |
| 643 | Ga0495631_0004732 | 3300046518 | Bacteria | 7191 |
| 644 | Ga0495631_0005056 | 3300046518 | Bacteria | 6948 |
| 645 | Ga0495631_0182346 | 3300046518 | Bacteria | 899 |
| 646 | Ga0495632_0000166 | 3300046519 | Bacteria | 68543 |
| 647 | Ga0495632_0004954 | 3300046519 | Bacteria | 8923 |
| 648 | Ga0495632_0008738 | 3300046519 | Bacteria | 6176 |
| 649 | Ga0495632_0013043 | 3300046519 | Bacteria | 4762 |
| 650 | Ga0495632_0040763 | 3300046519 | Bacteria | 2336 |
| 651 | Ga0495637_0000138 | 3300046520 | Bacteria | 55120 |
| 652 | Ga0495637_0001577 | 3300046520 | Bacteria | 13234 |
| 653 | Ga0495637_0002576 | 3300046520 | Bacteria | 9967 |
| 654 | Ga0495637_0004154 | 3300046520 | Bacteria | 7534 |
| 655 | Ga0495643_0002007 | 3300046522 | Bacteria | 16984 |
| 656 | Ga0495643_0028069 | 3300046522 | Bacteria | 3158 |
| 657 | Ga0495643_0077100 | 3300046522 | Bacteria | 1742 |
| 658 | Ga0495644_0004518 | 3300046523 | Bacteria | 5467 |
| 659 | Ga0495644_0219185 | 3300046523 | Bacteria | 735 |
| 660 | Ga0495648_0000758 | 3300046524 | Bacteria | 34444 |
| 661 | Ga0495648_0007082 | 3300046524 | Bacteria | 9029 |
| 662 | Ga0495648_0030444 | 3300046524 | Bacteria | 3568 |
| 663 | Ga0495648_0058557 | 3300046524 | Bacteria | 2303 |
| 664 | Ga0495648_0082523 | 3300046524 | Bacteria | 1824 |
| 665 | Ga0495648_0159990 | 3300046524 | Bacteria | 1165 |
| 666 | Ga0495663_0085087 | 3300046525 | Bacteria | 1024 |
| 667 | Ga0495642_0000016 | 3300046528 | Bacteria | 114282 |
| 668 | Ga0495642_0006163 | 3300046528 | Bacteria | 4603 |
| 669 | Ga0495642_0102078 | 3300046528 | Bacteria | 1221 |
| 670 | Ga0495654_0010482 | 3300046530 | Bacteria | 5040 |
| 671 | Ga0495654_0015115 | 3300046530 | Bacteria | 4102 |
| 672 | Ga0495654_0054824 | 3300046530 | Bacteria | 1932 |
| 673 | Ga0495654_0060406 | 3300046530 | Bacteria | 1822 |
| 674 | Ga0495654_0071796 | 3300046530 | Bacteria | 1640 |
| 675 | Ga0495654_0114819 | 3300046530 | Bacteria | 1225 |
| 676 | Ga0495587_0043008 | 3300046536 | Bacteria | 2692 |
| 677 | Ga0495598_0146856 | 3300046537 | Bacteria | 820 |
| 678 | Ga0495609_0000072 | 3300046538 | Bacteria | 125273 |
| 679 | Ga0495609_0000186 | 3300046538 | Bacteria | 62251 |
| 680 | Ga0495609_0000319 | 3300046538 | Bacteria | 43061 |
| 681 | Ga0495609_0004779 | 3300046538 | Bacteria | 7312 |
| 682 | Ga0495609_0024806 | 3300046538 | Bacteria | 2749 |
| 683 | Ga0495609_0056433 | 3300046538 | Bacteria | 1740 |
| 684 | Ga0495621_0004761 | 3300046539 | Bacteria | 3849 |
| 685 | Ga0495597_0015611 | 3300046542 | Bacteria | 3593 |
| 686 | Ga0495597_0073252 | 3300046542 | Bacteria | 1472 |
| 687 | Ga0495597_0148182 | 3300046542 | Bacteria | 964 |
| 688 | Ga0495597_0179086 | 3300046542 | Bacteria | 857 |
| 689 | Ga0495622_0000516 | 3300046557 | Bacteria | 23599 |
| 690 | Ga0495622_0004427 | 3300046557 | Bacteria | 6524 |
| 691 | Ga0495622_0022143 | 3300046557 | Bacteria | 2961 |
| 692 | Ga0495622_0040433 | 3300046557 | Bacteria | 2170 |
| 693 | Ga0495633_0196555 | 3300046558 | Bacteria | 926 |
| 694 | Ga0495633_0267223 | 3300046558 | Bacteria | 779 |
| 695 | Ga0495667_0316718 | 3300046559 | Unclassified | 987 |
| 696 | Ga0495656_0086891 | 3300046615 | Bacteria | 1423 |
| 697 | Ga0495668_0009126 | 3300046616 | Bacteria | 6115 |
| 698 | Ga0495668_0025995 | 3300046616 | Bacteria | 3324 |
| 699 | Ga0495668_0189293 | 3300046616 | Bacteria | 1127 |
| 700 | Ga0495611_0005135 | 3300046648 | Bacteria | 5611 |
| 701 | Ga0495611_0006017 | 3300046648 | Bacteria | 5176 |
| 702 | Ga0495611_0040807 | 3300046648 | Bacteria | 2069 |
| 703 | Ga0495625_0000056 | 3300046660 | Bacteria | 186024 |
| 704 | Ga0495625_0000718 | 3300046660 | Bacteria | 46602 |
| 705 | Ga0495625_0001903 | 3300046660 | Bacteria | 23588 |
| 706 | Ga0495625_0010231 | 3300046660 | Bacteria | 7779 |
| 707 | Ga0495625_0017472 | 3300046660 | Bacteria | 5617 |
| 708 | Ga0495625_0023716 | 3300046660 | Bacteria | 4683 |
| 709 | Ga0495625_0096571 | 3300046660 | Bacteria | 2035 |
| 710 | Ga0495625_0160130 | 3300046660 | Bacteria | 1508 |
| 711 | Ga0495625_0261943 | 3300046660 | Bacteria | 1118 |
| 712 | Ga0495625_0281433 | 3300046660 | Unclassified | 1070 |
| 713 | Ga0495659_0000823 | 3300046664 | Bacteria | 11031 |
| 714 | Ga0495659_0002449 | 3300046664 | Bacteria | 5988 |
| 715 | Ga0495659_0010990 | 3300046664 | Bacteria | 2916 |
| 716 | Ga0495661_0000914 | 3300046665 | Bacteria | 27086 |
| 717 | Ga0495661_0019746 | 3300046665 | Bacteria | 4411 |
| 718 | Ga0495661_0054705 | 3300046665 | Bacteria | 2395 |
| 719 | Ga0495661_0176764 | 3300046665 | Bacteria | 1134 |
| 720 | Ga0495661_0180352 | 3300046665 | Bacteria | 1120 |
| 721 | Ga0495661_0182034 | 3300046665 | Bacteria | 1113 |
| 722 | Ga0495661_0191544 | 3300046665 | Bacteria | 1076 |
| 723 | Ga0495661_0273566 | 3300046665 | Bacteria | 854 |
| 724 | Ga0495588_0004546 | 3300046674 | Bacteria | 6133 |
| 725 | Ga0495588_0008467 | 3300046674 | Bacteria | 4724 |
| 726 | Ga0495588_0011119 | 3300046674 | Bacteria | 4214 |
| 727 | Ga0495588_0100156 | 3300046674 | Bacteria | 1522 |
| 728 | Ga0495588_0236984 | 3300046674 | Bacteria | 962 |
| 729 | Ga0495623_0389317 | 3300046679 | Bacteria | 752 |
| 730 | Ga0495658_0002773 | 3300046683 | Bacteria | 8793 |
| 731 | Ga0495658_0195514 | 3300046683 | Bacteria | 1259 |
| 732 | Ga0495669_0002831 | 3300046684 | Bacteria | 7120 |
| 733 | Ga0495669_0142317 | 3300046684 | Unclassified | 1132 |
| 734 | Ga0495669_0245696 | 3300046684 | Bacteria | 859 |
| 735 | Ga0495670_0000171 | 3300046691 | Bacteria | 28803 |
| 736 | Ga0495670_0054312 | 3300046691 | Bacteria | 2006 |
| 737 | Ga0495670_0081649 | 3300046691 | Bacteria | 1647 |
| 738 | Ga0495670_0283702 | 3300046691 | Bacteria | 886 |
| 739 | Ga0495670_0347943 | 3300046691 | Bacteria | 797 |
| 740 | Ga0495671_0000138 | 3300046692 | Bacteria | 64535 |
| 741 | Ga0495671_0002242 | 3300046692 | Bacteria | 12287 |
| 742 | Ga0495671_0005515 | 3300046692 | Bacteria | 7401 |
| 743 | Ga0495671_0012417 | 3300046692 | Bacteria | 4653 |
| 744 | Ga0495671_0051767 | 3300046692 | Bacteria | 2042 |
| 745 | Ga0495671_0058017 | 3300046692 | Bacteria | 1915 |
| 746 | Ga0495671_0240173 | 3300046692 | Bacteria | 875 |
| 747 | Ga0495649_0012557 | 3300046694 | Bacteria | 4920 |
| 748 | Ga0495649_0030917 | 3300046694 | Bacteria | 2955 |
| 749 | Ga0495649_0158504 | 3300046694 | Bacteria | 1187 |
| 750 | Ga0495649_0295799 | 3300046694 | Bacteria | 825 |
| 751 | Ga0495589_0000045 | 3300046794 | Bacteria | 123922 |
| 752 | Ga0495589_0000282 | 3300046794 | Bacteria | 41422 |
| 753 | Ga0495589_0003117 | 3300046794 | Bacteria | 9071 |
| 754 | Ga0495600_0193891 | 3300046809 | Bacteria | 1306 |
| 755 | Ga0495660_0002784 | 3300046810 | Bacteria | 11024 |
| 756 | Ga0495604_0402876 | 3300047317 | Bacteria | 901 |
| 757 | Ga0495636_0000276 | 3300047318 | Bacteria | 20170 |
| 758 | Ga0495636_0008252 | 3300047318 | Bacteria | 4111 |
| 759 | Ga0495672_0000312 | 3300047320 | Bacteria | 64934 |
| 760 | Ga0495672_0000357 | 3300047320 | Bacteria | 58589 |
| 761 | Ga0495672_0026485 | 3300047320 | Bacteria | 3700 |
| 762 | Ga0495676_0023524 | 3300047321 | Bacteria | 5347 |
| 763 | Ga0495680_0017133 | 3300047322 | Bacteria | 6199 |
| 764 | Ga0495680_0105538 | 3300047322 | Bacteria | 2095 |
| 765 | Ga0495680_0155626 | 3300047322 | Bacteria | 1663 |
| 766 | Ga0495683_0005825 | 3300047323 | Bacteria | 6781 |
| 767 | Ga0495683_0067043 | 3300047323 | Bacteria | 1767 |
| 768 | Ga0495683_0082837 | 3300047323 | Bacteria | 1562 |
| 769 | Ga0495687_000050 | 3300047443 | Bacteria | 200856 |
| 770 | Ga0495687_000538 | 3300047443 | Bacteria | 45144 |
| 771 | Ga0495687_000622 | 3300047443 | Bacteria | 40986 |
| 772 | Ga0495687_001285 | 3300047443 | Bacteria | 23621 |
| 773 | Ga0495687_072901 | 3300047443 | Bacteria | 1370 |
| 774 | Ga0495675_0000123 | 3300047444 | Bacteria | 55312 |
| 775 | Ga0495677_0000111 | 3300047445 | Bacteria | 40961 |
| 776 | Ga0495677_0000135 | 3300047445 | Bacteria | 35127 |
| 777 | Ga0495677_0000306 | 3300047445 | Bacteria | 21272 |
| 778 | Ga0495677_0041519 | 3300047445 | Bacteria | 1683 |
| 779 | Ga0495677_0265775 | 3300047445 | Bacteria | 672 |
| 780 | Ga0495679_010958 | 3300047446 | Bacteria | 3528 |
| 781 | Ga0495685_000137 | 3300047447 | Bacteria | 25064 |
| 782 | Ga0495685_005785 | 3300047447 | Bacteria | 4039 |
| 783 | Ga0495673_0000138 | 3300047469 | Bacteria | 130703 |
| 784 | Ga0495673_0000354 | 3300047469 | Bacteria | 57082 |
| 785 | Ga0495673_0010358 | 3300047469 | Bacteria | 5076 |
| 786 | Ga0495673_0016053 | 3300047469 | Bacteria | 3840 |
| 787 | Ga0495673_0061433 | 3300047469 | Bacteria | 1608 |
| 788 | Ga0495681_0000195 | 3300047470 | Bacteria | 51032 |
| 789 | Ga0495681_0003860 | 3300047470 | Bacteria | 10362 |
| 790 | Ga0495681_0021183 | 3300047470 | Bacteria | 3507 |
| 791 | Ga0495681_0027946 | 3300047470 | Bacteria | 2911 |
| 792 | Ga0495681_0078561 | 3300047470 | Bacteria | 1478 |
| 793 | Ga0495686_0007048 | 3300047472 | Bacteria | 8480 |
| 794 | Ga0495686_0106765 | 3300047472 | Bacteria | 1683 |
| 795 | Ga0495686_0113577 | 3300047472 | Bacteria | 1622 |
| 796 | Ga0495686_0123045 | 3300047472 | Bacteria | 1544 |
| 797 | Ga0495686_0188213 | 3300047472 | Bacteria | 1191 |
| 798 | Ga0495593_0010956 | 3300047673 | Bacteria | 5222 |
| 799 | Ga0495593_0011378 | 3300047673 | Bacteria | 5111 |
| 800 | Ga0495614_0007845 | 3300048089 | Bacteria | 4745 |
| 801 | Ga0495626_0000419 | 3300048091 | Bacteria | 43563 |
| 802 | Ga0495626_0006306 | 3300048091 | Bacteria | 6765 |
| 803 | Ga0495626_0024118 | 3300048091 | Bacteria | 2984 |
| 804 | Ga0496100_0017439 | 3300048903 | Bacteria | 4238 |
| 805 | Ga0496100_0207754 | 3300048903 | Bacteria | 1431 |
| 806 | Ga0496101_0003286 | 3300048904 | Bacteria | 10053 |
| 807 | Ga0496101_0386344 | 3300048904 | Bacteria | 1101 |
| 808 | Ga0496102_0007804 | 3300048905 | Bacteria | 9149 |
| 809 | Ga0496102_0071315 | 3300048905 | Bacteria | 3190 |
| 810 | Ga0496102_0354338 | 3300048905 | Unclassified | 1382 |
| 811 | Ga0496103_0071738 | 3300048906 | Bacteria | 2168 |
| 812 | Ga0496104_0015096 | 3300048907 | Bacteria | 6990 |
| 813 | Ga0496104_0177785 | 3300048907 | Bacteria | 2038 |
| 814 | Ga0496104_0259168 | 3300048907 | Bacteria | 1652 |
| 815 | Ga0496105_0007115 | 3300048908 | Bacteria | 8632 |
| 816 | Ga0496105_0213036 | 3300048908 | Bacteria | 1574 |
| 817 | Ga0496106_0015648 | 3300048909 | Bacteria | 5611 |
| 818 | Ga0496107_0024141 | 3300048910 | Bacteria | 4300 |
| 819 | Ga0496107_0543935 | 3300048910 | Bacteria | 860 |
| 820 | Ga0496108_0014037 | 3300048911 | Bacteria | 6535 |
| 821 | Ga0496108_0068863 | 3300048911 | Bacteria | 2986 |
| 822 | Ga0496108_0486924 | 3300048911 | Bacteria | 1077 |
| 823 | Ga0496109_0017981 | 3300048912 | Bacteria | 6206 |
| 824 | Ga0496110_0005924 | 3300048913 | Bacteria | 9619 |
| 825 | Ga0496110_0140364 | 3300048913 | Bacteria | 2184 |
| 826 | Ga0496110_0327469 | 3300048913 | Bacteria | 1395 |
| 827 | Ga0496111_0038181 | 3300048914 | Bacteria | 3440 |
| 828 | Ga0496111_0183508 | 3300048914 | Bacteria | 1555 |
| 829 | Ga0496112_0355190 | 3300048915 | Bacteria | 1408 |
| 830 | Ga0496113_0328794 | 3300048916 | Bacteria | 1226 |
| 831 | Ga0496114_0006664 | 3300048917 | Bacteria | 9100 |
| 832 | Ga0496114_0028641 | 3300048917 | Bacteria | 4572 |
| 833 | Ga0496116_0017188 | 3300048919 | Bacteria | 5627 |
| 834 | Ga0496116_0036642 | 3300048919 | Bacteria | 3429 |
| 835 | Ga0496116_0144503 | 3300048919 | Bacteria | 1332 |
| 836 | Ga0496117_0000237 | 3300048920 | Bacteria | 104534 |
| 837 | Ga0496117_0002997 | 3300048920 | Bacteria | 20327 |
| 838 | Ga0496117_0073041 | 3300048920 | Bacteria | 2290 |
| 839 | Ga0496117_0181909 | 3300048920 | Bacteria | 1207 |
| 840 | Ga0496117_0223416 | 3300048920 | Bacteria | 1046 |
| 841 | Ga0496118_0000280 | 3300048921 | Bacteria | 89951 |
| 842 | Ga0496118_0002137 | 3300048921 | Bacteria | 27581 |
| 843 | Ga0496118_0030679 | 3300048921 | Bacteria | 4478 |
| 844 | Ga0496118_0068011 | 3300048921 | Bacteria | 2589 |
| 845 | Ga0496118_0113460 | 3300048921 | Bacteria | 1790 |
| 846 | Ga0496118_0120580 | 3300048921 | Bacteria | 1711 |
| 847 | Ga0496118_0203001 | 3300048921 | Bacteria | 1172 |
| 848 | Ga0496119_0000107 | 3300048922 | Bacteria | 116784 |
| 849 | Ga0496119_0076860 | 3300048922 | Bacteria | 1936 |
| 850 | Ga0496120_0000011 | 3300048923 | Bacteria | 365549 |
| 851 | Ga0496120_0007054 | 3300048923 | Bacteria | 8439 |
| 852 | Ga0496121_0000159 | 3300048924 | Bacteria | 147049 |
| 853 | Ga0496121_0000313 | 3300048924 | Bacteria | 100952 |
| 854 | Ga0496121_0006818 | 3300048924 | Bacteria | 13984 |
| 855 | Ga0496121_0009067 | 3300048924 | Bacteria | 11522 |
| 856 | Ga0496121_0011908 | 3300048924 | Bacteria | 9573 |
| 857 | Ga0496121_0075887 | 3300048924 | Bacteria | 2683 |
| 858 | Ga0496121_0113847 | 3300048924 | Bacteria | 2057 |
| 859 | Ga0496121_0201409 | 3300048924 | Bacteria | 1418 |
| 860 | Ga0496121_0358330 | 3300048924 | Bacteria | 969 |
| 861 | Ga0496122_0000137 | 3300048925 | Bacteria | 170016 |
| 862 | Ga0496122_0002198 | 3300048925 | Bacteria | 28484 |
| 863 | Ga0496122_0014590 | 3300048925 | Bacteria | 7585 |
| 864 | Ga0496122_0031976 | 3300048925 | Bacteria | 4362 |
| 865 | Ga0496122_0070087 | 3300048925 | Bacteria | 2507 |
| 866 | Ga0496122_0082993 | 3300048925 | Bacteria | 2224 |
| 867 | Ga0496122_0094941 | 3300048925 | Bacteria | 2017 |
| 868 | Ga0496123_0000022 | 3300048926 | Bacteria | 361832 |
| 869 | Ga0496123_0000314 | 3300048926 | Bacteria | 92927 |
| 870 | Ga0496123_0006452 | 3300048926 | Bacteria | 11355 |
| 871 | Ga0496123_0011999 | 3300048926 | Bacteria | 7432 |
| 872 | Ga0496123_0024975 | 3300048926 | Bacteria | 4520 |
| 873 | Ga0496123_0035309 | 3300048926 | Bacteria | 3564 |
| 874 | Ga0496123_0149149 | 3300048926 | Bacteria | 1265 |
| 875 | Ga0496123_0232325 | 3300048926 | Bacteria | 922 |
| 876 | Ga0496124_0009311 | 3300048927 | Bacteria | 10124 |
| 877 | Ga0496124_0019956 | 3300048927 | Bacteria | 6215 |
| 878 | Ga0496124_0031748 | 3300048927 | Bacteria | 4672 |
| 879 | Ga0496124_0061504 | 3300048927 | Bacteria | 3147 |
| 880 | Ga0496124_0275523 | 3300048927 | Bacteria | 1229 |
| 881 | Ga0496124_0316751 | 3300048927 | Bacteria | 1119 |
| 882 | Ga0496125_0000005 | 3300048928 | Bacteria | 827598 |
| 883 | Ga0496125_0001361 | 3300048928 | Bacteria | 36000 |
| 884 | Ga0496125_0005506 | 3300048928 | Bacteria | 14036 |
| 885 | Ga0496125_0007561 | 3300048928 | Bacteria | 11538 |
| 886 | Ga0496125_0008142 | 3300048928 | Bacteria | 11037 |
| 887 | Ga0496125_0068383 | 3300048928 | Bacteria | 2795 |
| 888 | Ga0496125_0201736 | 3300048928 | Bacteria | 1301 |
| 889 | Ga0496125_0301838 | 3300048928 | Bacteria | 980 |
| 890 | Ga0496126_0003367 | 3300048929 | Bacteria | 20272 |
| 891 | Ga0496126_0014664 | 3300048929 | Bacteria | 7912 |
| 892 | Ga0496126_0030841 | 3300048929 | Bacteria | 5075 |
| 893 | Ga0496126_0110468 | 3300048929 | Bacteria | 2395 |
| 894 | Ga0496126_0165925 | 3300048929 | Bacteria | 1885 |
| 895 | Ga0496126_0200925 | 3300048929 | Bacteria | 1683 |
| 896 | Ga0496126_0364906 | 3300048929 | Bacteria | 1179 |
| 897 | Ga0496126_0440425 | 3300048929 | Bacteria | 1050 |
| 898 | Ga0495678_103588 | 3300049459 | Bacteria | 983 |
| 899 | Ga0495682_0000057 | 3300049460 | Bacteria | 102695 |
| 900 | Ga0495682_0000150 | 3300049460 | Bacteria | 59591 |
| 901 | Ga0495682_0002187 | 3300049460 | Bacteria | 9464 |
| 902 | Ga0495682_0050060 | 3300049460 | Bacteria | 1521 |
| 903 | Ga0501292_015697 | 3300049515 | Bacteria | 1186 |
| 904 | Ga0501031_0200272 | 3300049568 | Bacteria | 1303 |
| 905 | Ga0501031_0486151 | 3300049568 | Bacteria | 796 |
| 906 | Ga0501032_0001083 | 3300049569 | Bacteria | 21774 |
| 907 | Ga0501032_0074944 | 3300049569 | Bacteria | 2254 |
| 908 | Ga0501032_0126711 | 3300049569 | Bacteria | 1686 |
| 909 | Ga0501033_0007007 | 3300049570 | Bacteria | 8800 |
| 910 | Ga0501033_0033057 | 3300049570 | Bacteria | 3884 |
| 911 | Ga0501033_0054336 | 3300049570 | Bacteria | 2963 |
| 912 | Ga0501033_0125314 | 3300049570 | Bacteria | 1863 |
| 913 | Ga0501033_0560450 | 3300049570 | Bacteria | 786 |
| 914 | Ga0501034_0023042 | 3300049571 | Bacteria | 6345 |
| 915 | Ga0501034_0106313 | 3300049571 | Bacteria | 2799 |
| 916 | Ga0501036_0001511 | 3300049572 | Bacteria | 17940 |
| 917 | Ga0501036_0057761 | 3300049572 | Bacteria | 3287 |
| 918 | Ga0501037_0117943 | 3300049573 | Bacteria | 1910 |
| 919 | Ga0501037_0537767 | 3300049573 | Bacteria | 790 |
| 920 | Ga0501038_0002514 | 3300049574 | Bacteria | 17083 |
| 921 | Ga0501038_0105098 | 3300049574 | Bacteria | 2346 |
| 922 | Ga0501039_0019851 | 3300049575 | Bacteria | 5151 |
| 923 | Ga0501039_0108305 | 3300049575 | Bacteria | 2172 |
| 924 | Ga0501039_0770585 | 3300049575 | Bacteria | 751 |
| 925 | Ga0501042_0210718 | 3300049578 | Bacteria | 1402 |
| 926 | Ga0501043_0017574 | 3300049579 | Bacteria | 5607 |
| 927 | Ga0501043_0081669 | 3300049579 | Bacteria | 2540 |
| 928 | Ga0501043_0360780 | 3300049579 | Bacteria | 1103 |
| 929 | Ga0501046_0002922 | 3300049580 | Bacteria | 15807 |
| 930 | Ga0501046_0163552 | 3300049580 | Bacteria | 1673 |
| 931 | Ga0501047_0053686 | 3300049581 | Bacteria | 3897 |
| 932 | Ga0501047_0127817 | 3300049581 | Bacteria | 2421 |
| 933 | Ga0501047_0153961 | 3300049581 | Bacteria | 2173 |
| 934 | Ga0501047_0473360 | 3300049581 | Bacteria | 1081 |
| 935 | Ga0501048_0033726 | 3300049582 | Bacteria | 3697 |
| 936 | Ga0501067_0007502 | 3300049583 | Bacteria | 6060 |
| 937 | Ga0501067_0126497 | 3300049583 | Bacteria | 1422 |
| 938 | Ga0501068_0026008 | 3300049584 | Bacteria | 3445 |
| 939 | Ga0501069_0000699 | 3300049585 | Bacteria | 15622 |
| 940 | Ga0501070_0015536 | 3300049586 | Bacteria | 6403 |
| 941 | Ga0501070_0160074 | 3300049586 | Bacteria | 1856 |
| 942 | Ga0501072_0359312 | 3300049588 | Bacteria | 1156 |
| 943 | Ga0501072_1042017 | 3300049588 | Bacteria | 637 |
| 944 | Ga0501073_0006072 | 3300049589 | Bacteria | 9010 |
| 945 | Ga0501073_0025165 | 3300049589 | Bacteria | 4271 |
| 946 | Ga0501074_0001430 | 3300049590 | Bacteria | 15941 |
| 947 | Ga0501074_0272193 | 3300049590 | Bacteria | 1204 |
| 948 | Ga0501077_0224463 | 3300049593 | Bacteria | 1194 |
| 949 | Ga0501079_0525770 | 3300049741 | Bacteria | 930 |
| 950 | Ga0501080_0001937 | 3300049742 | Bacteria | 17876 |
| 951 | Ga0501080_0025505 | 3300049742 | Bacteria | 5487 |
| 952 | Ga0501080_0260589 | 3300049742 | Bacteria | 1580 |
| 953 | Ga0501081_0699858 | 3300049743 | Bacteria | 761 |
| 954 | Ga0501083_0002912 | 3300049744 | Bacteria | 11857 |
| 955 | Ga0501083_0059671 | 3300049744 | Bacteria | 2551 |
| 956 | Ga0501265_023190 | 3300049762 | Bacteria | 853 |
| 957 | Ga0501266_000054 | 3300049763 | Bacteria | 18170 |
| 958 | Ga0501035_0010721 | 3300049822 | Bacteria | 8485 |
| 959 | Ga0501035_0015990 | 3300049822 | Bacteria | 6925 |
| 960 | Ga0501035_0242035 | 3300049822 | Bacteria | 1534 |
| 961 | Ga0501035_0343841 | 3300049822 | Bacteria | 1249 |
| 962 | Ga0501035_0388426 | 3300049822 | Bacteria | 1163 |
| 963 | Ga0501044_0003491 | 3300049823 | Bacteria | 17698 |
| 964 | Ga0501044_0018003 | 3300049823 | Bacteria | 7574 |
| 965 | Ga0501044_0036069 | 3300049823 | Bacteria | 5175 |
| 966 | Ga0501044_0044768 | 3300049823 | Bacteria | 4590 |
| 967 | Ga0501044_0103215 | 3300049823 | Bacteria | 2866 |
| 968 | Ga0501044_0360559 | 3300049823 | Bacteria | 1372 |
| 969 | nmdc:mga03683_1809_c1 | 3300050489 | Bacteria | 6485 |
| 970 | nmdc:mga03683_67614_c1 | 3300050489 | Bacteria | 1521 |
| 971 | nmdc:mga03683_9357_c1 | 3300050489 | Bacteria | 3480 |
| 972 | nmdc:mga03n38_11169_c1 | 3300050490 | Bacteria | 3337 |
| 973 | nmdc:mga03n38_38252_c1 | 3300050490 | Bacteria | 2074 |
| 974 | nmdc:mga0yw44_192791_c1 | 3300050492 | Bacteria | 1344 |
| 975 | nmdc:mga0yw44_507445_c1 | 3300050492 | Bacteria | 818 |
| 976 | nmdc:mga0k408_109735_c1 | 3300050493 | Bacteria | 1631 |
| 977 | nmdc:mga0k408_120711_c1 | 3300050493 | Bacteria | 1552 |
| 978 | nmdc:mga0k408_18454_c1 | 3300050493 | Bacteria | 3895 |
| 979 | nmdc:mga0k408_23802_c1 | 3300050493 | Bacteria | 3459 |
| 980 | nmdc:mga0k408_35539_c1 | 3300050493 | Bacteria | 1814 |
| 981 | nmdc:mga0k408_416683_c1 | 3300050493 | Bacteria | 799 |
| 982 | nmdc:mga0k408_76875_c1 | 3300050493 | Bacteria | 1952 |
| 983 | nmdc:mga06z11_307568_c1 | 3300050494 | Bacteria | 943 |
| 984 | nmdc:mga06z11_77995_c1 | 3300050494 | Bacteria | 1770 |
| 985 | nmdc:mga04h51_66560_c1 | 3300050495 | Bacteria | 1248 |
| 986 | nmdc:mga07m45_12949_c1 | 3300050496 | Bacteria | 4414 |
| 987 | nmdc:mga07m45_130141_c1 | 3300050496 | Bacteria | 1456 |
| 988 | nmdc:mga07m45_13252_c1 | 3300050496 | Bacteria | 4370 |
| 989 | nmdc:mga07m45_20630_c1 | 3300050496 | Bacteria | 3581 |
| 990 | nmdc:mga07m45_21476_c1 | 3300050496 | Bacteria | 3516 |
| 991 | nmdc:mga07m45_23144_c1 | 3300050496 | Bacteria | 3394 |
| 992 | nmdc:mga07m45_24181_c1 | 3300050496 | Bacteria | 3326 |
| 993 | nmdc:mga07m45_273212_c1 | 3300050496 | Bacteria | 983 |
| 994 | nmdc:mga07m45_432249_c1 | 3300050496 | Bacteria | 764 |
| 995 | nmdc:mga05p37_241795_c1 | 3300050507 | Bacteria | 2170 |
| 996 | nmdc:mga09592_434381_c1 | 3300050508 | Bacteria | 1133 |
| 997 | nmdc:mga06r32_349326_c1 | 3300050510 | Bacteria | 1463 |
| 998 | nmdc:mga08y16_26_c1 | 3300050511 | Bacteria | 223965 |
| 999 | nmdc:mga08y16_545867_c1 | 3300050511 | Bacteria | 1173 |
| 1000 | nmdc:mga0sz30_25497_c1 | 3300050516 | Bacteria | 2417 |
| 1001 | Ga0500610_0000357 | 3300053079 | Bacteria | 13812 |
| 1002 | Ga0495655_0113866 | 3300053083 | Bacteria | 816 |
| 1003 | Ga0500643_008621 | 3300053087 | Bacteria | 3992 |
| 1004 | Ga0500643_083135 | 3300053087 | Bacteria | 878 |
| 1005 | Ga0500644_0017141 | 3300053088 | Bacteria | 2097 |
| 1006 | Ga0500644_0071631 | 3300053088 | Bacteria | 1250 |
| 1007 | Ga0500644_0096275 | 3300053088 | Bacteria | 1117 |
| 1008 | Ga0500581_018544 | 3300053089 | Bacteria | 3503 |
| 1009 | Ga0500646_0013403 | 3300053090 | Bacteria | 2121 |
| 1010 | Ga0500647_0143965 | 3300053091 | Bacteria | 1116 |
| 1011 | Ga0500651_0000063 | 3300053093 | Bacteria | 70772 |
| 1012 | Ga0500651_0000517 | 3300053093 | Bacteria | 19898 |
| 1013 | Ga0500651_0013292 | 3300053093 | Bacteria | 5013 |
| 1014 | Ga0500566_0000689 | 3300053094 | Bacteria | 19009 |
| 1015 | Ga0500566_0001144 | 3300053094 | Bacteria | 15405 |
| 1016 | Ga0500566_0016607 | 3300053094 | Bacteria | 4321 |
| 1017 | Ga0500566_0140632 | 3300053094 | Bacteria | 1281 |
| 1018 | Ga0500641_0005940 | 3300053096 | Bacteria | 4324 |
| 1019 | Ga0500641_0008971 | 3300053096 | Bacteria | 3584 |
| 1020 | Ga0500641_0061765 | 3300053096 | Bacteria | 1561 |
| 1021 | Ga0500650_0053857 | 3300053098 | Bacteria | 1872 |
| 1022 | Ga0500555_015335 | 3300053103 | Bacteria | 2210 |
| 1023 | Ga0500555_071813 | 3300053103 | Bacteria | 913 |
| 1024 | Ga0500556_0000015 | 3300053104 | Bacteria | 202598 |
| 1025 | Ga0500557_000020 | 3300053105 | Bacteria | 91933 |
| 1026 | Ga0500562_009386 | 3300053108 | Bacteria | 2475 |
| 1027 | Ga0500571_000022 | 3300053110 | Bacteria | 56973 |
| 1028 | Ga0500593_000228 | 3300053117 | Bacteria | 23190 |
| 1029 | Ga0500593_084365 | 3300053117 | Bacteria | 1355 |
| 1030 | Ga0500594_0009959 | 3300053118 | Bacteria | 2197 |
| 1031 | Ga0500595_000931 | 3300053119 | Bacteria | 16565 |
| 1032 | Ga0500607_003093 | 3300053121 | Bacteria | 12498 |
| 1033 | Ga0500607_021201 | 3300053121 | Bacteria | 3664 |
| 1034 | Ga0500607_060974 | 3300053121 | Bacteria | 1976 |
| 1035 | Ga0500608_002235 | 3300053122 | Bacteria | 6992 |
| 1036 | Ga0500608_007502 | 3300053122 | Bacteria | 4520 |
| 1037 | Ga0500608_077610 | 3300053122 | Bacteria | 1572 |
| 1038 | Ga0500614_019107 | 3300053123 | Bacteria | 1566 |
| 1039 | Ga0500618_003999 | 3300053125 | Bacteria | 4862 |
| 1040 | Ga0500618_017814 | 3300053125 | Bacteria | 1763 |
| 1041 | Ga0500618_042342 | 3300053125 | Bacteria | 1043 |
| 1042 | Ga0500626_014123 | 3300053128 | Bacteria | 3454 |
| 1043 | Ga0500642_0000019 | 3300053130 | Bacteria | 159944 |
| 1044 | Ga0500642_0000057 | 3300053130 | Bacteria | 67011 |
| 1045 | Ga0500642_0000414 | 3300053130 | Bacteria | 13963 |
| 1046 | Ga0500652_000710 | 3300053131 | Bacteria | 11310 |
| 1047 | Ga0500658_0000125 | 3300053134 | Bacteria | 36384 |
| 1048 | Ga0500658_0000804 | 3300053134 | Bacteria | 12998 |
| 1049 | Ga0500658_0184649 | 3300053134 | Bacteria | 950 |
| 1050 | Ga0500559_0001410 | 3300053136 | Bacteria | 13642 |
| 1051 | Ga0500559_0004516 | 3300053136 | Bacteria | 6582 |
| 1052 | Ga0500559_0013619 | 3300053136 | Bacteria | 3442 |
| 1053 | Ga0500559_0141020 | 3300053136 | Bacteria | 1128 |
| 1054 | Ga0500561_0033666 | 3300053137 | Bacteria | 1311 |
| 1055 | Ga0500564_013358 | 3300053138 | Bacteria | 3674 |
| 1056 | Ga0500568_0001840 | 3300053139 | Bacteria | 13074 |
| 1057 | Ga0500568_0004520 | 3300053139 | Bacteria | 7413 |
| 1058 | Ga0500568_0084708 | 3300053139 | Bacteria | 1200 |
| 1059 | Ga0500574_000185 | 3300053141 | Bacteria | 7291 |
| 1060 | Ga0500577_0083842 | 3300053142 | Bacteria | 1276 |
| 1061 | Ga0500577_0103967 | 3300053142 | Bacteria | 1165 |
| 1062 | Ga0500577_0262348 | 3300053142 | Bacteria | 751 |
| 1063 | Ga0500588_0072342 | 3300053146 | Bacteria | 1134 |
| 1064 | Ga0500589_001817 | 3300053147 | Bacteria | 6711 |
| 1065 | Ga0500589_240926 | 3300053147 | Bacteria | 669 |
| 1066 | Ga0500590_012511 | 3300053148 | Bacteria | 4327 |
| 1067 | Ga0500590_199967 | 3300053148 | Bacteria | 847 |
| 1068 | Ga0500604_0023917 | 3300053151 | Bacteria | 1745 |
| 1069 | Ga0500604_0095012 | 3300053151 | Bacteria | 977 |
| 1070 | Ga0500604_0150525 | 3300053151 | Bacteria | 790 |
| 1071 | Ga0500616_0000041 | 3300053153 | Bacteria | 359328 |
| 1072 | Ga0500616_0000997 | 3300053153 | Bacteria | 30619 |
| 1073 | Ga0500616_0071225 | 3300053153 | Bacteria | 1771 |
| 1074 | Ga0500616_0087061 | 3300053153 | Bacteria | 1556 |
| 1075 | Ga0500619_023270 | 3300053154 | Bacteria | 1808 |
| 1076 | Ga0500622_0000586 | 3300053156 | Bacteria | 33061 |
| 1077 | Ga0500622_0005571 | 3300053156 | Bacteria | 7518 |
| 1078 | Ga0500622_0093100 | 3300053156 | Bacteria | 1493 |
| 1079 | Ga0500622_0112652 | 3300053156 | Bacteria | 1328 |
| 1080 | Ga0500627_0001017 | 3300053158 | Bacteria | 7642 |
| 1081 | Ga0500627_0146239 | 3300053158 | Bacteria | 1067 |
| 1082 | Ga0500633_0058392 | 3300053160 | Bacteria | 1351 |
| 1083 | Ga0500634_0011762 | 3300053161 | Bacteria | 4530 |
| 1084 | Ga0500634_0012245 | 3300053161 | Bacteria | 4462 |
| 1085 | Ga0500634_0037133 | 3300053161 | Bacteria | 2651 |
| 1086 | Ga0500638_000424 | 3300053162 | Bacteria | 10110 |
| 1087 | Ga0500638_255907 | 3300053162 | Bacteria | 701 |
| 1088 | Ga0500636_0000173 | 3300053177 | Bacteria | 34092 |
| 1089 | Ga0500636_0029967 | 3300053177 | Bacteria | 3216 |
| 1090 | Ga0500636_0346786 | 3300053177 | Bacteria | 710 |
| 1091 | Ga0500625_096378 | 3300053729 | Bacteria | 1252 |
| 1092 | Ga0500609_004995 | 3300053731 | Bacteria | 1815 |
| 1093 | Ga0500601_000125 | 3300053737 | Bacteria | 15831 |
| 1094 | Ga0501084_0027930 | 3300054114 | Bacteria | 4715 |
| 1095 | Ga0501084_0052633 | 3300054114 | Bacteria | 3406 |
| 1096 | Ga0500661_021286 | 3300055283 | Bacteria | 1152 |
| 1097 | Ga0590071_028360 | 3300059421 | Bacteria | 1330 |
| 1098 | Ga0501082_0021724 | 3300060353 | Bacteria | 5532 |
| 1099 | Ga0501082_0089709 | 3300060353 | Bacteria | 2654 |
| 1100 | Ga0530510_0507035 | 3300061734 | Bacteria | 915 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041456 | Ga0451795_1577188 | Ga0451795_1577188_10_504 | 163 |
| 2 | 3300006195 | Ga0075366_10003598 | Ga0075366_100035988 | 177 |
| 3 | 3300050493 | nmdc:mga0k408_23802_c1 | nmdc:mga0k408_23802_c1_1952_2530 | 177 |
| 4 | 3300014497 | Ga0182008_10424475 | Ga0182008_104244751 | 178 |
| 5 | 3300046507 | Ga0495606_0522893 | Ga0495606_0522893_14_556 | 179 |
| 6 | 3300005327 | Ga0070658_10089717 | Ga0070658_100897172 | 186 |
| 7 | 3300005337 | Ga0070682_100067873 | Ga0070682_1000678732 | 186 |
| 8 | 3300005455 | Ga0070663_100271830 | Ga0070663_1002718302 | 186 |
| 9 | 3300025919 | Ga0207657_10037373 | Ga0207657_100373733 | 186 |
| 10 | 3300048907 | Ga0496104_0259168 | Ga0496104_0259168_148_765 | 186 |
| 11 | iso_pu_bacteria | 2874628541 | 2874635162 | 187 |
| 12 | iso_pu_bacteria | 2883577096 | 2883581384 | 187 |
| 13 | iso_pu_bacteria | 2508501042 | 2508692549 | 188 |
| 14 | iso_pu_bacteria | 2513237161 | 2514009567 | 188 |
| 15 | iso_pu_bacteria | 2517093001 | 2517104018 | 188 |
| 16 | iso_pu_bacteria | 2547132374 | 2548498503 | 188 |
| 17 | iso_pu_bacteria | 2599185214 | 2599627604 | 188 |
| 18 | iso_pu_bacteria | 2599185226 | 2599677174 | 188 |
| 19 | iso_pu_bacteria | 2599185227 | 2599685345 | 188 |
| 20 | iso_pu_bacteria | 2599185229 | 2599697094 | 188 |
| 21 | iso_pu_bacteria | 2599185292 | 2599907523 | 188 |
| 22 | iso_pu_bacteria | 2617270735 | 2617346664 | 188 |
| 23 | iso_pu_bacteria | 2643221570 | 2643867336 | 188 |
| 24 | iso_pu_bacteria | 2643221596 | 2643992024 | 188 |
| 25 | iso_pu_bacteria | 2643221609 | 2644061712 | 188 |
| 26 | iso_pu_bacteria | 2643221611 | 2644070453 | 188 |
| 27 | iso_pu_bacteria | 2643221628 | 2644158767 | 188 |
| 28 | iso_pu_bacteria | 2643221652 | 2644295746 | 188 |
| 29 | iso_pu_bacteria | 2643221658 | 2644325795 | 188 |
| 30 | iso_pu_bacteria | 2643221672 | 2644399662 | 188 |
| 31 | iso_pu_bacteria | 2643221717 | 2644646307 | 188 |
| 32 | iso_pu_bacteria | 2721755755 | 2723842854 | 188 |
| 33 | iso_pu_bacteria | 2738541277 | 2738722563 | 188 |
| 34 | iso_pu_bacteria | 2738543019 | 2739283134 | 188 |
| 35 | iso_pu_bacteria | 2791355196 | 2793064482 | 188 |
| 36 | iso_pu_bacteria | 2818991446 | 2819600853 | 188 |
| 37 | iso_pu_bacteria | 2824773399 | 2824777415 | 188 |
| 38 | iso_pu_bacteria | 2831265667 | 2831267559 | 188 |
| 39 | iso_pu_bacteria | 2838054893 | 2838056050 | 188 |
| 40 | iso_pu_bacteria | 2838054893 | 2838061312 | 188 |
| 41 | iso_pu_bacteria | 2838122688 | 2838128928 | 188 |
| 42 | iso_pu_bacteria | 2841966195 | 2841972179 | 188 |
| 43 | iso_pu_bacteria | 2841983080 | 2841986303 | 188 |
| 44 | iso_pu_bacteria | 2842038055 | 2842040521 | 188 |
| 45 | iso_pu_bacteria | 2842045827 | 2842046533 | 188 |
| 46 | iso_pu_bacteria | 2855730933 | 2855736474 | 188 |
| 47 | iso_pu_bacteria | 2855767633 | 2855773411 | 188 |
| 48 | iso_pu_bacteria | 2857537821 | 2857540102 | 188 |
| 49 | iso_pu_bacteria | 2874612657 | 2874614710 | 188 |
| 50 | iso_pu_bacteria | 2874620515 | 2874622217 | 188 |
| 51 | iso_pu_bacteria | 2881412998 | 2881418633 | 188 |
| 52 | iso_pu_bacteria | 2885192300 | 2885197082 | 188 |
| 53 | iso_pu_bacteria | 2899924645 | 2899931597 | 188 |
| 54 | iso_pu_bacteria | 2904449895 | 2904453839 | 188 |
| 55 | iso_pu_bacteria | 2904456579 | 2904462314 | 188 |
| 56 | iso_pu_bacteria | 2904666416 | 2904667829 | 188 |
| 57 | iso_pu_bacteria | 2928037797 | 2928042978 | 188 |
| 58 | iso_pu_bacteria | 2928044640 | 2928050363 | 188 |
| 59 | iso_pu_bacteria | 2928051484 | 2928056606 | 188 |
| 60 | iso_pu_bacteria | 2928064002 | 2928068933 | 188 |
| 61 | iso_pu_bacteria | 2928084124 | 2928088783 | 188 |
| 62 | iso_pu_bacteria | 2928115317 | 2928117535 | 188 |
| 63 | iso_pu_bacteria | 2929520902 | 2929525039 | 188 |
| 64 | iso_pu_bacteria | 2935648319 | 2935654248 | 188 |
| 65 | iso_pu_bacteria | 2935656913 | 2935663059 | 188 |
| 66 | iso_pu_bacteria | 2935984226 | 2935986608 | 188 |
| 67 | iso_pu_bacteria | 2936011229 | 2936017215 | 188 |
| 68 | iso_pu_bacteria | 2936019824 | 2936025717 | 188 |
| 69 | iso_pu_bacteria | 2936028420 | 2936034628 | 188 |
| 70 | iso_pu_bacteria | 2936046547 | 2936052685 | 188 |
| 71 | iso_pu_bacteria | 2941479691 | 2941483002 | 188 |
| 72 | iso_pu_bacteria | 2945945610 | 2945948672 | 188 |
| 73 | iso_pu_bacteria | 2945972063 | 2945972545 | 188 |
| 74 | 3300005347 | Ga0070668_100557237 | Ga0070668_1005572372 | 189 |
| 75 | 3300005543 | Ga0070672_100148520 | Ga0070672_1001485203 | 189 |
| 76 | 3300013102 | Ga0157371_10037776 | Ga0157371_100377762 | 189 |
| 77 | 3300013308 | Ga0157375_10161067 | Ga0157375_101610673 | 189 |
| 78 | 3300048929 | Ga0496126_0165925 | Ga0496126_0165925_672_1241 | 189 |
| 79 | iso_pu_bacteria | 2511231004 | 2511257825 | 189 |
| 80 | iso_pu_bacteria | 2511231007 | 2511274665 | 189 |
| 81 | iso_pu_bacteria | 2511231016 | 2511328671 | 189 |
| 82 | iso_pu_bacteria | 2513237139 | 2513878183 | 189 |
| 83 | iso_pu_bacteria | 2515154123 | 2515689200 | 189 |
| 84 | iso_pu_bacteria | 2582581314 | 2585320614 | 189 |
| 85 | iso_pu_bacteria | 2599185305 | 2599958575 | 189 |
| 86 | iso_pu_bacteria | 2599185318 | 2600038742 | 189 |
| 87 | iso_pu_bacteria | 2643221623 | 2644133709 | 189 |
| 88 | iso_pu_bacteria | 2675903515 | 2678263272 | 189 |
| 89 | iso_pu_bacteria | 2738541317 | 2738944740 | 189 |
| 90 | iso_pu_bacteria | 2744054620 | 2745009603 | 189 |
| 91 | iso_pu_bacteria | 2775507049 | 2776910820 | 189 |
| 92 | iso_pu_bacteria | 2802429603 | 2805919188 | 189 |
| 93 | iso_pu_bacteria | 2824671348 | 2824675912 | 189 |
| 94 | iso_pu_bacteria | 2824687955 | 2824692107 | 189 |
| 95 | iso_pu_bacteria | 2824696289 | 2824700462 | 189 |
| 96 | iso_pu_bacteria | 2841941048 | 2841944918 | 189 |
| 97 | iso_pu_bacteria | 2841949485 | 2841953349 | 189 |
| 98 | iso_pu_bacteria | 2841974524 | 2841978068 | 189 |
| 99 | iso_pu_bacteria | 2857524615 | 2857524698 | 189 |
| 100 | iso_pu_bacteria | 2858950400 | 2858952529 | 189 |
| 101 | iso_pu_bacteria | 2874604998 | 2874606479 | 189 |
| 102 | iso_pu_bacteria | 2876808645 | 2876813085 | 189 |
| 103 | iso_pu_bacteria | 2879110137 | 2879119201 | 189 |
| 104 | iso_pu_bacteria | 2885270888 | 2885275507 | 189 |
| 105 | iso_pu_bacteria | 2889033259 | 2889033820 | 189 |
| 106 | iso_pu_bacteria | 2893066018 | 2893069218 | 189 |
| 107 | iso_pu_bacteria | 2899803654 | 2899805120 | 189 |
| 108 | iso_pu_bacteria | 2900634093 | 2900642104 | 189 |
| 109 | iso_pu_bacteria | 2913036834 | 2913039003 | 189 |
| 110 | iso_pu_bacteria | 2913308742 | 2913309361 | 189 |
| 111 | iso_pu_bacteria | 2919073203 | 2919078582 | 189 |
| 112 | iso_pu_bacteria | 2919481497 | 2919483883 | 189 |
| 113 | iso_pu_bacteria | 2922361189 | 2922367240 | 189 |
| 114 | iso_pu_bacteria | 2931369376 | 2931370012 | 189 |
| 115 | iso_pu_bacteria | 2931396565 | 2931402054 | 189 |
| 116 | iso_pu_bacteria | 2933016740 | 2933022702 | 189 |
| 117 | iso_pu_bacteria | 3005483717 | 3005485803 | 189 |
| 118 | iso_pu_bacteria | 3005587118 | 3005588788 | 189 |
| 119 | iso_pu_bacteria | 3007419365 | 3007423625 | 189 |
| 120 | iso_pu_bacteria | 8005658619 | 8005661373 | 189 |
| 121 | iso_pu_bacteria | 8006964411 | 8006966168 | 189 |
| 122 | iso_pu_bacteria | 8021120328 | 8021127618 | 189 |
| 123 | iso_pu_bacteria | 8054558443 | 8054563673 | 189 |
| 124 | iso_pu_bacteria | 8054563764 | 8054564364 | 189 |
| 125 | iso_pu_bacteria | 8056143049 | 8056146817 | 189 |
| 126 | iso_pu_bacteria | 8056673599 | 8056675082 | 189 |
| 127 | 3300005337 | Ga0070682_100418806 | Ga0070682_1004188062 | 190 |
| 128 | 3300005347 | Ga0070668_100287766 | Ga0070668_1002877662 | 190 |
| 129 | 3300005347 | Ga0070668_100759046 | Ga0070668_1007590462 | 190 |
| 130 | 3300005719 | Ga0068861_100138851 | Ga0068861_1001388513 | 190 |
| 131 | 3300005842 | Ga0068858_100843716 | Ga0068858_1008437162 | 190 |
| 132 | 3300005843 | Ga0068860_100550446 | Ga0068860_1005504462 | 190 |
| 133 | 3300005844 | Ga0068862_100079023 | Ga0068862_1000790233 | 190 |
| 134 | 3300005937 | Ga0081455_10438662 | Ga0081455_104386622 | 190 |
| 135 | 3300009093 | Ga0105240_10181781 | Ga0105240_101817813 | 190 |
| 136 | 3300009094 | Ga0111539_11705122 | Ga0111539_117051222 | 190 |
| 137 | 3300009098 | Ga0105245_10042336 | Ga0105245_100423364 | 190 |
| 138 | 3300009101 | Ga0105247_10062041 | Ga0105247_100620412 | 190 |
| 139 | 3300009177 | Ga0105248_10218363 | Ga0105248_102183632 | 190 |
| 140 | 3300009545 | Ga0105237_11438483 | Ga0105237_114384831 | 190 |
| 141 | 3300009553 | Ga0105249_10043409 | Ga0105249_100434094 | 190 |
| 142 | 3300010375 | Ga0105239_10203277 | Ga0105239_102032772 | 190 |
| 143 | 3300013306 | Ga0163162_11104727 | Ga0163162_111047272 | 190 |
| 144 | 3300025297 | Ga0209758_1000169 | Ga0209758_100016936 | 190 |
| 145 | 3300025297 | Ga0209758_1025357 | Ga0209758_10253572 | 190 |
| 146 | 3300025298 | Ga0209050_1017511 | Ga0209050_10175112 | 190 |
| 147 | 3300025304 | Ga0209257_1000640 | Ga0209257_100064038 | 190 |
| 148 | 3300025916 | Ga0207663_10661450 | Ga0207663_106614501 | 190 |
| 149 | 3300025923 | Ga0207681_10264730 | Ga0207681_102647302 | 190 |
| 150 | 3300025925 | Ga0207650_10294159 | Ga0207650_102941592 | 190 |
| 151 | 3300025941 | Ga0207711_10449388 | Ga0207711_104493882 | 190 |
| 152 | 3300025961 | Ga0207712_10321970 | Ga0207712_103219702 | 190 |
| 153 | 3300025972 | Ga0207668_11075075 | Ga0207668_110750752 | 190 |
| 154 | 3300026035 | Ga0207703_10043282 | Ga0207703_100432824 | 190 |
| 155 | 3300026095 | Ga0207676_10199040 | Ga0207676_101990403 | 190 |
| 156 | 3300026118 | Ga0207675_100184054 | Ga0207675_1001840542 | 190 |
| 157 | 3300028380 | Ga0268265_10007850 | Ga0268265_100078507 | 190 |
| 158 | 3300028380 | Ga0268265_10274687 | Ga0268265_102746872 | 190 |
| 159 | 3300028786 | Ga0307517_10227876 | Ga0307517_102278761 | 190 |
| 160 | 3300031456 | Ga0307513_10022346 | Ga0307513_100223463 | 190 |
| 161 | 3300031616 | Ga0307508_10140453 | Ga0307508_101404531 | 190 |
| 162 | 3300031730 | Ga0307516_10093460 | Ga0307516_100934604 | 190 |
| 163 | 3300042001 | Ga0439441_029475 | Ga0439441_029475_214_789 | 190 |
| 164 | 3300042006 | Ga0439432_065863 | Ga0439432_065863_324_899 | 190 |
| 165 | 3300042011 | Ga0439454_016883 | Ga0439454_016883_388_963 | 190 |
| 166 | 3300042135 | Ga0450899_006226 | Ga0450899_006226_304_879 | 190 |
| 167 | 3300042137 | Ga0450902_039672 | Ga0450902_039672_36_611 | 190 |
| 168 | 3300042138 | Ga0450903_007196 | Ga0450903_007196_627_1202 | 190 |
| 169 | 3300042156 | Ga0439446_0005658 | Ga0439446_0005658_154_729 | 190 |
| 170 | 3300042185 | Ga0450909_007879 | Ga0450909_007879_254_829 | 190 |
| 171 | 3300042439 | Ga0439464_0015028 | Ga0439464_0015028_948_1523 | 190 |
| 172 | 3300046457 | Ga0495590_0257338 | Ga0495590_0257338_60_635 | 190 |
| 173 | 3300046460 | Ga0495638_0077439 | Ga0495638_0077439_1337_1912 | 190 |
| 174 | 3300047472 | Ga0495686_0113577 | Ga0495686_0113577_508_1083 | 190 |
| 175 | 3300047472 | Ga0495686_0188213 | Ga0495686_0188213_60_635 | 190 |
| 176 | 3300048903 | Ga0496100_0207754 | Ga0496100_0207754_480_1055 | 190 |
| 177 | 3300048905 | Ga0496102_0071315 | Ga0496102_0071315_1328_1903 | 190 |
| 178 | 3300048911 | Ga0496108_0068863 | Ga0496108_0068863_2273_2848 | 190 |
| 179 | 3300048913 | Ga0496110_0327469 | Ga0496110_0327469_376_951 | 190 |
| 180 | 3300048920 | Ga0496117_0000237 | Ga0496117_0000237_41375_41950 | 190 |
| 181 | 3300048921 | Ga0496118_0000280 | Ga0496118_0000280_34635_35210 | 190 |
| 182 | 3300048922 | Ga0496119_0000107 | Ga0496119_0000107_74078_74653 | 190 |
| 183 | 3300048923 | Ga0496120_0000011 | Ga0496120_0000011_42174_42749 | 190 |
| 184 | 3300049573 | Ga0501037_0117943 | Ga0501037_0117943_1196_1771 | 190 |
| 185 | 3300049574 | Ga0501038_0105098 | Ga0501038_0105098_1189_1764 | 190 |
| 186 | 3300049575 | Ga0501039_0108305 | Ga0501039_0108305_781_1356 | 190 |
| 187 | 3300049579 | Ga0501043_0081669 | Ga0501043_0081669_1146_1721 | 190 |
| 188 | 3300049580 | Ga0501046_0163552 | Ga0501046_0163552_526_1101 | 190 |
| 189 | 3300049581 | Ga0501047_0153961 | Ga0501047_0153961_771_1346 | 190 |
| 190 | 3300049581 | Ga0501047_0473360 | Ga0501047_0473360_432_1007 | 190 |
| 191 | 3300049584 | Ga0501068_0026008 | Ga0501068_0026008_2631_3206 | 190 |
| 192 | 3300049588 | Ga0501072_0359312 | Ga0501072_0359312_269_844 | 190 |
| 193 | 3300049589 | Ga0501073_0025165 | Ga0501073_0025165_2295_2870 | 190 |
| 194 | 3300049590 | Ga0501074_0272193 | Ga0501074_0272193_100_675 | 190 |
| 195 | 3300049593 | Ga0501077_0224463 | Ga0501077_0224463_446_1021 | 190 |
| 196 | 3300049741 | Ga0501079_0525770 | Ga0501079_0525770_46_621 | 190 |
| 197 | 3300049742 | Ga0501080_0025505 | Ga0501080_0025505_3853_4428 | 190 |
| 198 | 3300049744 | Ga0501083_0059671 | Ga0501083_0059671_1234_1809 | 190 |
| 199 | 3300049822 | Ga0501035_0388426 | Ga0501035_0388426_520_1095 | 190 |
| 200 | 3300049823 | Ga0501044_0036069 | Ga0501044_0036069_2084_2659 | 190 |
| 201 | 3300049823 | Ga0501044_0103215 | Ga0501044_0103215_132_707 | 190 |
| 202 | 3300049823 | Ga0501044_0360559 | Ga0501044_0360559_782_1357 | 190 |
| 203 | 3300050511 | nmdc:mga08y16_545867_c1 | nmdc:mga08y16_545867_c1_295_870 | 190 |
| 204 | 3300053093 | Ga0500651_0013292 | Ga0500651_0013292_809_1384 | 190 |
| 205 | 3300053094 | Ga0500566_0140632 | Ga0500566_0140632_435_1010 | 190 |
| 206 | 3300053096 | Ga0500641_0005940 | Ga0500641_0005940_1884_2459 | 190 |
| 207 | 3300053103 | Ga0500555_015335 | Ga0500555_015335_457_1032 | 190 |
| 208 | 3300053118 | Ga0500594_0009959 | Ga0500594_0009959_956_1531 | 190 |
| 209 | 3300053119 | Ga0500595_000931 | Ga0500595_000931_133_708 | 190 |
| 210 | 3300053130 | Ga0500642_0000414 | Ga0500642_0000414_11403_11978 | 190 |
| 211 | 3300053134 | Ga0500658_0184649 | Ga0500658_0184649_202_777 | 190 |
| 212 | 3300053139 | Ga0500568_0004520 | Ga0500568_0004520_2449_3024 | 190 |
| 213 | 3300053142 | Ga0500577_0083842 | Ga0500577_0083842_459_1034 | 190 |
| 214 | 3300053142 | Ga0500577_0262348 | Ga0500577_0262348_124_699 | 190 |
| 215 | 3300053151 | Ga0500604_0023917 | Ga0500604_0023917_76_651 | 190 |
| 216 | 3300053151 | Ga0500604_0095012 | Ga0500604_0095012_166_741 | 190 |
| 217 | 3300053153 | Ga0500616_0000997 | Ga0500616_0000997_6814_7389 | 190 |
| 218 | 3300053731 | Ga0500609_004995 | Ga0500609_004995_384_959 | 190 |
| 219 | 3300054114 | Ga0501084_0052633 | Ga0501084_0052633_1185_1760 | 190 |
| 220 | 3300060353 | Ga0501082_0089709 | Ga0501082_0089709_2056_2631 | 190 |
| 221 | iso_pu_bacteria | 2906626472 | 2906632319 | 190 |
| 222 | 3300001989 | JGI24739J22299_10065880 | JGI24739J22299_100658802 | 191 |
| 223 | 3300002774 | JGI25150J39212_1014226 | JGI25150J39212_10142262 | 191 |
| 224 | 3300003187 | JGI25151J46595_10001862 | JGI25151J46595_1000186212 | 191 |
| 225 | 3300003187 | JGI25151J46595_10005013 | JGI25151J46595_100050133 | 191 |
| 226 | 3300003187 | JGI25151J46595_10008704 | JGI25151J46595_100087042 | 191 |
| 227 | 3300003214 | JGI25165J46597_1005063 | JGI25165J46597_10050633 | 191 |
| 228 | 3300003215 | JGI25153J46596_10000524 | JGI25153J46596_1000052420 | 191 |
| 229 | 3300003215 | JGI25153J46596_10001612 | JGI25153J46596_100016128 | 191 |
| 230 | 3300003316 | rootH1_10006469 | rootH1_100064691 | 191 |
| 231 | 3300003323 | rootH1_10032909 | rootH1_100329094 | 191 |
| 232 | 3300003354 | JGI25160J50197_1002408 | JGI25160J50197_10024086 | 191 |
| 233 | 3300003354 | JGI25160J50197_1017500 | JGI25160J50197_10175002 | 191 |
| 234 | 3300003374 | JGI25161J50226_1002478 | JGI25161J50226_10024785 | 191 |
| 235 | 3300003578 | Ga0006562J51391_1089446 | Ga0006562J51391_10894465 | 191 |
| 236 | 3300003578 | Ga0006562J51391_1089447 | Ga0006562J51391_10894474 | 191 |
| 237 | 3300003761 | Ga0055535_1000458 | Ga0055535_10004584 | 191 |
| 238 | 3300003762 | Ga0055542_1000029 | Ga0055542_1000029184 | 191 |
| 239 | 3300003771 | Ga0055526_1000642 | Ga0055526_100064226 | 191 |
| 240 | 3300003771 | Ga0055526_1045218 | Ga0055526_10452182 | 191 |
| 241 | 3300003773 | Ga0055537_1000013 | Ga0055537_10000135 | 191 |
| 242 | 3300003773 | Ga0055537_1019911 | Ga0055537_10199112 | 191 |
| 243 | 3300003775 | Ga0055524_1004416 | Ga0055524_10044165 | 191 |
| 244 | 3300003781 | Ga0055536_1001113 | Ga0055536_10011135 | 191 |
| 245 | 3300003781 | Ga0055536_1001817 | Ga0055536_10018179 | 191 |
| 246 | 3300003781 | Ga0055536_1002156 | Ga0055536_10021564 | 191 |
| 247 | 3300003784 | Ga0055534_1000008 | Ga0055534_1000008195 | 191 |
| 248 | 3300003784 | Ga0055534_1001246 | Ga0055534_100124615 | 191 |
| 249 | 3300003790 | Ga0055528_1004208 | Ga0055528_10042085 | 191 |
| 250 | 3300003790 | Ga0055528_1041222 | Ga0055528_10412222 | 191 |
| 251 | 3300003791 | Ga0055530_10000350 | Ga0055530_1000035036 | 191 |
| 252 | 3300003792 | Ga0055540_1000480 | Ga0055540_100048020 | 191 |
| 253 | 3300003792 | Ga0055540_1000596 | Ga0055540_100059625 | 191 |
| 254 | 3300003792 | Ga0055540_1001036 | Ga0055540_10010368 | 191 |
| 255 | 3300003794 | Ga0055531_10000034 | Ga0055531_1000003410 | 191 |
| 256 | 3300003794 | Ga0055531_10000794 | Ga0055531_100007946 | 191 |
| 257 | 3300003794 | Ga0055531_10003334 | Ga0055531_1000333410 | 191 |
| 258 | 3300004625 | Ga0055543_1000297 | Ga0055543_100029733 | 191 |
| 259 | 3300005262 | Ga0065165_1006954 | Ga0065165_10069543 | 191 |
| 260 | 3300005262 | Ga0065165_1009111 | Ga0065165_10091113 | 191 |
| 261 | 3300005288 | Ga0065714_10074419 | Ga0065714_100744193 | 191 |
| 262 | 3300005288 | Ga0065714_10207112 | Ga0065714_102071121 | 191 |
| 263 | 3300005366 | Ga0070659_100089411 | Ga0070659_1000894112 | 191 |
| 264 | 3300005367 | Ga0070667_100007828 | Ga0070667_1000078284 | 191 |
| 265 | 3300005456 | Ga0070678_100172746 | Ga0070678_1001727462 | 191 |
| 266 | 3300005457 | Ga0070662_100917269 | Ga0070662_1009172691 | 191 |
| 267 | 3300005466 | Ga0070685_10379590 | Ga0070685_103795902 | 191 |
| 268 | 3300005539 | Ga0068853_100161555 | Ga0068853_1001615552 | 191 |
| 269 | 3300005548 | Ga0070665_100029762 | Ga0070665_1000297625 | 191 |
| 270 | 3300005548 | Ga0070665_100637408 | Ga0070665_1006374082 | 191 |
| 271 | 3300005548 | Ga0070665_101010375 | Ga0070665_1010103752 | 191 |
| 272 | 3300005563 | Ga0068855_100012150 | Ga0068855_1000121507 | 191 |
| 273 | 3300005577 | Ga0068857_100190665 | Ga0068857_1001906652 | 191 |
| 274 | 3300005577 | Ga0068857_101095876 | Ga0068857_1010958761 | 191 |
| 275 | 3300005614 | Ga0068856_100420179 | Ga0068856_1004201792 | 191 |
| 276 | 3300005616 | Ga0068852_100036759 | Ga0068852_1000367592 | 191 |
| 277 | 3300005834 | Ga0068851_10011128 | Ga0068851_100111284 | 191 |
| 278 | 3300005841 | Ga0068863_100151684 | Ga0068863_1001516842 | 191 |
| 279 | 3300005844 | Ga0068862_100104809 | Ga0068862_1001048093 | 191 |
| 280 | 3300005983 | Ga0081540_1019975 | Ga0081540_10199752 | 191 |
| 281 | 3300006042 | Ga0075368_10083080 | Ga0075368_100830801 | 191 |
| 282 | 3300006048 | Ga0075363_100078457 | Ga0075363_1000784573 | 191 |
| 283 | 3300006048 | Ga0075363_100343408 | Ga0075363_1003434082 | 191 |
| 284 | 3300006051 | Ga0075364_10009966 | Ga0075364_100099663 | 191 |
| 285 | 3300006051 | Ga0075364_10069073 | Ga0075364_100690733 | 191 |
| 286 | 3300006051 | Ga0075364_10427925 | Ga0075364_104279251 | 191 |
| 287 | 3300006058 | Ga0075432_10023817 | Ga0075432_100238172 | 191 |
| 288 | 3300006177 | Ga0075362_10007473 | Ga0075362_100074734 | 191 |
| 289 | 3300006177 | Ga0075362_10022548 | Ga0075362_100225482 | 191 |
| 290 | 3300006177 | Ga0075362_10228658 | Ga0075362_102286582 | 191 |
| 291 | 3300006178 | Ga0075367_10007939 | Ga0075367_100079396 | 191 |
| 292 | 3300006178 | Ga0075367_10350269 | Ga0075367_103502691 | 191 |
| 293 | 3300006186 | Ga0075369_10130131 | Ga0075369_101301312 | 191 |
| 294 | 3300006186 | Ga0075369_10233287 | Ga0075369_102332871 | 191 |
| 295 | 3300006195 | Ga0075366_10013698 | Ga0075366_100136983 | 191 |
| 296 | 3300006195 | Ga0075366_10071240 | Ga0075366_100712402 | 191 |
| 297 | 3300006195 | Ga0075366_10090209 | Ga0075366_100902092 | 191 |
| 298 | 3300006195 | Ga0075366_10376457 | Ga0075366_103764571 | 191 |
| 299 | 3300006353 | Ga0075370_10004534 | Ga0075370_100045348 | 191 |
| 300 | 3300006353 | Ga0075370_10006518 | Ga0075370_100065184 | 191 |
| 301 | 3300006353 | Ga0075370_10008423 | Ga0075370_100084235 | 191 |
| 302 | 3300006353 | Ga0075370_10034794 | Ga0075370_100347942 | 191 |
| 303 | 3300006353 | Ga0075370_10046470 | Ga0075370_100464702 | 191 |
| 304 | 3300006353 | Ga0075370_10064178 | Ga0075370_100641782 | 191 |
| 305 | 3300006353 | Ga0075370_10147610 | Ga0075370_101476101 | 191 |
| 306 | 3300006948 | Ga0099826_10009909 | Ga0099826_100099095 | 191 |
| 307 | 3300006948 | Ga0099826_10076909 | Ga0099826_100769092 | 191 |
| 308 | 3300009093 | Ga0105240_10000593 | Ga0105240_1000059320 | 191 |
| 309 | 3300009148 | Ga0105243_10045708 | Ga0105243_100457083 | 191 |
| 310 | 3300009148 | Ga0105243_11021701 | Ga0105243_110217011 | 191 |
| 311 | 3300009545 | Ga0105237_10004597 | Ga0105237_100045977 | 191 |
| 312 | 3300009551 | Ga0105238_10898135 | Ga0105238_108981352 | 191 |
| 313 | 3300011119 | Ga0105246_10083663 | Ga0105246_100836633 | 191 |
| 314 | 3300013100 | Ga0157373_10013430 | Ga0157373_100134308 | 191 |
| 315 | 3300013104 | Ga0157370_10081525 | Ga0157370_100815253 | 191 |
| 316 | 3300013105 | Ga0157369_10006869 | Ga0157369_1000686911 | 191 |
| 317 | 3300013306 | Ga0163162_10160588 | Ga0163162_101605882 | 191 |
| 318 | 3300014497 | Ga0182008_10037035 | Ga0182008_100370354 | 191 |
| 319 | 3300015261 | Ga0182006_1063164 | Ga0182006_10631642 | 191 |
| 320 | 3300015261 | Ga0182006_1093053 | Ga0182006_10930531 | 191 |
| 321 | 3300015262 | Ga0182007_10029701 | Ga0182007_100297012 | 191 |
| 322 | 3300015262 | Ga0182007_10050873 | Ga0182007_100508732 | 191 |
| 323 | 3300015683 | Ga0183362_10002 | Ga0183362_1000236 | 191 |
| 324 | 3300017792 | Ga0163161_10001036 | Ga0163161_1000103618 | 191 |
| 325 | 3300017792 | Ga0163161_10011465 | Ga0163161_100114654 | 191 |
| 326 | 3300017792 | Ga0163161_10051165 | Ga0163161_100511652 | 191 |
| 327 | 3300017792 | Ga0163161_10127690 | Ga0163161_101276902 | 191 |
| 328 | 3300021358 | Ga0213873_10049182 | Ga0213873_100491821 | 191 |
| 329 | 3300021441 | Ga0213871_10021859 | Ga0213871_100218592 | 191 |
| 330 | 3300025208 | Ga0209436_101898 | Ga0209436_1018983 | 191 |
| 331 | 3300025228 | Ga0209672_107059 | Ga0209672_1070591 | 191 |
| 332 | 3300025229 | Ga0209147_100494 | Ga0209147_10049410 | 191 |
| 333 | 3300025242 | Ga0209258_100018 | Ga0209258_100018360 | 191 |
| 334 | 3300025245 | Ga0207425_1000890 | Ga0207425_10008906 | 191 |
| 335 | 3300025245 | Ga0207425_1006777 | Ga0207425_10067773 | 191 |
| 336 | 3300025254 | Ga0209148_1000030 | Ga0209148_1000030360 | 191 |
| 337 | 3300025258 | Ga0209129_1003720 | Ga0209129_10037206 | 191 |
| 338 | 3300025258 | Ga0209129_1004626 | Ga0209129_10046262 | 191 |
| 339 | 3300025261 | Ga0209233_1007634 | Ga0209233_10076344 | 191 |
| 340 | 3300025263 | Ga0209565_1000042 | Ga0209565_1000042194 | 191 |
| 341 | 3300025263 | Ga0209565_1001579 | Ga0209565_100157913 | 191 |
| 342 | 3300025273 | Ga0209673_1000071 | Ga0209673_100007134 | 191 |
| 343 | 3300025273 | Ga0209673_1000940 | Ga0209673_100094011 | 191 |
| 344 | 3300025273 | Ga0209673_1001066 | Ga0209673_100106626 | 191 |
| 345 | 3300025273 | Ga0209673_1004735 | Ga0209673_10047355 | 191 |
| 346 | 3300025284 | Ga0209130_1000230 | Ga0209130_100023047 | 191 |
| 347 | 3300025284 | Ga0209130_1011217 | Ga0209130_10112172 | 191 |
| 348 | 3300025291 | Ga0209675_1000041 | Ga0209675_100004133 | 191 |
| 349 | 3300025291 | Ga0209675_1003973 | Ga0209675_10039737 | 191 |
| 350 | 3300025292 | Ga0209676_1000004 | Ga0209676_100000476 | 191 |
| 351 | 3300025292 | Ga0209676_1000123 | Ga0209676_100012321 | 191 |
| 352 | 3300025292 | Ga0209676_1012302 | Ga0209676_10123023 | 191 |
| 353 | 3300025294 | Ga0209025_1000040 | Ga0209025_1000040159 | 191 |
| 354 | 3300025294 | Ga0209025_1000113 | Ga0209025_100011360 | 191 |
| 355 | 3300025294 | Ga0209025_1001177 | Ga0209025_100117712 | 191 |
| 356 | 3300025294 | Ga0209025_1010408 | Ga0209025_10104082 | 191 |
| 357 | 3300025294 | Ga0209025_1019267 | Ga0209025_10192673 | 191 |
| 358 | 3300025295 | Ga0209564_1000319 | Ga0209564_100031961 | 191 |
| 359 | 3300025295 | Ga0209564_1006998 | Ga0209564_10069982 | 191 |
| 360 | 3300025297 | Ga0209758_1000011 | Ga0209758_1000011178 | 191 |
| 361 | 3300025297 | Ga0209758_1000359 | Ga0209758_100035935 | 191 |
| 362 | 3300025297 | Ga0209758_1004154 | Ga0209758_100415410 | 191 |
| 363 | 3300025297 | Ga0209758_1007868 | Ga0209758_10078683 | 191 |
| 364 | 3300025297 | Ga0209758_1022817 | Ga0209758_10228172 | 191 |
| 365 | 3300025298 | Ga0209050_1000002 | Ga0209050_1000002586 | 191 |
| 366 | 3300025298 | Ga0209050_1001339 | Ga0209050_100133917 | 191 |
| 367 | 3300025298 | Ga0209050_1001596 | Ga0209050_100159612 | 191 |
| 368 | 3300025299 | Ga0209256_1000166 | Ga0209256_100016662 | 191 |
| 369 | 3300025299 | Ga0209256_1004821 | Ga0209256_10048216 | 191 |
| 370 | 3300025302 | Ga0207426_1000325 | Ga0207426_100032565 | 191 |
| 371 | 3300025302 | Ga0207426_1000389 | Ga0207426_10003892 | 191 |
| 372 | 3300025302 | Ga0207426_1012504 | Ga0207426_10125044 | 191 |
| 373 | 3300025302 | Ga0207426_1049462 | Ga0207426_10494622 | 191 |
| 374 | 3300025303 | Ga0209051_1000002 | Ga0209051_1000002354 | 191 |
| 375 | 3300025303 | Ga0209051_1000091 | Ga0209051_100009121 | 191 |
| 376 | 3300025303 | Ga0209051_1000128 | Ga0209051_100012854 | 191 |
| 377 | 3300025304 | Ga0209257_1000002 | Ga0209257_1000002495 | 191 |
| 378 | 3300025304 | Ga0209257_1000276 | Ga0209257_100027610 | 191 |
| 379 | 3300025304 | Ga0209257_1001035 | Ga0209257_100103515 | 191 |
| 380 | 3300025321 | Ga0207656_10032702 | Ga0207656_100327022 | 191 |
| 381 | 3300025913 | Ga0207695_10000012 | Ga0207695_10000012631 | 191 |
| 382 | 3300025914 | Ga0207671_10201703 | Ga0207671_102017032 | 191 |
| 383 | 3300025924 | Ga0207694_10352320 | Ga0207694_103523202 | 191 |
| 384 | 3300025933 | Ga0207706_10176735 | Ga0207706_101767353 | 191 |
| 385 | 3300025935 | Ga0207709_10098934 | Ga0207709_100989342 | 191 |
| 386 | 3300025935 | Ga0207709_10102873 | Ga0207709_101028732 | 191 |
| 387 | 3300025949 | Ga0207667_10013355 | Ga0207667_100133556 | 191 |
| 388 | 3300025986 | Ga0207658_10042856 | Ga0207658_100428561 | 191 |
| 389 | 3300025986 | Ga0207658_10103958 | Ga0207658_101039582 | 191 |
| 390 | 3300026041 | Ga0207639_10082559 | Ga0207639_100825592 | 191 |
| 391 | 3300026088 | Ga0207641_10456416 | Ga0207641_104564162 | 191 |
| 392 | 3300026089 | Ga0207648_10073220 | Ga0207648_100732203 | 191 |
| 393 | 3300026116 | Ga0207674_10162170 | Ga0207674_101621703 | 191 |
| 394 | 3300026116 | Ga0207674_10369866 | Ga0207674_103698662 | 191 |
| 395 | 3300026121 | Ga0207683_10580141 | Ga0207683_105801412 | 191 |
| 396 | 3300027666 | Ga0209282_1039175 | Ga0209282_10391753 | 191 |
| 397 | 3300027907 | Ga0207428_10195605 | Ga0207428_101956052 | 191 |
| 398 | 3300028379 | Ga0268266_10030056 | Ga0268266_100300565 | 191 |
| 399 | 3300028380 | Ga0268265_10034773 | Ga0268265_100347732 | 191 |
| 400 | 3300028794 | Ga0307515_10000047 | Ga0307515_10000047182 | 191 |
| 401 | 3300028794 | Ga0307515_10067589 | Ga0307515_100675895 | 191 |
| 402 | 3300031251 | Ga0265327_10128284 | Ga0265327_101282842 | 191 |
| 403 | 3300031456 | Ga0307513_10041073 | Ga0307513_100410732 | 191 |
| 404 | 3300031548 | Ga0307408_100030968 | Ga0307408_1000309685 | 191 |
| 405 | 3300031548 | Ga0307408_100134386 | Ga0307408_1001343862 | 191 |
| 406 | 3300031548 | Ga0307408_100258781 | Ga0307408_1002587812 | 191 |
| 407 | 3300031548 | Ga0307408_100605898 | Ga0307408_1006058982 | 191 |
| 408 | 3300031548 | Ga0307408_101111667 | Ga0307408_1011116672 | 191 |
| 409 | 3300031649 | Ga0307514_10003247 | Ga0307514_1000324722 | 191 |
| 410 | 3300031731 | Ga0307405_10011136 | Ga0307405_100111364 | 191 |
| 411 | 3300031731 | Ga0307405_10064598 | Ga0307405_100645984 | 191 |
| 412 | 3300031731 | Ga0307405_10203066 | Ga0307405_102030662 | 191 |
| 413 | 3300031731 | Ga0307405_10231812 | Ga0307405_102318122 | 191 |
| 414 | 3300031731 | Ga0307405_11363096 | Ga0307405_113630961 | 191 |
| 415 | 3300031901 | Ga0307406_10316912 | Ga0307406_103169122 | 191 |
| 416 | 3300031911 | Ga0307412_10003750 | Ga0307412_100037507 | 191 |
| 417 | 3300031911 | Ga0307412_10157598 | Ga0307412_101575982 | 191 |
| 418 | 3300031911 | Ga0307412_10247862 | Ga0307412_102478622 | 191 |
| 419 | 3300031911 | Ga0307412_10267922 | Ga0307412_102679222 | 191 |
| 420 | 3300032002 | Ga0307416_100326925 | Ga0307416_1003269252 | 191 |
| 421 | 3300032004 | Ga0307414_10042687 | Ga0307414_100426874 | 191 |
| 422 | 3300032004 | Ga0307414_10047247 | Ga0307414_100472473 | 191 |
| 423 | 3300032004 | Ga0307414_10109071 | Ga0307414_101090711 | 191 |
| 424 | 3300032004 | Ga0307414_10419560 | Ga0307414_104195601 | 191 |
| 425 | 3300032004 | Ga0307414_10570503 | Ga0307414_105705031 | 191 |
| 426 | 3300032005 | Ga0307411_10053082 | Ga0307411_100530823 | 191 |
| 427 | 3300032005 | Ga0307411_10378082 | Ga0307411_103780822 | 191 |
| 428 | 3300037471 | Ga0395905_0008066 | Ga0395905_0008066_844_1422 | 191 |
| 429 | 3300037471 | Ga0395905_0107358 | Ga0395905_0107358_88_666 | 191 |
| 430 | 3300037471 | Ga0395905_0270247 | Ga0395905_0270247_27_605 | 191 |
| 431 | 3300037471 | Ga0395905_0506480 | Ga0395905_0506480_36_614 | 191 |
| 432 | 3300039093 | Ga0400489_52926 | Ga0400489_52926_12646_13224 | 191 |
| 433 | 3300039438 | Ga0436360_1316722 | Ga0436360_1316722_8548_9126 | 191 |
| 434 | 3300039447 | Ga0436361_0159868 | Ga0436361_0159868_859_1437 | 191 |
| 435 | 3300039453 | Ga0436362_0110582 | Ga0436362_0110582_70_648 | 191 |
| 436 | 3300041404 | Ga0439436_0017070 | Ga0439436_0017070_106_684 | 191 |
| 437 | 3300041406 | Ga0439439_0004298 | Ga0439439_0004298_1771_2349 | 191 |
| 438 | 3300041406 | Ga0439439_0013687 | Ga0439439_0013687_221_799 | 191 |
| 439 | 3300041411 | Ga0439466_0034340 | Ga0439466_0034340_1093_1671 | 191 |
| 440 | 3300041411 | Ga0439466_0065578 | Ga0439466_0065578_112_690 | 191 |
| 441 | 3300041413 | Ga0439465_0028833 | Ga0439465_0028833_1107_1685 | 191 |
| 442 | 3300041413 | Ga0439465_0034418 | Ga0439465_0034418_633_1211 | 191 |
| 443 | 3300041453 | Ga0451797_0888364 | Ga0451797_0888364_199_777 | 191 |
| 444 | 3300041453 | Ga0451797_0995910 | Ga0451797_0995910_461_1039 | 191 |
| 445 | 3300041491 | Ga0451833_0624708 | Ga0451833_0624708_162_740 | 191 |
| 446 | 3300041498 | Ga0451841_1366776 | Ga0451841_1366776_76_654 | 191 |
| 447 | 3300041512 | Ga0451853_3268004 | Ga0451853_3268004_613_1191 | 191 |
| 448 | 3300041999 | Ga0439433_0026055 | Ga0439433_0026055_490_1068 | 191 |
| 449 | 3300042004 | Ga0439445_0041332 | Ga0439445_0041332_225_803 | 191 |
| 450 | 3300042004 | Ga0439445_0054788 | Ga0439445_0054788_166_744 | 191 |
| 451 | 3300042006 | Ga0439432_009181 | Ga0439432_009181_2859_3437 | 191 |
| 452 | 3300042007 | Ga0439449_0001049 | Ga0439449_0001049_2431_3009 | 191 |
| 453 | 3300042007 | Ga0439449_0037568 | Ga0439449_0037568_951_1529 | 191 |
| 454 | 3300042007 | Ga0439449_0076051 | Ga0439449_0076051_638_1216 | 191 |
| 455 | 3300042010 | Ga0439452_060499 | Ga0439452_060499_209_787 | 191 |
| 456 | 3300042014 | Ga0439457_016994 | Ga0439457_016994_490_1068 | 191 |
| 457 | 3300042014 | Ga0439457_042931 | Ga0439457_042931_71_649 | 191 |
| 458 | 3300042014 | Ga0439457_089934 | Ga0439457_089934_111_689 | 191 |
| 459 | 3300042015 | Ga0439462_0002063 | Ga0439462_0002063_3212_3790 | 191 |
| 460 | 3300042015 | Ga0439462_0004837 | Ga0439462_0004837_260_838 | 191 |
| 461 | 3300042115 | Ga0450911_000107 | Ga0450911_000107_13611_14189 | 191 |
| 462 | 3300042115 | Ga0450911_000519 | Ga0450911_000519_8711_9289 | 191 |
| 463 | 3300042121 | Ga0450919_002690 | Ga0450919_002690_1611_2189 | 191 |
| 464 | 3300042122 | Ga0450920_057459 | Ga0450920_057459_87_665 | 191 |
| 465 | 3300042125 | Ga0450923_004062 | Ga0450923_004062_245_823 | 191 |
| 466 | 3300042127 | Ga0450890_012527 | Ga0450890_012527_111_689 | 191 |
| 467 | 3300042128 | Ga0450897_001641 | Ga0450897_001641_913_1491 | 191 |
| 468 | 3300042134 | Ga0450898_038517 | Ga0450898_038517_33_611 | 191 |
| 469 | 3300042145 | Ga0450906_005093 | Ga0450906_005093_197_775 | 191 |
| 470 | 3300042147 | Ga0450910_031038 | Ga0450910_031038_27_605 | 191 |
| 471 | 3300042156 | Ga0439446_0022901 | Ga0439446_0022901_946_1524 | 191 |
| 472 | 3300042156 | Ga0439446_0216493 | Ga0439446_0216493_30_608 | 191 |
| 473 | 3300042184 | Ga0450908_001204 | Ga0450908_001204_1759_2337 | 191 |
| 474 | 3300042184 | Ga0450908_003757 | Ga0450908_003757_705_1283 | 191 |
| 475 | 3300042435 | Ga0439434_0006459 | Ga0439434_0006459_1213_1791 | 191 |
| 476 | 3300042435 | Ga0439434_0103139 | Ga0439434_0103139_328_906 | 191 |
| 477 | 3300042435 | Ga0439434_0224980 | Ga0439434_0224980_23_601 | 191 |
| 478 | 3300042876 | Ga0451577_0003980 | Ga0451577_0003980_8371_8949 | 191 |
| 479 | 3300042876 | Ga0451577_0009290 | Ga0451577_0009290_6309_6887 | 191 |
| 480 | 3300042876 | Ga0451577_0074764 | Ga0451577_0074764_2115_2693 | 191 |
| 481 | 3300044658 | Ga0466972_0025143 | Ga0466972_0025143_2081_2659 | 191 |
| 482 | 3300044658 | Ga0466972_0243067 | Ga0466972_0243067_101_679 | 191 |
| 483 | 3300044673 | Ga0453683_0096128 | Ga0453683_0096128_156_734 | 191 |
| 484 | 3300044673 | Ga0453683_0100801 | Ga0453683_0100801_134_712 | 191 |
| 485 | 3300044673 | Ga0453683_0314629 | Ga0453683_0314629_137_715 | 191 |
| 486 | 3300044683 | Ga0466965_0040093 | Ga0466965_0040093_44_622 | 191 |
| 487 | 3300044712 | Ga0453684_0042329 | Ga0453684_0042329_1484_2062 | 191 |
| 488 | 3300044735 | Ga0466968_0000951 | Ga0466968_0000951_3589_4167 | 191 |
| 489 | 3300044901 | Ga0466960_0024092 | Ga0466960_0024092_384_962 | 191 |
| 490 | 3300045051 | Ga0451576_0056721 | Ga0451576_0056721_3052_3630 | 191 |
| 491 | 3300046453 | Ga0495627_004299 | Ga0495627_004299_5292_5870 | 191 |
| 492 | 3300046459 | Ga0495629_0351712 | Ga0495629_0351712_311_889 | 191 |
| 493 | 3300046460 | Ga0495638_0036835 | Ga0495638_0036835_1092_1670 | 191 |
| 494 | 3300046475 | Ga0495639_0007550 | Ga0495639_0007550_3909_4511 | 191 |
| 495 | 3300046506 | Ga0495583_0082715 | Ga0495583_0082715_652_1230 | 191 |
| 496 | 3300046512 | Ga0495610_0015531 | Ga0495610_0015531_1950_2528 | 191 |
| 497 | 3300046513 | Ga0495616_0001237 | Ga0495616_0001237_3709_4287 | 191 |
| 498 | 3300046514 | Ga0495618_0086391 | Ga0495618_0086391_1250_1852 | 191 |
| 499 | 3300046515 | Ga0495620_0060005 | Ga0495620_0060005_297_875 | 191 |
| 500 | 3300046515 | Ga0495620_0132975 | Ga0495620_0132975_205_783 | 191 |
| 501 | 3300046518 | Ga0495631_0000242 | Ga0495631_0000242_4940_5518 | 191 |
| 502 | 3300046520 | Ga0495637_0002576 | Ga0495637_0002576_5317_5895 | 191 |
| 503 | 3300046522 | Ga0495643_0077100 | Ga0495643_0077100_767_1345 | 191 |
| 504 | 3300046524 | Ga0495648_0082523 | Ga0495648_0082523_909_1487 | 191 |
| 505 | 3300046528 | Ga0495642_0102078 | Ga0495642_0102078_484_1086 | 191 |
| 506 | 3300046530 | Ga0495654_0060406 | Ga0495654_0060406_683_1261 | 191 |
| 507 | 3300046539 | Ga0495621_0004761 | Ga0495621_0004761_192_770 | 191 |
| 508 | 3300046557 | Ga0495622_0040433 | Ga0495622_0040433_1374_1952 | 191 |
| 509 | 3300046559 | Ga0495667_0316718 | Ga0495667_0316718_22_648 | 191 |
| 510 | 3300046660 | Ga0495625_0000056 | Ga0495625_0000056_18706_19284 | 191 |
| 511 | 3300046660 | Ga0495625_0261943 | Ga0495625_0261943_201_779 | 191 |
| 512 | 3300046665 | Ga0495661_0273566 | Ga0495661_0273566_131_709 | 191 |
| 513 | 3300046674 | Ga0495588_0004546 | Ga0495588_0004546_1499_2077 | 191 |
| 514 | 3300046674 | Ga0495588_0011119 | Ga0495588_0011119_1318_1896 | 191 |
| 515 | 3300046674 | Ga0495588_0100156 | Ga0495588_0100156_222_800 | 191 |
| 516 | 3300046674 | Ga0495588_0236984 | Ga0495588_0236984_368_946 | 191 |
| 517 | 3300046683 | Ga0495658_0002773 | Ga0495658_0002773_1497_2075 | 191 |
| 518 | 3300046683 | Ga0495658_0195514 | Ga0495658_0195514_206_784 | 191 |
| 519 | 3300046684 | Ga0495669_0245696 | Ga0495669_0245696_214_816 | 191 |
| 520 | 3300046691 | Ga0495670_0347943 | Ga0495670_0347943_55_633 | 191 |
| 521 | 3300046692 | Ga0495671_0002242 | Ga0495671_0002242_5180_5758 | 191 |
| 522 | 3300047317 | Ga0495604_0402876 | Ga0495604_0402876_250_852 | 191 |
| 523 | 3300047321 | Ga0495676_0023524 | Ga0495676_0023524_3032_3610 | 191 |
| 524 | 3300047445 | Ga0495677_0265775 | Ga0495677_0265775_54_656 | 191 |
| 525 | 3300047673 | Ga0495593_0011378 | Ga0495593_0011378_4056_4634 | 191 |
| 526 | 3300048089 | Ga0495614_0007845 | Ga0495614_0007845_3984_4562 | 191 |
| 527 | 3300048903 | Ga0496100_0017439 | Ga0496100_0017439_815_1417 | 191 |
| 528 | 3300048904 | Ga0496101_0003286 | Ga0496101_0003286_1015_1617 | 191 |
| 529 | 3300048904 | Ga0496101_0386344 | Ga0496101_0386344_383_961 | 191 |
| 530 | 3300048905 | Ga0496102_0007804 | Ga0496102_0007804_4304_4906 | 191 |
| 531 | 3300048905 | Ga0496102_0354338 | Ga0496102_0354338_628_1254 | 191 |
| 532 | 3300048906 | Ga0496103_0071738 | Ga0496103_0071738_1212_1814 | 191 |
| 533 | 3300048907 | Ga0496104_0015096 | Ga0496104_0015096_4173_4775 | 191 |
| 534 | 3300048907 | Ga0496104_0177785 | Ga0496104_0177785_1110_1730 | 191 |
| 535 | 3300048908 | Ga0496105_0007115 | Ga0496105_0007115_3506_4108 | 191 |
| 536 | 3300048908 | Ga0496105_0213036 | Ga0496105_0213036_110_730 | 191 |
| 537 | 3300048909 | Ga0496106_0015648 | Ga0496106_0015648_1862_2464 | 191 |
| 538 | 3300048910 | Ga0496107_0024141 | Ga0496107_0024141_3387_3989 | 191 |
| 539 | 3300048910 | Ga0496107_0543935 | Ga0496107_0543935_108_686 | 191 |
| 540 | 3300048911 | Ga0496108_0014037 | Ga0496108_0014037_2938_3558 | 191 |
| 541 | 3300048911 | Ga0496108_0486924 | Ga0496108_0486924_440_1042 | 191 |
| 542 | 3300048912 | Ga0496109_0017981 | Ga0496109_0017981_2444_3064 | 191 |
| 543 | 3300048913 | Ga0496110_0005924 | Ga0496110_0005924_5983_6603 | 191 |
| 544 | 3300048913 | Ga0496110_0140364 | Ga0496110_0140364_1227_1829 | 191 |
| 545 | 3300048914 | Ga0496111_0038181 | Ga0496111_0038181_1420_2040 | 191 |
| 546 | 3300048914 | Ga0496111_0183508 | Ga0496111_0183508_561_1163 | 191 |
| 547 | 3300048915 | Ga0496112_0355190 | Ga0496112_0355190_480_1082 | 191 |
| 548 | 3300048916 | Ga0496113_0328794 | Ga0496113_0328794_331_951 | 191 |
| 549 | 3300048917 | Ga0496114_0006664 | Ga0496114_0006664_4579_5181 | 191 |
| 550 | 3300048917 | Ga0496114_0028641 | Ga0496114_0028641_119_697 | 191 |
| 551 | 3300048919 | Ga0496116_0017188 | Ga0496116_0017188_1229_1807 | 191 |
| 552 | 3300048919 | Ga0496116_0036642 | Ga0496116_0036642_2376_2954 | 191 |
| 553 | 3300048920 | Ga0496117_0002997 | Ga0496117_0002997_19701_20279 | 191 |
| 554 | 3300048920 | Ga0496117_0181909 | Ga0496117_0181909_585_1163 | 191 |
| 555 | 3300048921 | Ga0496118_0002137 | Ga0496118_0002137_19701_20279 | 191 |
| 556 | 3300048921 | Ga0496118_0030679 | Ga0496118_0030679_3719_4297 | 191 |
| 557 | 3300048921 | Ga0496118_0120580 | Ga0496118_0120580_709_1287 | 191 |
| 558 | 3300048923 | Ga0496120_0007054 | Ga0496120_0007054_3776_4354 | 191 |
| 559 | 3300048924 | Ga0496121_0000159 | Ga0496121_0000159_2888_3466 | 191 |
| 560 | 3300048924 | Ga0496121_0009067 | Ga0496121_0009067_476_1054 | 191 |
| 561 | 3300048924 | Ga0496121_0011908 | Ga0496121_0011908_6991_7569 | 191 |
| 562 | 3300048924 | Ga0496121_0201409 | Ga0496121_0201409_338_916 | 191 |
| 563 | 3300048925 | Ga0496122_0002198 | Ga0496122_0002198_23794_24372 | 191 |
| 564 | 3300048925 | Ga0496122_0031976 | Ga0496122_0031976_1986_2564 | 191 |
| 565 | 3300048925 | Ga0496122_0082993 | Ga0496122_0082993_709_1287 | 191 |
| 566 | 3300048925 | Ga0496122_0094941 | Ga0496122_0094941_129_707 | 191 |
| 567 | 3300048926 | Ga0496123_0000314 | Ga0496123_0000314_7502_8080 | 191 |
| 568 | 3300048926 | Ga0496123_0006452 | Ga0496123_0006452_3487_4065 | 191 |
| 569 | 3300048926 | Ga0496123_0011999 | Ga0496123_0011999_5882_6457 | 191 |
| 570 | 3300048926 | Ga0496123_0035309 | Ga0496123_0035309_1558_2136 | 191 |
| 571 | 3300048926 | Ga0496123_0149149 | Ga0496123_0149149_656_1234 | 191 |
| 572 | 3300048926 | Ga0496123_0232325 | Ga0496123_0232325_268_846 | 191 |
| 573 | 3300048927 | Ga0496124_0009311 | Ga0496124_0009311_7462_8040 | 191 |
| 574 | 3300048927 | Ga0496124_0019956 | Ga0496124_0019956_497_1075 | 191 |
| 575 | 3300048927 | Ga0496124_0275523 | Ga0496124_0275523_358_936 | 191 |
| 576 | 3300048927 | Ga0496124_0316751 | Ga0496124_0316751_77_652 | 191 |
| 577 | 3300048928 | Ga0496125_0000005 | Ga0496125_0000005_588917_589495 | 191 |
| 578 | 3300048928 | Ga0496125_0001361 | Ga0496125_0001361_19968_20546 | 191 |
| 579 | 3300048928 | Ga0496125_0007561 | Ga0496125_0007561_2453_3031 | 191 |
| 580 | 3300048928 | Ga0496125_0008142 | Ga0496125_0008142_9277_9855 | 191 |
| 581 | 3300048928 | Ga0496125_0068383 | Ga0496125_0068383_590_1168 | 191 |
| 582 | 3300048928 | Ga0496125_0201736 | Ga0496125_0201736_136_714 | 191 |
| 583 | 3300048928 | Ga0496125_0301838 | Ga0496125_0301838_219_797 | 191 |
| 584 | 3300048929 | Ga0496126_0030841 | Ga0496126_0030841_678_1256 | 191 |
| 585 | 3300048929 | Ga0496126_0110468 | Ga0496126_0110468_1446_2024 | 191 |
| 586 | 3300049515 | Ga0501292_015697 | Ga0501292_015697_87_665 | 191 |
| 587 | 3300049568 | Ga0501031_0486151 | Ga0501031_0486151_208_786 | 191 |
| 588 | 3300049569 | Ga0501032_0001083 | Ga0501032_0001083_9526_10104 | 191 |
| 589 | 3300049570 | Ga0501033_0007007 | Ga0501033_0007007_4167_4745 | 191 |
| 590 | 3300049571 | Ga0501034_0023042 | Ga0501034_0023042_1965_2543 | 191 |
| 591 | 3300049572 | Ga0501036_0001511 | Ga0501036_0001511_5909_6487 | 191 |
| 592 | 3300049574 | Ga0501038_0002514 | Ga0501038_0002514_15732_16310 | 191 |
| 593 | 3300049575 | Ga0501039_0019851 | Ga0501039_0019851_723_1301 | 191 |
| 594 | 3300049578 | Ga0501042_0210718 | Ga0501042_0210718_254_832 | 191 |
| 595 | 3300049579 | Ga0501043_0017574 | Ga0501043_0017574_352_930 | 191 |
| 596 | 3300049580 | Ga0501046_0002922 | Ga0501046_0002922_4110_4688 | 191 |
| 597 | 3300049581 | Ga0501047_0053686 | Ga0501047_0053686_1700_2278 | 191 |
| 598 | 3300049582 | Ga0501048_0033726 | Ga0501048_0033726_10_588 | 191 |
| 599 | 3300049583 | Ga0501067_0007502 | Ga0501067_0007502_169_747 | 191 |
| 600 | 3300049585 | Ga0501069_0000699 | Ga0501069_0000699_4255_4833 | 191 |
| 601 | 3300049586 | Ga0501070_0015536 | Ga0501070_0015536_3989_4567 | 191 |
| 602 | 3300049588 | Ga0501072_1042017 | Ga0501072_1042017_21_599 | 191 |
| 603 | 3300049589 | Ga0501073_0006072 | Ga0501073_0006072_2181_2759 | 191 |
| 604 | 3300049590 | Ga0501074_0001430 | Ga0501074_0001430_4038_4616 | 191 |
| 605 | 3300049742 | Ga0501080_0001937 | Ga0501080_0001937_11573_12151 | 191 |
| 606 | 3300049743 | Ga0501081_0699858 | Ga0501081_0699858_74_655 | 191 |
| 607 | 3300049744 | Ga0501083_0002912 | Ga0501083_0002912_7166_7744 | 191 |
| 608 | 3300049762 | Ga0501265_023190 | Ga0501265_023190_77_655 | 191 |
| 609 | 3300049763 | Ga0501266_000054 | Ga0501266_000054_5655_6233 | 191 |
| 610 | 3300049822 | Ga0501035_0010721 | Ga0501035_0010721_3803_4381 | 191 |
| 611 | 3300049823 | Ga0501044_0003491 | Ga0501044_0003491_9656_10234 | 191 |
| 612 | 3300050489 | nmdc:mga03683_1809_c1 | nmdc:mga03683_1809_c1_3959_4537 | 191 |
| 613 | 3300050489 | nmdc:mga03683_9357_c1 | nmdc:mga03683_9357_c1_1142_1720 | 191 |
| 614 | 3300050490 | nmdc:mga03n38_11169_c1 | nmdc:mga03n38_11169_c1_82_693 | 191 |
| 615 | 3300050490 | nmdc:mga03n38_38252_c1 | nmdc:mga03n38_38252_c1_1072_1650 | 191 |
| 616 | 3300050492 | nmdc:mga0yw44_507445_c1 | nmdc:mga0yw44_507445_c1_11_589 | 191 |
| 617 | 3300050493 | nmdc:mga0k408_109735_c1 | nmdc:mga0k408_109735_c1_924_1502 | 191 |
| 618 | 3300050493 | nmdc:mga0k408_18454_c1 | nmdc:mga0k408_18454_c1_1293_1871 | 191 |
| 619 | 3300050493 | nmdc:mga0k408_35539_c1 | nmdc:mga0k408_35539_c1_778_1356 | 191 |
| 620 | 3300050493 | nmdc:mga0k408_416683_c1 | nmdc:mga0k408_416683_c1_67_645 | 191 |
| 621 | 3300050495 | nmdc:mga04h51_66560_c1 | nmdc:mga04h51_66560_c1_169_747 | 191 |
| 622 | 3300050496 | nmdc:mga07m45_12949_c1 | nmdc:mga07m45_12949_c1_1977_2555 | 191 |
| 623 | 3300050496 | nmdc:mga07m45_130141_c1 | nmdc:mga07m45_130141_c1_774_1352 | 191 |
| 624 | 3300050496 | nmdc:mga07m45_20630_c1 | nmdc:mga07m45_20630_c1_1113_1691 | 191 |
| 625 | 3300050496 | nmdc:mga07m45_21476_c1 | nmdc:mga07m45_21476_c1_1569_2147 | 191 |
| 626 | 3300050496 | nmdc:mga07m45_23144_c1 | nmdc:mga07m45_23144_c1_627_1205 | 191 |
| 627 | 3300050496 | nmdc:mga07m45_273212_c1 | nmdc:mga07m45_273212_c1_316_918 | 191 |
| 628 | 3300050496 | nmdc:mga07m45_432249_c1 | nmdc:mga07m45_432249_c1_36_614 | 191 |
| 629 | 3300050516 | nmdc:mga0sz30_25497_c1 | nmdc:mga0sz30_25497_c1_1828_2406 | 191 |
| 630 | 3300053079 | Ga0500610_0000357 | Ga0500610_0000357_3673_4251 | 191 |
| 631 | 3300053083 | Ga0495655_0113866 | Ga0495655_0113866_44_622 | 191 |
| 632 | 3300053087 | Ga0500643_008621 | Ga0500643_008621_2654_3232 | 191 |
| 633 | 3300053087 | Ga0500643_083135 | Ga0500643_083135_87_665 | 191 |
| 634 | 3300053088 | Ga0500644_0096275 | Ga0500644_0096275_148_726 | 191 |
| 635 | 3300053091 | Ga0500647_0143965 | Ga0500647_0143965_43_621 | 191 |
| 636 | 3300053093 | Ga0500651_0000063 | Ga0500651_0000063_33555_34133 | 191 |
| 637 | 3300053093 | Ga0500651_0000517 | Ga0500651_0000517_1974_2552 | 191 |
| 638 | 3300053094 | Ga0500566_0016607 | Ga0500566_0016607_1289_1867 | 191 |
| 639 | 3300053103 | Ga0500555_071813 | Ga0500555_071813_11_589 | 191 |
| 640 | 3300053108 | Ga0500562_009386 | Ga0500562_009386_1103_1681 | 191 |
| 641 | 3300053110 | Ga0500571_000022 | Ga0500571_000022_42700_43278 | 191 |
| 642 | 3300053117 | Ga0500593_000228 | Ga0500593_000228_8682_9260 | 191 |
| 643 | 3300053121 | Ga0500607_003093 | Ga0500607_003093_6751_7329 | 191 |
| 644 | 3300053121 | Ga0500607_021201 | Ga0500607_021201_1070_1648 | 191 |
| 645 | 3300053122 | Ga0500608_077610 | Ga0500608_077610_959_1537 | 191 |
| 646 | 3300053125 | Ga0500618_042342 | Ga0500618_042342_237_815 | 191 |
| 647 | 3300053128 | Ga0500626_014123 | Ga0500626_014123_1468_2046 | 191 |
| 648 | 3300053134 | Ga0500658_0000125 | Ga0500658_0000125_30380_30958 | 191 |
| 649 | 3300053134 | Ga0500658_0000804 | Ga0500658_0000804_6974_7552 | 191 |
| 650 | 3300053136 | Ga0500559_0013619 | Ga0500559_0013619_590_1168 | 191 |
| 651 | 3300053137 | Ga0500561_0033666 | Ga0500561_0033666_115_693 | 191 |
| 652 | 3300053138 | Ga0500564_013358 | Ga0500564_013358_2361_2939 | 191 |
| 653 | 3300053139 | Ga0500568_0001840 | Ga0500568_0001840_10687_11265 | 191 |
| 654 | 3300053141 | Ga0500574_000185 | Ga0500574_000185_3087_3665 | 191 |
| 655 | 3300053153 | Ga0500616_0071225 | Ga0500616_0071225_729_1307 | 191 |
| 656 | 3300053154 | Ga0500619_023270 | Ga0500619_023270_1103_1681 | 191 |
| 657 | 3300053158 | Ga0500627_0001017 | Ga0500627_0001017_1409_1987 | 191 |
| 658 | 3300053161 | Ga0500634_0011762 | Ga0500634_0011762_457_1035 | 191 |
| 659 | 3300053161 | Ga0500634_0012245 | Ga0500634_0012245_677_1255 | 191 |
| 660 | 3300053162 | Ga0500638_000424 | Ga0500638_000424_1033_1611 | 191 |
| 661 | 3300053177 | Ga0500636_0029967 | Ga0500636_0029967_1457_2035 | 191 |
| 662 | 3300053729 | Ga0500625_096378 | Ga0500625_096378_183_761 | 191 |
| 663 | 3300053737 | Ga0500601_000125 | Ga0500601_000125_11195_11773 | 191 |
| 664 | 3300054114 | Ga0501084_0027930 | Ga0501084_0027930_3232_3810 | 191 |
| 665 | 3300060353 | Ga0501082_0021724 | Ga0501082_0021724_978_1556 | 191 |
| 666 | 3300003758 | Ga0055532_1000122 | Ga0055532_100012241 | 192 |
| 667 | 3300003760 | Ga0055527_1000078 | Ga0055527_100007842 | 192 |
| 668 | 3300003761 | Ga0055535_1000054 | Ga0055535_100005442 | 192 |
| 669 | 3300003762 | Ga0055542_1004543 | Ga0055542_10045431 | 192 |
| 670 | 3300003792 | Ga0055540_1000017 | Ga0055540_100001732 | 192 |
| 671 | 3300005288 | Ga0065714_10003761 | Ga0065714_100037611 | 192 |
| 672 | 3300005288 | Ga0065714_10064479 | Ga0065714_1006447913 | 192 |
| 673 | 3300005288 | Ga0065714_10074291 | Ga0065714_100742914 | 192 |
| 674 | 3300005327 | Ga0070658_10007776 | Ga0070658_100077765 | 192 |
| 675 | 3300005331 | Ga0070670_100061461 | Ga0070670_1000614613 | 192 |
| 676 | 3300005354 | Ga0070675_100171954 | Ga0070675_1001719542 | 192 |
| 677 | 3300005355 | Ga0070671_100026204 | Ga0070671_1000262044 | 192 |
| 678 | 3300005356 | Ga0070674_100164048 | Ga0070674_1001640482 | 192 |
| 679 | 3300005364 | Ga0070673_100011258 | Ga0070673_1000112586 | 192 |
| 680 | 3300005367 | Ga0070667_100055974 | Ga0070667_1000559743 | 192 |
| 681 | 3300005435 | Ga0070714_100394864 | Ga0070714_1003948642 | 192 |
| 682 | 3300005457 | Ga0070662_100082922 | Ga0070662_1000829223 | 192 |
| 683 | 3300005459 | Ga0068867_100003215 | Ga0068867_1000032155 | 192 |
| 684 | 3300005543 | Ga0070672_100002432 | Ga0070672_1000024325 | 192 |
| 685 | 3300005543 | Ga0070672_100291448 | Ga0070672_1002914482 | 192 |
| 686 | 3300005548 | Ga0070665_100091135 | Ga0070665_1000911354 | 192 |
| 687 | 3300005563 | Ga0068855_100023740 | Ga0068855_1000237402 | 192 |
| 688 | 3300005577 | Ga0068857_100007525 | Ga0068857_1000075255 | 192 |
| 689 | 3300005617 | Ga0068859_100227938 | Ga0068859_1002279382 | 192 |
| 690 | 3300005844 | Ga0068862_100113857 | Ga0068862_1001138573 | 192 |
| 691 | 3300005981 | Ga0081538_10044611 | Ga0081538_100446112 | 192 |
| 692 | 3300005983 | Ga0081540_1000904 | Ga0081540_100090426 | 192 |
| 693 | 3300005985 | Ga0081539_10006459 | Ga0081539_100064592 | 192 |
| 694 | 3300005985 | Ga0081539_10031065 | Ga0081539_100310652 | 192 |
| 695 | 3300006038 | Ga0075365_10007694 | Ga0075365_100076942 | 192 |
| 696 | 3300006038 | Ga0075365_10099933 | Ga0075365_100999333 | 192 |
| 697 | 3300006038 | Ga0075365_10331089 | Ga0075365_103310892 | 192 |
| 698 | 3300006058 | Ga0075432_10008151 | Ga0075432_100081512 | 192 |
| 699 | 3300006058 | Ga0075432_10034676 | Ga0075432_100346762 | 192 |
| 700 | 3300006058 | Ga0075432_10037918 | Ga0075432_100379182 | 192 |
| 701 | 3300006177 | Ga0075362_10070372 | Ga0075362_100703722 | 192 |
| 702 | 3300006177 | Ga0075362_10084199 | Ga0075362_100841992 | 192 |
| 703 | 3300006195 | Ga0075366_10134002 | Ga0075366_101340023 | 192 |
| 704 | 3300006195 | Ga0075366_10135302 | Ga0075366_101353022 | 192 |
| 705 | 3300006353 | Ga0075370_10015503 | Ga0075370_100155032 | 192 |
| 706 | 3300006353 | Ga0075370_10037095 | Ga0075370_100370952 | 192 |
| 707 | 3300006881 | Ga0068865_100048958 | Ga0068865_1000489583 | 192 |
| 708 | 3300006931 | Ga0097620_100227952 | Ga0097620_1002279522 | 192 |
| 709 | 3300009011 | Ga0105251_10001140 | Ga0105251_100011408 | 192 |
| 710 | 3300009036 | Ga0105244_10029744 | Ga0105244_100297443 | 192 |
| 711 | 3300009092 | Ga0105250_10012881 | Ga0105250_100128812 | 192 |
| 712 | 3300009093 | Ga0105240_10013249 | Ga0105240_100132494 | 192 |
| 713 | 3300009098 | Ga0105245_10224019 | Ga0105245_102240192 | 192 |
| 714 | 3300009098 | Ga0105245_10925507 | Ga0105245_109255071 | 192 |
| 715 | 3300009101 | Ga0105247_10118400 | Ga0105247_101184003 | 192 |
| 716 | 3300009101 | Ga0105247_10609766 | Ga0105247_106097661 | 192 |
| 717 | 3300009147 | Ga0114129_11793092 | Ga0114129_117930921 | 192 |
| 718 | 3300009148 | Ga0105243_10340671 | Ga0105243_103406712 | 192 |
| 719 | 3300009174 | Ga0105241_10431693 | Ga0105241_104316931 | 192 |
| 720 | 3300009177 | Ga0105248_10478889 | Ga0105248_104788892 | 192 |
| 721 | 3300009545 | Ga0105237_10002173 | Ga0105237_100021739 | 192 |
| 722 | 3300009545 | Ga0105237_10042261 | Ga0105237_100422614 | 192 |
| 723 | 3300009545 | Ga0105237_10750960 | Ga0105237_107509602 | 192 |
| 724 | 3300011119 | Ga0105246_10004906 | Ga0105246_100049067 | 192 |
| 725 | 3300011119 | Ga0105246_10119114 | Ga0105246_101191143 | 192 |
| 726 | 3300013100 | Ga0157373_10002545 | Ga0157373_100025458 | 192 |
| 727 | 3300013104 | Ga0157370_10073112 | Ga0157370_100731123 | 192 |
| 728 | 3300013105 | Ga0157369_10000059 | Ga0157369_1000005991 | 192 |
| 729 | 3300013296 | Ga0157374_10000044 | Ga0157374_1000004441 | 192 |
| 730 | 3300013306 | Ga0163162_10131314 | Ga0163162_101313142 | 192 |
| 731 | 3300013307 | Ga0157372_10837308 | Ga0157372_108373082 | 192 |
| 732 | 3300013308 | Ga0157375_10012536 | Ga0157375_100125363 | 192 |
| 733 | 3300013308 | Ga0157375_10023559 | Ga0157375_100235591 | 192 |
| 734 | 3300013308 | Ga0157375_10542103 | Ga0157375_105421032 | 192 |
| 735 | 3300013308 | Ga0157375_11360151 | Ga0157375_113601512 | 192 |
| 736 | 3300014968 | Ga0157379_10145085 | Ga0157379_101450852 | 192 |
| 737 | 3300015265 | Ga0182005_1000403 | Ga0182005_10004038 | 192 |
| 738 | 3300017792 | Ga0163161_10211875 | Ga0163161_102118752 | 192 |
| 739 | 3300017792 | Ga0163161_10582355 | Ga0163161_105823552 | 192 |
| 740 | 3300017792 | Ga0163161_10677115 | Ga0163161_106771152 | 192 |
| 741 | 3300025226 | Ga0209674_100130 | Ga0209674_10013077 | 192 |
| 742 | 3300025228 | Ga0209672_100036 | Ga0209672_10003640 | 192 |
| 743 | 3300025228 | Ga0209672_100488 | Ga0209672_10048814 | 192 |
| 744 | 3300025229 | Ga0209147_100066 | Ga0209147_10006640 | 192 |
| 745 | 3300025242 | Ga0209258_100085 | Ga0209258_10008540 | 192 |
| 746 | 3300025254 | Ga0209148_1000198 | Ga0209148_100019840 | 192 |
| 747 | 3300025256 | Ga0209759_1000993 | Ga0209759_10009935 | 192 |
| 748 | 3300025272 | Ga0209455_1000289 | Ga0209455_100028914 | 192 |
| 749 | 3300025292 | Ga0209676_1002561 | Ga0209676_10025615 | 192 |
| 750 | 3300025298 | Ga0209050_1000037 | Ga0209050_1000037171 | 192 |
| 751 | 3300025303 | Ga0209051_1000040 | Ga0209051_1000040172 | 192 |
| 752 | 3300025728 | Ga0207655_1003737 | Ga0207655_100373710 | 192 |
| 753 | 3300025899 | Ga0207642_10371339 | Ga0207642_103713392 | 192 |
| 754 | 3300025900 | Ga0207710_10035905 | Ga0207710_100359051 | 192 |
| 755 | 3300025904 | Ga0207647_10167197 | Ga0207647_101671972 | 192 |
| 756 | 3300025907 | Ga0207645_10001280 | Ga0207645_100012805 | 192 |
| 757 | 3300025908 | Ga0207643_10036289 | Ga0207643_100362893 | 192 |
| 758 | 3300025908 | Ga0207643_10055747 | Ga0207643_100557473 | 192 |
| 759 | 3300025909 | Ga0207705_10007418 | Ga0207705_100074187 | 192 |
| 760 | 3300025909 | Ga0207705_10212823 | Ga0207705_102128232 | 192 |
| 761 | 3300025911 | Ga0207654_10741385 | Ga0207654_107413851 | 192 |
| 762 | 3300025913 | Ga0207695_10720704 | Ga0207695_107207041 | 192 |
| 763 | 3300025914 | Ga0207671_10024648 | Ga0207671_100246482 | 192 |
| 764 | 3300025925 | Ga0207650_10087320 | Ga0207650_100873203 | 192 |
| 765 | 3300025926 | Ga0207659_10096692 | Ga0207659_100966923 | 192 |
| 766 | 3300025927 | Ga0207687_10083811 | Ga0207687_100838112 | 192 |
| 767 | 3300025927 | Ga0207687_10563955 | Ga0207687_105639552 | 192 |
| 768 | 3300025931 | Ga0207644_10007662 | Ga0207644_100076624 | 192 |
| 769 | 3300025932 | Ga0207690_10045947 | Ga0207690_100459471 | 192 |
| 770 | 3300025933 | Ga0207706_10105226 | Ga0207706_101052263 | 192 |
| 771 | 3300025935 | Ga0207709_10008456 | Ga0207709_100084562 | 192 |
| 772 | 3300025935 | Ga0207709_10399892 | Ga0207709_103998922 | 192 |
| 773 | 3300025936 | Ga0207670_10415282 | Ga0207670_104152822 | 192 |
| 774 | 3300025938 | Ga0207704_10051188 | Ga0207704_100511882 | 192 |
| 775 | 3300025938 | Ga0207704_10247933 | Ga0207704_102479332 | 192 |
| 776 | 3300025940 | Ga0207691_10001439 | Ga0207691_1000143919 | 192 |
| 777 | 3300025940 | Ga0207691_10080660 | Ga0207691_100806602 | 192 |
| 778 | 3300025940 | Ga0207691_10401401 | Ga0207691_104014012 | 192 |
| 779 | 3300025942 | Ga0207689_10044219 | Ga0207689_100442192 | 192 |
| 780 | 3300025945 | Ga0207679_10130143 | Ga0207679_101301432 | 192 |
| 781 | 3300025949 | Ga0207667_10009505 | Ga0207667_100095054 | 192 |
| 782 | 3300025960 | Ga0207651_10116156 | Ga0207651_101161563 | 192 |
| 783 | 3300025981 | Ga0207640_11111296 | Ga0207640_111112962 | 192 |
| 784 | 3300025986 | Ga0207658_10001632 | Ga0207658_100016323 | 192 |
| 785 | 3300025986 | Ga0207658_10025023 | Ga0207658_100250233 | 192 |
| 786 | 3300026023 | Ga0207677_10012746 | Ga0207677_100127464 | 192 |
| 787 | 3300026067 | Ga0207678_10008402 | Ga0207678_100084023 | 192 |
| 788 | 3300026067 | Ga0207678_10080588 | Ga0207678_100805883 | 192 |
| 789 | 3300026075 | Ga0207708_10153607 | Ga0207708_101536073 | 192 |
| 790 | 3300026089 | Ga0207648_10099462 | Ga0207648_100994623 | 192 |
| 791 | 3300026089 | Ga0207648_10321353 | Ga0207648_103213531 | 192 |
| 792 | 3300026089 | Ga0207648_10330196 | Ga0207648_103301962 | 192 |
| 793 | 3300026116 | Ga0207674_10007877 | Ga0207674_100078775 | 192 |
| 794 | 3300026116 | Ga0207674_10414373 | Ga0207674_104143732 | 192 |
| 795 | 3300026118 | Ga0207675_100473096 | Ga0207675_1004730962 | 192 |
| 796 | 3300026121 | Ga0207683_10051718 | Ga0207683_100517183 | 192 |
| 797 | 3300026121 | Ga0207683_10216873 | Ga0207683_102168732 | 192 |
| 798 | 3300026142 | Ga0207698_10066687 | Ga0207698_100666872 | 192 |
| 799 | 3300027695 | Ga0209966_1082362 | Ga0209966_10823621 | 192 |
| 800 | 3300027907 | Ga0207428_10002856 | Ga0207428_1000285611 | 192 |
| 801 | 3300027907 | Ga0207428_10158713 | Ga0207428_101587132 | 192 |
| 802 | 3300028380 | Ga0268265_10045549 | Ga0268265_100455493 | 192 |
| 803 | 3300028794 | Ga0307515_10236450 | Ga0307515_102364502 | 192 |
| 804 | 3300031507 | Ga0307509_10011751 | Ga0307509_1001175110 | 192 |
| 805 | 3300031548 | Ga0307408_100000338 | Ga0307408_10000033810 | 192 |
| 806 | 3300031548 | Ga0307408_100003163 | Ga0307408_1000031636 | 192 |
| 807 | 3300031548 | Ga0307408_100006210 | Ga0307408_1000062109 | 192 |
| 808 | 3300031616 | Ga0307508_10137671 | Ga0307508_101376712 | 192 |
| 809 | 3300031730 | Ga0307516_10314593 | Ga0307516_103145932 | 192 |
| 810 | 3300031731 | Ga0307405_10321694 | Ga0307405_103216942 | 192 |
| 811 | 3300031731 | Ga0307405_10522895 | Ga0307405_105228951 | 192 |
| 812 | 3300031852 | Ga0307410_10129231 | Ga0307410_101292312 | 192 |
| 813 | 3300031911 | Ga0307412_10000332 | Ga0307412_1000033217 | 192 |
| 814 | 3300031911 | Ga0307412_10125723 | Ga0307412_101257233 | 192 |
| 815 | 3300031911 | Ga0307412_11172917 | Ga0307412_111729171 | 192 |
| 816 | 3300032004 | Ga0307414_10808311 | Ga0307414_108083112 | 192 |
| 817 | 3300033180 | Ga0307510_10019174 | Ga0307510_100191743 | 192 |
| 818 | 3300037312 | Ga0395899_0000036 | Ga0395899_0000036_60338_60919 | 192 |
| 819 | 3300037418 | Ga0395900_0000071 | Ga0395900_0000071_60338_60919 | 192 |
| 820 | 3300037466 | Ga0395898_0000115 | Ga0395898_0000115_46677_47258 | 192 |
| 821 | 3300041405 | Ga0439438_000149 | Ga0439438_000149_23751_24332 | 192 |
| 822 | 3300041405 | Ga0439438_002641 | Ga0439438_002641_4480_5061 | 192 |
| 823 | 3300041407 | Ga0439447_002210 | Ga0439447_002210_3966_4547 | 192 |
| 824 | 3300041407 | Ga0439447_011078 | Ga0439447_011078_1217_1798 | 192 |
| 825 | 3300041411 | Ga0439466_0000719 | Ga0439466_0000719_11611_12192 | 192 |
| 826 | 3300041411 | Ga0439466_0000880 | Ga0439466_0000880_9508_10089 | 192 |
| 827 | 3300041411 | Ga0439466_0001876 | Ga0439466_0001876_6487_7068 | 192 |
| 828 | 3300041494 | Ga0451837_1569949 | Ga0451837_1569949_271_873 | 192 |
| 829 | 3300041509 | Ga0451843_0892095 | Ga0451843_0892095_118_699 | 192 |
| 830 | 3300041512 | Ga0451853_2345502 | Ga0451853_2345502_161_772 | 192 |
| 831 | 3300041512 | Ga0451853_2947663 | Ga0451853_2947663_711_1292 | 192 |
| 832 | 3300041997 | Ga0439431_0068524 | Ga0439431_0068524_99_680 | 192 |
| 833 | 3300041999 | Ga0439433_0015099 | Ga0439433_0015099_471_1052 | 192 |
| 834 | 3300042004 | Ga0439445_0073960 | Ga0439445_0073960_31_612 | 192 |
| 835 | 3300042006 | Ga0439432_065782 | Ga0439432_065782_140_721 | 192 |
| 836 | 3300042006 | Ga0439432_115781 | Ga0439432_115781_120_701 | 192 |
| 837 | 3300042007 | Ga0439449_0002301 | Ga0439449_0002301_1681_2262 | 192 |
| 838 | 3300042009 | Ga0439451_001608 | Ga0439451_001608_1358_1939 | 192 |
| 839 | 3300042010 | Ga0439452_000559 | Ga0439452_000559_13216_13797 | 192 |
| 840 | 3300042010 | Ga0439452_012799 | Ga0439452_012799_696_1277 | 192 |
| 841 | 3300042010 | Ga0439452_049128 | Ga0439452_049128_276_857 | 192 |
| 842 | 3300042115 | Ga0450911_005372 | Ga0450911_005372_130_711 | 192 |
| 843 | 3300042123 | Ga0450921_015948 | Ga0450921_015948_49_630 | 192 |
| 844 | 3300042127 | Ga0450890_004088 | Ga0450890_004088_1122_1703 | 192 |
| 845 | 3300042137 | Ga0450902_005710 | Ga0450902_005710_221_802 | 192 |
| 846 | 3300042137 | Ga0450902_038776 | Ga0450902_038776_190_771 | 192 |
| 847 | 3300042138 | Ga0450903_001727 | Ga0450903_001727_1847_2428 | 192 |
| 848 | 3300042142 | Ga0450905_000666 | Ga0450905_000666_3575_4156 | 192 |
| 849 | 3300042156 | Ga0439446_0044427 | Ga0439446_0044427_113_694 | 192 |
| 850 | 3300042185 | Ga0450909_008301 | Ga0450909_008301_284_865 | 192 |
| 851 | 3300042532 | Ga0450893_0005302 | Ga0450893_0005302_75_656 | 192 |
| 852 | 3300044656 | Ga0466969_0064826 | Ga0466969_0064826_1081_1731 | 192 |
| 853 | 3300044669 | Ga0466981_0312141 | Ga0466981_0312141_253_834 | 192 |
| 854 | 3300044684 | Ga0466966_0011494 | Ga0466966_0011494_3545_4195 | 192 |
| 855 | 3300044684 | Ga0466966_0071843 | Ga0466966_0071843_486_1094 | 192 |
| 856 | 3300044693 | Ga0466961_0074502 | Ga0466961_0074502_829_1479 | 192 |
| 857 | 3300044694 | Ga0466963_0035458 | Ga0466963_0035458_51_659 | 192 |
| 858 | 3300044765 | Ga0466970_0075377 | Ga0466970_0075377_37_618 | 192 |
| 859 | 3300045049 | Ga0466959_0020980 | Ga0466959_0020980_3019_3669 | 192 |
| 860 | 3300045836 | Ga0466958_0051662 | Ga0466958_0051662_1265_1873 | 192 |
| 861 | 3300046452 | Ga0495617_058726 | Ga0495617_058726_591_1172 | 192 |
| 862 | 3300046452 | Ga0495617_065748 | Ga0495617_065748_156_737 | 192 |
| 863 | 3300046452 | Ga0495617_119958 | Ga0495617_119958_207_788 | 192 |
| 864 | 3300046455 | Ga0495603_0016851 | Ga0495603_0016851_2384_2965 | 192 |
| 865 | 3300046457 | Ga0495590_0037979 | Ga0495590_0037979_254_835 | 192 |
| 866 | 3300046457 | Ga0495590_0047821 | Ga0495590_0047821_28_609 | 192 |
| 867 | 3300046458 | Ga0495591_053412 | Ga0495591_053412_28_609 | 192 |
| 868 | 3300046459 | Ga0495629_0106493 | Ga0495629_0106493_778_1395 | 192 |
| 869 | 3300046460 | Ga0495638_0010696 | Ga0495638_0010696_693_1274 | 192 |
| 870 | 3300046460 | Ga0495638_0021932 | Ga0495638_0021932_334_915 | 192 |
| 871 | 3300046460 | Ga0495638_0041685 | Ga0495638_0041685_1286_1867 | 192 |
| 872 | 3300046460 | Ga0495638_0065953 | Ga0495638_0065953_1495_2076 | 192 |
| 873 | 3300046460 | Ga0495638_0078445 | Ga0495638_0078445_168_749 | 192 |
| 874 | 3300046460 | Ga0495638_0249677 | Ga0495638_0249677_247_828 | 192 |
| 875 | 3300046471 | Ga0495650_0000531 | Ga0495650_0000531_36234_36815 | 192 |
| 876 | 3300046471 | Ga0495650_0039260 | Ga0495650_0039260_897_1478 | 192 |
| 877 | 3300046474 | Ga0495605_0000551 | Ga0495605_0000551_11880_12461 | 192 |
| 878 | 3300046474 | Ga0495605_0001579 | Ga0495605_0001579_10294_10875 | 192 |
| 879 | 3300046474 | Ga0495605_0001765 | Ga0495605_0001765_671_1339 | 192 |
| 880 | 3300046474 | Ga0495605_0004117 | Ga0495605_0004117_7306_7887 | 192 |
| 881 | 3300046474 | Ga0495605_0010517 | Ga0495605_0010517_921_1502 | 192 |
| 882 | 3300046474 | Ga0495605_0076161 | Ga0495605_0076161_913_1494 | 192 |
| 883 | 3300046475 | Ga0495639_0249743 | Ga0495639_0249743_149_730 | 192 |
| 884 | 3300046491 | Ga0495584_0000086 | Ga0495584_0000086_46632_47213 | 192 |
| 885 | 3300046491 | Ga0495584_0007969 | Ga0495584_0007969_24_692 | 192 |
| 886 | 3300046491 | Ga0495584_0012121 | Ga0495584_0012121_2160_2741 | 192 |
| 887 | 3300046491 | Ga0495584_0017233 | Ga0495584_0017233_2635_3216 | 192 |
| 888 | 3300046491 | Ga0495584_0224178 | Ga0495584_0224178_236_817 | 192 |
| 889 | 3300046492 | Ga0495585_0001557 | Ga0495585_0001557_6535_7116 | 192 |
| 890 | 3300046492 | Ga0495585_0009499 | Ga0495585_0009499_337_918 | 192 |
| 891 | 3300046492 | Ga0495585_0072199 | Ga0495585_0072199_843_1448 | 192 |
| 892 | 3300046501 | Ga0495607_0000747 | Ga0495607_0000747_21987_22568 | 192 |
| 893 | 3300046501 | Ga0495607_0001090 | Ga0495607_0001090_21400_22068 | 192 |
| 894 | 3300046501 | Ga0495607_0003073 | Ga0495607_0003073_4141_4722 | 192 |
| 895 | 3300046501 | Ga0495607_0009909 | Ga0495607_0009909_572_1153 | 192 |
| 896 | 3300046501 | Ga0495607_0035678 | Ga0495607_0035678_1938_2519 | 192 |
| 897 | 3300046506 | Ga0495583_0000708 | Ga0495583_0000708_28083_28664 | 192 |
| 898 | 3300046506 | Ga0495583_0000982 | Ga0495583_0000982_21950_22531 | 192 |
| 899 | 3300046506 | Ga0495583_0141801 | Ga0495583_0141801_40_621 | 192 |
| 900 | 3300046507 | Ga0495606_0197486 | Ga0495606_0197486_515_1096 | 192 |
| 901 | 3300046512 | Ga0495610_0000306 | Ga0495610_0000306_3475_4056 | 192 |
| 902 | 3300046512 | Ga0495610_0000638 | Ga0495610_0000638_29290_29871 | 192 |
| 903 | 3300046512 | Ga0495610_0122868 | Ga0495610_0122868_354_935 | 192 |
| 904 | 3300046512 | Ga0495610_0184185 | Ga0495610_0184185_193_774 | 192 |
| 905 | 3300046513 | Ga0495616_0000281 | Ga0495616_0000281_2960_3628 | 192 |
| 906 | 3300046513 | Ga0495616_0005083 | Ga0495616_0005083_4770_5351 | 192 |
| 907 | 3300046513 | Ga0495616_0007365 | Ga0495616_0007365_2517_3098 | 192 |
| 908 | 3300046513 | Ga0495616_0028885 | Ga0495616_0028885_1483_2064 | 192 |
| 909 | 3300046513 | Ga0495616_0079579 | Ga0495616_0079579_955_1536 | 192 |
| 910 | 3300046517 | Ga0495630_0045714 | Ga0495630_0045714_1817_2398 | 192 |
| 911 | 3300046518 | Ga0495631_0004732 | Ga0495631_0004732_5404_5985 | 192 |
| 912 | 3300046518 | Ga0495631_0005056 | Ga0495631_0005056_5818_6399 | 192 |
| 913 | 3300046518 | Ga0495631_0182346 | Ga0495631_0182346_163_744 | 192 |
| 914 | 3300046519 | Ga0495632_0000166 | Ga0495632_0000166_44516_45097 | 192 |
| 915 | 3300046519 | Ga0495632_0004954 | Ga0495632_0004954_5315_5896 | 192 |
| 916 | 3300046519 | Ga0495632_0008738 | Ga0495632_0008738_2591_3172 | 192 |
| 917 | 3300046519 | Ga0495632_0013043 | Ga0495632_0013043_175_756 | 192 |
| 918 | 3300046519 | Ga0495632_0040763 | Ga0495632_0040763_474_1055 | 192 |
| 919 | 3300046520 | Ga0495637_0000138 | Ga0495637_0000138_31958_32539 | 192 |
| 920 | 3300046520 | Ga0495637_0001577 | Ga0495637_0001577_10257_10838 | 192 |
| 921 | 3300046520 | Ga0495637_0004154 | Ga0495637_0004154_5686_6267 | 192 |
| 922 | 3300046522 | Ga0495643_0002007 | Ga0495643_0002007_4178_4759 | 192 |
| 923 | 3300046522 | Ga0495643_0028069 | Ga0495643_0028069_2161_2742 | 192 |
| 924 | 3300046523 | Ga0495644_0004518 | Ga0495644_0004518_569_1150 | 192 |
| 925 | 3300046523 | Ga0495644_0219185 | Ga0495644_0219185_109_690 | 192 |
| 926 | 3300046524 | Ga0495648_0000758 | Ga0495648_0000758_31303_31884 | 192 |
| 927 | 3300046524 | Ga0495648_0007082 | Ga0495648_0007082_7202_7783 | 192 |
| 928 | 3300046524 | Ga0495648_0030444 | Ga0495648_0030444_384_965 | 192 |
| 929 | 3300046524 | Ga0495648_0058557 | Ga0495648_0058557_1689_2270 | 192 |
| 930 | 3300046524 | Ga0495648_0159990 | Ga0495648_0159990_437_1018 | 192 |
| 931 | 3300046525 | Ga0495663_0085087 | Ga0495663_0085087_296_877 | 192 |
| 932 | 3300046528 | Ga0495642_0000016 | Ga0495642_0000016_65941_66522 | 192 |
| 933 | 3300046528 | Ga0495642_0006163 | Ga0495642_0006163_2736_3404 | 192 |
| 934 | 3300046530 | Ga0495654_0010482 | Ga0495654_0010482_2535_3116 | 192 |
| 935 | 3300046530 | Ga0495654_0015115 | Ga0495654_0015115_2982_3563 | 192 |
| 936 | 3300046530 | Ga0495654_0054824 | Ga0495654_0054824_1003_1584 | 192 |
| 937 | 3300046530 | Ga0495654_0114819 | Ga0495654_0114819_538_1119 | 192 |
| 938 | 3300046536 | Ga0495587_0043008 | Ga0495587_0043008_1848_2429 | 192 |
| 939 | 3300046537 | Ga0495598_0146856 | Ga0495598_0146856_214_795 | 192 |
| 940 | 3300046538 | Ga0495609_0000072 | Ga0495609_0000072_47082_47663 | 192 |
| 941 | 3300046538 | Ga0495609_0000186 | Ga0495609_0000186_41821_42402 | 192 |
| 942 | 3300046538 | Ga0495609_0000319 | Ga0495609_0000319_37552_38220 | 192 |
| 943 | 3300046538 | Ga0495609_0004779 | Ga0495609_0004779_5058_5639 | 192 |
| 944 | 3300046538 | Ga0495609_0024806 | Ga0495609_0024806_1229_1810 | 192 |
| 945 | 3300046538 | Ga0495609_0056433 | Ga0495609_0056433_958_1539 | 192 |
| 946 | 3300046542 | Ga0495597_0015611 | Ga0495597_0015611_213_794 | 192 |
| 947 | 3300046542 | Ga0495597_0073252 | Ga0495597_0073252_485_1066 | 192 |
| 948 | 3300046542 | Ga0495597_0148182 | Ga0495597_0148182_157_738 | 192 |
| 949 | 3300046542 | Ga0495597_0179086 | Ga0495597_0179086_216_797 | 192 |
| 950 | 3300046557 | Ga0495622_0000516 | Ga0495622_0000516_21868_22449 | 192 |
| 951 | 3300046557 | Ga0495622_0004427 | Ga0495622_0004427_1320_1901 | 192 |
| 952 | 3300046557 | Ga0495622_0022143 | Ga0495622_0022143_166_747 | 192 |
| 953 | 3300046558 | Ga0495633_0196555 | Ga0495633_0196555_245_826 | 192 |
| 954 | 3300046558 | Ga0495633_0267223 | Ga0495633_0267223_46_627 | 192 |
| 955 | 3300046615 | Ga0495656_0086891 | Ga0495656_0086891_133_714 | 192 |
| 956 | 3300046616 | Ga0495668_0009126 | Ga0495668_0009126_4935_5516 | 192 |
| 957 | 3300046616 | Ga0495668_0025995 | Ga0495668_0025995_2152_2733 | 192 |
| 958 | 3300046616 | Ga0495668_0189293 | Ga0495668_0189293_70_675 | 192 |
| 959 | 3300046648 | Ga0495611_0005135 | Ga0495611_0005135_801_1382 | 192 |
| 960 | 3300046648 | Ga0495611_0006017 | Ga0495611_0006017_4241_4822 | 192 |
| 961 | 3300046648 | Ga0495611_0040807 | Ga0495611_0040807_837_1418 | 192 |
| 962 | 3300046660 | Ga0495625_0000718 | Ga0495625_0000718_31288_31869 | 192 |
| 963 | 3300046660 | Ga0495625_0001903 | Ga0495625_0001903_3222_3803 | 192 |
| 964 | 3300046660 | Ga0495625_0010231 | Ga0495625_0010231_2352_2933 | 192 |
| 965 | 3300046660 | Ga0495625_0017472 | Ga0495625_0017472_3880_4461 | 192 |
| 966 | 3300046660 | Ga0495625_0023716 | Ga0495625_0023716_262_843 | 192 |
| 967 | 3300046660 | Ga0495625_0096571 | Ga0495625_0096571_642_1223 | 192 |
| 968 | 3300046660 | Ga0495625_0160130 | Ga0495625_0160130_647_1228 | 192 |
| 969 | 3300046660 | Ga0495625_0281433 | Ga0495625_0281433_386_967 | 192 |
| 970 | 3300046664 | Ga0495659_0000823 | Ga0495659_0000823_9173_9754 | 192 |
| 971 | 3300046664 | Ga0495659_0002449 | Ga0495659_0002449_5093_5674 | 192 |
| 972 | 3300046664 | Ga0495659_0010990 | Ga0495659_0010990_1531_2112 | 192 |
| 973 | 3300046665 | Ga0495661_0000914 | Ga0495661_0000914_23459_24127 | 192 |
| 974 | 3300046665 | Ga0495661_0019746 | Ga0495661_0019746_1116_1697 | 192 |
| 975 | 3300046665 | Ga0495661_0054705 | Ga0495661_0054705_1071_1652 | 192 |
| 976 | 3300046665 | Ga0495661_0176764 | Ga0495661_0176764_71_652 | 192 |
| 977 | 3300046665 | Ga0495661_0180352 | Ga0495661_0180352_153_734 | 192 |
| 978 | 3300046665 | Ga0495661_0182034 | Ga0495661_0182034_303_884 | 192 |
| 979 | 3300046665 | Ga0495661_0191544 | Ga0495661_0191544_269_850 | 192 |
| 980 | 3300046674 | Ga0495588_0008467 | Ga0495588_0008467_1116_1697 | 192 |
| 981 | 3300046679 | Ga0495623_0389317 | Ga0495623_0389317_141_722 | 192 |
| 982 | 3300046684 | Ga0495669_0002831 | Ga0495669_0002831_5627_6208 | 192 |
| 983 | 3300046684 | Ga0495669_0142317 | Ga0495669_0142317_458_1039 | 192 |
| 984 | 3300046691 | Ga0495670_0000171 | Ga0495670_0000171_16045_16626 | 192 |
| 985 | 3300046691 | Ga0495670_0054312 | Ga0495670_0054312_625_1206 | 192 |
| 986 | 3300046691 | Ga0495670_0081649 | Ga0495670_0081649_799_1380 | 192 |
| 987 | 3300046691 | Ga0495670_0283702 | Ga0495670_0283702_284_865 | 192 |
| 988 | 3300046692 | Ga0495671_0000138 | Ga0495671_0000138_17288_17869 | 192 |
| 989 | 3300046692 | Ga0495671_0005515 | Ga0495671_0005515_4845_5423 | 192 |
| 990 | 3300046692 | Ga0495671_0012417 | Ga0495671_0012417_748_1329 | 192 |
| 991 | 3300046692 | Ga0495671_0051767 | Ga0495671_0051767_1027_1608 | 192 |
| 992 | 3300046692 | Ga0495671_0058017 | Ga0495671_0058017_964_1545 | 192 |
| 993 | 3300046692 | Ga0495671_0240173 | Ga0495671_0240173_265_846 | 192 |
| 994 | 3300046694 | Ga0495649_0012557 | Ga0495649_0012557_456_1037 | 192 |
| 995 | 3300046694 | Ga0495649_0030917 | Ga0495649_0030917_1637_2218 | 192 |
| 996 | 3300046694 | Ga0495649_0158504 | Ga0495649_0158504_138_719 | 192 |
| 997 | 3300046694 | Ga0495649_0295799 | Ga0495649_0295799_121_702 | 192 |
| 998 | 3300046794 | Ga0495589_0000045 | Ga0495589_0000045_119971_120552 | 192 |
| 999 | 3300046794 | Ga0495589_0000282 | Ga0495589_0000282_3203_3871 | 192 |
| 1000 | 3300046794 | Ga0495589_0003117 | Ga0495589_0003117_6264_6845 | 192 |
| 1001 | 3300046809 | Ga0495600_0193891 | Ga0495600_0193891_415_996 | 192 |
| 1002 | 3300046810 | Ga0495660_0002784 | Ga0495660_0002784_4518_5099 | 192 |
| 1003 | 3300047318 | Ga0495636_0000276 | Ga0495636_0000276_2518_3099 | 192 |
| 1004 | 3300047318 | Ga0495636_0008252 | Ga0495636_0008252_2161_2742 | 192 |
| 1005 | 3300047320 | Ga0495672_0000312 | Ga0495672_0000312_58519_59100 | 192 |
| 1006 | 3300047320 | Ga0495672_0000357 | Ga0495672_0000357_17683_18264 | 192 |
| 1007 | 3300047320 | Ga0495672_0026485 | Ga0495672_0026485_47_628 | 192 |
| 1008 | 3300047322 | Ga0495680_0017133 | Ga0495680_0017133_4100_4681 | 192 |
| 1009 | 3300047322 | Ga0495680_0105538 | Ga0495680_0105538_1276_1857 | 192 |
| 1010 | 3300047322 | Ga0495680_0155626 | Ga0495680_0155626_27_608 | 192 |
| 1011 | 3300047323 | Ga0495683_0005825 | Ga0495683_0005825_3995_4576 | 192 |
| 1012 | 3300047323 | Ga0495683_0067043 | Ga0495683_0067043_909_1490 | 192 |
| 1013 | 3300047323 | Ga0495683_0082837 | Ga0495683_0082837_24_605 | 192 |
| 1014 | 3300047443 | Ga0495687_000050 | Ga0495687_000050_136483_137064 | 192 |
| 1015 | 3300047443 | Ga0495687_000538 | Ga0495687_000538_30276_30857 | 192 |
| 1016 | 3300047443 | Ga0495687_000622 | Ga0495687_000622_37552_38220 | 192 |
| 1017 | 3300047443 | Ga0495687_001285 | Ga0495687_001285_7953_8534 | 192 |
| 1018 | 3300047443 | Ga0495687_072901 | Ga0495687_072901_55_636 | 192 |
| 1019 | 3300047444 | Ga0495675_0000123 | Ga0495675_0000123_5473_6054 | 192 |
| 1020 | 3300047445 | Ga0495677_0000111 | Ga0495677_0000111_37552_38220 | 192 |
| 1021 | 3300047445 | Ga0495677_0000135 | Ga0495677_0000135_15955_16536 | 192 |
| 1022 | 3300047445 | Ga0495677_0000306 | Ga0495677_0000306_6511_7092 | 192 |
| 1023 | 3300047445 | Ga0495677_0041519 | Ga0495677_0041519_624_1205 | 192 |
| 1024 | 3300047446 | Ga0495679_010958 | Ga0495679_010958_354_935 | 192 |
| 1025 | 3300047447 | Ga0495685_000137 | Ga0495685_000137_16166_16747 | 192 |
| 1026 | 3300047447 | Ga0495685_005785 | Ga0495685_005785_1526_2107 | 192 |
| 1027 | 3300047469 | Ga0495673_0000138 | Ga0495673_0000138_122532_123113 | 192 |
| 1028 | 3300047469 | Ga0495673_0000354 | Ga0495673_0000354_4799_5380 | 192 |
| 1029 | 3300047469 | Ga0495673_0010358 | Ga0495673_0010358_3785_4366 | 192 |
| 1030 | 3300047469 | Ga0495673_0016053 | Ga0495673_0016053_199_780 | 192 |
| 1031 | 3300047469 | Ga0495673_0061433 | Ga0495673_0061433_331_912 | 192 |
| 1032 | 3300047470 | Ga0495681_0000195 | Ga0495681_0000195_14932_15513 | 192 |
| 1033 | 3300047470 | Ga0495681_0003860 | Ga0495681_0003860_6502_7083 | 192 |
| 1034 | 3300047470 | Ga0495681_0021183 | Ga0495681_0021183_2495_3076 | 192 |
| 1035 | 3300047470 | Ga0495681_0027946 | Ga0495681_0027946_828_1409 | 192 |
| 1036 | 3300047470 | Ga0495681_0078561 | Ga0495681_0078561_402_983 | 192 |
| 1037 | 3300047472 | Ga0495686_0007048 | Ga0495686_0007048_6308_6889 | 192 |
| 1038 | 3300047472 | Ga0495686_0106765 | Ga0495686_0106765_481_1062 | 192 |
| 1039 | 3300047472 | Ga0495686_0123045 | Ga0495686_0123045_783_1364 | 192 |
| 1040 | 3300047673 | Ga0495593_0010956 | Ga0495593_0010956_2566_3147 | 192 |
| 1041 | 3300048091 | Ga0495626_0000419 | Ga0495626_0000419_39725_40306 | 192 |
| 1042 | 3300048091 | Ga0495626_0006306 | Ga0495626_0006306_2227_2808 | 192 |
| 1043 | 3300048091 | Ga0495626_0024118 | Ga0495626_0024118_1148_1816 | 192 |
| 1044 | 3300048919 | Ga0496116_0144503 | Ga0496116_0144503_633_1214 | 192 |
| 1045 | 3300048920 | Ga0496117_0073041 | Ga0496117_0073041_959_1540 | 192 |
| 1046 | 3300048920 | Ga0496117_0223416 | Ga0496117_0223416_328_909 | 192 |
| 1047 | 3300048921 | Ga0496118_0068011 | Ga0496118_0068011_1107_1688 | 192 |
| 1048 | 3300048921 | Ga0496118_0113460 | Ga0496118_0113460_191_772 | 192 |
| 1049 | 3300048921 | Ga0496118_0203001 | Ga0496118_0203001_112_693 | 192 |
| 1050 | 3300048922 | Ga0496119_0076860 | Ga0496119_0076860_1202_1783 | 192 |
| 1051 | 3300048924 | Ga0496121_0000313 | Ga0496121_0000313_56404_56985 | 192 |
| 1052 | 3300048924 | Ga0496121_0006818 | Ga0496121_0006818_3814_4395 | 192 |
| 1053 | 3300048924 | Ga0496121_0075887 | Ga0496121_0075887_444_1025 | 192 |
| 1054 | 3300048924 | Ga0496121_0113847 | Ga0496121_0113847_509_1090 | 192 |
| 1055 | 3300048925 | Ga0496122_0000137 | Ga0496122_0000137_140035_140616 | 192 |
| 1056 | 3300048925 | Ga0496122_0014590 | Ga0496122_0014590_3722_4303 | 192 |
| 1057 | 3300048925 | Ga0496122_0070087 | Ga0496122_0070087_561_1142 | 192 |
| 1058 | 3300048926 | Ga0496123_0000022 | Ga0496123_0000022_27924_28505 | 192 |
| 1059 | 3300048926 | Ga0496123_0024975 | Ga0496123_0024975_1220_1801 | 192 |
| 1060 | 3300048927 | Ga0496124_0031748 | Ga0496124_0031748_629_1210 | 192 |
| 1061 | 3300048927 | Ga0496124_0061504 | Ga0496124_0061504_223_804 | 192 |
| 1062 | 3300048928 | Ga0496125_0005506 | Ga0496125_0005506_8979_9560 | 192 |
| 1063 | 3300048929 | Ga0496126_0003367 | Ga0496126_0003367_14279_14860 | 192 |
| 1064 | 3300048929 | Ga0496126_0014664 | Ga0496126_0014664_4350_4931 | 192 |
| 1065 | 3300048929 | Ga0496126_0200925 | Ga0496126_0200925_363_944 | 192 |
| 1066 | 3300048929 | Ga0496126_0440425 | Ga0496126_0440425_225_806 | 192 |
| 1067 | 3300049459 | Ga0495678_103588 | Ga0495678_103588_225_806 | 192 |
| 1068 | 3300049460 | Ga0495682_0000057 | Ga0495682_0000057_60824_61405 | 192 |
| 1069 | 3300049460 | Ga0495682_0000150 | Ga0495682_0000150_55491_56072 | 192 |
| 1070 | 3300049460 | Ga0495682_0002187 | Ga0495682_0002187_5217_5798 | 192 |
| 1071 | 3300049460 | Ga0495682_0050060 | Ga0495682_0050060_342_923 | 192 |
| 1072 | 3300049569 | Ga0501032_0074944 | Ga0501032_0074944_702_1283 | 192 |
| 1073 | 3300049570 | Ga0501033_0125314 | Ga0501033_0125314_1076_1657 | 192 |
| 1074 | 3300049575 | Ga0501039_0770585 | Ga0501039_0770585_91_672 | 192 |
| 1075 | 3300049583 | Ga0501067_0126497 | Ga0501067_0126497_167_748 | 192 |
| 1076 | 3300050489 | nmdc:mga03683_67614_c1 | nmdc:mga03683_67614_c1_448_1029 | 192 |
| 1077 | 3300050492 | nmdc:mga0yw44_192791_c1 | nmdc:mga0yw44_192791_c1_62_646 | 192 |
| 1078 | 3300050493 | nmdc:mga0k408_120711_c1 | nmdc:mga0k408_120711_c1_912_1493 | 192 |
| 1079 | 3300050493 | nmdc:mga0k408_76875_c1 | nmdc:mga0k408_76875_c1_1113_1694 | 192 |
| 1080 | 3300050494 | nmdc:mga06z11_307568_c1 | nmdc:mga06z11_307568_c1_212_793 | 192 |
| 1081 | 3300050494 | nmdc:mga06z11_77995_c1 | nmdc:mga06z11_77995_c1_60_641 | 192 |
| 1082 | 3300050496 | nmdc:mga07m45_13252_c1 | nmdc:mga07m45_13252_c1_1716_2297 | 192 |
| 1083 | 3300050496 | nmdc:mga07m45_24181_c1 | nmdc:mga07m45_24181_c1_2420_3001 | 192 |
| 1084 | 3300053088 | Ga0500644_0071631 | Ga0500644_0071631_267_848 | 192 |
| 1085 | 3300053089 | Ga0500581_018544 | Ga0500581_018544_491_1072 | 192 |
| 1086 | 3300053090 | Ga0500646_0013403 | Ga0500646_0013403_259_840 | 192 |
| 1087 | 3300053094 | Ga0500566_0000689 | Ga0500566_0000689_12436_13017 | 192 |
| 1088 | 3300053094 | Ga0500566_0001144 | Ga0500566_0001144_9112_9693 | 192 |
| 1089 | 3300053096 | Ga0500641_0008971 | Ga0500641_0008971_1132_1713 | 192 |
| 1090 | 3300053096 | Ga0500641_0061765 | Ga0500641_0061765_220_801 | 192 |
| 1091 | 3300053098 | Ga0500650_0053857 | Ga0500650_0053857_271_852 | 192 |
| 1092 | 3300053104 | Ga0500556_0000015 | Ga0500556_0000015_151852_152433 | 192 |
| 1093 | 3300053105 | Ga0500557_000020 | Ga0500557_000020_73572_74165 | 192 |
| 1094 | 3300053117 | Ga0500593_084365 | Ga0500593_084365_622_1203 | 192 |
| 1095 | 3300053121 | Ga0500607_060974 | Ga0500607_060974_647_1228 | 192 |
| 1096 | 3300053122 | Ga0500608_002235 | Ga0500608_002235_141_722 | 192 |
| 1097 | 3300053123 | Ga0500614_019107 | Ga0500614_019107_587_1168 | 192 |
| 1098 | 3300053125 | Ga0500618_003999 | Ga0500618_003999_3455_4036 | 192 |
| 1099 | 3300053130 | Ga0500642_0000019 | Ga0500642_0000019_69850_70431 | 192 |
| 1100 | 3300053130 | Ga0500642_0000057 | Ga0500642_0000057_51447_52040 | 192 |
| 1101 | 3300053131 | Ga0500652_000710 | Ga0500652_000710_5300_5881 | 192 |
| 1102 | 3300053136 | Ga0500559_0001410 | Ga0500559_0001410_4830_5411 | 192 |
| 1103 | 3300053136 | Ga0500559_0141020 | Ga0500559_0141020_33_614 | 192 |
| 1104 | 3300053142 | Ga0500577_0103967 | Ga0500577_0103967_43_624 | 192 |
| 1105 | 3300053146 | Ga0500588_0072342 | Ga0500588_0072342_204_785 | 192 |
| 1106 | 3300053147 | Ga0500589_001817 | Ga0500589_001817_205_786 | 192 |
| 1107 | 3300053147 | Ga0500589_240926 | Ga0500589_240926_57_638 | 192 |
| 1108 | 3300053148 | Ga0500590_012511 | Ga0500590_012511_1886_2467 | 192 |
| 1109 | 3300053148 | Ga0500590_199967 | Ga0500590_199967_69_650 | 192 |
| 1110 | 3300053151 | Ga0500604_0150525 | Ga0500604_0150525_147_728 | 192 |
| 1111 | 3300053153 | Ga0500616_0000041 | Ga0500616_0000041_77735_78316 | 192 |
| 1112 | 3300053156 | Ga0500622_0005571 | Ga0500622_0005571_5177_5758 | 192 |
| 1113 | 3300053156 | Ga0500622_0093100 | Ga0500622_0093100_76_657 | 192 |
| 1114 | 3300053156 | Ga0500622_0112652 | Ga0500622_0112652_332_913 | 192 |
| 1115 | 3300053158 | Ga0500627_0146239 | Ga0500627_0146239_96_677 | 192 |
| 1116 | 3300053160 | Ga0500633_0058392 | Ga0500633_0058392_193_774 | 192 |
| 1117 | 3300053161 | Ga0500634_0037133 | Ga0500634_0037133_597_1178 | 192 |
| 1118 | 3300053162 | Ga0500638_255907 | Ga0500638_255907_88_669 | 192 |
| 1119 | 3300053177 | Ga0500636_0000173 | Ga0500636_0000173_10071_10652 | 192 |
| 1120 | 3300053177 | Ga0500636_0346786 | Ga0500636_0346786_115_696 | 192 |
| 1121 | 3300055283 | Ga0500661_021286 | Ga0500661_021286_410_991 | 192 |
| 1122 | 3300061734 | Ga0530510_0507035 | Ga0530510_0507035_167_748 | 192 |
| 1123 | iso_pu_bacteria | 2507262055 | 2507507784 | 192 |
| 1124 | iso_pu_bacteria | 2513237101 | 2513696353 | 192 |
| 1125 | iso_pu_bacteria | 2515154112 | 2515626692 | 192 |
| 1126 | iso_pu_bacteria | 2874590934 | 2874598893 | 192 |
| 1127 | iso_pu_bacteria | 2874645413 | 2874650659 | 192 |
| 1128 | iso_pu_bacteria | 2876771140 | 2876778932 | 192 |
| 1129 | iso_pu_bacteria | 2876818435 | 2876824173 | 192 |
| 1130 | iso_pu_bacteria | 2879074833 | 2879082725 | 192 |
| 1131 | iso_pu_bacteria | 2879127579 | 2879132114 | 192 |
| 1132 | iso_pu_bacteria | 2879142872 | 2879148359 | 192 |
| 1133 | iso_pu_bacteria | 2935608549 | 2935609705 | 192 |
| 1134 | iso_pu_bacteria | 2935819856 | 2935822867 | 192 |
| 1135 | iso_pu_bacteria | 2935847175 | 2935848449 | 192 |
| 1136 | iso_pu_bacteria | 2935908558 | 2935909747 | 192 |
| 1137 | iso_pu_bacteria | 2935916978 | 2935917471 | 192 |
| 1138 | iso_pu_bacteria | 2935926038 | 2935927228 | 192 |
| 1139 | iso_pu_bacteria | 2935934488 | 2935936928 | 192 |
| 1140 | iso_pu_bacteria | 2935942939 | 2935944769 | 192 |
| 1141 | iso_pu_bacteria | 2935951376 | 2935953206 | 192 |
| 1142 | iso_pu_bacteria | 2935967501 | 2935970046 | 192 |
| 1143 | iso_pu_bacteria | 2935975950 | 2935980333 | 192 |
| 1144 | iso_pu_bacteria | 2936055302 | 2936062032 | 192 |
| 1145 | iso_pu_bacteria | 8019638758 | 8019646462 | 192 |
| 1146 | iso_pu_bacteria | 8019668869 | 8019670859 | 192 |
| 1147 | iso_pu_bacteria | 8019678201 | 8019685338 | 192 |
| 1148 | iso_pu_bacteria | 8019687851 | 8019690936 | 192 |
| 1149 | 3300003203 | JGI25406J46586_10006853 | JGI25406J46586_100068535 | 193 |
| 1150 | 3300003320 | rootH2_10059534 | rootH2_100595342 | 193 |
| 1151 | 3300005353 | Ga0070669_100205796 | Ga0070669_1002057963 | 193 |
| 1152 | 3300005356 | Ga0070674_100182456 | Ga0070674_1001824562 | 193 |
| 1153 | 3300005434 | Ga0070709_10239711 | Ga0070709_102397111 | 193 |
| 1154 | 3300005546 | Ga0070696_100270863 | Ga0070696_1002708632 | 193 |
| 1155 | 3300005719 | Ga0068861_100072448 | Ga0068861_1000724483 | 193 |
| 1156 | 3300005844 | Ga0068862_100409081 | Ga0068862_1004090813 | 193 |
| 1157 | 3300006844 | Ga0075428_100247782 | Ga0075428_1002477822 | 193 |
| 1158 | 3300006844 | Ga0075428_100647073 | Ga0075428_1006470732 | 193 |
| 1159 | 3300006847 | Ga0075431_100366461 | Ga0075431_1003664613 | 193 |
| 1160 | 3300006881 | Ga0068865_100103884 | Ga0068865_1001038843 | 193 |
| 1161 | 3300009094 | Ga0111539_10000208 | Ga0111539_1000020815 | 193 |
| 1162 | 3300009094 | Ga0111539_11600060 | Ga0111539_116000602 | 193 |
| 1163 | 3300009553 | Ga0105249_10526106 | Ga0105249_105261062 | 193 |
| 1164 | 3300014326 | Ga0157380_10034099 | Ga0157380_100340994 | 193 |
| 1165 | 3300025284 | Ga0209130_1008750 | Ga0209130_10087502 | 193 |
| 1166 | 3300025961 | Ga0207712_10282574 | Ga0207712_102825743 | 193 |
| 1167 | 3300026118 | Ga0207675_100045243 | Ga0207675_1000452434 | 193 |
| 1168 | 3300027907 | Ga0207428_10000016 | Ga0207428_10000016191 | 193 |
| 1169 | 3300028380 | Ga0268265_10533527 | Ga0268265_105335272 | 193 |
| 1170 | 3300028794 | Ga0307515_10007012 | Ga0307515_1000701221 | 193 |
| 1171 | 3300028800 | Ga0265338_10691057 | Ga0265338_106910571 | 193 |
| 1172 | 3300031456 | Ga0307513_10297615 | Ga0307513_102976151 | 193 |
| 1173 | 3300031548 | Ga0307408_100266481 | Ga0307408_1002664812 | 193 |
| 1174 | 3300031728 | Ga0316578_10212710 | Ga0316578_102127102 | 193 |
| 1175 | 3300031730 | Ga0307516_10316330 | Ga0307516_103163301 | 193 |
| 1176 | 3300031824 | Ga0307413_10024029 | Ga0307413_100240293 | 193 |
| 1177 | 3300031903 | Ga0307407_10053693 | Ga0307407_100536933 | 193 |
| 1178 | 3300035398 | Ga0316574_0000057 | Ga0316574_0000057_9112_9699 | 193 |
| 1179 | 3300036401 | Ga0373937_0221108 | Ga0373937_0221108_292_876 | 193 |
| 1180 | 3300037068 | Ga0373925_0725955 | Ga0373925_0725955_208_792 | 193 |
| 1181 | 3300037418 | Ga0395900_1047130 | Ga0395900_1047130_55_639 | 193 |
| 1182 | 3300037471 | Ga0395905_0000775 | Ga0395905_0000775_39132_39734 | 193 |
| 1183 | 3300037471 | Ga0395905_0141347 | Ga0395905_0141347_1005_1589 | 193 |
| 1184 | 3300037471 | Ga0395905_0200233 | Ga0395905_0200233_857_1441 | 193 |
| 1185 | 3300037471 | Ga0395905_0210756 | Ga0395905_0210756_380_964 | 193 |
| 1186 | 3300039062 | Ga0400483_055198 | Ga0400483_055198_855_1439 | 193 |
| 1187 | 3300039062 | Ga0400483_099673 | Ga0400483_099673_602_1186 | 193 |
| 1188 | 3300039062 | Ga0400483_137833 | Ga0400483_137833_1582_2166 | 193 |
| 1189 | 3300039062 | Ga0400483_269888 | Ga0400483_269888_189_773 | 193 |
| 1190 | 3300039062 | Ga0400483_281109 | Ga0400483_281109_1242_1841 | 193 |
| 1191 | 3300039062 | Ga0400483_289222 | Ga0400483_289222_52_636 | 193 |
| 1192 | 3300041413 | Ga0439465_0008944 | Ga0439465_0008944_2382_2966 | 193 |
| 1193 | 3300042006 | Ga0439432_089381 | Ga0439432_089381_93_677 | 193 |
| 1194 | 3300042013 | Ga0439456_053450 | Ga0439456_053450_91_672 | 193 |
| 1195 | 3300042015 | Ga0439462_0014489 | Ga0439462_0014489_1375_1959 | 193 |
| 1196 | 3300045976 | Ga0466967_0453901 | Ga0466967_0453901_365_970 | 193 |
| 1197 | 3300046460 | Ga0495638_0013625 | Ga0495638_0013625_172_756 | 193 |
| 1198 | 3300046530 | Ga0495654_0071796 | Ga0495654_0071796_61_645 | 193 |
| 1199 | 3300048924 | Ga0496121_0358330 | Ga0496121_0358330_327_920 | 193 |
| 1200 | 3300049568 | Ga0501031_0200272 | Ga0501031_0200272_444_1028 | 193 |
| 1201 | 3300049569 | Ga0501032_0126711 | Ga0501032_0126711_273_857 | 193 |
| 1202 | 3300049570 | Ga0501033_0054336 | Ga0501033_0054336_305_889 | 193 |
| 1203 | 3300049570 | Ga0501033_0560450 | Ga0501033_0560450_127_720 | 193 |
| 1204 | 3300049571 | Ga0501034_0106313 | Ga0501034_0106313_425_1009 | 193 |
| 1205 | 3300049572 | Ga0501036_0057761 | Ga0501036_0057761_1656_2240 | 193 |
| 1206 | 3300049573 | Ga0501037_0537767 | Ga0501037_0537767_85_681 | 193 |
| 1207 | 3300049579 | Ga0501043_0360780 | Ga0501043_0360780_128_712 | 193 |
| 1208 | 3300049581 | Ga0501047_0127817 | Ga0501047_0127817_480_1064 | 193 |
| 1209 | 3300049586 | Ga0501070_0160074 | Ga0501070_0160074_704_1288 | 193 |
| 1210 | 3300049742 | Ga0501080_0260589 | Ga0501080_0260589_918_1502 | 193 |
| 1211 | 3300049822 | Ga0501035_0343841 | Ga0501035_0343841_318_902 | 193 |
| 1212 | 3300049823 | Ga0501044_0018003 | Ga0501044_0018003_6675_7259 | 193 |
| 1213 | 3300050507 | nmdc:mga05p37_241795_c1 | nmdc:mga05p37_241795_c1_124_705 | 193 |
| 1214 | 3300050508 | nmdc:mga09592_434381_c1 | nmdc:mga09592_434381_c1_261_842 | 193 |
| 1215 | 3300050510 | nmdc:mga06r32_349326_c1 | nmdc:mga06r32_349326_c1_595_1191 | 193 |
| 1216 | 3300050511 | nmdc:mga08y16_26_c1 | nmdc:mga08y16_26_c1_12870_13451 | 193 |
| 1217 | 3300053088 | Ga0500644_0017141 | Ga0500644_0017141_454_1038 | 193 |
| 1218 | 3300053122 | Ga0500608_007502 | Ga0500608_007502_1376_1960 | 193 |
| 1219 | 3300053125 | Ga0500618_017814 | Ga0500618_017814_303_887 | 193 |
| 1220 | 3300053136 | Ga0500559_0004516 | Ga0500559_0004516_2535_3128 | 193 |
| 1221 | 3300053139 | Ga0500568_0084708 | Ga0500568_0084708_389_973 | 193 |
| 1222 | 3300053153 | Ga0500616_0087061 | Ga0500616_0087061_138_722 | 193 |
| 1223 | 3300053156 | Ga0500622_0000586 | Ga0500622_0000586_28259_28843 | 193 |
| 1224 | 3300059421 | Ga0590071_028360 | Ga0590071_028360_629_1210 | 193 |
| 1225 | 3300001989 | JGI24739J22299_10018697 | JGI24739J22299_100186973 | 194 |
| 1226 | 3300005329 | Ga0070683_100642390 | Ga0070683_1006423902 | 194 |
| 1227 | 3300005539 | Ga0068853_100037228 | Ga0068853_1000372283 | 194 |
| 1228 | 3300005548 | Ga0070665_100717317 | Ga0070665_1007173172 | 194 |
| 1229 | 3300009545 | Ga0105237_10569171 | Ga0105237_105691712 | 194 |
| 1230 | 3300021361 | Ga0213872_10036968 | Ga0213872_100369682 | 194 |
| 1231 | 3300025302 | Ga0207426_1000092 | Ga0207426_100009274 | 194 |
| 1232 | 3300025924 | Ga0207694_10012851 | Ga0207694_100128513 | 194 |
| 1233 | 3300031616 | Ga0307508_10103951 | Ga0307508_101039511 | 194 |
| 1234 | 3300048929 | Ga0496126_0364906 | Ga0496126_0364906_56_640 | 194 |
| 1235 | 3300049570 | Ga0501033_0033057 | Ga0501033_0033057_943_1527 | 194 |
| 1236 | 3300049822 | Ga0501035_0015990 | Ga0501035_0015990_5546_6130 | 194 |
| 1237 | 3300049822 | Ga0501035_0242035 | Ga0501035_0242035_537_1121 | 194 |
| 1238 | 3300049823 | Ga0501044_0044768 | Ga0501044_0044768_1792_2376 | 194 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3byq-assembly1.cif.gz_B | crystal structure of a duf1185 family protein (bb2672) from bordetella bronchiseptica rb50 at 1.70 a resolution | 0.9575 | 1 | 193 |
| 3byq-assembly1.cif.gz_B | crystal structure of a duf1185 family protein (bb2672) from bordetella bronchiseptica rb50 at 1.70 a resolution | 0.9527 | 1 | 193 |
| 2qtp-assembly1.cif.gz_A | crystal structure of a duf1185 family protein (spo0826) from silicibacter pomeroyi dss-3 at 2.10 a resolution | 0.9198 | 5 | 171 |
| 2qtp-assembly1.cif.gz_A | crystal structure of a duf1185 family protein (spo0826) from silicibacter pomeroyi dss-3 at 2.10 a resolution | 0.9138 | 5 | 171 |
| 5avm-assembly3.cif.gz_E | crystal structures of 5-aminoimidazole ribonucleotide (air) synthetase, purm, from thermus thermophilus | 0.5982 | 52 | 170 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3byqA00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;BB2672 | 0.954 | 4 | 193 | 3.30.1330.110 |
| 3byqA00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;BB2672 | 0.9389 | 4 | 193 | 3.30.1330.110 |
| 2qtpA00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;BB2672 | 0.9181 | 5 | 171 | 3.30.1330.110 |
| 2qtpA00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;BB2672 | 0.912 | 5 | 171 | 3.30.1330.110 |
| 2aagB00 | Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor | 0.6437 | 86 | 125 | 3.30.429.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A529X5A4-F1-model_v4 | deleted | 0.999 | 1 | 114 |
|
| AF-A0A440UUX6-F1-model_v4 | Amino acid synthesis family protein | 0.9926 | 1 | 95 |
|
| AF-A0A166RNT4-F1-model_v4 | Peptide synthetase | 0.9906 | 1 | 173 |
|
| AF-A0A529X5A4-F1-model_v4 | deleted | 0.9903 | 1 | 114 |
|
| AF-A0A442WN23-F1-model_v4 | Uncharacterized protein | 0.9831 | 1 | 193 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar