F491889
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1223 | 642 | 981 | 316 |
Family's Representative Sequence
| Representative Sequence | 3300048907|Ga0496104_0000399|Ga0496104_0000399_14801_15859 |
| Length | 352 |
| Sequence | MLWSAPKERVSKHVAAPSFETAAFRGLLRMRRRKVSMLQLRRLGQSDLHLAPIMLGGNVFGWTIDEKTSFGILDAFVDAGFNAVDTSDSYARWVPGSPGGESETIIGNWIKRSGKRDKVLIATKVGEDMGEGRSLKKDYILRECEASLRRLQTDHIDLYQTHFDDEVTPVEETMQAYAALIKAGKVRAIGASNISPARLKASLAASKQLGLPRYESLQPLYNLSDRKEFETEFAPICREQKLGVINYYSLAAGFLTGKYRSAEEGAKHPGRGGRLKRYLDARGLGILKVVGEVAARHNALPAQIALAWLIARPIVTAPIVSATSLKQLGEILKAPQIKLSPADIAALDAAGS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 3 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 4 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 5 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 6 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 7 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 8 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 9 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 10 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 11 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 12 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 13 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 14 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 15 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 16 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 17 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 18 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 19 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 20 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 21 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 22 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 23 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 24 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 25 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 26 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 27 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 28 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 29 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 30 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 31 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 32 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 33 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 34 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 35 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 36 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 37 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 38 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 39 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 40 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 41 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 42 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 43 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 44 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 45 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 46 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 47 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 48 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 49 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 50 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 51 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 52 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 53 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 54 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 55 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 56 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 57 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 58 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 59 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 60 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 61 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 62 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 63 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 64 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 65 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 66 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 67 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 68 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 69 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 70 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 71 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 72 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 73 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 74 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 75 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 76 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 77 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 78 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 79 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 80 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 81 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 82 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 83 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 84 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 85 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 86 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 87 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 88 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 89 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 90 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 91 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 92 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 93 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 94 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 95 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 96 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 97 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 98 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 99 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 100 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 101 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 102 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 103 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 104 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 105 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 106 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 107 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 108 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 109 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 110 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 111 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 112 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 113 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 114 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 115 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 116 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 117 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 118 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 119 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 120 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 121 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 122 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 123 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 124 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 125 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 126 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 127 | 2928972540 | Brevundimonas sp. 1080 | Isolate | Rhizosphere |
| 128 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 129 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 130 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 131 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 132 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 133 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 134 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 135 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 136 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 137 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 138 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 139 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 140 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 141 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 142 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 143 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 144 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 145 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 146 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 147 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 148 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 149 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 150 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 151 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 152 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 153 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 154 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 155 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 156 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 157 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 158 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 159 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 160 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 161 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 162 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 163 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 164 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 165 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 166 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 167 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 168 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 169 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 170 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 171 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 172 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 173 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 174 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 175 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 176 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 177 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 178 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 179 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 180 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 181 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 182 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 183 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 184 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 185 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 186 | 2977240413 | Brevundimonas vesicularis SORGH_AS 431 | Isolate | Unclassified |
| 187 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 188 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 189 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 190 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 191 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 192 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 193 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 194 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 195 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 196 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 197 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 198 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 199 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 200 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 201 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 202 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 203 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 204 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 205 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 206 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 207 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 208 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 209 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 210 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 211 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 212 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 213 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 214 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 215 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 216 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 217 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 218 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 219 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 220 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 221 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 222 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 223 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 224 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 225 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 226 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 227 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 229 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 230 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 231 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 232 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 233 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 234 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 235 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 236 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 237 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 238 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 239 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 240 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 241 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 242 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 243 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 244 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 245 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 246 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 247 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 248 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 249 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 250 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 251 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 252 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 253 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 254 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 255 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 256 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 257 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 258 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 259 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 260 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 261 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 262 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 263 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 264 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 265 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 266 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 267 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 268 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 269 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 270 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 271 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 272 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 273 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 274 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 275 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 276 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 277 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 278 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 279 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 280 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 281 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 282 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 283 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 284 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 285 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 286 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 287 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 288 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 289 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 290 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 291 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 292 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 293 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 294 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 295 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 296 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 297 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 298 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 299 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 300 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 301 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 302 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 303 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 304 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 305 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 306 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 307 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 308 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 309 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 310 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 311 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 312 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 313 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 314 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 315 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 316 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 317 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 318 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 319 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 320 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 322 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 323 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 324 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 325 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 326 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 327 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 328 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 329 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 331 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 332 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 333 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 334 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 336 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 337 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 339 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 340 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 341 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 342 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 343 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 344 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 345 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 346 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 347 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 348 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 349 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 350 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 351 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 352 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 353 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 354 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 355 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 356 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 357 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 358 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 359 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 360 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 361 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 362 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 363 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 364 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 365 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 366 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 367 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 368 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 369 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 371 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 372 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 373 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 374 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 375 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 376 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 377 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 379 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 380 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 381 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 382 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 383 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 384 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 385 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 386 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 387 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 388 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 389 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 390 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 391 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 392 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 393 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 394 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 395 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 396 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 397 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 398 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 399 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 400 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 401 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 402 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 403 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 404 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 405 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 406 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 407 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 408 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 409 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 410 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 411 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 412 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 413 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 414 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 415 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 416 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 417 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 418 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 419 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 420 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 421 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 422 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 423 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 424 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 425 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 426 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 427 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 428 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 429 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 430 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 431 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 432 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 433 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 434 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 435 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 436 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 437 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 438 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 439 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 440 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 441 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 442 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 443 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 444 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 445 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 446 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 447 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 448 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 449 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 450 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 451 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 452 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 453 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 454 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 455 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 456 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 457 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 458 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 459 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 460 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 461 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 462 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 463 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 464 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 465 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 466 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 467 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 468 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 469 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 470 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 471 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 472 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 473 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 474 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 475 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 476 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 477 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 478 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 479 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 480 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 481 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 482 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 483 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 484 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 485 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 486 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 487 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 488 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 489 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 490 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 491 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 492 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 493 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 494 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 495 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 496 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 497 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 498 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 499 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 500 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 501 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 502 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 503 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 504 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 505 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 506 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 541 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 550 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 552 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 553 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 554 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 555 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 556 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 557 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 558 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 559 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 560 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 561 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 562 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 563 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 564 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 565 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 566 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 567 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 568 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 569 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 570 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 571 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 572 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 573 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 574 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 575 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 576 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 577 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 578 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 579 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 580 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 581 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 582 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 583 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 584 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 585 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 586 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 587 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 588 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 589 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 590 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 591 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 592 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 593 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 594 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 595 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 596 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 597 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 598 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 599 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 600 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 601 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 602 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 603 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 604 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 605 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 606 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 607 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 608 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 609 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 610 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 611 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 612 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 613 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 614 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 615 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 616 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 617 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 618 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 619 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 620 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 621 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 622 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 623 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 624 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 625 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 626 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 627 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 628 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 629 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 630 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 631 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 632 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 633 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 634 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 635 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 636 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 637 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 638 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 639 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 640 | 8046352972 | Agromyces mangrovi NBRC 112812 | Isolate | Rhizosphere |
| 641 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 642 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 80.05 |
| Metatranscriptomes | 0.16 |
| Isolates | 19.79 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.19 |
| Nodule | 16.52 |
| Rhizoplane | 5.4 |
| Rhizosphere | 71.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.6 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214711591 | 2209111006 | Bacteria | 4350 |
| 2 | ARcpr5oldR_c000035 | 3300000041 | Bacteria | 26838 |
| 3 | ARSoilYngRDRAFT_c00458 | 3300000042 | Bacteria | 4991 |
| 4 | ARSoilOldRDRAFT_c000053 | 3300000044 | Bacteria | 23841 |
| 5 | ARCol0yngRDRAFT_1000025 | 3300000652 | Bacteria | 26845 |
| 6 | JGI24752J21851_1003441 | 3300001976 | Bacteria | 2082 |
| 7 | JGI24739J22299_10018162 | 3300001989 | Bacteria | 2531 |
| 8 | JGI24737J22298_10000053 | 3300001990 | Bacteria | 34054 |
| 9 | JGI24737J22298_10004052 | 3300001990 | Bacteria | 5124 |
| 10 | JGI24735J21928_10013098 | 3300002067 | Bacteria | 2612 |
| 11 | JGI24738J21930_10002204 | 3300002075 | Bacteria | 5182 |
| 12 | JGI24749J21850_1000375 | 3300002076 | Bacteria | 6658 |
| 13 | JGI24034J26672_10000960 | 3300002239 | Bacteria | 3760 |
| 14 | JGI24742J22300_10000216 | 3300002244 | Bacteria | 8591 |
| 15 | JGI25157J39369_1001732 | 3300002741 | Bacteria | 7216 |
| 16 | JGI25406J46586_10028248 | 3300003203 | Bacteria | 2140 |
| 17 | JGI25165J46597_1000097 | 3300003214 | Bacteria | 161115 |
| 18 | Ga0006562J51391_1053984 | 3300003578 | Bacteria | 1828 |
| 19 | Ga0065712_10071633 | 3300005290 | Bacteria | 5146 |
| 20 | Ga0065712_10172224 | 3300005290 | Bacteria | 1217 |
| 21 | Ga0065715_10003868 | 3300005293 | Bacteria | 9723 |
| 22 | Ga0065715_10093047 | 3300005293 | Bacteria | 4830 |
| 23 | Ga0070658_10011015 | 3300005327 | Bacteria | 7249 |
| 24 | Ga0070658_10019708 | 3300005327 | Bacteria | 5401 |
| 25 | Ga0070658_10077237 | 3300005327 | Bacteria | 2731 |
| 26 | Ga0070676_10004729 | 3300005328 | Bacteria | 7199 |
| 27 | Ga0070676_10006093 | 3300005328 | Bacteria | 6438 |
| 28 | Ga0070683_100001083 | 3300005329 | Bacteria | 20468 |
| 29 | Ga0070683_100016216 | 3300005329 | Bacteria | 6564 |
| 30 | Ga0070683_100176436 | 3300005329 | Bacteria | 2028 |
| 31 | Ga0070683_100341950 | 3300005329 | Bacteria | 1425 |
| 32 | Ga0070690_100002762 | 3300005330 | Bacteria | 9483 |
| 33 | Ga0070670_100003174 | 3300005331 | Bacteria | 13579 |
| 34 | Ga0070670_100005035 | 3300005331 | Bacteria | 11118 |
| 35 | Ga0070670_100173359 | 3300005331 | Bacteria | 1871 |
| 36 | Ga0070670_100188058 | 3300005331 | Bacteria | 1793 |
| 37 | Ga0070677_10002672 | 3300005333 | Bacteria | 5704 |
| 38 | Ga0070677_10015355 | 3300005333 | Bacteria | 2713 |
| 39 | Ga0068869_100000279 | 3300005334 | Bacteria | 27008 |
| 40 | Ga0068869_100002437 | 3300005334 | Bacteria | 11217 |
| 41 | Ga0068869_100009143 | 3300005334 | Bacteria | 6420 |
| 42 | Ga0070666_10009526 | 3300005335 | Bacteria | 6058 |
| 43 | Ga0070666_10069794 | 3300005335 | Bacteria | 2390 |
| 44 | Ga0070666_10232201 | 3300005335 | Bacteria | 1303 |
| 45 | Ga0070680_100021592 | 3300005336 | Bacteria | 5119 |
| 46 | Ga0070680_100121685 | 3300005336 | Bacteria | 2179 |
| 47 | Ga0070682_100066117 | 3300005337 | Bacteria | 2299 |
| 48 | Ga0068868_100002361 | 3300005338 | Bacteria | 13072 |
| 49 | Ga0068868_100004075 | 3300005338 | Bacteria | 10198 |
| 50 | Ga0068868_100021850 | 3300005338 | Bacteria | 4823 |
| 51 | Ga0068868_100155201 | 3300005338 | Bacteria | 1887 |
| 52 | Ga0070660_100000245 | 3300005339 | Bacteria | 35915 |
| 53 | Ga0070660_100019914 | 3300005339 | Bacteria | 4923 |
| 54 | Ga0070660_100030071 | 3300005339 | Bacteria | 4072 |
| 55 | Ga0070660_100060582 | 3300005339 | Bacteria | 2938 |
| 56 | Ga0070689_100026576 | 3300005340 | Bacteria | 4358 |
| 57 | Ga0070689_100043413 | 3300005340 | Bacteria | 3455 |
| 58 | Ga0070691_10006681 | 3300005341 | Bacteria | 5279 |
| 59 | Ga0070691_10113767 | 3300005341 | Bacteria | 1356 |
| 60 | Ga0070687_100000348 | 3300005343 | Bacteria | 15751 |
| 61 | Ga0070687_100026749 | 3300005343 | Bacteria | 2781 |
| 62 | Ga0070661_100000017 | 3300005344 | Bacteria | 153232 |
| 63 | Ga0070661_100011716 | 3300005344 | Bacteria | 6117 |
| 64 | Ga0070661_100048950 | 3300005344 | Bacteria | 3095 |
| 65 | Ga0070661_100102973 | 3300005344 | Bacteria | 2126 |
| 66 | Ga0070661_100148435 | 3300005344 | Bacteria | 1771 |
| 67 | Ga0070661_100212771 | 3300005344 | Bacteria | 1480 |
| 68 | Ga0070661_100290992 | 3300005344 | Bacteria | 1269 |
| 69 | Ga0070692_10000101 | 3300005345 | Bacteria | 19118 |
| 70 | Ga0070668_100003604 | 3300005347 | Bacteria | 11429 |
| 71 | Ga0070668_100004663 | 3300005347 | Bacteria | 10156 |
| 72 | Ga0070668_100017165 | 3300005347 | Bacteria | 5418 |
| 73 | Ga0070669_100000314 | 3300005353 | Bacteria | 37924 |
| 74 | Ga0070669_100001878 | 3300005353 | Bacteria | 15141 |
| 75 | Ga0070669_100010555 | 3300005353 | Bacteria | 6558 |
| 76 | Ga0070675_100000161 | 3300005354 | Bacteria | 40950 |
| 77 | Ga0070675_100009512 | 3300005354 | Bacteria | 7565 |
| 78 | Ga0070671_100000313 | 3300005355 | Bacteria | 32932 |
| 79 | Ga0070671_100053208 | 3300005355 | Bacteria | 3365 |
| 80 | Ga0070671_100116746 | 3300005355 | Bacteria | 2244 |
| 81 | Ga0070674_100001686 | 3300005356 | Bacteria | 11955 |
| 82 | Ga0070674_100006198 | 3300005356 | Bacteria | 6958 |
| 83 | Ga0070674_100099854 | 3300005356 | Bacteria | 2112 |
| 84 | Ga0070674_100243015 | 3300005356 | Bacteria | 1410 |
| 85 | Ga0070673_100000272 | 3300005364 | Bacteria | 26555 |
| 86 | Ga0070673_100006863 | 3300005364 | Bacteria | 7446 |
| 87 | Ga0070673_100012960 | 3300005364 | Bacteria | 5746 |
| 88 | Ga0070673_100091896 | 3300005364 | Bacteria | 2481 |
| 89 | Ga0070673_100344750 | 3300005364 | Bacteria | 1321 |
| 90 | Ga0070688_100000991 | 3300005365 | Bacteria | 14237 |
| 91 | Ga0070659_100006215 | 3300005366 | Bacteria | 8627 |
| 92 | Ga0070667_100021659 | 3300005367 | Bacteria | 5334 |
| 93 | Ga0070667_100024052 | 3300005367 | Bacteria | 5059 |
| 94 | Ga0070667_100187175 | 3300005367 | Bacteria | 1832 |
| 95 | Ga0070714_100030068 | 3300005435 | Bacteria | 4520 |
| 96 | Ga0070713_100008870 | 3300005436 | Bacteria | 7159 |
| 97 | Ga0070713_100052266 | 3300005436 | Bacteria | 3382 |
| 98 | Ga0070701_10000204 | 3300005438 | Bacteria | 18457 |
| 99 | Ga0070701_10211640 | 3300005438 | Bacteria | 1151 |
| 100 | Ga0070711_100053807 | 3300005439 | Bacteria | 2775 |
| 101 | Ga0070711_100082880 | 3300005439 | Bacteria | 2290 |
| 102 | Ga0070711_100177141 | 3300005439 | Bacteria | 1630 |
| 103 | Ga0070700_100000856 | 3300005441 | Bacteria | 15021 |
| 104 | Ga0070700_100017272 | 3300005441 | Bacteria | 4121 |
| 105 | Ga0070700_100098822 | 3300005441 | Bacteria | 1919 |
| 106 | Ga0070694_100002279 | 3300005444 | Bacteria | 11339 |
| 107 | Ga0070708_100142114 | 3300005445 | Bacteria | 2226 |
| 108 | Ga0070663_100000945 | 3300005455 | Bacteria | 15785 |
| 109 | Ga0070663_100087170 | 3300005455 | Bacteria | 2307 |
| 110 | Ga0070663_100181347 | 3300005455 | Bacteria | 1634 |
| 111 | Ga0070678_100002374 | 3300005456 | Bacteria | 10296 |
| 112 | Ga0070678_100006220 | 3300005456 | Bacteria | 6983 |
| 113 | Ga0070678_100111091 | 3300005456 | Bacteria | 2144 |
| 114 | Ga0070662_100003593 | 3300005457 | Bacteria | 9675 |
| 115 | Ga0070662_100004917 | 3300005457 | Bacteria | 8490 |
| 116 | Ga0070662_100011596 | 3300005457 | Bacteria | 5817 |
| 117 | Ga0070662_100015465 | 3300005457 | Bacteria | 5112 |
| 118 | Ga0070662_100031459 | 3300005457 | Bacteria | 3724 |
| 119 | Ga0070681_10038476 | 3300005458 | Bacteria | 4796 |
| 120 | Ga0070681_10049176 | 3300005458 | Bacteria | 4212 |
| 121 | Ga0068867_100002227 | 3300005459 | Bacteria | 13620 |
| 122 | Ga0068867_100029790 | 3300005459 | Bacteria | 3934 |
| 123 | Ga0068867_100044752 | 3300005459 | Bacteria | 3243 |
| 124 | Ga0068867_100148888 | 3300005459 | Bacteria | 1837 |
| 125 | Ga0068867_100159729 | 3300005459 | Bacteria | 1777 |
| 126 | Ga0070685_10031229 | 3300005466 | Bacteria | 2974 |
| 127 | Ga0070679_100002050 | 3300005530 | Bacteria | 18095 |
| 128 | Ga0070679_100021093 | 3300005530 | Bacteria | 6357 |
| 129 | Ga0070679_100100453 | 3300005530 | Bacteria | 2879 |
| 130 | Ga0070679_100171854 | 3300005530 | Bacteria | 2140 |
| 131 | Ga0070679_100267966 | 3300005530 | Bacteria | 1662 |
| 132 | Ga0070679_100419515 | 3300005530 | Bacteria | 1283 |
| 133 | Ga0070684_100000365 | 3300005535 | Bacteria | 31110 |
| 134 | Ga0070684_100031623 | 3300005535 | Bacteria | 4507 |
| 135 | Ga0070684_100190808 | 3300005535 | Bacteria | 1864 |
| 136 | Ga0068853_100000523 | 3300005539 | Bacteria | 25970 |
| 137 | Ga0068853_100001161 | 3300005539 | Bacteria | 18726 |
| 138 | Ga0068853_100005637 | 3300005539 | Bacteria | 9836 |
| 139 | Ga0068853_100051530 | 3300005539 | Bacteria | 3543 |
| 140 | Ga0068853_100065961 | 3300005539 | Bacteria | 3142 |
| 141 | Ga0068853_100198124 | 3300005539 | Bacteria | 1827 |
| 142 | Ga0070672_100000709 | 3300005543 | Bacteria | 19721 |
| 143 | Ga0070672_100003804 | 3300005543 | Bacteria | 9826 |
| 144 | Ga0070672_100033253 | 3300005543 | Bacteria | 3903 |
| 145 | Ga0070672_100067211 | 3300005543 | Bacteria | 2840 |
| 146 | Ga0070686_100007788 | 3300005544 | Bacteria | 5986 |
| 147 | Ga0070686_100279823 | 3300005544 | Bacteria | 1230 |
| 148 | Ga0070695_100001044 | 3300005545 | Bacteria | 15130 |
| 149 | Ga0070695_100148466 | 3300005545 | Bacteria | 1633 |
| 150 | Ga0070696_100021689 | 3300005546 | Bacteria | 4356 |
| 151 | Ga0070696_100134489 | 3300005546 | Bacteria | 1802 |
| 152 | Ga0070693_100000905 | 3300005547 | Bacteria | 13209 |
| 153 | Ga0070693_100022703 | 3300005547 | Bacteria | 3341 |
| 154 | Ga0070665_100041750 | 3300005548 | Bacteria | 4611 |
| 155 | Ga0070665_100064470 | 3300005548 | Bacteria | 3674 |
| 156 | Ga0070704_100017774 | 3300005549 | Bacteria | 4532 |
| 157 | Ga0070704_100216206 | 3300005549 | Bacteria | 1556 |
| 158 | Ga0068855_100011208 | 3300005563 | Bacteria | 10824 |
| 159 | Ga0068855_100040932 | 3300005563 | Bacteria | 5495 |
| 160 | Ga0068855_100166115 | 3300005563 | Bacteria | 2502 |
| 161 | Ga0070664_100002074 | 3300005564 | Bacteria | 16005 |
| 162 | Ga0070664_100155231 | 3300005564 | Bacteria | 2022 |
| 163 | Ga0068857_100050390 | 3300005577 | Bacteria | 3694 |
| 164 | Ga0068857_100461132 | 3300005577 | Bacteria | 1189 |
| 165 | Ga0068854_100000749 | 3300005578 | Bacteria | 19195 |
| 166 | Ga0068854_100006483 | 3300005578 | Bacteria | 7448 |
| 167 | Ga0068856_100000902 | 3300005614 | Bacteria | 31812 |
| 168 | Ga0068856_100039818 | 3300005614 | Bacteria | 4614 |
| 169 | Ga0068856_100174369 | 3300005614 | Bacteria | 2163 |
| 170 | Ga0068856_100203581 | 3300005614 | Bacteria | 1994 |
| 171 | Ga0070702_100002928 | 3300005615 | Bacteria | 7519 |
| 172 | Ga0068852_100002308 | 3300005616 | Bacteria | 13115 |
| 173 | Ga0068852_100015241 | 3300005616 | Bacteria | 5953 |
| 174 | Ga0068852_100026542 | 3300005616 | Bacteria | 4710 |
| 175 | Ga0068852_100048482 | 3300005616 | Bacteria | 3629 |
| 176 | Ga0068852_100050517 | 3300005616 | Bacteria | 3563 |
| 177 | Ga0068852_100070611 | 3300005616 | Bacteria | 3064 |
| 178 | Ga0068852_100212963 | 3300005616 | Bacteria | 1834 |
| 179 | Ga0068859_100008773 | 3300005617 | Bacteria | 10209 |
| 180 | Ga0068859_100085817 | 3300005617 | Bacteria | 3193 |
| 181 | Ga0068864_100000546 | 3300005618 | Bacteria | 32083 |
| 182 | Ga0068864_100000595 | 3300005618 | Bacteria | 30701 |
| 183 | Ga0068864_100030198 | 3300005618 | Bacteria | 4593 |
| 184 | Ga0068864_100032654 | 3300005618 | Bacteria | 4423 |
| 185 | Ga0068866_10001825 | 3300005718 | Bacteria | 8959 |
| 186 | Ga0068866_10002012 | 3300005718 | Bacteria | 8459 |
| 187 | Ga0068861_100000825 | 3300005719 | Bacteria | 18722 |
| 188 | Ga0068861_100001557 | 3300005719 | Bacteria | 14574 |
| 189 | Ga0068861_100003439 | 3300005719 | Bacteria | 10510 |
| 190 | Ga0068870_10000112 | 3300005840 | Bacteria | 27710 |
| 191 | Ga0068870_10211528 | 3300005840 | Bacteria | 1182 |
| 192 | Ga0068863_100000703 | 3300005841 | Bacteria | 33695 |
| 193 | Ga0068863_100006906 | 3300005841 | Bacteria | 11124 |
| 194 | Ga0068863_100507583 | 3300005841 | Bacteria | 1188 |
| 195 | Ga0068858_100002003 | 3300005842 | Bacteria | 20846 |
| 196 | Ga0068858_100008283 | 3300005842 | Bacteria | 9996 |
| 197 | Ga0068858_100228418 | 3300005842 | Bacteria | 1764 |
| 198 | Ga0068860_100006736 | 3300005843 | Bacteria | 11522 |
| 199 | Ga0068860_100007376 | 3300005843 | Bacteria | 10995 |
| 200 | Ga0068860_100023722 | 3300005843 | Bacteria | 5931 |
| 201 | Ga0068860_100049862 | 3300005843 | Bacteria | 3986 |
| 202 | Ga0068860_100174138 | 3300005843 | Bacteria | 2079 |
| 203 | Ga0068862_100006290 | 3300005844 | Bacteria | 9882 |
| 204 | Ga0068862_100146665 | 3300005844 | Bacteria | 2098 |
| 205 | Ga0068862_100170220 | 3300005844 | Bacteria | 1950 |
| 206 | Ga0081455_10000048 | 3300005937 | Bacteria | 126551 |
| 207 | Ga0081455_10003554 | 3300005937 | Bacteria | 17889 |
| 208 | Ga0081455_10021067 | 3300005937 | Bacteria | 6121 |
| 209 | Ga0081455_10102220 | 3300005937 | Bacteria | 2298 |
| 210 | Ga0081539_10007581 | 3300005985 | Bacteria | 9810 |
| 211 | Ga0070717_10220513 | 3300006028 | Bacteria | 1667 |
| 212 | Ga0075365_10036995 | 3300006038 | Bacteria | 3166 |
| 213 | Ga0075365_10037327 | 3300006038 | Bacteria | 3154 |
| 214 | Ga0075365_10199791 | 3300006038 | Bacteria | 1400 |
| 215 | Ga0075365_10277252 | 3300006038 | Bacteria | 1179 |
| 216 | Ga0075363_100013824 | 3300006048 | Bacteria | 3928 |
| 217 | Ga0075364_10007466 | 3300006051 | Bacteria | 6494 |
| 218 | Ga0070715_10068351 | 3300006163 | Bacteria | 1580 |
| 219 | Ga0070712_100019604 | 3300006175 | Bacteria | 4415 |
| 220 | Ga0075367_10005318 | 3300006178 | Bacteria | 6376 |
| 221 | Ga0075367_10043746 | 3300006178 | Bacteria | 2623 |
| 222 | Ga0075367_10117360 | 3300006178 | Bacteria | 1638 |
| 223 | Ga0075367_10256332 | 3300006178 | Bacteria | 1097 |
| 224 | Ga0075369_10004969 | 3300006186 | Bacteria | 4947 |
| 225 | Ga0075369_10051358 | 3300006186 | Bacteria | 1785 |
| 226 | Ga0075369_10084149 | 3300006186 | Bacteria | 1413 |
| 227 | Ga0097621_100000473 | 3300006237 | Bacteria | 28196 |
| 228 | Ga0097621_100003287 | 3300006237 | Bacteria | 11118 |
| 229 | Ga0097621_100006173 | 3300006237 | Bacteria | 8491 |
| 230 | Ga0097621_100047825 | 3300006237 | Bacteria | 3467 |
| 231 | Ga0097621_100058617 | 3300006237 | Bacteria | 3150 |
| 232 | Ga0075370_10005271 | 3300006353 | Bacteria | 6404 |
| 233 | Ga0068871_100000118 | 3300006358 | Bacteria | 49211 |
| 234 | Ga0075428_100028450 | 3300006844 | Bacteria | 6184 |
| 235 | Ga0075430_100000196 | 3300006846 | Bacteria | 40930 |
| 236 | Ga0075431_100001183 | 3300006847 | Bacteria | 23547 |
| 237 | Ga0075431_100109721 | 3300006847 | Bacteria | 2848 |
| 238 | Ga0075431_100311688 | 3300006847 | Bacteria | 1588 |
| 239 | Ga0075431_100387536 | 3300006847 | Bacteria | 1400 |
| 240 | Ga0075433_10000991 | 3300006852 | Bacteria | 20176 |
| 241 | Ga0075433_10037073 | 3300006852 | Bacteria | 4204 |
| 242 | Ga0075434_100001106 | 3300006871 | Bacteria | 22102 |
| 243 | Ga0075434_100013398 | 3300006871 | Bacteria | 7801 |
| 244 | Ga0075434_100028901 | 3300006871 | Bacteria | 5452 |
| 245 | Ga0075434_100047743 | 3300006871 | Bacteria | 4248 |
| 246 | Ga0075434_100060504 | 3300006871 | Bacteria | 3767 |
| 247 | Ga0075434_100090524 | 3300006871 | Bacteria | 3061 |
| 248 | Ga0075434_100315712 | 3300006871 | Bacteria | 1583 |
| 249 | Ga0068865_100051161 | 3300006881 | Bacteria | 2858 |
| 250 | Ga0068865_100110247 | 3300006881 | Bacteria | 2029 |
| 251 | Ga0097620_100008773 | 3300006931 | Bacteria | 10209 |
| 252 | Ga0097620_100085816 | 3300006931 | Bacteria | 3193 |
| 253 | Ga0075435_100066202 | 3300007076 | Bacteria | 2939 |
| 254 | Ga0105251_10027020 | 3300009011 | Bacteria | 2915 |
| 255 | Ga0105250_10045964 | 3300009092 | Bacteria | 1750 |
| 256 | Ga0105240_10064698 | 3300009093 | Bacteria | 4543 |
| 257 | Ga0105240_10079927 | 3300009093 | Bacteria | 4022 |
| 258 | Ga0105240_10087185 | 3300009093 | Bacteria | 3823 |
| 259 | Ga0105240_10558510 | 3300009093 | Bacteria | 1266 |
| 260 | Ga0111539_10000683 | 3300009094 | Bacteria | 43914 |
| 261 | Ga0111539_10001167 | 3300009094 | Bacteria | 34770 |
| 262 | Ga0111539_10004804 | 3300009094 | Bacteria | 17625 |
| 263 | Ga0111539_10485927 | 3300009094 | Bacteria | 1438 |
| 264 | Ga0105245_10001982 | 3300009098 | Bacteria | 18594 |
| 265 | Ga0105245_10308175 | 3300009098 | Bacteria | 1556 |
| 266 | Ga0105247_10015215 | 3300009101 | Bacteria | 4613 |
| 267 | Ga0105247_10028209 | 3300009101 | Bacteria | 3396 |
| 268 | Ga0114129_10036793 | 3300009147 | Bacteria | 6911 |
| 269 | Ga0114129_10194026 | 3300009147 | Bacteria | 2755 |
| 270 | Ga0114129_10743300 | 3300009147 | Bacteria | 1256 |
| 271 | Ga0105243_10002278 | 3300009148 | Bacteria | 16096 |
| 272 | Ga0105243_10015285 | 3300009148 | Bacteria | 5808 |
| 273 | Ga0105243_10085153 | 3300009148 | Bacteria | 2590 |
| 274 | Ga0105241_10003555 | 3300009174 | Bacteria | 11590 |
| 275 | Ga0105241_10470278 | 3300009174 | Bacteria | 1115 |
| 276 | Ga0105242_10001156 | 3300009176 | Bacteria | 20789 |
| 277 | Ga0105242_10029797 | 3300009176 | Bacteria | 4354 |
| 278 | Ga0105242_10083983 | 3300009176 | Bacteria | 2667 |
| 279 | Ga0105242_10258309 | 3300009176 | Bacteria | 1572 |
| 280 | Ga0105248_10020934 | 3300009177 | Bacteria | 7249 |
| 281 | Ga0105248_10278606 | 3300009177 | Bacteria | 1883 |
| 282 | Ga0105248_10294030 | 3300009177 | Bacteria | 1829 |
| 283 | Ga0105248_10395258 | 3300009177 | Bacteria | 1557 |
| 284 | Ga0105237_10005748 | 3300009545 | Bacteria | 13935 |
| 285 | Ga0105237_10041035 | 3300009545 | Bacteria | 4668 |
| 286 | Ga0105237_10072571 | 3300009545 | Bacteria | 3436 |
| 287 | Ga0105237_10202482 | 3300009545 | Bacteria | 1985 |
| 288 | Ga0105237_10414798 | 3300009545 | Bacteria | 1352 |
| 289 | Ga0105238_10007631 | 3300009551 | Bacteria | 10837 |
| 290 | Ga0105238_10053124 | 3300009551 | Bacteria | 4072 |
| 291 | Ga0105238_10068987 | 3300009551 | Bacteria | 3536 |
| 292 | Ga0105249_10001021 | 3300009553 | Bacteria | 24754 |
| 293 | Ga0105249_10006960 | 3300009553 | Bacteria | 9861 |
| 294 | Ga0105249_10041930 | 3300009553 | Bacteria | 4162 |
| 295 | Ga0105239_10008950 | 3300010375 | Bacteria | 11329 |
| 296 | Ga0105239_10010109 | 3300010375 | Bacteria | 10577 |
| 297 | Ga0105239_10046440 | 3300010375 | Bacteria | 4759 |
| 298 | Ga0105239_10083831 | 3300010375 | Bacteria | 3511 |
| 299 | Ga0105239_10136101 | 3300010375 | Bacteria | 2735 |
| 300 | Ga0105239_10170670 | 3300010375 | Bacteria | 2432 |
| 301 | Ga0105246_10003701 | 3300011119 | Bacteria | 9254 |
| 302 | Ga0105246_10254631 | 3300011119 | Bacteria | 1395 |
| 303 | Ga0157371_10031202 | 3300013102 | Bacteria | 3840 |
| 304 | Ga0157371_10060452 | 3300013102 | Bacteria | 2687 |
| 305 | Ga0157371_10093722 | 3300013102 | Bacteria | 2128 |
| 306 | Ga0157371_10192287 | 3300013102 | Bacteria | 1461 |
| 307 | Ga0157370_10090616 | 3300013104 | Bacteria | 2871 |
| 308 | Ga0157370_10287651 | 3300013104 | Bacteria | 1518 |
| 309 | Ga0157369_10014889 | 3300013105 | Bacteria | 8779 |
| 310 | Ga0157369_10290972 | 3300013105 | Bacteria | 1700 |
| 311 | Ga0157369_10618529 | 3300013105 | Bacteria | 1118 |
| 312 | Ga0157369_10768354 | 3300013105 | Bacteria | 991 |
| 313 | Ga0157374_10005306 | 3300013296 | Bacteria | 10823 |
| 314 | Ga0157374_10015941 | 3300013296 | Bacteria | 6602 |
| 315 | Ga0157378_10002986 | 3300013297 | Bacteria | 15027 |
| 316 | Ga0157378_10079081 | 3300013297 | Bacteria | 2968 |
| 317 | Ga0163162_10007593 | 3300013306 | Bacteria | 10554 |
| 318 | Ga0163162_10009522 | 3300013306 | Bacteria | 9448 |
| 319 | Ga0163162_10066320 | 3300013306 | Bacteria | 3658 |
| 320 | Ga0163162_10109954 | 3300013306 | Bacteria | 2853 |
| 321 | Ga0157372_10008348 | 3300013307 | Bacteria | 11015 |
| 322 | Ga0157372_10048370 | 3300013307 | Bacteria | 4727 |
| 323 | Ga0157372_10132943 | 3300013307 | Bacteria | 2864 |
| 324 | Ga0157375_10000508 | 3300013308 | Bacteria | 35108 |
| 325 | Ga0157375_10002379 | 3300013308 | Bacteria | 16278 |
| 326 | Ga0157375_10041288 | 3300013308 | Bacteria | 4453 |
| 327 | Ga0157375_10055341 | 3300013308 | Bacteria | 3911 |
| 328 | Ga0157375_10268905 | 3300013308 | Bacteria | 1867 |
| 329 | Ga0163163_10082125 | 3300014325 | Bacteria | 3226 |
| 330 | Ga0163163_10102744 | 3300014325 | Bacteria | 2882 |
| 331 | Ga0157380_10000212 | 3300014326 | Bacteria | 34358 |
| 332 | Ga0157380_10008734 | 3300014326 | Bacteria | 7241 |
| 333 | Ga0182008_10036668 | 3300014497 | Bacteria | 2453 |
| 334 | Ga0157377_10000287 | 3300014745 | Bacteria | 24040 |
| 335 | Ga0157379_10008690 | 3300014968 | Bacteria | 8847 |
| 336 | Ga0157379_10023266 | 3300014968 | Bacteria | 5496 |
| 337 | Ga0157379_10024668 | 3300014968 | Bacteria | 5337 |
| 338 | Ga0157379_10065966 | 3300014968 | Bacteria | 3236 |
| 339 | Ga0157379_10141716 | 3300014968 | Bacteria | 2167 |
| 340 | Ga0157376_10004642 | 3300014969 | Bacteria | 9575 |
| 341 | Ga0157376_10010411 | 3300014969 | Bacteria | 6803 |
| 342 | Ga0157376_10044552 | 3300014969 | Bacteria | 3648 |
| 343 | Ga0182006_1023464 | 3300015261 | Bacteria | 2555 |
| 344 | Ga0182007_10017175 | 3300015262 | Bacteria | 2651 |
| 345 | Ga0163161_10000415 | 3300017792 | Bacteria | 35797 |
| 346 | Ga0206353_10023203 | 3300020082 | Bacteria | 2965 |
| 347 | Ga0209026_1000041 | 3300025250 | Bacteria | 275745 |
| 348 | Ga0209148_1000069 | 3300025254 | Bacteria | 334444 |
| 349 | Ga0209759_1000183 | 3300025256 | Bacteria | 102218 |
| 350 | Ga0209233_1000030 | 3300025261 | Bacteria | 636702 |
| 351 | Ga0209233_1008564 | 3300025261 | Bacteria | 3154 |
| 352 | Ga0209233_1009332 | 3300025261 | Bacteria | 2991 |
| 353 | Ga0207666_1000073 | 3300025271 | Bacteria | 16742 |
| 354 | Ga0207666_1000396 | 3300025271 | Bacteria | 5740 |
| 355 | Ga0209455_1000161 | 3300025272 | Bacteria | 117353 |
| 356 | Ga0207673_1000295 | 3300025290 | Bacteria | 5011 |
| 357 | Ga0209758_1005328 | 3300025297 | Bacteria | 10011 |
| 358 | Ga0207697_10000061 | 3300025315 | Bacteria | 45271 |
| 359 | Ga0207697_10005956 | 3300025315 | Bacteria | 5594 |
| 360 | Ga0207696_1062241 | 3300025711 | Bacteria | 1048 |
| 361 | Ga0207653_10066499 | 3300025885 | Bacteria | 1225 |
| 362 | Ga0207682_10002961 | 3300025893 | Bacteria | 7454 |
| 363 | Ga0207682_10008495 | 3300025893 | Bacteria | 4059 |
| 364 | Ga0207682_10013203 | 3300025893 | Bacteria | 3220 |
| 365 | Ga0207642_10001238 | 3300025899 | Bacteria | 7906 |
| 366 | Ga0207642_10007466 | 3300025899 | Bacteria | 3696 |
| 367 | Ga0207642_10051660 | 3300025899 | Bacteria | 1861 |
| 368 | Ga0207710_10014209 | 3300025900 | Bacteria | 3355 |
| 369 | Ga0207710_10015430 | 3300025900 | Bacteria | 3228 |
| 370 | Ga0207688_10000001 | 3300025901 | Bacteria | 107505 |
| 371 | Ga0207688_10015574 | 3300025901 | Bacteria | 4122 |
| 372 | Ga0207688_10029501 | 3300025901 | Bacteria | 3020 |
| 373 | Ga0207688_10039415 | 3300025901 | Bacteria | 2624 |
| 374 | Ga0207680_10001817 | 3300025903 | Bacteria | 10043 |
| 375 | Ga0207680_10004563 | 3300025903 | Bacteria | 6577 |
| 376 | Ga0207680_10230206 | 3300025903 | Bacteria | 1274 |
| 377 | Ga0207647_10002852 | 3300025904 | Bacteria | 13027 |
| 378 | Ga0207647_10009210 | 3300025904 | Bacteria | 7025 |
| 379 | Ga0207647_10020047 | 3300025904 | Bacteria | 4488 |
| 380 | Ga0207685_10020978 | 3300025905 | Bacteria | 2181 |
| 381 | Ga0207685_10023072 | 3300025905 | Bacteria | 2113 |
| 382 | Ga0207645_10000222 | 3300025907 | Bacteria | 47139 |
| 383 | Ga0207645_10007540 | 3300025907 | Bacteria | 7676 |
| 384 | Ga0207643_10000009 | 3300025908 | Bacteria | 160496 |
| 385 | Ga0207643_10029264 | 3300025908 | Bacteria | 3063 |
| 386 | Ga0207705_10019295 | 3300025909 | Bacteria | 4875 |
| 387 | Ga0207705_10135527 | 3300025909 | Bacteria | 1835 |
| 388 | Ga0207654_10001390 | 3300025911 | Bacteria | 12824 |
| 389 | Ga0207654_10054567 | 3300025911 | Bacteria | 2310 |
| 390 | Ga0207707_10004174 | 3300025912 | Bacteria | 12795 |
| 391 | Ga0207707_10007205 | 3300025912 | Bacteria | 9680 |
| 392 | Ga0207707_10095845 | 3300025912 | Bacteria | 2593 |
| 393 | Ga0207707_10098046 | 3300025912 | Bacteria | 2562 |
| 394 | Ga0207695_10041473 | 3300025913 | Bacteria | 4927 |
| 395 | Ga0207695_10054337 | 3300025913 | Bacteria | 4183 |
| 396 | Ga0207671_10003241 | 3300025914 | Bacteria | 16375 |
| 397 | Ga0207671_10167142 | 3300025914 | Bacteria | 1706 |
| 398 | Ga0207671_10321818 | 3300025914 | Bacteria | 1224 |
| 399 | Ga0207693_10003519 | 3300025915 | Bacteria | 13369 |
| 400 | Ga0207693_10056703 | 3300025915 | Bacteria | 3071 |
| 401 | Ga0207663_10018683 | 3300025916 | Bacteria | 3891 |
| 402 | Ga0207663_10027568 | 3300025916 | Bacteria | 3313 |
| 403 | Ga0207663_10034887 | 3300025916 | Bacteria | 3013 |
| 404 | Ga0207663_10042477 | 3300025916 | Bacteria | 2777 |
| 405 | Ga0207660_10000197 | 3300025917 | Bacteria | 38486 |
| 406 | Ga0207660_10029243 | 3300025917 | Bacteria | 3777 |
| 407 | Ga0207660_10040842 | 3300025917 | Bacteria | 3249 |
| 408 | Ga0207660_10065669 | 3300025917 | Bacteria | 2623 |
| 409 | Ga0207662_10001861 | 3300025918 | Bacteria | 10377 |
| 410 | Ga0207662_10002878 | 3300025918 | Bacteria | 8720 |
| 411 | Ga0207662_10011648 | 3300025918 | Bacteria | 4885 |
| 412 | Ga0207657_10000776 | 3300025919 | Bacteria | 33868 |
| 413 | Ga0207657_10024538 | 3300025919 | Bacteria | 5577 |
| 414 | Ga0207657_10040737 | 3300025919 | Bacteria | 4113 |
| 415 | Ga0207657_10042331 | 3300025919 | Bacteria | 4020 |
| 416 | Ga0207657_10042811 | 3300025919 | Bacteria | 3992 |
| 417 | Ga0207657_10058761 | 3300025919 | Bacteria | 3308 |
| 418 | Ga0207657_10087807 | 3300025919 | Bacteria | 2601 |
| 419 | Ga0207657_10101928 | 3300025919 | Bacteria | 2381 |
| 420 | Ga0207649_10000052 | 3300025920 | Bacteria | 106800 |
| 421 | Ga0207649_10090569 | 3300025920 | Bacteria | 2002 |
| 422 | Ga0207649_10090776 | 3300025920 | Bacteria | 2000 |
| 423 | Ga0207652_10001438 | 3300025921 | Bacteria | 21098 |
| 424 | Ga0207652_10026866 | 3300025921 | Bacteria | 4797 |
| 425 | Ga0207652_10028531 | 3300025921 | Bacteria | 4657 |
| 426 | Ga0207652_10092441 | 3300025921 | Bacteria | 2661 |
| 427 | Ga0207681_10001008 | 3300025923 | Bacteria | 18376 |
| 428 | Ga0207681_10096122 | 3300025923 | Bacteria | 2126 |
| 429 | Ga0207694_10062975 | 3300025924 | Bacteria | 2888 |
| 430 | Ga0207650_10006131 | 3300025925 | Bacteria | 8190 |
| 431 | Ga0207650_10110205 | 3300025925 | Bacteria | 2130 |
| 432 | Ga0207659_10000132 | 3300025926 | Bacteria | 43798 |
| 433 | Ga0207659_10017260 | 3300025926 | Bacteria | 4712 |
| 434 | Ga0207659_10029958 | 3300025926 | Bacteria | 3713 |
| 435 | Ga0207659_10118645 | 3300025926 | Bacteria | 2024 |
| 436 | Ga0207687_10000174 | 3300025927 | Bacteria | 42351 |
| 437 | Ga0207687_10117028 | 3300025927 | Bacteria | 1988 |
| 438 | Ga0207700_10009939 | 3300025928 | Bacteria | 5974 |
| 439 | Ga0207700_10060096 | 3300025928 | Bacteria | 2877 |
| 440 | Ga0207700_10205857 | 3300025928 | Bacteria | 1660 |
| 441 | Ga0207664_10293125 | 3300025929 | Bacteria | 1430 |
| 442 | Ga0207644_10000212 | 3300025931 | Bacteria | 40175 |
| 443 | Ga0207644_10083949 | 3300025931 | Bacteria | 2360 |
| 444 | Ga0207644_10161389 | 3300025931 | Bacteria | 1742 |
| 445 | Ga0207690_10000148 | 3300025932 | Bacteria | 56244 |
| 446 | Ga0207690_10023203 | 3300025932 | Bacteria | 3870 |
| 447 | Ga0207706_10000788 | 3300025933 | Bacteria | 32791 |
| 448 | Ga0207706_10001360 | 3300025933 | Bacteria | 24441 |
| 449 | Ga0207706_10006177 | 3300025933 | Bacteria | 11123 |
| 450 | Ga0207706_10013452 | 3300025933 | Bacteria | 7437 |
| 451 | Ga0207706_10025201 | 3300025933 | Bacteria | 5332 |
| 452 | Ga0207706_10049341 | 3300025933 | Bacteria | 3720 |
| 453 | Ga0207686_10001289 | 3300025934 | Bacteria | 14380 |
| 454 | Ga0207686_10122465 | 3300025934 | Bacteria | 1772 |
| 455 | Ga0207686_10167481 | 3300025934 | Bacteria | 1546 |
| 456 | Ga0207709_10000530 | 3300025935 | Bacteria | 33097 |
| 457 | Ga0207709_10016430 | 3300025935 | Bacteria | 4114 |
| 458 | Ga0207709_10026603 | 3300025935 | Bacteria | 3325 |
| 459 | Ga0207670_10000523 | 3300025936 | Bacteria | 21171 |
| 460 | Ga0207670_10047836 | 3300025936 | Bacteria | 2851 |
| 461 | Ga0207670_10097235 | 3300025936 | Bacteria | 2095 |
| 462 | Ga0207669_10000857 | 3300025937 | Bacteria | 12949 |
| 463 | Ga0207669_10011343 | 3300025937 | Bacteria | 4331 |
| 464 | Ga0207669_10276148 | 3300025937 | Bacteria | 1265 |
| 465 | Ga0207704_10000198 | 3300025938 | Bacteria | 31182 |
| 466 | Ga0207665_10000273 | 3300025939 | Bacteria | 35752 |
| 467 | Ga0207665_10026454 | 3300025939 | Bacteria | 3829 |
| 468 | Ga0207691_10000517 | 3300025940 | Bacteria | 38398 |
| 469 | Ga0207691_10008786 | 3300025940 | Bacteria | 9690 |
| 470 | Ga0207691_10120748 | 3300025940 | Bacteria | 2323 |
| 471 | Ga0207691_10458060 | 3300025940 | Bacteria | 1085 |
| 472 | Ga0207711_10008997 | 3300025941 | Bacteria | 8349 |
| 473 | Ga0207711_10134794 | 3300025941 | Bacteria | 2217 |
| 474 | Ga0207711_10206302 | 3300025941 | Bacteria | 1795 |
| 475 | Ga0207711_10319028 | 3300025941 | Bacteria | 1436 |
| 476 | Ga0207689_10000031 | 3300025942 | Bacteria | 97131 |
| 477 | Ga0207689_10000358 | 3300025942 | Bacteria | 42928 |
| 478 | Ga0207689_10004425 | 3300025942 | Bacteria | 12751 |
| 479 | Ga0207661_10189859 | 3300025944 | Bacteria | 1801 |
| 480 | Ga0207679_10000183 | 3300025945 | Bacteria | 51645 |
| 481 | Ga0207679_10024542 | 3300025945 | Bacteria | 4135 |
| 482 | Ga0207679_10027807 | 3300025945 | Bacteria | 3917 |
| 483 | Ga0207679_10066848 | 3300025945 | Bacteria | 2695 |
| 484 | Ga0207679_10072670 | 3300025945 | Bacteria | 2599 |
| 485 | Ga0207679_10087436 | 3300025945 | Bacteria | 2400 |
| 486 | Ga0207679_10089341 | 3300025945 | Bacteria | 2378 |
| 487 | Ga0207679_10260355 | 3300025945 | Bacteria | 1479 |
| 488 | Ga0207667_10057690 | 3300025949 | Bacteria | 4074 |
| 489 | Ga0207667_10153953 | 3300025949 | Bacteria | 2366 |
| 490 | Ga0207667_10236604 | 3300025949 | Bacteria | 1869 |
| 491 | Ga0207651_10000051 | 3300025960 | Bacteria | 54163 |
| 492 | Ga0207651_10070958 | 3300025960 | Bacteria | 2467 |
| 493 | Ga0207712_10000738 | 3300025961 | Bacteria | 24767 |
| 494 | Ga0207712_10056531 | 3300025961 | Bacteria | 2765 |
| 495 | Ga0207668_10000664 | 3300025972 | Bacteria | 21087 |
| 496 | Ga0207668_10005924 | 3300025972 | Bacteria | 7203 |
| 497 | Ga0207668_10007445 | 3300025972 | Bacteria | 6511 |
| 498 | Ga0207668_10169535 | 3300025972 | Bacteria | 1711 |
| 499 | Ga0207640_10002152 | 3300025981 | Bacteria | 10584 |
| 500 | Ga0207658_10016338 | 3300025986 | Bacteria | 5104 |
| 501 | Ga0207658_10023034 | 3300025986 | Bacteria | 4342 |
| 502 | Ga0207658_10094760 | 3300025986 | Bacteria | 2324 |
| 503 | Ga0207658_10098984 | 3300025986 | Bacteria | 2280 |
| 504 | Ga0207677_10075252 | 3300026023 | Bacteria | 2399 |
| 505 | Ga0207677_10196088 | 3300026023 | Bacteria | 1601 |
| 506 | Ga0207703_10004462 | 3300026035 | Bacteria | 11493 |
| 507 | Ga0207703_10015159 | 3300026035 | Bacteria | 6015 |
| 508 | Ga0207703_10051485 | 3300026035 | Bacteria | 3337 |
| 509 | Ga0207703_10068565 | 3300026035 | Bacteria | 2923 |
| 510 | Ga0207703_10095892 | 3300026035 | Bacteria | 2503 |
| 511 | Ga0207703_10155946 | 3300026035 | Bacteria | 1995 |
| 512 | Ga0207703_10222027 | 3300026035 | Bacteria | 1690 |
| 513 | Ga0207639_10001257 | 3300026041 | Bacteria | 17164 |
| 514 | Ga0207639_10003583 | 3300026041 | Bacteria | 10427 |
| 515 | Ga0207639_10011340 | 3300026041 | Bacteria | 6186 |
| 516 | Ga0207639_10328023 | 3300026041 | Bacteria | 1361 |
| 517 | Ga0207678_10000531 | 3300026067 | Bacteria | 34761 |
| 518 | Ga0207678_10000889 | 3300026067 | Bacteria | 27495 |
| 519 | Ga0207678_10005685 | 3300026067 | Bacteria | 11142 |
| 520 | Ga0207678_10072422 | 3300026067 | Bacteria | 2953 |
| 521 | Ga0207708_10000573 | 3300026075 | Bacteria | 28465 |
| 522 | Ga0207708_10006283 | 3300026075 | Bacteria | 8804 |
| 523 | Ga0207702_10003284 | 3300026078 | Bacteria | 14915 |
| 524 | Ga0207702_10116321 | 3300026078 | Bacteria | 2386 |
| 525 | Ga0207702_10173574 | 3300026078 | Bacteria | 1979 |
| 526 | Ga0207641_10001041 | 3300026088 | Bacteria | 28118 |
| 527 | Ga0207641_10045137 | 3300026088 | Bacteria | 3709 |
| 528 | Ga0207648_10000581 | 3300026089 | Bacteria | 41019 |
| 529 | Ga0207648_10056497 | 3300026089 | Bacteria | 3425 |
| 530 | Ga0207648_10080415 | 3300026089 | Bacteria | 2843 |
| 531 | Ga0207648_10299183 | 3300026089 | Bacteria | 1443 |
| 532 | Ga0207676_10000124 | 3300026095 | Bacteria | 67747 |
| 533 | Ga0207676_10038983 | 3300026095 | Bacteria | 3631 |
| 534 | Ga0207676_10041569 | 3300026095 | Bacteria | 3530 |
| 535 | Ga0207676_10099964 | 3300026095 | Bacteria | 2402 |
| 536 | Ga0207674_10000095 | 3300026116 | Bacteria | 99278 |
| 537 | Ga0207674_10136790 | 3300026116 | Bacteria | 2411 |
| 538 | Ga0207675_100000414 | 3300026118 | Bacteria | 41042 |
| 539 | Ga0207675_100000774 | 3300026118 | Bacteria | 31932 |
| 540 | Ga0207675_100006890 | 3300026118 | Bacteria | 10763 |
| 541 | Ga0207675_100033910 | 3300026118 | Bacteria | 4757 |
| 542 | Ga0207683_10000242 | 3300026121 | Bacteria | 48576 |
| 543 | Ga0207683_10001174 | 3300026121 | Bacteria | 23704 |
| 544 | Ga0207683_10009390 | 3300026121 | Bacteria | 8332 |
| 545 | Ga0207683_10010671 | 3300026121 | Bacteria | 7829 |
| 546 | Ga0207683_10142415 | 3300026121 | Bacteria | 2161 |
| 547 | Ga0207683_10178426 | 3300026121 | Bacteria | 1925 |
| 548 | Ga0207698_10000951 | 3300026142 | Bacteria | 16837 |
| 549 | Ga0207698_10024205 | 3300026142 | Bacteria | 4257 |
| 550 | Ga0207698_10040475 | 3300026142 | Bacteria | 3464 |
| 551 | Ga0207698_10045410 | 3300026142 | Bacteria | 3310 |
| 552 | Ga0207698_10175166 | 3300026142 | Bacteria | 1893 |
| 553 | Ga0210002_1001450 | 3300027617 | Bacteria | 3346 |
| 554 | Ga0209983_1015293 | 3300027665 | Bacteria | 1582 |
| 555 | Ga0209966_1001052 | 3300027695 | Bacteria | 5088 |
| 556 | Ga0209998_10021989 | 3300027717 | Bacteria | 1373 |
| 557 | Ga0209974_10006235 | 3300027876 | Bacteria | 4171 |
| 558 | Ga0207428_10000037 | 3300027907 | Bacteria | 218857 |
| 559 | Ga0207428_10001217 | 3300027907 | Bacteria | 27628 |
| 560 | Ga0207428_10001773 | 3300027907 | Bacteria | 22109 |
| 561 | Ga0207428_10111969 | 3300027907 | Bacteria | 2100 |
| 562 | Ga0268266_10010785 | 3300028379 | Bacteria | 7962 |
| 563 | Ga0268266_10030986 | 3300028379 | Bacteria | 4542 |
| 564 | Ga0268266_10046350 | 3300028379 | Bacteria | 3722 |
| 565 | Ga0268265_10000757 | 3300028380 | Bacteria | 31383 |
| 566 | Ga0268265_10077792 | 3300028380 | Bacteria | 2607 |
| 567 | Ga0268265_10101042 | 3300028380 | Bacteria | 2329 |
| 568 | Ga0268264_10002331 | 3300028381 | Bacteria | 16789 |
| 569 | Ga0268264_10002813 | 3300028381 | Bacteria | 15201 |
| 570 | Ga0265337_1000827 | 3300028556 | Bacteria | 16247 |
| 571 | Ga0265325_10000049 | 3300031241 | Bacteria | 80854 |
| 572 | Ga0265325_10000449 | 3300031241 | Bacteria | 29667 |
| 573 | Ga0265325_10146745 | 3300031241 | Bacteria | 1118 |
| 574 | Ga0265339_10010187 | 3300031249 | Bacteria | 5852 |
| 575 | Ga0265316_10096444 | 3300031344 | Bacteria | 2252 |
| 576 | Ga0265316_10171026 | 3300031344 | Bacteria | 1621 |
| 577 | Ga0265313_10000367 | 3300031595 | Bacteria | 48929 |
| 578 | Ga0265313_10003967 | 3300031595 | Bacteria | 11626 |
| 579 | Ga0265313_10015742 | 3300031595 | Bacteria | 4383 |
| 580 | Ga0265342_10000677 | 3300031712 | Bacteria | 35579 |
| 581 | Ga0307516_10050383 | 3300031730 | Bacteria | 4086 |
| 582 | Ga0307416_100010572 | 3300032002 | Bacteria | 6105 |
| 583 | Ga0307416_100105843 | 3300032002 | Bacteria | 2464 |
| 584 | Ga0307414_10082841 | 3300032004 | Bacteria | 2353 |
| 585 | Ga0307414_10179314 | 3300032004 | Bacteria | 1702 |
| 586 | Ga0307415_100002198 | 3300032126 | Bacteria | 9657 |
| 587 | Ga0316583_10000628 | 3300032133 | Bacteria | 10789 |
| 588 | Ga0373930_0000371 | 3300034816 | Bacteria | 5868 |
| 589 | Ga0373948_0000135 | 3300034817 | Bacteria | 7792 |
| 590 | Ga0373948_0011654 | 3300034817 | Bacteria | 1559 |
| 591 | Ga0373950_0000327 | 3300034818 | Bacteria | 5972 |
| 592 | Ga0373950_0008917 | 3300034818 | Bacteria | 1589 |
| 593 | Ga0373958_0000084 | 3300034819 | Bacteria | 9758 |
| 594 | Ga0373958_0001069 | 3300034819 | Bacteria | 3596 |
| 595 | Ga0373958_0007148 | 3300034819 | Bacteria | 1767 |
| 596 | Ga0373958_0008916 | 3300034819 | Bacteria | 1639 |
| 597 | Ga0373938_0000013 | 3300034957 | Bacteria | 24269 |
| 598 | Ga0373928_0001053 | 3300035084 | Bacteria | 5442 |
| 599 | Ga0373928_0013678 | 3300035084 | Bacteria | 1631 |
| 600 | Ga0373934_0020165 | 3300035086 | Bacteria | 2562 |
| 601 | Ga0373940_0002191 | 3300035088 | Bacteria | 3746 |
| 602 | Ga0373949_0001199 | 3300035090 | Bacteria | 7686 |
| 603 | Ga0373949_0001274 | 3300035090 | Bacteria | 7344 |
| 604 | Ga0373952_0000880 | 3300035092 | Bacteria | 5466 |
| 605 | Ga0373952_0008037 | 3300035092 | Bacteria | 1992 |
| 606 | Ga0373923_0001378 | 3300035111 | Bacteria | 6932 |
| 607 | Ga0373932_0001840 | 3300035112 | Bacteria | 5677 |
| 608 | Ga0373939_0001777 | 3300035114 | Bacteria | 5188 |
| 609 | Ga0373941_0000125 | 3300035115 | Bacteria | 13305 |
| 610 | Ga0373941_0002154 | 3300035115 | Bacteria | 4294 |
| 611 | Ga0373941_0009277 | 3300035115 | Bacteria | 2473 |
| 612 | Ga0373953_0005292 | 3300035117 | Bacteria | 4176 |
| 613 | Ga0373956_0004976 | 3300035119 | Bacteria | 5327 |
| 614 | Ga0373957_0028363 | 3300035120 | Bacteria | 2039 |
| 615 | Ga0373960_0006378 | 3300035121 | Bacteria | 2766 |
| 616 | Ga0373943_0059752 | 3300035170 | Bacteria | 1901 |
| 617 | Ga0373946_0063744 | 3300035171 | Bacteria | 1575 |
| 618 | Ga0373955_0009608 | 3300035172 | Bacteria | 4539 |
| 619 | Ga0373942_0008302 | 3300035207 | Bacteria | 2420 |
| 620 | Ga0373961_0000638 | 3300035241 | Bacteria | 12665 |
| 621 | Ga0373961_0016882 | 3300035241 | Bacteria | 1885 |
| 622 | Ga0373962_0000542 | 3300035242 | Bacteria | 8470 |
| 623 | Ga0373962_0000610 | 3300035242 | Bacteria | 8072 |
| 624 | Ga0373924_0170015 | 3300035410 | Bacteria | 958 |
| 625 | Ga0373931_0001856 | 3300035691 | Bacteria | 9202 |
| 626 | Ga0373931_0002178 | 3300035691 | Bacteria | 8639 |
| 627 | Ga0373931_0062411 | 3300035691 | Bacteria | 2012 |
| 628 | Ga0373931_0098181 | 3300035691 | Bacteria | 1643 |
| 629 | Ga0373935_0015566 | 3300035692 | Bacteria | 4598 |
| 630 | Ga0373927_0000951 | 3300035695 | Bacteria | 22059 |
| 631 | Ga0373927_0186281 | 3300035695 | Bacteria | 1362 |
| 632 | Ga0373933_0003247 | 3300035724 | Bacteria | 9080 |
| 633 | Ga0373933_0011036 | 3300035724 | Bacteria | 4964 |
| 634 | Ga0373947_0001613 | 3300035725 | Bacteria | 13832 |
| 635 | Ga0373947_0053957 | 3300035725 | Bacteria | 2425 |
| 636 | Ga0373947_0116294 | 3300035725 | Bacteria | 1696 |
| 637 | Ga0373937_0003502 | 3300036401 | Bacteria | 13198 |
| 638 | Ga0373937_0070411 | 3300036401 | Bacteria | 3226 |
| 639 | Ga0373937_0073217 | 3300036401 | Bacteria | 3160 |
| 640 | Ga0373937_0361944 | 3300036401 | Bacteria | 1375 |
| 641 | Ga0373925_0004688 | 3300037068 | Bacteria | 10316 |
| 642 | Ga0373925_0063632 | 3300037068 | Bacteria | 2776 |
| 643 | Ga0373925_0094420 | 3300037068 | Bacteria | 2290 |
| 644 | Ga0395900_0017348 | 3300037418 | Bacteria | 7350 |
| 645 | Ga0395898_0006718 | 3300037466 | Bacteria | 12266 |
| 646 | Ga0395898_0014233 | 3300037466 | Bacteria | 8177 |
| 647 | Ga0395898_0075499 | 3300037466 | Bacteria | 3256 |
| 648 | Ga0395905_0003688 | 3300037471 | Bacteria | 16210 |
| 649 | Ga0395905_0105739 | 3300037471 | Bacteria | 2643 |
| 650 | Ga0395905_0124190 | 3300037471 | Bacteria | 2427 |
| 651 | Ga0395901_0022367 | 3300038443 | Bacteria | 6478 |
| 652 | Ga0395901_0097496 | 3300038443 | Bacteria | 3082 |
| 653 | Ga0395901_0268937 | 3300038443 | Bacteria | 1773 |
| 654 | Ga0242420_002459 | 3300038996 | Bacteria | 2643 |
| 655 | Ga0439441_010371 | 3300042001 | Bacteria | 1561 |
| 656 | Ga0439463_025969 | 3300042016 | Bacteria | 1471 |
| 657 | Ga0439464_0036453 | 3300042439 | Bacteria | 1391 |
| 658 | Ga0466972_0015182 | 3300044658 | Bacteria | 3850 |
| 659 | Ga0466965_0107678 | 3300044683 | Bacteria | 1430 |
| 660 | Ga0466963_0006183 | 3300044694 | Bacteria | 7068 |
| 661 | Ga0453684_0117665 | 3300044712 | Bacteria | 3216 |
| 662 | Ga0466968_0175285 | 3300044735 | Unclassified | 995 |
| 663 | Ga0466957_0082975 | 3300044842 | Bacteria | 1998 |
| 664 | Ga0466960_0026170 | 3300044901 | Bacteria | 2647 |
| 665 | Ga0451576_0006125 | 3300045051 | Bacteria | 14822 |
| 666 | Ga0466967_0146415 | 3300045976 | Bacteria | 2203 |
| 667 | Ga0495592_0063389 | 3300046454 | Bacteria | 2711 |
| 668 | Ga0495603_0073075 | 3300046455 | Bacteria | 2015 |
| 669 | Ga0495629_0016760 | 3300046459 | Bacteria | 5258 |
| 670 | Ga0495629_0027053 | 3300046459 | Bacteria | 4074 |
| 671 | Ga0495629_0046557 | 3300046459 | Bacteria | 3042 |
| 672 | Ga0495638_0085840 | 3300046460 | Bacteria | 1903 |
| 673 | Ga0495651_0001390 | 3300046462 | Bacteria | 18780 |
| 674 | Ga0495651_0003040 | 3300046462 | Bacteria | 12936 |
| 675 | Ga0495651_0037130 | 3300046462 | Bacteria | 3793 |
| 676 | Ga0495653_0002914 | 3300046463 | Bacteria | 13682 |
| 677 | Ga0495653_0025910 | 3300046463 | Bacteria | 4705 |
| 678 | Ga0495653_0237990 | 3300046463 | Bacteria | 1215 |
| 679 | Ga0495582_0012076 | 3300046473 | Bacteria | 4759 |
| 680 | Ga0495664_0050005 | 3300046477 | Bacteria | 2481 |
| 681 | Ga0495594_0085893 | 3300046499 | Bacteria | 1760 |
| 682 | Ga0495594_0105719 | 3300046499 | Bacteria | 1585 |
| 683 | Ga0495608_0002575 | 3300046511 | Bacteria | 13014 |
| 684 | Ga0495608_0049633 | 3300046511 | Bacteria | 2786 |
| 685 | Ga0495608_0188263 | 3300046511 | Bacteria | 1304 |
| 686 | Ga0495618_0033729 | 3300046514 | Bacteria | 3210 |
| 687 | Ga0495618_0199864 | 3300046514 | Bacteria | 1265 |
| 688 | Ga0495628_0018554 | 3300046516 | Bacteria | 5760 |
| 689 | Ga0495630_0011811 | 3300046517 | Bacteria | 6329 |
| 690 | Ga0495630_0381737 | 3300046517 | Bacteria | 1079 |
| 691 | Ga0495643_0001057 | 3300046522 | Bacteria | 27702 |
| 692 | Ga0495643_0037183 | 3300046522 | Bacteria | 2672 |
| 693 | Ga0495642_0099534 | 3300046528 | Bacteria | 1236 |
| 694 | Ga0495652_0017992 | 3300046529 | Bacteria | 6305 |
| 695 | Ga0495652_0114884 | 3300046529 | Bacteria | 2158 |
| 696 | Ga0495665_0008400 | 3300046531 | Bacteria | 5600 |
| 697 | Ga0495665_0051314 | 3300046531 | Bacteria | 2185 |
| 698 | Ga0495640_0004112 | 3300046533 | Bacteria | 11640 |
| 699 | Ga0495640_0016677 | 3300046533 | Bacteria | 5494 |
| 700 | Ga0495640_0178579 | 3300046533 | Bacteria | 1354 |
| 701 | Ga0495586_0013941 | 3300046535 | Bacteria | 4265 |
| 702 | Ga0495587_0000592 | 3300046536 | Bacteria | 24861 |
| 703 | Ga0495598_0034242 | 3300046537 | Bacteria | 1447 |
| 704 | Ga0495597_0009494 | 3300046542 | Bacteria | 4802 |
| 705 | Ga0495645_0009188 | 3300046543 | Bacteria | 6907 |
| 706 | Ga0495633_0000840 | 3300046558 | Bacteria | 27053 |
| 707 | Ga0495667_0015047 | 3300046559 | Bacteria | 5222 |
| 708 | Ga0495667_0066259 | 3300046559 | Bacteria | 2361 |
| 709 | Ga0495667_0131527 | 3300046559 | Bacteria | 1614 |
| 710 | Ga0495668_0035104 | 3300046616 | Bacteria | 2810 |
| 711 | Ga0495668_0069815 | 3300046616 | Bacteria | 1932 |
| 712 | Ga0495625_0257737 | 3300046660 | Bacteria | 1130 |
| 713 | Ga0495625_0285823 | 3300046660 | Bacteria | 1060 |
| 714 | Ga0495635_0089136 | 3300046663 | Bacteria | 2110 |
| 715 | Ga0495661_0009254 | 3300046665 | Bacteria | 6767 |
| 716 | Ga0495657_0034526 | 3300046675 | Bacteria | 3512 |
| 717 | Ga0495657_0044791 | 3300046675 | Bacteria | 3007 |
| 718 | Ga0495657_0115655 | 3300046675 | Bacteria | 1694 |
| 719 | Ga0495623_0000569 | 3300046679 | Bacteria | 24558 |
| 720 | Ga0495623_0028202 | 3300046679 | Bacteria | 3612 |
| 721 | Ga0495623_0120930 | 3300046679 | Bacteria | 1576 |
| 722 | Ga0495646_0013966 | 3300046680 | Bacteria | 5103 |
| 723 | Ga0495646_0069877 | 3300046680 | Bacteria | 2070 |
| 724 | Ga0495646_0072760 | 3300046680 | Bacteria | 2021 |
| 725 | Ga0495647_0025500 | 3300046681 | Bacteria | 2160 |
| 726 | Ga0495658_0001364 | 3300046683 | Bacteria | 12807 |
| 727 | Ga0495658_0009773 | 3300046683 | Bacteria | 4783 |
| 728 | Ga0495669_0007219 | 3300046684 | Bacteria | 4657 |
| 729 | Ga0495613_0093917 | 3300046689 | Bacteria | 2171 |
| 730 | Ga0495613_0133762 | 3300046689 | Bacteria | 1775 |
| 731 | Ga0495600_0021660 | 3300046809 | Bacteria | 4120 |
| 732 | Ga0495600_0162683 | 3300046809 | Bacteria | 1442 |
| 733 | Ga0495660_0048035 | 3300046810 | Bacteria | 2335 |
| 734 | Ga0495581_0075165 | 3300047315 | Bacteria | 1955 |
| 735 | Ga0495604_0015813 | 3300047317 | Bacteria | 6022 |
| 736 | Ga0495604_0126039 | 3300047317 | Bacteria | 1846 |
| 737 | Ga0495674_0060491 | 3300047319 | Bacteria | 3305 |
| 738 | Ga0495674_0091058 | 3300047319 | Bacteria | 2605 |
| 739 | Ga0495674_0183316 | 3300047319 | Bacteria | 1742 |
| 740 | Ga0495676_0078385 | 3300047321 | Bacteria | 2516 |
| 741 | Ga0495680_0013849 | 3300047322 | Bacteria | 7016 |
| 742 | Ga0495680_0016164 | 3300047322 | Bacteria | 6416 |
| 743 | Ga0495680_0017538 | 3300047322 | Bacteria | 6108 |
| 744 | Ga0495675_0000815 | 3300047444 | Bacteria | 19215 |
| 745 | Ga0495675_0125243 | 3300047444 | Bacteria | 1599 |
| 746 | Ga0495684_0013859 | 3300047471 | Bacteria | 6201 |
| 747 | Ga0495684_0067831 | 3300047471 | Bacteria | 2713 |
| 748 | Ga0495602_0075852 | 3300048088 | Bacteria | 2852 |
| 749 | Ga0495614_0011254 | 3300048089 | Bacteria | 3937 |
| 750 | Ga0495615_0026860 | 3300048090 | Bacteria | 1347 |
| 751 | Ga0496100_0000345 | 3300048903 | Bacteria | 22686 |
| 752 | Ga0496100_0009503 | 3300048903 | Bacteria | 5464 |
| 753 | Ga0496101_0000866 | 3300048904 | Bacteria | 17903 |
| 754 | Ga0496101_0082414 | 3300048904 | Bacteria | 2380 |
| 755 | Ga0496102_0001833 | 3300048905 | Bacteria | 18355 |
| 756 | Ga0496102_0009757 | 3300048905 | Bacteria | 8255 |
| 757 | Ga0496102_0149148 | 3300048905 | Bacteria | 2196 |
| 758 | Ga0496102_0152829 | 3300048905 | Bacteria | 2169 |
| 759 | Ga0496103_0001022 | 3300048906 | Bacteria | 19583 |
| 760 | Ga0496103_0011074 | 3300048906 | Bacteria | 5341 |
| 761 | Ga0496103_0114002 | 3300048906 | Bacteria | 1718 |
| 762 | Ga0496103_0139041 | 3300048906 | Bacteria | 1552 |
| 763 | Ga0496103_0273803 | 3300048906 | Bacteria | 1086 |
| 764 | Ga0496104_0000399 | 3300048907 | Bacteria | 38066 |
| 765 | Ga0496104_0019547 | 3300048907 | Bacteria | 6200 |
| 766 | Ga0496104_0072995 | 3300048907 | Bacteria | 3264 |
| 767 | Ga0496104_0090384 | 3300048907 | Bacteria | 2925 |
| 768 | Ga0496104_0183110 | 3300048907 | Bacteria | 2005 |
| 769 | Ga0496104_0525705 | 3300048907 | Bacteria | 1094 |
| 770 | Ga0496105_0007591 | 3300048908 | Bacteria | 8406 |
| 771 | Ga0496105_0277548 | 3300048908 | Bacteria | 1352 |
| 772 | Ga0496106_0002528 | 3300048909 | Bacteria | 13620 |
| 773 | Ga0496106_0011874 | 3300048909 | Bacteria | 6431 |
| 774 | Ga0496106_0046057 | 3300048909 | Bacteria | 3277 |
| 775 | Ga0496107_0013104 | 3300048910 | Bacteria | 5792 |
| 776 | Ga0496107_0045820 | 3300048910 | Bacteria | 3146 |
| 777 | Ga0496107_0155049 | 3300048910 | Bacteria | 1695 |
| 778 | Ga0496108_0006961 | 3300048911 | Bacteria | 9152 |
| 779 | Ga0496108_0107612 | 3300048911 | Bacteria | 2381 |
| 780 | Ga0496108_0153348 | 3300048911 | Bacteria | 1988 |
| 781 | Ga0496108_0179411 | 3300048911 | Bacteria | 1833 |
| 782 | Ga0496108_0195394 | 3300048911 | Bacteria | 1754 |
| 783 | Ga0496108_0227434 | 3300048911 | Bacteria | 1621 |
| 784 | Ga0496108_0308844 | 3300048911 | Bacteria | 1378 |
| 785 | Ga0496109_0000086 | 3300048912 | Bacteria | 95253 |
| 786 | Ga0496109_0002193 | 3300048912 | Bacteria | 16208 |
| 787 | Ga0496109_0002269 | 3300048912 | Bacteria | 15980 |
| 788 | Ga0496109_0062339 | 3300048912 | Bacteria | 3409 |
| 789 | Ga0496109_0068652 | 3300048912 | Bacteria | 3248 |
| 790 | Ga0496109_0189441 | 3300048912 | Bacteria | 1933 |
| 791 | Ga0496109_0309053 | 3300048912 | Bacteria | 1491 |
| 792 | Ga0496110_0011525 | 3300048913 | Bacteria | 7242 |
| 793 | Ga0496110_0026044 | 3300048913 | Bacteria | 5001 |
| 794 | Ga0496110_0142283 | 3300048913 | Bacteria | 2168 |
| 795 | Ga0496110_0192968 | 3300048913 | Bacteria | 1849 |
| 796 | Ga0496111_0067217 | 3300048914 | Bacteria | 2604 |
| 797 | Ga0496111_0193652 | 3300048914 | Bacteria | 1511 |
| 798 | Ga0496111_0309637 | 3300048914 | Bacteria | 1170 |
| 799 | Ga0496112_0003327 | 3300048915 | Bacteria | 13267 |
| 800 | Ga0496112_0033949 | 3300048915 | Bacteria | 4963 |
| 801 | Ga0496112_0213360 | 3300048915 | Bacteria | 1887 |
| 802 | Ga0496112_0238048 | 3300048915 | Bacteria | 1773 |
| 803 | Ga0496112_0268323 | 3300048915 | Bacteria | 1655 |
| 804 | Ga0496113_0003576 | 3300048916 | Bacteria | 9327 |
| 805 | Ga0496113_0324098 | 3300048916 | Bacteria | 1235 |
| 806 | Ga0496114_0019405 | 3300048917 | Bacteria | 5508 |
| 807 | Ga0496114_0027893 | 3300048917 | Bacteria | 4628 |
| 808 | Ga0496114_0047784 | 3300048917 | Bacteria | 3559 |
| 809 | Ga0496114_0093376 | 3300048917 | Bacteria | 2558 |
| 810 | Ga0496114_0102844 | 3300048917 | Bacteria | 2441 |
| 811 | Ga0496115_0000967 | 3300048918 | Bacteria | 20862 |
| 812 | Ga0496115_0012638 | 3300048918 | Bacteria | 6362 |
| 813 | Ga0496115_0020459 | 3300048918 | Bacteria | 5106 |
| 814 | Ga0496115_0171791 | 3300048918 | Bacteria | 1792 |
| 815 | Ga0496115_0520116 | 3300048918 | Bacteria | 954 |
| 816 | Ga0496117_0203750 | 3300048920 | Bacteria | 1116 |
| 817 | Ga0496120_0002681 | 3300048923 | Bacteria | 17483 |
| 818 | Ga0496120_0053840 | 3300048923 | Bacteria | 2284 |
| 819 | Ga0496122_0002952 | 3300048925 | Bacteria | 23182 |
| 820 | Ga0496123_0002116 | 3300048926 | Bacteria | 25471 |
| 821 | Ga0496126_0010620 | 3300048929 | Bacteria | 9629 |
| 822 | Ga0501031_0000011 | 3300049568 | Bacteria | 142761 |
| 823 | Ga0501031_0006154 | 3300049568 | Bacteria | 7834 |
| 824 | Ga0501032_0000006 | 3300049569 | Bacteria | 261727 |
| 825 | Ga0501032_0000029 | 3300049569 | Bacteria | 130865 |
| 826 | Ga0501032_0063621 | 3300049569 | Bacteria | 2469 |
| 827 | Ga0501032_0070967 | 3300049569 | Bacteria | 2322 |
| 828 | Ga0501033_0000039 | 3300049570 | Bacteria | 142732 |
| 829 | Ga0501033_0000168 | 3300049570 | Bacteria | 62921 |
| 830 | Ga0501033_0011727 | 3300049570 | Bacteria | 6702 |
| 831 | Ga0501034_0000030 | 3300049571 | Bacteria | 248180 |
| 832 | Ga0501034_0000434 | 3300049571 | Bacteria | 69367 |
| 833 | Ga0501034_0011360 | 3300049571 | Bacteria | 9234 |
| 834 | Ga0501034_0021075 | 3300049571 | Bacteria | 6651 |
| 835 | Ga0501034_0135160 | 3300049571 | Bacteria | 2447 |
| 836 | Ga0501036_0000003 | 3300049572 | Bacteria | 261545 |
| 837 | Ga0501036_0000444 | 3300049572 | Bacteria | 29528 |
| 838 | Ga0501036_0000999 | 3300049572 | Bacteria | 21368 |
| 839 | Ga0501036_0011708 | 3300049572 | Bacteria | 7269 |
| 840 | Ga0501036_0238748 | 3300049572 | Bacteria | 1524 |
| 841 | Ga0501037_0000003 | 3300049573 | Bacteria | 261548 |
| 842 | Ga0501037_0000872 | 3300049573 | Bacteria | 22530 |
| 843 | Ga0501037_0025532 | 3300049573 | Bacteria | 4364 |
| 844 | Ga0501037_0104914 | 3300049573 | Bacteria | 2037 |
| 845 | Ga0501037_0134748 | 3300049573 | Bacteria | 1769 |
| 846 | Ga0501038_0000004 | 3300049574 | Bacteria | 261289 |
| 847 | Ga0501038_0000397 | 3300049574 | Bacteria | 37858 |
| 848 | Ga0501038_0064483 | 3300049574 | Bacteria | 3124 |
| 849 | Ga0501038_0069640 | 3300049574 | Bacteria | 2988 |
| 850 | Ga0501039_0000008 | 3300049575 | Bacteria | 274778 |
| 851 | Ga0501039_0000040 | 3300049575 | Bacteria | 115567 |
| 852 | Ga0501039_0017409 | 3300049575 | Bacteria | 5511 |
| 853 | Ga0501039_0020496 | 3300049575 | Bacteria | 5066 |
| 854 | Ga0501039_0228716 | 3300049575 | Bacteria | 1462 |
| 855 | Ga0501040_0021742 | 3300049576 | Bacteria | 4289 |
| 856 | Ga0501040_0066210 | 3300049576 | Bacteria | 2489 |
| 857 | Ga0501042_0280874 | 3300049578 | Bacteria | 1202 |
| 858 | Ga0501043_0000177 | 3300049579 | Bacteria | 56981 |
| 859 | Ga0501043_0000560 | 3300049579 | Bacteria | 33338 |
| 860 | Ga0501043_0056663 | 3300049579 | Bacteria | 3078 |
| 861 | Ga0501043_0085563 | 3300049579 | Bacteria | 2477 |
| 862 | Ga0501046_0027824 | 3300049580 | Bacteria | 4608 |
| 863 | Ga0501046_0029478 | 3300049580 | Bacteria | 4460 |
| 864 | Ga0501046_0042624 | 3300049580 | Bacteria | 3618 |
| 865 | Ga0501046_0055891 | 3300049580 | Bacteria | 3099 |
| 866 | Ga0501046_0113288 | 3300049580 | Bacteria | 2070 |
| 867 | Ga0501047_0000235 | 3300049581 | Bacteria | 65603 |
| 868 | Ga0501047_0002232 | 3300049581 | Bacteria | 18536 |
| 869 | Ga0501047_0013069 | 3300049581 | Bacteria | 7863 |
| 870 | Ga0501047_0028366 | 3300049581 | Bacteria | 5395 |
| 871 | Ga0501047_0080796 | 3300049581 | Bacteria | 3125 |
| 872 | Ga0501047_0085667 | 3300049581 | Bacteria | 3027 |
| 873 | Ga0501047_0086031 | 3300049581 | Bacteria | 3020 |
| 874 | Ga0501048_0001478 | 3300049582 | Bacteria | 17828 |
| 875 | Ga0501048_0018257 | 3300049582 | Bacteria | 5160 |
| 876 | Ga0501048_0184007 | 3300049582 | Bacteria | 1481 |
| 877 | Ga0501067_0107194 | 3300049583 | Bacteria | 1553 |
| 878 | Ga0501068_0008698 | 3300049584 | Bacteria | 5661 |
| 879 | Ga0501069_0031216 | 3300049585 | Bacteria | 2929 |
| 880 | Ga0501070_0003834 | 3300049586 | Bacteria | 12978 |
| 881 | Ga0501070_0006925 | 3300049586 | Bacteria | 9649 |
| 882 | Ga0501070_0016166 | 3300049586 | Bacteria | 6270 |
| 883 | Ga0501070_0054553 | 3300049586 | Bacteria | 3314 |
| 884 | Ga0501070_0079535 | 3300049586 | Bacteria | 2713 |
| 885 | Ga0501070_0087292 | 3300049586 | Bacteria | 2582 |
| 886 | Ga0501070_0216481 | 3300049586 | Bacteria | 1571 |
| 887 | Ga0501070_0291310 | 3300049586 | Bacteria | 1330 |
| 888 | Ga0501071_0056645 | 3300049587 | Bacteria | 2832 |
| 889 | Ga0501071_0091436 | 3300049587 | Bacteria | 2235 |
| 890 | Ga0501072_0122600 | 3300049588 | Bacteria | 2071 |
| 891 | Ga0501073_0095188 | 3300049589 | Bacteria | 2068 |
| 892 | Ga0501074_0015817 | 3300049590 | Bacteria | 5486 |
| 893 | Ga0501074_0080424 | 3300049590 | Bacteria | 2338 |
| 894 | Ga0501074_0116677 | 3300049590 | Bacteria | 1910 |
| 895 | Ga0501079_0400073 | 3300049741 | Bacteria | 1077 |
| 896 | Ga0501080_0001954 | 3300049742 | Bacteria | 17798 |
| 897 | Ga0501080_0028000 | 3300049742 | Bacteria | 5240 |
| 898 | Ga0501080_0189677 | 3300049742 | Bacteria | 1889 |
| 899 | Ga0501083_0003735 | 3300049744 | Bacteria | 10694 |
| 900 | Ga0501083_0034611 | 3300049744 | Bacteria | 3453 |
| 901 | Ga0501083_0048003 | 3300049744 | Bacteria | 2883 |
| 902 | Ga0501035_0000112 | 3300049822 | Bacteria | 99138 |
| 903 | Ga0501035_0000144 | 3300049822 | Bacteria | 86257 |
| 904 | Ga0501035_0001116 | 3300049822 | Bacteria | 28096 |
| 905 | Ga0501035_0017005 | 3300049822 | Bacteria | 6702 |
| 906 | Ga0501035_0024179 | 3300049822 | Bacteria | 5572 |
| 907 | Ga0501035_0203969 | 3300049822 | Bacteria | 1694 |
| 908 | Ga0501035_0226799 | 3300049822 | Bacteria | 1593 |
| 909 | Ga0501044_0000008 | 3300049823 | Bacteria | 274778 |
| 910 | Ga0501044_0005687 | 3300049823 | Bacteria | 13819 |
| 911 | Ga0501044_0005957 | 3300049823 | Bacteria | 13490 |
| 912 | Ga0501044_0022594 | 3300049823 | Bacteria | 6702 |
| 913 | Ga0501044_0061369 | 3300049823 | Bacteria | 3846 |
| 914 | Ga0501044_0072080 | 3300049823 | Bacteria | 3513 |
| 915 | Ga0501044_0137971 | 3300049823 | Bacteria | 2428 |
| 916 | nmdc:mga00v17_5132_c1 | 3300050491 | Bacteria | 4712 |
| 917 | nmdc:mga0yw44_1475_c1 | 3300050492 | Bacteria | 9373 |
| 918 | nmdc:mga0yw44_16078_c1 | 3300050492 | Bacteria | 4032 |
| 919 | nmdc:mga0yw44_186545_c1 | 3300050492 | Bacteria | 1367 |
| 920 | nmdc:mga06z11_276429_c1 | 3300050494 | Bacteria | 994 |
| 921 | nmdc:mga06z11_28859_c1 | 3300050494 | Bacteria | 2666 |
| 922 | nmdc:mga07m45_14713_c1 | 3300050496 | Bacteria | 4175 |
| 923 | nmdc:mga07m45_147922_c1 | 3300050496 | Bacteria | 1362 |
| 924 | nmdc:mga05p37_11291_c1 | 3300050507 | Bacteria | 10625 |
| 925 | nmdc:mga05p37_1975_c1 | 3300050507 | Bacteria | 23914 |
| 926 | nmdc:mga05p37_43110_c1 | 3300050507 | Bacteria | 5549 |
| 927 | nmdc:mga05p37_540205_c1 | 3300050507 | Bacteria | 1329 |
| 928 | nmdc:mga09592_1638_c1 | 3300050508 | Bacteria | 18033 |
| 929 | nmdc:mga09592_183144_c1 | 3300050508 | Bacteria | 1812 |
| 930 | nmdc:mga0qj67_969_c1 | 3300050509 | Bacteria | 19753 |
| 931 | nmdc:mga06r32_47690_c1 | 3300050510 | Bacteria | 4093 |
| 932 | nmdc:mga06r32_5519_c1 | 3300050510 | Bacteria | 11399 |
| 933 | nmdc:mga06r32_638_c1 | 3300050510 | Bacteria | 30472 |
| 934 | nmdc:mga08y16_13712_c1 | 3300050511 | Bacteria | 8533 |
| 935 | nmdc:mga08y16_16181_c1 | 3300050511 | Bacteria | 7841 |
| 936 | nmdc:mga08y16_333_c1 | 3300050511 | Bacteria | 42807 |
| 937 | nmdc:mga08y16_549_c1 | 3300050511 | Bacteria | 34756 |
| 938 | nmdc:mga0n895_110078_c1 | 3300050512 | Bacteria | 2770 |
| 939 | nmdc:mga0n895_1174_c1 | 3300050512 | Bacteria | 19193 |
| 940 | nmdc:mga0n895_230391_c1 | 3300050512 | Bacteria | 1880 |
| 941 | nmdc:mga0n895_233805_c1 | 3300050512 | Bacteria | 1865 |
| 942 | nmdc:mga0n895_45441_c1 | 3300050512 | Bacteria | 4286 |
| 943 | nmdc:mga0n895_807_c1 | 3300050512 | Bacteria | 22393 |
| 944 | nmdc:mga0n895_86938_c1 | 3300050512 | Bacteria | 3123 |
| 945 | nmdc:mga0n895_97850_c1 | 3300050512 | Bacteria | 2940 |
| 946 | nmdc:mga0rr50_108639_c1 | 3300050513 | Bacteria | 2192 |
| 947 | nmdc:mga0rr50_135891_c1 | 3300050513 | Bacteria | 1973 |
| 948 | nmdc:mga0rr50_2201_c1 | 3300050513 | Bacteria | 10932 |
| 949 | nmdc:mga0a205_42015_c1 | 3300050515 | Bacteria | 4405 |
| 950 | nmdc:mga0a205_53174_c1 | 3300050515 | Bacteria | 3908 |
| 951 | nmdc:mga0a205_745_c1 | 3300050515 | Bacteria | 26246 |
| 952 | nmdc:mga0sz30_25203_c1 | 3300050516 | Bacteria | 2432 |
| 953 | Ga0495601_0001138 | 3300053077 | Bacteria | 14570 |
| 954 | Ga0495601_0004969 | 3300053077 | Bacteria | 7717 |
| 955 | Ga0495601_0013085 | 3300053077 | Bacteria | 4987 |
| 956 | Ga0495612_0007560 | 3300053078 | Bacteria | 4441 |
| 957 | Ga0495612_0010175 | 3300053078 | Bacteria | 3804 |
| 958 | Ga0495612_0012061 | 3300053078 | Bacteria | 3481 |
| 959 | Ga0495612_0018057 | 3300053078 | Bacteria | 2823 |
| 960 | Ga0495612_0019860 | 3300053078 | Bacteria | 2692 |
| 961 | Ga0500610_0019799 | 3300053079 | Bacteria | 3275 |
| 962 | Ga0495655_0005186 | 3300053083 | Bacteria | 2286 |
| 963 | Ga0495595_0000967 | 3300053084 | Bacteria | 11043 |
| 964 | Ga0495595_0004707 | 3300053084 | Bacteria | 5490 |
| 965 | Ga0495595_0008594 | 3300053084 | Bacteria | 4199 |
| 966 | Ga0495619_0000349 | 3300053085 | Bacteria | 32210 |
| 967 | Ga0495619_0000430 | 3300053085 | Bacteria | 28482 |
| 968 | Ga0495619_0004620 | 3300053085 | Bacteria | 8778 |
| 969 | Ga0495619_0005118 | 3300053085 | Bacteria | 8322 |
| 970 | Ga0495619_0034792 | 3300053085 | Bacteria | 3275 |
| 971 | Ga0495619_0091252 | 3300053085 | Bacteria | 2062 |
| 972 | Ga0495619_0217143 | 3300053085 | Bacteria | 1324 |
| 973 | Ga0500643_008569 | 3300053087 | Bacteria | 4008 |
| 974 | Ga0500641_0010774 | 3300053096 | Bacteria | 3311 |
| 975 | Ga0500595_000016 | 3300053119 | Bacteria | 211397 |
| 976 | Ga0500595_026251 | 3300053119 | Bacteria | 2009 |
| 977 | Ga0500620_000454 | 3300053155 | Bacteria | 7381 |
| 978 | Ga0500620_001650 | 3300053155 | Bacteria | 4210 |
| 979 | Ga0500627_0015934 | 3300053158 | Bacteria | 2920 |
| 980 | Ga0500609_008607 | 3300053731 | Bacteria | 1377 |
| 981 | Ga0501082_0227623 | 3300060353 | Bacteria | 1623 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046675 | Ga0495657_0115655 | Ga0495657_0115655_901_1680 | 258 |
| 2 | iso_pu_bacteria | 2906427513 | 2906428389 | 261 |
| 3 | 3300032002 | Ga0307416_100010572 | Ga0307416_1000105725 | 264 |
| 4 | 3300032126 | Ga0307415_100002198 | Ga0307415_1000021987 | 264 |
| 5 | iso_pu_bacteria | 2881853255 | 2881859010 | 265 |
| 6 | iso_pu_bacteria | 2977828996 | 2977835763 | 266 |
| 7 | 3300005530 | Ga0070679_100267966 | Ga0070679_1002679662 | 269 |
| 8 | 3300025921 | Ga0207652_10026866 | Ga0207652_100268662 | 269 |
| 9 | 3300032004 | Ga0307414_10179314 | Ga0307414_101793142 | 270 |
| 10 | 3300005364 | Ga0070673_100344750 | Ga0070673_1003447501 | 272 |
| 11 | 3300005543 | Ga0070672_100067211 | Ga0070672_1000672112 | 272 |
| 12 | 3300025940 | Ga0207691_10458060 | Ga0207691_104580601 | 273 |
| 13 | iso_pu_bacteria | 2968138860 | 2968145209 | 274 |
| 14 | 3300037068 | Ga0373925_0063632 | Ga0373925_0063632_1309_2334 | 275 |
| 15 | 3300046459 | Ga0495629_0027053 | Ga0495629_0027053_2389_3414 | 275 |
| 16 | 3300046533 | Ga0495640_0178579 | Ga0495640_0178579_42_1067 | 275 |
| 17 | 3300046683 | Ga0495658_0009773 | Ga0495658_0009773_45_1070 | 275 |
| 18 | 3300013102 | Ga0157371_10060452 | Ga0157371_100604522 | 280 |
| 19 | 3300005335 | Ga0070666_10069794 | Ga0070666_100697942 | 281 |
| 20 | 3300005344 | Ga0070661_100212771 | Ga0070661_1002127712 | 281 |
| 21 | 3300005355 | Ga0070671_100053208 | Ga0070671_1000532083 | 281 |
| 22 | 3300005564 | Ga0070664_100155231 | Ga0070664_1001552312 | 281 |
| 23 | 3300005616 | Ga0068852_100048482 | Ga0068852_1000484824 | 281 |
| 24 | 3300006237 | Ga0097621_100047825 | Ga0097621_1000478252 | 281 |
| 25 | 3300013105 | Ga0157369_10618529 | Ga0157369_106185292 | 281 |
| 26 | 3300025945 | Ga0207679_10260355 | Ga0207679_102603552 | 281 |
| 27 | 3300026023 | Ga0207677_10196088 | Ga0207677_101960882 | 281 |
| 28 | 3300035695 | Ga0373927_0186281 | Ga0373927_0186281_309_1334 | 281 |
| 29 | 3300048912 | Ga0496109_0189441 | Ga0496109_0189441_682_1707 | 281 |
| 30 | 3300025901 | Ga0207688_10039415 | Ga0207688_100394153 | 282 |
| 31 | 3300025933 | Ga0207706_10006177 | Ga0207706_100061775 | 282 |
| 32 | iso_pu_bacteria | 2958144490 | 2958150547 | 283 |
| 33 | 3300009147 | Ga0114129_10743300 | Ga0114129_107433001 | 284 |
| 34 | 3300050512 | nmdc:mga0n895_110078_c1 | nmdc:mga0n895_110078_c1_1761_2723 | 284 |
| 35 | 3300050515 | nmdc:mga0a205_53174_c1 | nmdc:mga0a205_53174_c1_1081_2043 | 284 |
| 36 | iso_pu_bacteria | 2874131515 | 2874132644 | 284 |
| 37 | 3300005356 | Ga0070674_100243015 | Ga0070674_1002430152 | 286 |
| 38 | 3300005364 | Ga0070673_100091896 | Ga0070673_1000918962 | 286 |
| 39 | 3300006237 | Ga0097621_100058617 | Ga0097621_1000586173 | 287 |
| 40 | 3300006871 | Ga0075434_100315712 | Ga0075434_1003157122 | 287 |
| 41 | 3300005329 | Ga0070683_100176436 | Ga0070683_1001764361 | 289 |
| 42 | 3300005334 | Ga0068869_100002437 | Ga0068869_1000024378 | 289 |
| 43 | 3300005335 | Ga0070666_10009526 | Ga0070666_100095266 | 289 |
| 44 | 3300005338 | Ga0068868_100021850 | Ga0068868_1000218505 | 289 |
| 45 | 3300005343 | Ga0070687_100026749 | Ga0070687_1000267492 | 289 |
| 46 | 3300005347 | Ga0070668_100004663 | Ga0070668_1000046638 | 289 |
| 47 | 3300005353 | Ga0070669_100010555 | Ga0070669_1000105556 | 289 |
| 48 | 3300005356 | Ga0070674_100006198 | Ga0070674_1000061988 | 289 |
| 49 | 3300005367 | Ga0070667_100021659 | Ga0070667_1000216594 | 289 |
| 50 | 3300005457 | Ga0070662_100011596 | Ga0070662_1000115963 | 289 |
| 51 | 3300005459 | Ga0068867_100044752 | Ga0068867_1000447523 | 289 |
| 52 | 3300005543 | Ga0070672_100003804 | Ga0070672_1000038045 | 289 |
| 53 | 3300005577 | Ga0068857_100461132 | Ga0068857_1004611321 | 289 |
| 54 | 3300005617 | Ga0068859_100085817 | Ga0068859_1000858172 | 289 |
| 55 | 3300005618 | Ga0068864_100030198 | Ga0068864_1000301983 | 289 |
| 56 | 3300005718 | Ga0068866_10001825 | Ga0068866_100018253 | 289 |
| 57 | 3300005719 | Ga0068861_100003439 | Ga0068861_1000034399 | 289 |
| 58 | 3300005841 | Ga0068863_100006906 | Ga0068863_1000069068 | 289 |
| 59 | 3300005842 | Ga0068858_100002003 | Ga0068858_1000020036 | 289 |
| 60 | 3300005843 | Ga0068860_100007376 | Ga0068860_1000073768 | 289 |
| 61 | 3300005844 | Ga0068862_100146665 | Ga0068862_1001466652 | 289 |
| 62 | 3300006931 | Ga0097620_100085816 | Ga0097620_1000858162 | 289 |
| 63 | 3300009094 | Ga0111539_10485927 | Ga0111539_104859272 | 289 |
| 64 | 3300009148 | Ga0105243_10015285 | Ga0105243_100152852 | 289 |
| 65 | 3300009176 | Ga0105242_10258309 | Ga0105242_102583092 | 289 |
| 66 | 3300009553 | Ga0105249_10041930 | Ga0105249_100419304 | 289 |
| 67 | 3300013306 | Ga0163162_10109954 | Ga0163162_101099542 | 289 |
| 68 | 3300013308 | Ga0157375_10002379 | Ga0157375_100023798 | 289 |
| 69 | 3300014326 | Ga0157380_10008734 | Ga0157380_100087345 | 289 |
| 70 | 3300014968 | Ga0157379_10023266 | Ga0157379_100232666 | 289 |
| 71 | 3300025893 | Ga0207682_10013203 | Ga0207682_100132034 | 289 |
| 72 | 3300025899 | Ga0207642_10007466 | Ga0207642_100074662 | 289 |
| 73 | 3300025903 | Ga0207680_10004563 | Ga0207680_100045636 | 289 |
| 74 | 3300025918 | Ga0207662_10011648 | Ga0207662_100116483 | 289 |
| 75 | 3300025923 | Ga0207681_10001008 | Ga0207681_1000100815 | 289 |
| 76 | 3300025933 | Ga0207706_10013452 | Ga0207706_100134525 | 289 |
| 77 | 3300025934 | Ga0207686_10167481 | Ga0207686_101674812 | 289 |
| 78 | 3300025935 | Ga0207709_10016430 | Ga0207709_100164304 | 289 |
| 79 | 3300025937 | Ga0207669_10011343 | Ga0207669_100113433 | 289 |
| 80 | 3300025942 | Ga0207689_10004425 | Ga0207689_100044258 | 289 |
| 81 | 3300025945 | Ga0207679_10072670 | Ga0207679_100726702 | 289 |
| 82 | 3300025972 | Ga0207668_10005924 | Ga0207668_100059244 | 289 |
| 83 | 3300026035 | Ga0207703_10004462 | Ga0207703_1000446212 | 289 |
| 84 | 3300026089 | Ga0207648_10056497 | Ga0207648_100564972 | 289 |
| 85 | 3300026095 | Ga0207676_10041569 | Ga0207676_100415693 | 289 |
| 86 | 3300026118 | Ga0207675_100006890 | Ga0207675_1000068905 | 289 |
| 87 | 3300028381 | Ga0268264_10002813 | Ga0268264_100028139 | 289 |
| 88 | 3300046537 | Ga0495598_0034242 | Ga0495598_0034242_273_1298 | 289 |
| 89 | 3300005331 | Ga0070670_100003174 | Ga0070670_1000031745 | 290 |
| 90 | 3300005333 | Ga0070677_10015355 | Ga0070677_100153552 | 290 |
| 91 | 3300005354 | Ga0070675_100009512 | Ga0070675_1000095122 | 290 |
| 92 | 3300005355 | Ga0070671_100116746 | Ga0070671_1001167462 | 290 |
| 93 | 3300005364 | Ga0070673_100006863 | Ga0070673_1000068635 | 290 |
| 94 | 3300005367 | Ga0070667_100187175 | Ga0070667_1001871752 | 290 |
| 95 | 3300005456 | Ga0070678_100006220 | Ga0070678_1000062202 | 290 |
| 96 | 3300005543 | Ga0070672_100033253 | Ga0070672_1000332532 | 290 |
| 97 | 3300005618 | Ga0068864_100032654 | Ga0068864_1000326542 | 290 |
| 98 | 3300005841 | Ga0068863_100507583 | Ga0068863_1005075831 | 290 |
| 99 | 3300013308 | Ga0157375_10055341 | Ga0157375_100553415 | 290 |
| 100 | 3300014969 | Ga0157376_10044552 | Ga0157376_100445522 | 290 |
| 101 | 3300025901 | Ga0207688_10029501 | Ga0207688_100295013 | 290 |
| 102 | 3300025926 | Ga0207659_10029958 | Ga0207659_100299584 | 290 |
| 103 | 3300025931 | Ga0207644_10083949 | Ga0207644_100839492 | 290 |
| 104 | 3300025940 | Ga0207691_10008786 | Ga0207691_100087865 | 290 |
| 105 | 3300025986 | Ga0207658_10023034 | Ga0207658_100230344 | 290 |
| 106 | 3300026095 | Ga0207676_10038983 | Ga0207676_100389832 | 290 |
| 107 | 3300026121 | Ga0207683_10010671 | Ga0207683_100106715 | 290 |
| 108 | 3300006871 | Ga0075434_100090524 | Ga0075434_1000905243 | 292 |
| 109 | iso_pu_bacteria | 2937891427 | 2937896710 | 292 |
| 110 | 3300025945 | Ga0207679_10066848 | Ga0207679_100668482 | 293 |
| 111 | 3300035170 | Ga0373943_0059752 | Ga0373943_0059752_87_1031 | 294 |
| 112 | 3300035171 | Ga0373946_0063744 | Ga0373946_0063744_52_996 | 294 |
| 113 | 3300035725 | Ga0373947_0053957 | Ga0373947_0053957_763_1707 | 294 |
| 114 | 3300046455 | Ga0495603_0073075 | Ga0495603_0073075_624_1568 | 294 |
| 115 | 3300046459 | Ga0495629_0016760 | Ga0495629_0016760_3496_4440 | 294 |
| 116 | 3300046473 | Ga0495582_0012076 | Ga0495582_0012076_204_1148 | 294 |
| 117 | 3300046499 | Ga0495594_0105719 | Ga0495594_0105719_224_1168 | 294 |
| 118 | 3300046681 | Ga0495647_0025500 | Ga0495647_0025500_438_1382 | 294 |
| 119 | 3300046683 | Ga0495658_0001364 | Ga0495658_0001364_9480_10424 | 294 |
| 120 | 3300046689 | Ga0495613_0093917 | Ga0495613_0093917_328_1272 | 294 |
| 121 | 3300050508 | nmdc:mga09592_183144_c1 | nmdc:mga09592_183144_c1_742_1734 | 294 |
| 122 | 3300053085 | Ga0495619_0005118 | Ga0495619_0005118_2718_3662 | 294 |
| 123 | 3300005356 | Ga0070674_100099854 | Ga0070674_1000998542 | 296 |
| 124 | iso_pu_bacteria | 2924754689 | 2924762570 | 296 |
| 125 | 3300005331 | Ga0070670_100173359 | Ga0070670_1001733591 | 297 |
| 126 | 3300005337 | Ga0070682_100066117 | Ga0070682_1000661171 | 297 |
| 127 | 3300005340 | Ga0070689_100026576 | Ga0070689_1000265763 | 297 |
| 128 | 3300005441 | Ga0070700_100098822 | Ga0070700_1000988222 | 297 |
| 129 | 3300005549 | Ga0070704_100216206 | Ga0070704_1002162061 | 297 |
| 130 | 3300005843 | Ga0068860_100174138 | Ga0068860_1001741382 | 297 |
| 131 | 3300025899 | Ga0207642_10051660 | Ga0207642_100516602 | 297 |
| 132 | 3300025900 | Ga0207710_10015430 | Ga0207710_100154302 | 297 |
| 133 | 3300025905 | Ga0207685_10020978 | Ga0207685_100209782 | 297 |
| 134 | 3300025915 | Ga0207693_10003519 | Ga0207693_100035194 | 297 |
| 135 | 3300025916 | Ga0207663_10018683 | Ga0207663_100186833 | 297 |
| 136 | 3300025919 | Ga0207657_10058761 | Ga0207657_100587613 | 297 |
| 137 | 3300025927 | Ga0207687_10117028 | Ga0207687_101170282 | 297 |
| 138 | 3300025928 | Ga0207700_10009939 | Ga0207700_100099393 | 297 |
| 139 | 3300025931 | Ga0207644_10161389 | Ga0207644_101613892 | 297 |
| 140 | 3300025934 | Ga0207686_10122465 | Ga0207686_101224652 | 297 |
| 141 | 3300025935 | Ga0207709_10026603 | Ga0207709_100266034 | 297 |
| 142 | 3300025936 | Ga0207670_10097235 | Ga0207670_100972352 | 297 |
| 143 | 3300025939 | Ga0207665_10000273 | Ga0207665_1000027332 | 297 |
| 144 | 3300025941 | Ga0207711_10134794 | Ga0207711_101347941 | 297 |
| 145 | 3300025960 | Ga0207651_10070958 | Ga0207651_100709582 | 297 |
| 146 | 3300025972 | Ga0207668_10169535 | Ga0207668_101695352 | 297 |
| 147 | 3300026035 | Ga0207703_10095892 | Ga0207703_100958922 | 297 |
| 148 | 3300026067 | Ga0207678_10005685 | Ga0207678_100056856 | 297 |
| 149 | 3300026089 | Ga0207648_10299183 | Ga0207648_102991832 | 297 |
| 150 | 3300026121 | Ga0207683_10001174 | Ga0207683_1000117419 | 297 |
| 151 | 3300028379 | Ga0268266_10030986 | Ga0268266_100309862 | 297 |
| 152 | 3300001976 | JGI24752J21851_1003441 | JGI24752J21851_10034412 | 298 |
| 153 | 3300001990 | JGI24737J22298_10000053 | JGI24737J22298_1000005327 | 298 |
| 154 | 3300002075 | JGI24738J21930_10002204 | JGI24738J21930_100022045 | 298 |
| 155 | 3300002076 | JGI24749J21850_1000375 | JGI24749J21850_10003758 | 298 |
| 156 | 3300002239 | JGI24034J26672_10000960 | JGI24034J26672_100009603 | 298 |
| 157 | 3300002244 | JGI24742J22300_10000216 | JGI24742J22300_100002168 | 298 |
| 158 | 3300005290 | Ga0065712_10172224 | Ga0065712_101722242 | 298 |
| 159 | 3300005293 | Ga0065715_10093047 | Ga0065715_100930476 | 298 |
| 160 | 3300005328 | Ga0070676_10004729 | Ga0070676_100047296 | 298 |
| 161 | 3300005329 | Ga0070683_100001083 | Ga0070683_1000010838 | 298 |
| 162 | 3300005330 | Ga0070690_100002762 | Ga0070690_1000027627 | 298 |
| 163 | 3300005331 | Ga0070670_100005035 | Ga0070670_1000050355 | 298 |
| 164 | 3300005333 | Ga0070677_10002672 | Ga0070677_100026722 | 298 |
| 165 | 3300005334 | Ga0068869_100000279 | Ga0068869_10000027911 | 298 |
| 166 | 3300005336 | Ga0070680_100021592 | Ga0070680_1000215926 | 298 |
| 167 | 3300005338 | Ga0068868_100004075 | Ga0068868_1000040758 | 298 |
| 168 | 3300005339 | Ga0070660_100000245 | Ga0070660_10000024525 | 298 |
| 169 | 3300005341 | Ga0070691_10006681 | Ga0070691_100066813 | 298 |
| 170 | 3300005343 | Ga0070687_100000348 | Ga0070687_10000034815 | 298 |
| 171 | 3300005344 | Ga0070661_100000017 | Ga0070661_100000017154 | 298 |
| 172 | 3300005345 | Ga0070692_10000101 | Ga0070692_1000010115 | 298 |
| 173 | 3300005347 | Ga0070668_100003604 | Ga0070668_10000360411 | 298 |
| 174 | 3300005353 | Ga0070669_100000314 | Ga0070669_10000031428 | 298 |
| 175 | 3300005354 | Ga0070675_100000161 | Ga0070675_10000016128 | 298 |
| 176 | 3300005355 | Ga0070671_100000313 | Ga0070671_10000031327 | 298 |
| 177 | 3300005356 | Ga0070674_100001686 | Ga0070674_1000016868 | 298 |
| 178 | 3300005364 | Ga0070673_100000272 | Ga0070673_10000027228 | 298 |
| 179 | 3300005367 | Ga0070667_100024052 | Ga0070667_1000240525 | 298 |
| 180 | 3300005438 | Ga0070701_10000204 | Ga0070701_1000020422 | 298 |
| 181 | 3300005441 | Ga0070700_100000856 | Ga0070700_10000085615 | 298 |
| 182 | 3300005444 | Ga0070694_100002279 | Ga0070694_1000022798 | 298 |
| 183 | 3300005445 | Ga0070708_100142114 | Ga0070708_1001421142 | 298 |
| 184 | 3300005455 | Ga0070663_100000945 | Ga0070663_10000094515 | 298 |
| 185 | 3300005456 | Ga0070678_100002374 | Ga0070678_10000237411 | 298 |
| 186 | 3300005457 | Ga0070662_100003593 | Ga0070662_1000035938 | 298 |
| 187 | 3300005459 | Ga0068867_100002227 | Ga0068867_10000222715 | 298 |
| 188 | 3300005466 | Ga0070685_10031229 | Ga0070685_100312293 | 298 |
| 189 | 3300005530 | Ga0070679_100002050 | Ga0070679_10000205012 | 298 |
| 190 | 3300005535 | Ga0070684_100000365 | Ga0070684_10000036521 | 298 |
| 191 | 3300005539 | Ga0068853_100000523 | Ga0068853_10000052325 | 298 |
| 192 | 3300005545 | Ga0070695_100001044 | Ga0070695_1000010445 | 298 |
| 193 | 3300005546 | Ga0070696_100021689 | Ga0070696_1000216892 | 298 |
| 194 | 3300005547 | Ga0070693_100000905 | Ga0070693_1000009053 | 298 |
| 195 | 3300005615 | Ga0070702_100002928 | Ga0070702_1000029283 | 298 |
| 196 | 3300006871 | Ga0075434_100013398 | Ga0075434_1000133982 | 298 |
| 197 | 3300035084 | Ga0373928_0013678 | Ga0373928_0013678_11_907 | 298 |
| 198 | 3300005331 | Ga0070670_100188058 | Ga0070670_1001880582 | 299 |
| 199 | 3300005344 | Ga0070661_100290992 | Ga0070661_1002909921 | 299 |
| 200 | 3300005614 | Ga0068856_100174369 | Ga0068856_1001743693 | 299 |
| 201 | 3300006871 | Ga0075434_100028901 | Ga0075434_1000289012 | 299 |
| 202 | 3300025945 | Ga0207679_10027807 | Ga0207679_100278072 | 299 |
| 203 | 3300026095 | Ga0207676_10099964 | Ga0207676_100999643 | 299 |
| 204 | 3300035410 | Ga0373924_0170015 | Ga0373924_0170015_25_924 | 299 |
| 205 | 3300048917 | Ga0496114_0027893 | Ga0496114_0027893_1832_2857 | 299 |
| 206 | 3300048917 | Ga0496114_0102844 | Ga0496114_0102844_1506_2405 | 299 |
| 207 | 3300048918 | Ga0496115_0520116 | Ga0496115_0520116_20_919 | 299 |
| 208 | iso_pu_bacteria | 8046352972 | 8046356023 | 301 |
| 209 | 3300035691 | Ga0373931_0062411 | Ga0373931_0062411_446_1390 | 302 |
| 210 | 3300050512 | nmdc:mga0n895_86938_c1 | nmdc:mga0n895_86938_c1_1770_2714 | 302 |
| 211 | 3300005439 | Ga0070711_100082880 | Ga0070711_1000828802 | 303 |
| 212 | 3300011119 | Ga0105246_10254631 | Ga0105246_102546312 | 303 |
| 213 | 3300025916 | Ga0207663_10034887 | Ga0207663_100348873 | 303 |
| 214 | 3300035691 | Ga0373931_0098181 | Ga0373931_0098181_688_1632 | 303 |
| 215 | 3300037466 | Ga0395898_0006718 | Ga0395898_0006718_5705_6652 | 303 |
| 216 | 3300048911 | Ga0496108_0227434 | Ga0496108_0227434_612_1556 | 303 |
| 217 | 3300048915 | Ga0496112_0238048 | Ga0496112_0238048_520_1464 | 303 |
| 218 | 3300050513 | nmdc:mga0rr50_108639_c1 | nmdc:mga0rr50_108639_c1_927_1871 | 303 |
| 219 | 3300005328 | Ga0070676_10006093 | Ga0070676_100060934 | 304 |
| 220 | 3300005329 | Ga0070683_100016216 | Ga0070683_1000162164 | 304 |
| 221 | 3300005334 | Ga0068869_100009143 | Ga0068869_1000091434 | 304 |
| 222 | 3300005335 | Ga0070666_10232201 | Ga0070666_102322011 | 304 |
| 223 | 3300005338 | Ga0068868_100002361 | Ga0068868_1000023616 | 304 |
| 224 | 3300005338 | Ga0068868_100155201 | Ga0068868_1001552012 | 304 |
| 225 | 3300005339 | Ga0070660_100030071 | Ga0070660_1000300713 | 304 |
| 226 | 3300005344 | Ga0070661_100011716 | Ga0070661_1000117163 | 304 |
| 227 | 3300005344 | Ga0070661_100148435 | Ga0070661_1001484352 | 304 |
| 228 | 3300005347 | Ga0070668_100017165 | Ga0070668_1000171654 | 304 |
| 229 | 3300005353 | Ga0070669_100001878 | Ga0070669_10000187815 | 304 |
| 230 | 3300005366 | Ga0070659_100006215 | Ga0070659_1000062152 | 304 |
| 231 | 3300005455 | Ga0070663_100087170 | Ga0070663_1000871702 | 304 |
| 232 | 3300005456 | Ga0070678_100111091 | Ga0070678_1001110912 | 304 |
| 233 | 3300005457 | Ga0070662_100004917 | Ga0070662_1000049177 | 304 |
| 234 | 3300005459 | Ga0068867_100148888 | Ga0068867_1001488882 | 304 |
| 235 | 3300005535 | Ga0070684_100031623 | Ga0070684_1000316232 | 304 |
| 236 | 3300005535 | Ga0070684_100190808 | Ga0070684_1001908082 | 304 |
| 237 | 3300005539 | Ga0068853_100005637 | Ga0068853_1000056377 | 304 |
| 238 | 3300005539 | Ga0068853_100065961 | Ga0068853_1000659612 | 304 |
| 239 | 3300005547 | Ga0070693_100022703 | Ga0070693_1000227033 | 304 |
| 240 | 3300005563 | Ga0068855_100011208 | Ga0068855_1000112089 | 304 |
| 241 | 3300005577 | Ga0068857_100050390 | Ga0068857_1000503902 | 304 |
| 242 | 3300005578 | Ga0068854_100006483 | Ga0068854_1000064838 | 304 |
| 243 | 3300005614 | Ga0068856_100203581 | Ga0068856_1002035812 | 304 |
| 244 | 3300005616 | Ga0068852_100002308 | Ga0068852_1000023089 | 304 |
| 245 | 3300005618 | Ga0068864_100000546 | Ga0068864_10000054631 | 304 |
| 246 | 3300005719 | Ga0068861_100001557 | Ga0068861_10000155710 | 304 |
| 247 | 3300005840 | Ga0068870_10211528 | Ga0068870_102115281 | 304 |
| 248 | 3300005843 | Ga0068860_100023722 | Ga0068860_1000237226 | 304 |
| 249 | 3300005844 | Ga0068862_100170220 | Ga0068862_1001702202 | 304 |
| 250 | 3300005937 | Ga0081455_10003554 | Ga0081455_100035548 | 304 |
| 251 | 3300006237 | Ga0097621_100003287 | Ga0097621_1000032874 | 304 |
| 252 | 3300006847 | Ga0075431_100109721 | Ga0075431_1001097212 | 304 |
| 253 | 3300006847 | Ga0075431_100311688 | Ga0075431_1003116882 | 304 |
| 254 | 3300006847 | Ga0075431_100387536 | Ga0075431_1003875361 | 304 |
| 255 | 3300006852 | Ga0075433_10037073 | Ga0075433_100370733 | 304 |
| 256 | 3300006871 | Ga0075434_100060504 | Ga0075434_1000605042 | 304 |
| 257 | 3300009174 | Ga0105241_10470278 | Ga0105241_104702781 | 304 |
| 258 | 3300009177 | Ga0105248_10278606 | Ga0105248_102786062 | 304 |
| 259 | 3300009177 | Ga0105248_10395258 | Ga0105248_103952582 | 304 |
| 260 | 3300009545 | Ga0105237_10414798 | Ga0105237_104147982 | 304 |
| 261 | 3300009551 | Ga0105238_10068987 | Ga0105238_100689874 | 304 |
| 262 | 3300013296 | Ga0157374_10005306 | Ga0157374_100053069 | 304 |
| 263 | 3300013306 | Ga0163162_10007593 | Ga0163162_100075939 | 304 |
| 264 | 3300013307 | Ga0157372_10132943 | Ga0157372_101329433 | 304 |
| 265 | 3300013308 | Ga0157375_10041288 | Ga0157375_100412886 | 304 |
| 266 | 3300014969 | Ga0157376_10010411 | Ga0157376_100104115 | 304 |
| 267 | 3300025893 | Ga0207682_10008495 | Ga0207682_100084952 | 304 |
| 268 | 3300025903 | Ga0207680_10230206 | Ga0207680_102302061 | 304 |
| 269 | 3300025907 | Ga0207645_10007540 | Ga0207645_100075406 | 304 |
| 270 | 3300025908 | Ga0207643_10029264 | Ga0207643_100292643 | 304 |
| 271 | 3300025919 | Ga0207657_10024538 | Ga0207657_100245385 | 304 |
| 272 | 3300025919 | Ga0207657_10042811 | Ga0207657_100428113 | 304 |
| 273 | 3300025920 | Ga0207649_10090569 | Ga0207649_100905692 | 304 |
| 274 | 3300025923 | Ga0207681_10096122 | Ga0207681_100961222 | 304 |
| 275 | 3300025924 | Ga0207694_10062975 | Ga0207694_100629752 | 304 |
| 276 | 3300025926 | Ga0207659_10017260 | Ga0207659_100172605 | 304 |
| 277 | 3300025933 | Ga0207706_10000788 | Ga0207706_1000078832 | 304 |
| 278 | 3300025940 | Ga0207691_10120748 | Ga0207691_101207482 | 304 |
| 279 | 3300025941 | Ga0207711_10206302 | Ga0207711_102063022 | 304 |
| 280 | 3300025941 | Ga0207711_10319028 | Ga0207711_103190282 | 304 |
| 281 | 3300025942 | Ga0207689_10000358 | Ga0207689_1000035815 | 304 |
| 282 | 3300025945 | Ga0207679_10024542 | Ga0207679_100245422 | 304 |
| 283 | 3300025945 | Ga0207679_10089341 | Ga0207679_100893412 | 304 |
| 284 | 3300025972 | Ga0207668_10007445 | Ga0207668_100074455 | 304 |
| 285 | 3300025986 | Ga0207658_10098984 | Ga0207658_100989842 | 304 |
| 286 | 3300026035 | Ga0207703_10015159 | Ga0207703_100151592 | 304 |
| 287 | 3300026035 | Ga0207703_10051485 | Ga0207703_100514852 | 304 |
| 288 | 3300026041 | Ga0207639_10011340 | Ga0207639_100113404 | 304 |
| 289 | 3300026067 | Ga0207678_10000889 | Ga0207678_1000088928 | 304 |
| 290 | 3300026067 | Ga0207678_10072422 | Ga0207678_100724222 | 304 |
| 291 | 3300026078 | Ga0207702_10116321 | Ga0207702_101163212 | 304 |
| 292 | 3300026088 | Ga0207641_10045137 | Ga0207641_100451372 | 304 |
| 293 | 3300026118 | Ga0207675_100000774 | Ga0207675_1000007745 | 304 |
| 294 | 3300026121 | Ga0207683_10142415 | Ga0207683_101424152 | 304 |
| 295 | 3300026121 | Ga0207683_10178426 | Ga0207683_101784262 | 304 |
| 296 | 3300026142 | Ga0207698_10040475 | Ga0207698_100404754 | 304 |
| 297 | 3300027907 | Ga0207428_10111969 | Ga0207428_101119692 | 304 |
| 298 | 3300028380 | Ga0268265_10077792 | Ga0268265_100777922 | 304 |
| 299 | 3300035691 | Ga0373931_0001856 | Ga0373931_0001856_1113_2138 | 304 |
| 300 | 3300036401 | Ga0373937_0070411 | Ga0373937_0070411_1388_2413 | 304 |
| 301 | 3300048905 | Ga0496102_0009757 | Ga0496102_0009757_134_1159 | 304 |
| 302 | 3300048909 | Ga0496106_0011874 | Ga0496106_0011874_443_1468 | 304 |
| 303 | 3300048910 | Ga0496107_0155049 | Ga0496107_0155049_536_1561 | 304 |
| 304 | 3300048911 | Ga0496108_0153348 | Ga0496108_0153348_949_1974 | 304 |
| 305 | 3300048912 | Ga0496109_0000086 | Ga0496109_0000086_78774_79802 | 304 |
| 306 | 3300048912 | Ga0496109_0062339 | Ga0496109_0062339_2278_3303 | 304 |
| 307 | 3300048913 | Ga0496110_0011525 | Ga0496110_0011525_3431_4456 | 304 |
| 308 | 3300048915 | Ga0496112_0268323 | Ga0496112_0268323_281_1306 | 304 |
| 309 | 3300048918 | Ga0496115_0020459 | Ga0496115_0020459_1898_2923 | 304 |
| 310 | 3300050507 | nmdc:mga05p37_43110_c1 | nmdc:mga05p37_43110_c1_1177_2199 | 304 |
| 311 | 3300050510 | nmdc:mga06r32_47690_c1 | nmdc:mga06r32_47690_c1_481_1503 | 304 |
| 312 | 3300050510 | nmdc:mga06r32_5519_c1 | nmdc:mga06r32_5519_c1_1533_2561 | 304 |
| 313 | 3300050511 | nmdc:mga08y16_16181_c1 | nmdc:mga08y16_16181_c1_842_1864 | 304 |
| 314 | 3300050512 | nmdc:mga0n895_230391_c1 | nmdc:mga0n895_230391_c1_104_1129 | 304 |
| 315 | iso_pu_bacteria | 2937980651 | 2937981578 | 304 |
| 316 | 3300037418 | Ga0395900_0017348 | Ga0395900_0017348_3558_4505 | 306 |
| 317 | 3300037466 | Ga0395898_0014233 | Ga0395898_0014233_1159_2106 | 306 |
| 318 | 3300038443 | Ga0395901_0022367 | Ga0395901_0022367_2008_2955 | 306 |
| 319 | iso_pu_bacteria | 2856356410 | 2856361101 | 306 |
| 320 | iso_pu_bacteria | 2503198000 | 2503199600 | 310 |
| 321 | iso_pu_bacteria | 2508501127 | 2509142767 | 310 |
| 322 | iso_pu_bacteria | 2509276018 | 2509371043 | 310 |
| 323 | iso_pu_bacteria | 2509276022 | 2509394524 | 310 |
| 324 | iso_pu_bacteria | 2510065059 | 2510319157 | 310 |
| 325 | iso_pu_bacteria | 2512875016 | 2512932996 | 310 |
| 326 | iso_pu_bacteria | 2512875024 | 2512961017 | 310 |
| 327 | iso_pu_bacteria | 2513237090 | 2513611208 | 310 |
| 328 | iso_pu_bacteria | 2513237164 | 2514038463 | 310 |
| 329 | iso_pu_bacteria | 2513237305 | 2514417195 | 310 |
| 330 | iso_pu_bacteria | 2588253730 | 2588519050 | 310 |
| 331 | iso_pu_bacteria | 2597489875 | 2597811371 | 310 |
| 332 | iso_pu_bacteria | 2599185301 | 2599939066 | 310 |
| 333 | iso_pu_bacteria | 2643221547 | 2643755823 | 310 |
| 334 | iso_pu_bacteria | 2643221551 | 2643776940 | 310 |
| 335 | iso_pu_bacteria | 2643221555 | 2643795388 | 310 |
| 336 | iso_pu_bacteria | 2643221595 | 2643986087 | 310 |
| 337 | iso_pu_bacteria | 2643221627 | 2644153652 | 310 |
| 338 | iso_pu_bacteria | 2693429783 | 2694634265 | 310 |
| 339 | iso_pu_bacteria | 2693429784 | 2694637960 | 310 |
| 340 | iso_pu_bacteria | 2721755686 | 2723573972 | 310 |
| 341 | iso_pu_bacteria | 2756170246 | 2756677386 | 310 |
| 342 | iso_pu_bacteria | 2791355123 | 2792748399 | 310 |
| 343 | iso_pu_bacteria | 2839993093 | 2839995018 | 310 |
| 344 | iso_pu_bacteria | 2841734538 | 2841737343 | 310 |
| 345 | iso_pu_bacteria | 2844002411 | 2844009123 | 310 |
| 346 | iso_pu_bacteria | 2844009547 | 2844012195 | 310 |
| 347 | iso_pu_bacteria | 2847670302 | 2847674615 | 310 |
| 348 | iso_pu_bacteria | 2847686936 | 2847690733 | 310 |
| 349 | iso_pu_bacteria | 2854896431 | 2854900790 | 310 |
| 350 | iso_pu_bacteria | 2854916844 | 2854919562 | 310 |
| 351 | iso_pu_bacteria | 2856314179 | 2856317499 | 310 |
| 352 | iso_pu_bacteria | 2856320880 | 2856322680 | 310 |
| 353 | iso_pu_bacteria | 2856342000 | 2856346014 | 310 |
| 354 | iso_pu_bacteria | 2856364286 | 2856366719 | 310 |
| 355 | iso_pu_bacteria | 2857349434 | 2857356599 | 310 |
| 356 | iso_pu_bacteria | 2869162929 | 2869165157 | 310 |
| 357 | iso_pu_bacteria | 2869169390 | 2869171225 | 310 |
| 358 | iso_pu_bacteria | 2869234852 | 2869237790 | 310 |
| 359 | iso_pu_bacteria | 2869242130 | 2869244240 | 310 |
| 360 | iso_pu_bacteria | 2869249662 | 2869250147 | 310 |
| 361 | iso_pu_bacteria | 2869256925 | 2869258938 | 310 |
| 362 | iso_pu_bacteria | 2869264136 | 2869265315 | 310 |
| 363 | iso_pu_bacteria | 2869278585 | 2869285802 | 310 |
| 364 | iso_pu_bacteria | 2869285874 | 2869287870 | 310 |
| 365 | iso_pu_bacteria | 2871429161 | 2871435818 | 310 |
| 366 | iso_pu_bacteria | 2871435913 | 2871441833 | 310 |
| 367 | iso_pu_bacteria | 2871444079 | 2871451563 | 310 |
| 368 | iso_pu_bacteria | 2871451962 | 2871459482 | 310 |
| 369 | iso_pu_bacteria | 2871459585 | 2871465662 | 310 |
| 370 | iso_pu_bacteria | 2871466892 | 2871474393 | 310 |
| 371 | iso_pu_bacteria | 2871474448 | 2871479403 | 310 |
| 372 | iso_pu_bacteria | 2871481445 | 2871483802 | 310 |
| 373 | iso_pu_bacteria | 2871488783 | 2871489907 | 310 |
| 374 | iso_pu_bacteria | 2871495908 | 2871498021 | 310 |
| 375 | iso_pu_bacteria | 2874102143 | 2874102218 | 310 |
| 376 | iso_pu_bacteria | 2874109183 | 2874111112 | 310 |
| 377 | iso_pu_bacteria | 2874116593 | 2874117235 | 310 |
| 378 | iso_pu_bacteria | 2874139085 | 2874141884 | 310 |
| 379 | iso_pu_bacteria | 2874146452 | 2874151503 | 310 |
| 380 | iso_pu_bacteria | 2874155637 | 2874159135 | 310 |
| 381 | iso_pu_bacteria | 2874168670 | 2874175688 | 310 |
| 382 | iso_pu_bacteria | 2876363079 | 2876364757 | 310 |
| 383 | iso_pu_bacteria | 2876369609 | 2876377128 | 310 |
| 384 | iso_pu_bacteria | 2876377896 | 2876378463 | 310 |
| 385 | iso_pu_bacteria | 2876386047 | 2876389284 | 310 |
| 386 | iso_pu_bacteria | 2876392853 | 2876396187 | 310 |
| 387 | iso_pu_bacteria | 2876413966 | 2876417554 | 310 |
| 388 | iso_pu_bacteria | 2876420981 | 2876426088 | 310 |
| 389 | iso_pu_bacteria | 2878035449 | 2878038537 | 310 |
| 390 | iso_pu_bacteria | 2878730984 | 2878731744 | 310 |
| 391 | iso_pu_bacteria | 2878738818 | 2878739377 | 310 |
| 392 | iso_pu_bacteria | 2878745973 | 2878749381 | 310 |
| 393 | iso_pu_bacteria | 2878753008 | 2878754437 | 310 |
| 394 | iso_pu_bacteria | 2878760144 | 2878762243 | 310 |
| 395 | iso_pu_bacteria | 2878767105 | 2878769210 | 310 |
| 396 | iso_pu_bacteria | 2878788777 | 2878790005 | 310 |
| 397 | iso_pu_bacteria | 2881147464 | 2881149423 | 310 |
| 398 | iso_pu_bacteria | 2881155292 | 2881160631 | 310 |
| 399 | iso_pu_bacteria | 2881161766 | 2881166323 | 310 |
| 400 | iso_pu_bacteria | 2881845957 | 2881849733 | 310 |
| 401 | iso_pu_bacteria | 2881861095 | 2881865584 | 310 |
| 402 | iso_pu_bacteria | 2882632389 | 2882634095 | 310 |
| 403 | iso_pu_bacteria | 2882912400 | 2882918643 | 310 |
| 404 | iso_pu_bacteria | 2885305155 | 2885307754 | 310 |
| 405 | iso_pu_bacteria | 2885312484 | 2885313251 | 310 |
| 406 | iso_pu_bacteria | 2885318864 | 2885319940 | 310 |
| 407 | iso_pu_bacteria | 2885334103 | 2885340190 | 310 |
| 408 | iso_pu_bacteria | 2885342637 | 2885345083 | 310 |
| 409 | iso_pu_bacteria | 2888337043 | 2888337971 | 310 |
| 410 | iso_pu_bacteria | 2888343758 | 2888345271 | 310 |
| 411 | iso_pu_bacteria | 2888350351 | 2888354560 | 310 |
| 412 | iso_pu_bacteria | 2889010040 | 2889016164 | 310 |
| 413 | iso_pu_bacteria | 2889016732 | 2889018795 | 310 |
| 414 | iso_pu_bacteria | 2903448605 | 2903449256 | 310 |
| 415 | iso_pu_bacteria | 2903492973 | 2903493612 | 310 |
| 416 | iso_pu_bacteria | 2903492973 | 2903497642 | 310 |
| 417 | iso_pu_bacteria | 2903513507 | 2903519879 | 310 |
| 418 | iso_pu_bacteria | 2903521522 | 2903522507 | 310 |
| 419 | iso_pu_bacteria | 2903528002 | 2903528886 | 310 |
| 420 | iso_pu_bacteria | 2903540706 | 2903542819 | 310 |
| 421 | iso_pu_bacteria | 2904659560 | 2904662963 | 310 |
| 422 | iso_pu_bacteria | 2906308376 | 2906310419 | 310 |
| 423 | iso_pu_bacteria | 2906321335 | 2906324484 | 310 |
| 424 | iso_pu_bacteria | 2906328253 | 2906333284 | 310 |
| 425 | iso_pu_bacteria | 2906354277 | 2906360008 | 310 |
| 426 | iso_pu_bacteria | 2906363423 | 2906363878 | 310 |
| 427 | iso_pu_bacteria | 2906370794 | 2906373259 | 310 |
| 428 | iso_pu_bacteria | 2906393657 | 2906395715 | 310 |
| 429 | iso_pu_bacteria | 2906401398 | 2906405660 | 310 |
| 430 | iso_pu_bacteria | 2906414383 | 2906417564 | 310 |
| 431 | iso_pu_bacteria | 2922130491 | 2922137262 | 310 |
| 432 | iso_pu_bacteria | 2922158528 | 2922162456 | 310 |
| 433 | iso_pu_bacteria | 2922185730 | 2922191931 | 310 |
| 434 | iso_pu_bacteria | 2924710171 | 2924710992 | 310 |
| 435 | iso_pu_bacteria | 2924726620 | 2924727465 | 310 |
| 436 | iso_pu_bacteria | 2924733363 | 2924736358 | 310 |
| 437 | iso_pu_bacteria | 2924741084 | 2924745283 | 310 |
| 438 | iso_pu_bacteria | 2924762789 | 2924769285 | 310 |
| 439 | iso_pu_bacteria | 2924776078 | 2924776898 | 310 |
| 440 | iso_pu_bacteria | 2924784321 | 2924790175 | 310 |
| 441 | iso_pu_bacteria | 2937813078 | 2937817248 | 310 |
| 442 | iso_pu_bacteria | 2937822353 | 2937825769 | 310 |
| 443 | iso_pu_bacteria | 2937836603 | 2937840727 | 310 |
| 444 | iso_pu_bacteria | 2937848649 | 2937855436 | 310 |
| 445 | iso_pu_bacteria | 2937861824 | 2937862715 | 310 |
| 446 | iso_pu_bacteria | 2937877337 | 2937883501 | 310 |
| 447 | iso_pu_bacteria | 2937972304 | 2937973520 | 310 |
| 448 | iso_pu_bacteria | 2937994558 | 2937996669 | 310 |
| 449 | iso_pu_bacteria | 2938014810 | 2938018576 | 310 |
| 450 | iso_pu_bacteria | 2958034702 | 2958041818 | 310 |
| 451 | iso_pu_bacteria | 2958041894 | 2958050349 | 310 |
| 452 | iso_pu_bacteria | 2958041894 | 2958056483 | 310 |
| 453 | iso_pu_bacteria | 2958064165 | 2958065926 | 310 |
| 454 | iso_pu_bacteria | 2958071322 | 2958073640 | 310 |
| 455 | iso_pu_bacteria | 2958084443 | 2958090669 | 310 |
| 456 | iso_pu_bacteria | 2958092219 | 2958100721 | 310 |
| 457 | iso_pu_bacteria | 2958100919 | 2958102137 | 310 |
| 458 | iso_pu_bacteria | 2958108152 | 2958108307 | 310 |
| 459 | iso_pu_bacteria | 2958115193 | 2958120786 | 310 |
| 460 | iso_pu_bacteria | 2958130278 | 2958132274 | 310 |
| 461 | iso_pu_bacteria | 2958165035 | 2958167141 | 310 |
| 462 | iso_pu_bacteria | 2958172287 | 2958174803 | 310 |
| 463 | iso_pu_bacteria | 2958179912 | 2958182088 | 310 |
| 464 | iso_pu_bacteria | 2961077736 | 2961079932 | 310 |
| 465 | iso_pu_bacteria | 2961114664 | 2961117989 | 310 |
| 466 | iso_pu_bacteria | 2961127735 | 2961134584 | 310 |
| 467 | iso_pu_bacteria | 2961163497 | 2961165610 | 310 |
| 468 | iso_pu_bacteria | 2961170736 | 2961171867 | 310 |
| 469 | iso_pu_bacteria | 2961183825 | 2961189591 | 310 |
| 470 | iso_pu_bacteria | 2963644680 | 2963646213 | 310 |
| 471 | iso_pu_bacteria | 2965018300 | 2965020433 | 310 |
| 472 | iso_pu_bacteria | 2965040258 | 2965042429 | 310 |
| 473 | iso_pu_bacteria | 2965062239 | 2965066127 | 310 |
| 474 | iso_pu_bacteria | 2965089291 | 2965089750 | 310 |
| 475 | iso_pu_bacteria | 2967996073 | 2967996974 | 310 |
| 476 | iso_pu_bacteria | 2968003550 | 2968005035 | 310 |
| 477 | iso_pu_bacteria | 2968016561 | 2968016685 | 310 |
| 478 | iso_pu_bacteria | 2968083720 | 2968085319 | 310 |
| 479 | iso_pu_bacteria | 2968091066 | 2968091437 | 310 |
| 480 | iso_pu_bacteria | 2968097103 | 2968099116 | 310 |
| 481 | iso_pu_bacteria | 2968110612 | 2968114050 | 310 |
| 482 | iso_pu_bacteria | 2968117919 | 2968123240 | 310 |
| 483 | iso_pu_bacteria | 2968128360 | 2968129059 | 310 |
| 484 | iso_pu_bacteria | 2968171901 | 2968174012 | 310 |
| 485 | iso_pu_bacteria | 2970469710 | 2970470027 | 310 |
| 486 | iso_pu_bacteria | 2970489779 | 2970492592 | 310 |
| 487 | iso_pu_bacteria | 2970503327 | 2970504465 | 310 |
| 488 | iso_pu_bacteria | 2970510686 | 2970515177 | 310 |
| 489 | iso_pu_bacteria | 2970524798 | 2970526983 | 310 |
| 490 | iso_pu_bacteria | 2970532167 | 2970535808 | 310 |
| 491 | iso_pu_bacteria | 2970540015 | 2970546952 | 310 |
| 492 | iso_pu_bacteria | 2970554993 | 2970557098 | 310 |
| 493 | iso_pu_bacteria | 2970593180 | 2970600419 | 310 |
| 494 | iso_pu_bacteria | 2970619444 | 2970620133 | 310 |
| 495 | iso_pu_bacteria | 2970627176 | 2970631020 | 310 |
| 496 | iso_pu_bacteria | 2977821940 | 2977823654 | 310 |
| 497 | iso_pu_bacteria | 2977843712 | 2977847536 | 310 |
| 498 | iso_pu_bacteria | 2977851361 | 2977856354 | 310 |
| 499 | iso_pu_bacteria | 2977858184 | 2977859243 | 310 |
| 500 | iso_pu_bacteria | 2977864932 | 2977871017 | 310 |
| 501 | iso_pu_bacteria | 2977898635 | 2977904252 | 310 |
| 502 | iso_pu_bacteria | 2977907340 | 2977913281 | 310 |
| 503 | iso_pu_bacteria | 2977915119 | 2977920158 | 310 |
| 504 | iso_pu_bacteria | 2977922695 | 2977928857 | 310 |
| 505 | iso_pu_bacteria | 2977942078 | 2977943071 | 310 |
| 506 | iso_pu_bacteria | 2977950692 | 2977952243 | 310 |
| 507 | iso_pu_bacteria | 2977971508 | 2977976440 | 310 |
| 508 | iso_pu_bacteria | 2977986579 | 2977988862 | 310 |
| 509 | iso_pu_bacteria | 2979710463 | 2979710543 | 310 |
| 510 | iso_pu_bacteria | 2979764755 | 2979768889 | 310 |
| 511 | iso_pu_bacteria | 2979772303 | 2979776223 | 310 |
| 512 | iso_pu_bacteria | 2979779861 | 2979780527 | 310 |
| 513 | iso_pu_bacteria | 2979808191 | 2979809102 | 310 |
| 514 | iso_pu_bacteria | 2987636660 | 2987643879 | 310 |
| 515 | iso_pu_bacteria | 2987652177 | 2987656448 | 310 |
| 516 | iso_pu_bacteria | 2987659509 | 2987661618 | 310 |
| 517 | iso_pu_bacteria | 2987666974 | 2987672461 | 310 |
| 518 | iso_pu_bacteria | 2996310559 | 2996315722 | 310 |
| 519 | iso_pu_bacteria | 2996341866 | 2996347826 | 310 |
| 520 | iso_pu_bacteria | 2996348954 | 2996353044 | 310 |
| 521 | iso_pu_bacteria | 2996386984 | 2996389660 | 310 |
| 522 | iso_pu_bacteria | 3000135777 | 3000141329 | 310 |
| 523 | iso_pu_bacteria | 3002141150 | 3002144138 | 310 |
| 524 | iso_pu_bacteria | 3004167301 | 3004174362 | 310 |
| 525 | iso_pu_bacteria | 3004188549 | 3004190667 | 310 |
| 526 | iso_pu_bacteria | 3004195979 | 3004199053 | 310 |
| 527 | iso_pu_bacteria | 3004203850 | 3004208028 | 310 |
| 528 | iso_pu_bacteria | 3004211236 | 3004211502 | 310 |
| 529 | iso_pu_bacteria | 3004218560 | 3004224949 | 310 |
| 530 | iso_pu_bacteria | 3004232784 | 3004237404 | 310 |
| 531 | iso_pu_bacteria | 3004268573 | 3004270578 | 310 |
| 532 | iso_pu_bacteria | 3004275668 | 3004279726 | 310 |
| 533 | iso_pu_bacteria | 3004289098 | 3004294022 | 310 |
| 534 | iso_pu_bacteria | 3004334049 | 3004336205 | 310 |
| 535 | iso_pu_bacteria | 637000159 | 637076077 | 310 |
| 536 | iso_pu_bacteria | 8004312739 | 8004316702 | 310 |
| 537 | iso_pu_bacteria | 8004361976 | 8004364909 | 310 |
| 538 | iso_pu_bacteria | 8004374579 | 8004376013 | 310 |
| 539 | iso_pu_bacteria | 8004387939 | 8004389658 | 310 |
| 540 | iso_pu_bacteria | 8004395343 | 8004397035 | 310 |
| 541 | iso_pu_bacteria | 8004445564 | 8004449945 | 310 |
| 542 | iso_pu_bacteria | 8004633249 | 8004636732 | 310 |
| 543 | iso_pu_bacteria | 8004640170 | 8004645513 | 310 |
| 544 | iso_pu_bacteria | 8004703790 | 8004705667 | 310 |
| 545 | iso_pu_bacteria | 8004714634 | 8004718055 | 310 |
| 546 | iso_pu_bacteria | 8004727605 | 8004732041 | 310 |
| 547 | iso_pu_bacteria | 8055617313 | 8055618833 | 310 |
| 548 | iso_pu_bacteria | 8056875544 | 8056878731 | 310 |
| 549 | 3300009011 | Ga0105251_10027020 | Ga0105251_100270203 | 313 |
| 550 | 3300009176 | Ga0105242_10083983 | Ga0105242_100839832 | 313 |
| 551 | 3300009177 | Ga0105248_10294030 | Ga0105248_102940303 | 313 |
| 552 | 3300009545 | Ga0105237_10041035 | Ga0105237_100410353 | 313 |
| 553 | 3300010375 | Ga0105239_10170670 | Ga0105239_101706702 | 313 |
| 554 | 3300013104 | Ga0157370_10090616 | Ga0157370_100906162 | 313 |
| 555 | 3300013297 | Ga0157378_10079081 | Ga0157378_100790813 | 313 |
| 556 | 3300031241 | Ga0265325_10146745 | Ga0265325_101467452 | 313 |
| 557 | 3300031249 | Ga0265339_10010187 | Ga0265339_100101872 | 313 |
| 558 | 3300031344 | Ga0265316_10096444 | Ga0265316_100964444 | 313 |
| 559 | 3300031595 | Ga0265313_10003967 | Ga0265313_1000396714 | 313 |
| 560 | 3300034819 | Ga0373958_0001069 | Ga0373958_0001069_2538_3482 | 313 |
| 561 | 3300035115 | Ga0373941_0009277 | Ga0373941_0009277_805_1749 | 313 |
| 562 | 3300048090 | Ga0495615_0026860 | Ga0495615_0026860_284_1234 | 313 |
| 563 | 3300048903 | Ga0496100_0009503 | Ga0496100_0009503_1703_2647 | 313 |
| 564 | 3300048904 | Ga0496101_0082414 | Ga0496101_0082414_737_1681 | 313 |
| 565 | 3300048905 | Ga0496102_0152829 | Ga0496102_0152829_116_1066 | 313 |
| 566 | 3300048906 | Ga0496103_0139041 | Ga0496103_0139041_131_1075 | 313 |
| 567 | 3300048906 | Ga0496103_0273803 | Ga0496103_0273803_50_1000 | 313 |
| 568 | 3300048907 | Ga0496104_0090384 | Ga0496104_0090384_766_1710 | 313 |
| 569 | 3300048907 | Ga0496104_0525705 | Ga0496104_0525705_43_993 | 313 |
| 570 | 3300048910 | Ga0496107_0013104 | Ga0496107_0013104_912_1856 | 313 |
| 571 | 3300048911 | Ga0496108_0179411 | Ga0496108_0179411_741_1691 | 313 |
| 572 | 3300048912 | Ga0496109_0068652 | Ga0496109_0068652_602_1546 | 313 |
| 573 | 3300048913 | Ga0496110_0142283 | Ga0496110_0142283_705_1649 | 313 |
| 574 | 3300048913 | Ga0496110_0192968 | Ga0496110_0192968_701_1651 | 313 |
| 575 | 3300048914 | Ga0496111_0067217 | Ga0496111_0067217_1098_2042 | 313 |
| 576 | 3300048914 | Ga0496111_0309637 | Ga0496111_0309637_130_1080 | 313 |
| 577 | 3300048917 | Ga0496114_0047784 | Ga0496114_0047784_310_1254 | 313 |
| 578 | 3300048918 | Ga0496115_0171791 | Ga0496115_0171791_310_1254 | 313 |
| 579 | 3300049568 | Ga0501031_0000011 | Ga0501031_0000011_54984_55928 | 313 |
| 580 | 3300049569 | Ga0501032_0000006 | Ga0501032_0000006_205800_206744 | 313 |
| 581 | 3300049570 | Ga0501033_0000039 | Ga0501033_0000039_54984_55928 | 313 |
| 582 | 3300049571 | Ga0501034_0000030 | Ga0501034_0000030_28386_29330 | 313 |
| 583 | 3300049572 | Ga0501036_0000003 | Ga0501036_0000003_54984_55928 | 313 |
| 584 | 3300049573 | Ga0501037_0000003 | Ga0501037_0000003_54984_55928 | 313 |
| 585 | 3300049574 | Ga0501038_0000004 | Ga0501038_0000004_54984_55928 | 313 |
| 586 | 3300049575 | Ga0501039_0000008 | Ga0501039_0000008_54984_55928 | 313 |
| 587 | 3300049576 | Ga0501040_0066210 | Ga0501040_0066210_1120_2064 | 313 |
| 588 | 3300049579 | Ga0501043_0000177 | Ga0501043_0000177_36256_37200 | 313 |
| 589 | 3300049581 | Ga0501047_0002232 | Ga0501047_0002232_13619_14563 | 313 |
| 590 | 3300049585 | Ga0501069_0031216 | Ga0501069_0031216_1484_2425 | 313 |
| 591 | 3300049586 | Ga0501070_0003834 | Ga0501070_0003834_11643_12587 | 313 |
| 592 | 3300049586 | Ga0501070_0087292 | Ga0501070_0087292_184_1125 | 313 |
| 593 | 3300049586 | Ga0501070_0216481 | Ga0501070_0216481_558_1499 | 313 |
| 594 | 3300049742 | Ga0501080_0189677 | Ga0501080_0189677_885_1826 | 313 |
| 595 | 3300049822 | Ga0501035_0000112 | Ga0501035_0000112_43211_44155 | 313 |
| 596 | 3300049822 | Ga0501035_0001116 | Ga0501035_0001116_16068_17009 | 313 |
| 597 | 3300049823 | Ga0501044_0000008 | Ga0501044_0000008_54984_55928 | 313 |
| 598 | iso_pu_bacteria | 2928972540 | 2928972998 | 313 |
| 599 | iso_pu_bacteria | 2977240413 | 2977242779 | 313 |
| 600 | 3300001989 | JGI24739J22299_10018162 | JGI24739J22299_100181622 | 314 |
| 601 | 3300002067 | JGI24735J21928_10013098 | JGI24735J21928_100130982 | 314 |
| 602 | 3300002741 | JGI25157J39369_1001732 | JGI25157J39369_10017326 | 314 |
| 603 | 3300003203 | JGI25406J46586_10028248 | JGI25406J46586_100282481 | 314 |
| 604 | 3300003214 | JGI25165J46597_1000097 | JGI25165J46597_1000097141 | 314 |
| 605 | 3300003578 | Ga0006562J51391_1053984 | Ga0006562J51391_10539842 | 314 |
| 606 | 3300005327 | Ga0070658_10077237 | Ga0070658_100772372 | 314 |
| 607 | 3300005339 | Ga0070660_100019914 | Ga0070660_1000199145 | 314 |
| 608 | 3300005339 | Ga0070660_100060582 | Ga0070660_1000605823 | 314 |
| 609 | 3300005344 | Ga0070661_100048950 | Ga0070661_1000489501 | 314 |
| 610 | 3300005455 | Ga0070663_100181347 | Ga0070663_1001813471 | 314 |
| 611 | 3300005459 | Ga0068867_100029790 | Ga0068867_1000297903 | 314 |
| 612 | 3300005530 | Ga0070679_100021093 | Ga0070679_1000210938 | 314 |
| 613 | 3300005539 | Ga0068853_100001161 | Ga0068853_1000011617 | 314 |
| 614 | 3300005539 | Ga0068853_100198124 | Ga0068853_1001981242 | 314 |
| 615 | 3300005543 | Ga0070672_100000709 | Ga0070672_10000070912 | 314 |
| 616 | 3300005548 | Ga0070665_100041750 | Ga0070665_1000417503 | 314 |
| 617 | 3300005548 | Ga0070665_100064470 | Ga0070665_1000644704 | 314 |
| 618 | 3300005563 | Ga0068855_100166115 | Ga0068855_1001661152 | 314 |
| 619 | 3300005564 | Ga0070664_100002074 | Ga0070664_10000207418 | 314 |
| 620 | 3300005578 | Ga0068854_100000749 | Ga0068854_10000074915 | 314 |
| 621 | 3300005614 | Ga0068856_100000902 | Ga0068856_10000090218 | 314 |
| 622 | 3300005616 | Ga0068852_100015241 | Ga0068852_1000152415 | 314 |
| 623 | 3300005616 | Ga0068852_100026542 | Ga0068852_1000265422 | 314 |
| 624 | 3300005616 | Ga0068852_100070611 | Ga0068852_1000706112 | 314 |
| 625 | 3300005616 | Ga0068852_100212963 | Ga0068852_1002129632 | 314 |
| 626 | 3300005618 | Ga0068864_100000595 | Ga0068864_1000005952 | 314 |
| 627 | 3300005718 | Ga0068866_10002012 | Ga0068866_100020128 | 314 |
| 628 | 3300005719 | Ga0068861_100000825 | Ga0068861_10000082515 | 314 |
| 629 | 3300005840 | Ga0068870_10000112 | Ga0068870_1000011214 | 314 |
| 630 | 3300005841 | Ga0068863_100000703 | Ga0068863_10000070311 | 314 |
| 631 | 3300005842 | Ga0068858_100008283 | Ga0068858_1000082834 | 314 |
| 632 | 3300005843 | Ga0068860_100006736 | Ga0068860_1000067363 | 314 |
| 633 | 3300005985 | Ga0081539_10007581 | Ga0081539_100075811 | 314 |
| 634 | 3300006038 | Ga0075365_10036995 | Ga0075365_100369953 | 314 |
| 635 | 3300006038 | Ga0075365_10037327 | Ga0075365_100373274 | 314 |
| 636 | 3300006038 | Ga0075365_10199791 | Ga0075365_101997911 | 314 |
| 637 | 3300006038 | Ga0075365_10277252 | Ga0075365_102772521 | 314 |
| 638 | 3300006048 | Ga0075363_100013824 | Ga0075363_1000138244 | 314 |
| 639 | 3300006051 | Ga0075364_10007466 | Ga0075364_100074662 | 314 |
| 640 | 3300006178 | Ga0075367_10005318 | Ga0075367_100053184 | 314 |
| 641 | 3300006178 | Ga0075367_10043746 | Ga0075367_100437464 | 314 |
| 642 | 3300006178 | Ga0075367_10117360 | Ga0075367_101173601 | 314 |
| 643 | 3300006178 | Ga0075367_10256332 | Ga0075367_102563321 | 314 |
| 644 | 3300006186 | Ga0075369_10004969 | Ga0075369_100049694 | 314 |
| 645 | 3300006186 | Ga0075369_10051358 | Ga0075369_100513582 | 314 |
| 646 | 3300006186 | Ga0075369_10084149 | Ga0075369_100841492 | 314 |
| 647 | 3300006237 | Ga0097621_100000473 | Ga0097621_10000047328 | 314 |
| 648 | 3300006353 | Ga0075370_10005271 | Ga0075370_100052714 | 314 |
| 649 | 3300006358 | Ga0068871_100000118 | Ga0068871_10000011836 | 314 |
| 650 | 3300006881 | Ga0068865_100051161 | Ga0068865_1000511614 | 314 |
| 651 | 3300006881 | Ga0068865_100110247 | Ga0068865_1001102472 | 314 |
| 652 | 3300009092 | Ga0105250_10045964 | Ga0105250_100459642 | 314 |
| 653 | 3300009093 | Ga0105240_10064698 | Ga0105240_100646983 | 314 |
| 654 | 3300009093 | Ga0105240_10087185 | Ga0105240_100871852 | 314 |
| 655 | 3300009093 | Ga0105240_10558510 | Ga0105240_105585101 | 314 |
| 656 | 3300009094 | Ga0111539_10001167 | Ga0111539_1000116726 | 314 |
| 657 | 3300009098 | Ga0105245_10001982 | Ga0105245_100019823 | 314 |
| 658 | 3300009101 | Ga0105247_10028209 | Ga0105247_100282092 | 314 |
| 659 | 3300009147 | Ga0114129_10194026 | Ga0114129_101940263 | 314 |
| 660 | 3300009148 | Ga0105243_10002278 | Ga0105243_1000227815 | 314 |
| 661 | 3300009148 | Ga0105243_10085153 | Ga0105243_100851531 | 314 |
| 662 | 3300009174 | Ga0105241_10003555 | Ga0105241_100035553 | 314 |
| 663 | 3300009176 | Ga0105242_10001156 | Ga0105242_1000115611 | 314 |
| 664 | 3300009545 | Ga0105237_10005748 | Ga0105237_100057486 | 314 |
| 665 | 3300009545 | Ga0105237_10202482 | Ga0105237_102024822 | 314 |
| 666 | 3300009551 | Ga0105238_10007631 | Ga0105238_100076317 | 314 |
| 667 | 3300009553 | Ga0105249_10001021 | Ga0105249_1000102111 | 314 |
| 668 | 3300010375 | Ga0105239_10008950 | Ga0105239_100089506 | 314 |
| 669 | 3300010375 | Ga0105239_10010109 | Ga0105239_100101099 | 314 |
| 670 | 3300010375 | Ga0105239_10046440 | Ga0105239_100464405 | 314 |
| 671 | 3300010375 | Ga0105239_10136101 | Ga0105239_101361013 | 314 |
| 672 | 3300011119 | Ga0105246_10003701 | Ga0105246_100037016 | 314 |
| 673 | 3300013102 | Ga0157371_10031202 | Ga0157371_100312024 | 314 |
| 674 | 3300013104 | Ga0157370_10287651 | Ga0157370_102876511 | 314 |
| 675 | 3300013105 | Ga0157369_10014889 | Ga0157369_100148895 | 314 |
| 676 | 3300013105 | Ga0157369_10290972 | Ga0157369_102909722 | 314 |
| 677 | 3300013105 | Ga0157369_10768354 | Ga0157369_107683541 | 314 |
| 678 | 3300013296 | Ga0157374_10015941 | Ga0157374_100159413 | 314 |
| 679 | 3300013297 | Ga0157378_10002986 | Ga0157378_1000298611 | 314 |
| 680 | 3300013306 | Ga0163162_10009522 | Ga0163162_100095226 | 314 |
| 681 | 3300013307 | Ga0157372_10008348 | Ga0157372_1000834811 | 314 |
| 682 | 3300013308 | Ga0157375_10000508 | Ga0157375_1000050811 | 314 |
| 683 | 3300014325 | Ga0163163_10082125 | Ga0163163_100821253 | 314 |
| 684 | 3300014326 | Ga0157380_10000212 | Ga0157380_1000021226 | 314 |
| 685 | 3300014497 | Ga0182008_10036668 | Ga0182008_100366682 | 314 |
| 686 | 3300014745 | Ga0157377_10000287 | Ga0157377_1000028717 | 314 |
| 687 | 3300014968 | Ga0157379_10008690 | Ga0157379_100086903 | 314 |
| 688 | 3300014969 | Ga0157376_10004642 | Ga0157376_100046424 | 314 |
| 689 | 3300015261 | Ga0182006_1023464 | Ga0182006_10234642 | 314 |
| 690 | 3300015262 | Ga0182007_10017175 | Ga0182007_100171753 | 314 |
| 691 | 3300017792 | Ga0163161_10000415 | Ga0163161_1000041531 | 314 |
| 692 | 3300025250 | Ga0209026_1000041 | Ga0209026_1000041270 | 314 |
| 693 | 3300025254 | Ga0209148_1000069 | Ga0209148_1000069287 | 314 |
| 694 | 3300025256 | Ga0209759_1000183 | Ga0209759_100018367 | 314 |
| 695 | 3300025261 | Ga0209233_1000030 | Ga0209233_1000030546 | 314 |
| 696 | 3300025261 | Ga0209233_1008564 | Ga0209233_10085643 | 314 |
| 697 | 3300025271 | Ga0207666_1000073 | Ga0207666_10000734 | 314 |
| 698 | 3300025272 | Ga0209455_1000161 | Ga0209455_100016141 | 314 |
| 699 | 3300025290 | Ga0207673_1000295 | Ga0207673_10002954 | 314 |
| 700 | 3300025297 | Ga0209758_1005328 | Ga0209758_10053286 | 314 |
| 701 | 3300025315 | Ga0207697_10000061 | Ga0207697_1000006139 | 314 |
| 702 | 3300025711 | Ga0207696_1062241 | Ga0207696_10622411 | 314 |
| 703 | 3300025893 | Ga0207682_10002961 | Ga0207682_100029614 | 314 |
| 704 | 3300025899 | Ga0207642_10001238 | Ga0207642_100012387 | 314 |
| 705 | 3300025900 | Ga0207710_10014209 | Ga0207710_100142092 | 314 |
| 706 | 3300025901 | Ga0207688_10000001 | Ga0207688_1000000196 | 314 |
| 707 | 3300025903 | Ga0207680_10001817 | Ga0207680_1000181711 | 314 |
| 708 | 3300025904 | Ga0207647_10002852 | Ga0207647_100028522 | 314 |
| 709 | 3300025904 | Ga0207647_10009210 | Ga0207647_100092103 | 314 |
| 710 | 3300025907 | Ga0207645_10000222 | Ga0207645_1000022229 | 314 |
| 711 | 3300025908 | Ga0207643_10000009 | Ga0207643_1000000941 | 314 |
| 712 | 3300025909 | Ga0207705_10019295 | Ga0207705_100192952 | 314 |
| 713 | 3300025911 | Ga0207654_10001390 | Ga0207654_1000139012 | 314 |
| 714 | 3300025911 | Ga0207654_10054567 | Ga0207654_100545673 | 314 |
| 715 | 3300025912 | Ga0207707_10004174 | Ga0207707_1000417411 | 314 |
| 716 | 3300025913 | Ga0207695_10041473 | Ga0207695_100414735 | 314 |
| 717 | 3300025913 | Ga0207695_10054337 | Ga0207695_100543372 | 314 |
| 718 | 3300025914 | Ga0207671_10003241 | Ga0207671_1000324112 | 314 |
| 719 | 3300025914 | Ga0207671_10321818 | Ga0207671_103218181 | 314 |
| 720 | 3300025916 | Ga0207663_10042477 | Ga0207663_100424773 | 314 |
| 721 | 3300025917 | Ga0207660_10000197 | Ga0207660_1000019711 | 314 |
| 722 | 3300025917 | Ga0207660_10065669 | Ga0207660_100656692 | 314 |
| 723 | 3300025918 | Ga0207662_10001861 | Ga0207662_1000186111 | 314 |
| 724 | 3300025919 | Ga0207657_10000776 | Ga0207657_1000077627 | 314 |
| 725 | 3300025919 | Ga0207657_10040737 | Ga0207657_100407375 | 314 |
| 726 | 3300025919 | Ga0207657_10101928 | Ga0207657_101019282 | 314 |
| 727 | 3300025920 | Ga0207649_10000052 | Ga0207649_1000005289 | 314 |
| 728 | 3300025920 | Ga0207649_10090776 | Ga0207649_100907762 | 314 |
| 729 | 3300025921 | Ga0207652_10001438 | Ga0207652_1000143824 | 314 |
| 730 | 3300025921 | Ga0207652_10028531 | Ga0207652_100285313 | 314 |
| 731 | 3300025925 | Ga0207650_10006131 | Ga0207650_100061313 | 314 |
| 732 | 3300025926 | Ga0207659_10000132 | Ga0207659_1000013225 | 314 |
| 733 | 3300025927 | Ga0207687_10000174 | Ga0207687_1000017424 | 314 |
| 734 | 3300025928 | Ga0207700_10060096 | Ga0207700_100600963 | 314 |
| 735 | 3300025931 | Ga0207644_10000212 | Ga0207644_1000021211 | 314 |
| 736 | 3300025932 | Ga0207690_10000148 | Ga0207690_1000014853 | 314 |
| 737 | 3300025933 | Ga0207706_10001360 | Ga0207706_1000136011 | 314 |
| 738 | 3300025934 | Ga0207686_10001289 | Ga0207686_100012892 | 314 |
| 739 | 3300025935 | Ga0207709_10000530 | Ga0207709_100005306 | 314 |
| 740 | 3300025936 | Ga0207670_10000523 | Ga0207670_1000052325 | 314 |
| 741 | 3300025937 | Ga0207669_10000857 | Ga0207669_1000085710 | 314 |
| 742 | 3300025938 | Ga0207704_10000198 | Ga0207704_1000019840 | 314 |
| 743 | 3300025940 | Ga0207691_10000517 | Ga0207691_1000051715 | 314 |
| 744 | 3300025941 | Ga0207711_10008997 | Ga0207711_100089972 | 314 |
| 745 | 3300025942 | Ga0207689_10000031 | Ga0207689_1000003175 | 314 |
| 746 | 3300025945 | Ga0207679_10000183 | Ga0207679_1000018324 | 314 |
| 747 | 3300025949 | Ga0207667_10057690 | Ga0207667_100576903 | 314 |
| 748 | 3300025949 | Ga0207667_10236604 | Ga0207667_102366042 | 314 |
| 749 | 3300025960 | Ga0207651_10000051 | Ga0207651_1000005142 | 314 |
| 750 | 3300025961 | Ga0207712_10000738 | Ga0207712_1000073811 | 314 |
| 751 | 3300025972 | Ga0207668_10000664 | Ga0207668_1000066424 | 314 |
| 752 | 3300025981 | Ga0207640_10002152 | Ga0207640_100021527 | 314 |
| 753 | 3300025986 | Ga0207658_10016338 | Ga0207658_100163383 | 314 |
| 754 | 3300026023 | Ga0207677_10075252 | Ga0207677_100752522 | 314 |
| 755 | 3300026035 | Ga0207703_10068565 | Ga0207703_100685654 | 314 |
| 756 | 3300026041 | Ga0207639_10001257 | Ga0207639_100012576 | 314 |
| 757 | 3300026041 | Ga0207639_10003583 | Ga0207639_100035837 | 314 |
| 758 | 3300026041 | Ga0207639_10328023 | Ga0207639_103280231 | 314 |
| 759 | 3300026067 | Ga0207678_10000531 | Ga0207678_1000053111 | 314 |
| 760 | 3300026075 | Ga0207708_10000573 | Ga0207708_100005736 | 314 |
| 761 | 3300026078 | Ga0207702_10003284 | Ga0207702_1000328415 | 314 |
| 762 | 3300026078 | Ga0207702_10173574 | Ga0207702_101735743 | 314 |
| 763 | 3300026088 | Ga0207641_10001041 | Ga0207641_100010414 | 314 |
| 764 | 3300026089 | Ga0207648_10000581 | Ga0207648_1000058127 | 314 |
| 765 | 3300026095 | Ga0207676_10000124 | Ga0207676_1000012441 | 314 |
| 766 | 3300026116 | Ga0207674_10000095 | Ga0207674_1000009511 | 314 |
| 767 | 3300026118 | Ga0207675_100000414 | Ga0207675_10000041427 | 314 |
| 768 | 3300026121 | Ga0207683_10000242 | Ga0207683_1000024236 | 314 |
| 769 | 3300026142 | Ga0207698_10000951 | Ga0207698_100009514 | 314 |
| 770 | 3300026142 | Ga0207698_10024205 | Ga0207698_100242052 | 314 |
| 771 | 3300026142 | Ga0207698_10175166 | Ga0207698_101751662 | 314 |
| 772 | 3300027617 | Ga0210002_1001450 | Ga0210002_10014503 | 314 |
| 773 | 3300027876 | Ga0209974_10006235 | Ga0209974_100062354 | 314 |
| 774 | 3300027907 | Ga0207428_10000037 | Ga0207428_10000037190 | 314 |
| 775 | 3300028379 | Ga0268266_10010785 | Ga0268266_100107856 | 314 |
| 776 | 3300028379 | Ga0268266_10046350 | Ga0268266_100463504 | 314 |
| 777 | 3300028380 | Ga0268265_10000757 | Ga0268265_100007575 | 314 |
| 778 | 3300028381 | Ga0268264_10002331 | Ga0268264_100023314 | 314 |
| 779 | 3300031712 | Ga0265342_10000677 | Ga0265342_100006772 | 314 |
| 780 | 3300031730 | Ga0307516_10050383 | Ga0307516_100503832 | 314 |
| 781 | 3300032002 | Ga0307416_100105843 | Ga0307416_1001058433 | 314 |
| 782 | 3300032004 | Ga0307414_10082841 | Ga0307414_100828413 | 314 |
| 783 | 3300034817 | Ga0373948_0011654 | Ga0373948_0011654_119_1063 | 314 |
| 784 | 3300034819 | Ga0373958_0007148 | Ga0373958_0007148_627_1571 | 314 |
| 785 | 3300035090 | Ga0373949_0001199 | Ga0373949_0001199_306_1250 | 314 |
| 786 | 3300035092 | Ga0373952_0008037 | Ga0373952_0008037_270_1214 | 314 |
| 787 | 3300035111 | Ga0373923_0001378 | Ga0373923_0001378_3535_4482 | 314 |
| 788 | 3300035112 | Ga0373932_0001840 | Ga0373932_0001840_3216_4160 | 314 |
| 789 | 3300035114 | Ga0373939_0001777 | Ga0373939_0001777_3768_4712 | 314 |
| 790 | 3300035115 | Ga0373941_0002154 | Ga0373941_0002154_511_1455 | 314 |
| 791 | 3300035121 | Ga0373960_0006378 | Ga0373960_0006378_1561_2505 | 314 |
| 792 | 3300035207 | Ga0373942_0008302 | Ga0373942_0008302_616_1560 | 314 |
| 793 | 3300035241 | Ga0373961_0016882 | Ga0373961_0016882_526_1470 | 314 |
| 794 | 3300035242 | Ga0373962_0000610 | Ga0373962_0000610_4984_5928 | 314 |
| 795 | 3300035691 | Ga0373931_0002178 | Ga0373931_0002178_4158_5102 | 314 |
| 796 | 3300035692 | Ga0373935_0015566 | Ga0373935_0015566_2500_3447 | 314 |
| 797 | 3300035695 | Ga0373927_0000951 | Ga0373927_0000951_21048_21995 | 314 |
| 798 | 3300035725 | Ga0373947_0001613 | Ga0373947_0001613_8560_9507 | 314 |
| 799 | 3300037466 | Ga0395898_0075499 | Ga0395898_0075499_1004_1951 | 314 |
| 800 | 3300037471 | Ga0395905_0003688 | Ga0395905_0003688_10457_11419 | 314 |
| 801 | 3300037471 | Ga0395905_0105739 | Ga0395905_0105739_293_1240 | 314 |
| 802 | 3300037471 | Ga0395905_0124190 | Ga0395905_0124190_669_1616 | 314 |
| 803 | 3300038443 | Ga0395901_0097496 | Ga0395901_0097496_176_1123 | 314 |
| 804 | 3300038443 | Ga0395901_0268937 | Ga0395901_0268937_697_1644 | 314 |
| 805 | 3300044658 | Ga0466972_0015182 | Ga0466972_0015182_1302_2249 | 314 |
| 806 | 3300044683 | Ga0466965_0107678 | Ga0466965_0107678_308_1255 | 314 |
| 807 | 3300044735 | Ga0466968_0175285 | Ga0466968_0175285_26_976 | 314 |
| 808 | 3300044901 | Ga0466960_0026170 | Ga0466960_0026170_453_1400 | 314 |
| 809 | 3300046460 | Ga0495638_0085840 | Ga0495638_0085840_674_1621 | 314 |
| 810 | 3300046462 | Ga0495651_0037130 | Ga0495651_0037130_2680_3627 | 314 |
| 811 | 3300046463 | Ga0495653_0025910 | Ga0495653_0025910_1177_2124 | 314 |
| 812 | 3300046511 | Ga0495608_0049633 | Ga0495608_0049633_746_1693 | 314 |
| 813 | 3300046517 | Ga0495630_0011811 | Ga0495630_0011811_1305_2252 | 314 |
| 814 | 3300046522 | Ga0495643_0001057 | Ga0495643_0001057_26083_27036 | 314 |
| 815 | 3300046522 | Ga0495643_0037183 | Ga0495643_0037183_454_1401 | 314 |
| 816 | 3300046528 | Ga0495642_0099534 | Ga0495642_0099534_181_1134 | 314 |
| 817 | 3300046531 | Ga0495665_0008400 | Ga0495665_0008400_3649_4596 | 314 |
| 818 | 3300046535 | Ga0495586_0013941 | Ga0495586_0013941_3055_4002 | 314 |
| 819 | 3300046542 | Ga0495597_0009494 | Ga0495597_0009494_3678_4631 | 314 |
| 820 | 3300046558 | Ga0495633_0000840 | Ga0495633_0000840_9774_10733 | 314 |
| 821 | 3300046616 | Ga0495668_0035104 | Ga0495668_0035104_1078_2025 | 314 |
| 822 | 3300046616 | Ga0495668_0069815 | Ga0495668_0069815_599_1546 | 314 |
| 823 | 3300046660 | Ga0495625_0257737 | Ga0495625_0257737_158_1105 | 314 |
| 824 | 3300046660 | Ga0495625_0285823 | Ga0495625_0285823_34_981 | 314 |
| 825 | 3300046663 | Ga0495635_0089136 | Ga0495635_0089136_1152_2099 | 314 |
| 826 | 3300046665 | Ga0495661_0009254 | Ga0495661_0009254_252_1205 | 314 |
| 827 | 3300046679 | Ga0495623_0028202 | Ga0495623_0028202_2582_3529 | 314 |
| 828 | 3300046680 | Ga0495646_0069877 | Ga0495646_0069877_66_1013 | 314 |
| 829 | 3300046684 | Ga0495669_0007219 | Ga0495669_0007219_307_1251 | 314 |
| 830 | 3300046810 | Ga0495660_0048035 | Ga0495660_0048035_277_1224 | 314 |
| 831 | 3300047317 | Ga0495604_0015813 | Ga0495604_0015813_4330_5277 | 314 |
| 832 | 3300047319 | Ga0495674_0183316 | Ga0495674_0183316_50_997 | 314 |
| 833 | 3300048089 | Ga0495614_0011254 | Ga0495614_0011254_49_996 | 314 |
| 834 | 3300048903 | Ga0496100_0000345 | Ga0496100_0000345_766_1710 | 314 |
| 835 | 3300048904 | Ga0496101_0000866 | Ga0496101_0000866_12520_13464 | 314 |
| 836 | 3300048905 | Ga0496102_0001833 | Ga0496102_0001833_13767_14711 | 314 |
| 837 | 3300048906 | Ga0496103_0001022 | Ga0496103_0001022_14328_15272 | 314 |
| 838 | 3300048907 | Ga0496104_0072995 | Ga0496104_0072995_392_1336 | 314 |
| 839 | 3300048909 | Ga0496106_0002528 | Ga0496106_0002528_12206_13150 | 314 |
| 840 | 3300048911 | Ga0496108_0006961 | Ga0496108_0006961_7546_8490 | 314 |
| 841 | 3300048911 | Ga0496108_0308844 | Ga0496108_0308844_290_1237 | 314 |
| 842 | 3300048912 | Ga0496109_0002269 | Ga0496109_0002269_2974_3918 | 314 |
| 843 | 3300048913 | Ga0496110_0026044 | Ga0496110_0026044_3765_4709 | 314 |
| 844 | 3300048914 | Ga0496111_0193652 | Ga0496111_0193652_516_1460 | 314 |
| 845 | 3300048915 | Ga0496112_0033949 | Ga0496112_0033949_1757_2704 | 314 |
| 846 | 3300048915 | Ga0496112_0213360 | Ga0496112_0213360_714_1658 | 314 |
| 847 | 3300048916 | Ga0496113_0324098 | Ga0496113_0324098_275_1219 | 314 |
| 848 | 3300048917 | Ga0496114_0093376 | Ga0496114_0093376_221_1165 | 314 |
| 849 | 3300048918 | Ga0496115_0000967 | Ga0496115_0000967_15537_16481 | 314 |
| 850 | 3300048918 | Ga0496115_0012638 | Ga0496115_0012638_4095_5057 | 314 |
| 851 | 3300048920 | Ga0496117_0203750 | Ga0496117_0203750_80_1027 | 314 |
| 852 | 3300048923 | Ga0496120_0002681 | Ga0496120_0002681_14762_15709 | 314 |
| 853 | 3300048923 | Ga0496120_0053840 | Ga0496120_0053840_1125_2072 | 314 |
| 854 | 3300048925 | Ga0496122_0002952 | Ga0496122_0002952_19162_20121 | 314 |
| 855 | 3300048926 | Ga0496123_0002116 | Ga0496123_0002116_1450_2409 | 314 |
| 856 | 3300048929 | Ga0496126_0010620 | Ga0496126_0010620_4448_5395 | 314 |
| 857 | 3300049568 | Ga0501031_0006154 | Ga0501031_0006154_3024_3974 | 314 |
| 858 | 3300049569 | Ga0501032_0000029 | Ga0501032_0000029_77126_78076 | 314 |
| 859 | 3300049569 | Ga0501032_0063621 | Ga0501032_0063621_1172_2128 | 314 |
| 860 | 3300049570 | Ga0501033_0000168 | Ga0501033_0000168_15710_16660 | 314 |
| 861 | 3300049570 | Ga0501033_0011727 | Ga0501033_0011727_3701_4657 | 314 |
| 862 | 3300049571 | Ga0501034_0000434 | Ga0501034_0000434_15711_16661 | 314 |
| 863 | 3300049571 | Ga0501034_0021075 | Ga0501034_0021075_3701_4657 | 314 |
| 864 | 3300049572 | Ga0501036_0000999 | Ga0501036_0000999_8904_9854 | 314 |
| 865 | 3300049572 | Ga0501036_0011708 | Ga0501036_0011708_947_1891 | 314 |
| 866 | 3300049572 | Ga0501036_0238748 | Ga0501036_0238748_342_1298 | 314 |
| 867 | 3300049573 | Ga0501037_0000872 | Ga0501037_0000872_12778_13728 | 314 |
| 868 | 3300049573 | Ga0501037_0025532 | Ga0501037_0025532_2999_3955 | 314 |
| 869 | 3300049574 | Ga0501038_0000397 | Ga0501038_0000397_27583_28533 | 314 |
| 870 | 3300049574 | Ga0501038_0064483 | Ga0501038_0064483_123_1079 | 314 |
| 871 | 3300049575 | Ga0501039_0000040 | Ga0501039_0000040_61174_62124 | 314 |
| 872 | 3300049575 | Ga0501039_0017409 | Ga0501039_0017409_2803_3747 | 314 |
| 873 | 3300049575 | Ga0501039_0020496 | Ga0501039_0020496_410_1366 | 314 |
| 874 | 3300049576 | Ga0501040_0021742 | Ga0501040_0021742_2451_3407 | 314 |
| 875 | 3300049578 | Ga0501042_0280874 | Ga0501042_0280874_129_1085 | 314 |
| 876 | 3300049579 | Ga0501043_0000560 | Ga0501043_0000560_23694_24644 | 314 |
| 877 | 3300049580 | Ga0501046_0027824 | Ga0501046_0027824_1007_1963 | 314 |
| 878 | 3300049580 | Ga0501046_0029478 | Ga0501046_0029478_3420_4364 | 314 |
| 879 | 3300049580 | Ga0501046_0055891 | Ga0501046_0055891_886_1836 | 314 |
| 880 | 3300049581 | Ga0501047_0013069 | Ga0501047_0013069_3217_4161 | 314 |
| 881 | 3300049581 | Ga0501047_0028366 | Ga0501047_0028366_3047_4003 | 314 |
| 882 | 3300049581 | Ga0501047_0080796 | Ga0501047_0080796_506_1456 | 314 |
| 883 | 3300049581 | Ga0501047_0086031 | Ga0501047_0086031_1628_2572 | 314 |
| 884 | 3300049582 | Ga0501048_0018257 | Ga0501048_0018257_292_1236 | 314 |
| 885 | 3300049583 | Ga0501067_0107194 | Ga0501067_0107194_574_1530 | 314 |
| 886 | 3300049584 | Ga0501068_0008698 | Ga0501068_0008698_4082_5038 | 314 |
| 887 | 3300049586 | Ga0501070_0006925 | Ga0501070_0006925_5231_6175 | 314 |
| 888 | 3300049586 | Ga0501070_0054553 | Ga0501070_0054553_2331_3287 | 314 |
| 889 | 3300049586 | Ga0501070_0291310 | Ga0501070_0291310_12_956 | 314 |
| 890 | 3300049587 | Ga0501071_0056645 | Ga0501071_0056645_704_1660 | 314 |
| 891 | 3300049587 | Ga0501071_0091436 | Ga0501071_0091436_611_1555 | 314 |
| 892 | 3300049589 | Ga0501073_0095188 | Ga0501073_0095188_714_1670 | 314 |
| 893 | 3300049590 | Ga0501074_0080424 | Ga0501074_0080424_679_1635 | 314 |
| 894 | 3300049590 | Ga0501074_0116677 | Ga0501074_0116677_842_1786 | 314 |
| 895 | 3300049742 | Ga0501080_0028000 | Ga0501080_0028000_3278_4234 | 314 |
| 896 | 3300049744 | Ga0501083_0034611 | Ga0501083_0034611_596_1540 | 314 |
| 897 | 3300049822 | Ga0501035_0000144 | Ga0501035_0000144_11593_12543 | 314 |
| 898 | 3300049822 | Ga0501035_0017005 | Ga0501035_0017005_2046_3002 | 314 |
| 899 | 3300049822 | Ga0501035_0024179 | Ga0501035_0024179_2864_3808 | 314 |
| 900 | 3300049822 | Ga0501035_0203969 | Ga0501035_0203969_446_1390 | 314 |
| 901 | 3300049823 | Ga0501044_0005957 | Ga0501044_0005957_8966_9916 | 314 |
| 902 | 3300049823 | Ga0501044_0022594 | Ga0501044_0022594_2046_3002 | 314 |
| 903 | 3300049823 | Ga0501044_0061369 | Ga0501044_0061369_1764_2708 | 314 |
| 904 | 3300049823 | Ga0501044_0072080 | Ga0501044_0072080_64_1011 | 314 |
| 905 | 3300050491 | nmdc:mga00v17_5132_c1 | nmdc:mga00v17_5132_c1_3222_4169 | 314 |
| 906 | 3300050492 | nmdc:mga0yw44_1475_c1 | nmdc:mga0yw44_1475_c1_6146_7093 | 314 |
| 907 | 3300050492 | nmdc:mga0yw44_16078_c1 | nmdc:mga0yw44_16078_c1_1143_2114 | 314 |
| 908 | 3300050492 | nmdc:mga0yw44_186545_c1 | nmdc:mga0yw44_186545_c1_110_1057 | 314 |
| 909 | 3300050494 | nmdc:mga06z11_276429_c1 | nmdc:mga06z11_276429_c1_27_974 | 314 |
| 910 | 3300050494 | nmdc:mga06z11_28859_c1 | nmdc:mga06z11_28859_c1_442_1386 | 314 |
| 911 | 3300050496 | nmdc:mga07m45_14713_c1 | nmdc:mga07m45_14713_c1_1556_2503 | 314 |
| 912 | 3300050496 | nmdc:mga07m45_147922_c1 | nmdc:mga07m45_147922_c1_319_1266 | 314 |
| 913 | 3300050507 | nmdc:mga05p37_540205_c1 | nmdc:mga05p37_540205_c1_101_1063 | 314 |
| 914 | 3300050511 | nmdc:mga08y16_333_c1 | nmdc:mga08y16_333_c1_17067_18011 | 314 |
| 915 | 3300050512 | nmdc:mga0n895_1174_c1 | nmdc:mga0n895_1174_c1_18199_19143 | 314 |
| 916 | 3300050513 | nmdc:mga0rr50_135891_c1 | nmdc:mga0rr50_135891_c1_704_1648 | 314 |
| 917 | 3300050516 | nmdc:mga0sz30_25203_c1 | nmdc:mga0sz30_25203_c1_535_1482 | 314 |
| 918 | 3300053078 | Ga0495612_0012061 | Ga0495612_0012061_151_1098 | 314 |
| 919 | 3300053079 | Ga0500610_0019799 | Ga0500610_0019799_640_1587 | 314 |
| 920 | 3300053083 | Ga0495655_0005186 | Ga0495655_0005186_556_1503 | 314 |
| 921 | 3300053096 | Ga0500641_0010774 | Ga0500641_0010774_2320_3267 | 314 |
| 922 | 3300053119 | Ga0500595_026251 | Ga0500595_026251_736_1683 | 314 |
| 923 | 3300053155 | Ga0500620_000454 | Ga0500620_000454_3471_4418 | 314 |
| 924 | 3300053155 | Ga0500620_001650 | Ga0500620_001650_349_1296 | 314 |
| 925 | 3300053158 | Ga0500627_0015934 | Ga0500627_0015934_493_1473 | 314 |
| 926 | 3300053731 | Ga0500609_008607 | Ga0500609_008607_105_1052 | 314 |
| 927 | 2209111006 | 2214711591 | 2213723600 | 315 |
| 928 | 3300000041 | ARcpr5oldR_c000035 | ARcpr5oldR_0000354 | 315 |
| 929 | 3300000042 | ARSoilYngRDRAFT_c00458 | ARSoilYngRDRAFT_004584 | 315 |
| 930 | 3300000044 | ARSoilOldRDRAFT_c000053 | ARSoilOldRDRAFT_00005330 | 315 |
| 931 | 3300000652 | ARCol0yngRDRAFT_1000025 | ARCol0yngRDRAFT_100002534 | 315 |
| 932 | 3300001990 | JGI24737J22298_10004052 | JGI24737J22298_100040525 | 315 |
| 933 | 3300005290 | Ga0065712_10071633 | Ga0065712_100716334 | 315 |
| 934 | 3300005293 | Ga0065715_10003868 | Ga0065715_100038689 | 315 |
| 935 | 3300005327 | Ga0070658_10011015 | Ga0070658_100110155 | 315 |
| 936 | 3300005327 | Ga0070658_10019708 | Ga0070658_100197083 | 315 |
| 937 | 3300005329 | Ga0070683_100341950 | Ga0070683_1003419502 | 315 |
| 938 | 3300005336 | Ga0070680_100121685 | Ga0070680_1001216851 | 315 |
| 939 | 3300005340 | Ga0070689_100043413 | Ga0070689_1000434134 | 315 |
| 940 | 3300005341 | Ga0070691_10113767 | Ga0070691_101137671 | 315 |
| 941 | 3300005344 | Ga0070661_100102973 | Ga0070661_1001029731 | 315 |
| 942 | 3300005364 | Ga0070673_100012960 | Ga0070673_1000129602 | 315 |
| 943 | 3300005365 | Ga0070688_100000991 | Ga0070688_1000009913 | 315 |
| 944 | 3300005435 | Ga0070714_100030068 | Ga0070714_1000300683 | 315 |
| 945 | 3300005436 | Ga0070713_100008870 | Ga0070713_1000088703 | 315 |
| 946 | 3300005436 | Ga0070713_100052266 | Ga0070713_1000522662 | 315 |
| 947 | 3300005438 | Ga0070701_10211640 | Ga0070701_102116402 | 315 |
| 948 | 3300005439 | Ga0070711_100053807 | Ga0070711_1000538074 | 315 |
| 949 | 3300005439 | Ga0070711_100177141 | Ga0070711_1001771412 | 315 |
| 950 | 3300005441 | Ga0070700_100017272 | Ga0070700_1000172722 | 315 |
| 951 | 3300005457 | Ga0070662_100015465 | Ga0070662_1000154654 | 315 |
| 952 | 3300005457 | Ga0070662_100031459 | Ga0070662_1000314592 | 315 |
| 953 | 3300005458 | Ga0070681_10038476 | Ga0070681_100384764 | 315 |
| 954 | 3300005458 | Ga0070681_10049176 | Ga0070681_100491763 | 315 |
| 955 | 3300005459 | Ga0068867_100159729 | Ga0068867_1001597291 | 315 |
| 956 | 3300005530 | Ga0070679_100100453 | Ga0070679_1001004533 | 315 |
| 957 | 3300005530 | Ga0070679_100171854 | Ga0070679_1001718543 | 315 |
| 958 | 3300005530 | Ga0070679_100419515 | Ga0070679_1004195151 | 315 |
| 959 | 3300005539 | Ga0068853_100051530 | Ga0068853_1000515301 | 315 |
| 960 | 3300005544 | Ga0070686_100007788 | Ga0070686_1000077882 | 315 |
| 961 | 3300005544 | Ga0070686_100279823 | Ga0070686_1002798232 | 315 |
| 962 | 3300005545 | Ga0070695_100148466 | Ga0070695_1001484661 | 315 |
| 963 | 3300005546 | Ga0070696_100134489 | Ga0070696_1001344892 | 315 |
| 964 | 3300005549 | Ga0070704_100017774 | Ga0070704_1000177745 | 315 |
| 965 | 3300005563 | Ga0068855_100040932 | Ga0068855_1000409323 | 315 |
| 966 | 3300005614 | Ga0068856_100039818 | Ga0068856_1000398187 | 315 |
| 967 | 3300005616 | Ga0068852_100050517 | Ga0068852_1000505173 | 315 |
| 968 | 3300005617 | Ga0068859_100008773 | Ga0068859_1000087735 | 315 |
| 969 | 3300005842 | Ga0068858_100228418 | Ga0068858_1002284182 | 315 |
| 970 | 3300005843 | Ga0068860_100049862 | Ga0068860_1000498623 | 315 |
| 971 | 3300005844 | Ga0068862_100006290 | Ga0068862_1000062903 | 315 |
| 972 | 3300005937 | Ga0081455_10000048 | Ga0081455_1000004873 | 315 |
| 973 | 3300005937 | Ga0081455_10021067 | Ga0081455_100210673 | 315 |
| 974 | 3300005937 | Ga0081455_10102220 | Ga0081455_101022202 | 315 |
| 975 | 3300006028 | Ga0070717_10220513 | Ga0070717_102205133 | 315 |
| 976 | 3300006163 | Ga0070715_10068351 | Ga0070715_100683512 | 315 |
| 977 | 3300006175 | Ga0070712_100019604 | Ga0070712_1000196042 | 315 |
| 978 | 3300006237 | Ga0097621_100006173 | Ga0097621_1000061739 | 315 |
| 979 | 3300006844 | Ga0075428_100028450 | Ga0075428_1000284503 | 315 |
| 980 | 3300006846 | Ga0075430_100000196 | Ga0075430_10000019612 | 315 |
| 981 | 3300006847 | Ga0075431_100001183 | Ga0075431_10000118328 | 315 |
| 982 | 3300006852 | Ga0075433_10000991 | Ga0075433_1000099127 | 315 |
| 983 | 3300006871 | Ga0075434_100001106 | Ga0075434_10000110612 | 315 |
| 984 | 3300006871 | Ga0075434_100047743 | Ga0075434_1000477435 | 315 |
| 985 | 3300006931 | Ga0097620_100008773 | Ga0097620_1000087735 | 315 |
| 986 | 3300007076 | Ga0075435_100066202 | Ga0075435_1000662024 | 315 |
| 987 | 3300009093 | Ga0105240_10079927 | Ga0105240_100799274 | 315 |
| 988 | 3300009094 | Ga0111539_10000683 | Ga0111539_1000068342 | 315 |
| 989 | 3300009094 | Ga0111539_10004804 | Ga0111539_100048045 | 315 |
| 990 | 3300009098 | Ga0105245_10308175 | Ga0105245_103081752 | 315 |
| 991 | 3300009101 | Ga0105247_10015215 | Ga0105247_100152156 | 315 |
| 992 | 3300009147 | Ga0114129_10036793 | Ga0114129_100367937 | 315 |
| 993 | 3300009176 | Ga0105242_10029797 | Ga0105242_100297976 | 315 |
| 994 | 3300009177 | Ga0105248_10020934 | Ga0105248_100209345 | 315 |
| 995 | 3300009545 | Ga0105237_10072571 | Ga0105237_100725712 | 315 |
| 996 | 3300009551 | Ga0105238_10053124 | Ga0105238_100531244 | 315 |
| 997 | 3300009553 | Ga0105249_10006960 | Ga0105249_100069609 | 315 |
| 998 | 3300010375 | Ga0105239_10083831 | Ga0105239_100838314 | 315 |
| 999 | 3300013102 | Ga0157371_10093722 | Ga0157371_100937222 | 315 |
| 1000 | 3300013102 | Ga0157371_10192287 | Ga0157371_101922871 | 315 |
| 1001 | 3300013306 | Ga0163162_10066320 | Ga0163162_100663202 | 315 |
| 1002 | 3300013307 | Ga0157372_10048370 | Ga0157372_100483707 | 315 |
| 1003 | 3300013308 | Ga0157375_10268905 | Ga0157375_102689052 | 315 |
| 1004 | 3300014325 | Ga0163163_10102744 | Ga0163163_101027442 | 315 |
| 1005 | 3300014968 | Ga0157379_10024668 | Ga0157379_100246681 | 315 |
| 1006 | 3300014968 | Ga0157379_10065966 | Ga0157379_100659662 | 315 |
| 1007 | 3300014968 | Ga0157379_10141716 | Ga0157379_101417162 | 315 |
| 1008 | 3300020082 | Ga0206353_10023203 | Ga0206353_100232032 | 315 |
| 1009 | 3300025261 | Ga0209233_1009332 | Ga0209233_10093322 | 315 |
| 1010 | 3300025271 | Ga0207666_1000396 | Ga0207666_10003966 | 315 |
| 1011 | 3300025315 | Ga0207697_10005956 | Ga0207697_100059564 | 315 |
| 1012 | 3300025885 | Ga0207653_10066499 | Ga0207653_100664992 | 315 |
| 1013 | 3300025901 | Ga0207688_10015574 | Ga0207688_100155743 | 315 |
| 1014 | 3300025904 | Ga0207647_10020047 | Ga0207647_100200474 | 315 |
| 1015 | 3300025905 | Ga0207685_10023072 | Ga0207685_100230721 | 315 |
| 1016 | 3300025909 | Ga0207705_10135527 | Ga0207705_101355272 | 315 |
| 1017 | 3300025912 | Ga0207707_10007205 | Ga0207707_100072053 | 315 |
| 1018 | 3300025912 | Ga0207707_10095845 | Ga0207707_100958451 | 315 |
| 1019 | 3300025912 | Ga0207707_10098046 | Ga0207707_100980464 | 315 |
| 1020 | 3300025914 | Ga0207671_10167142 | Ga0207671_101671422 | 315 |
| 1021 | 3300025915 | Ga0207693_10056703 | Ga0207693_100567033 | 315 |
| 1022 | 3300025916 | Ga0207663_10027568 | Ga0207663_100275683 | 315 |
| 1023 | 3300025917 | Ga0207660_10029243 | Ga0207660_100292432 | 315 |
| 1024 | 3300025917 | Ga0207660_10040842 | Ga0207660_100408423 | 315 |
| 1025 | 3300025918 | Ga0207662_10002878 | Ga0207662_100028789 | 315 |
| 1026 | 3300025919 | Ga0207657_10042331 | Ga0207657_100423312 | 315 |
| 1027 | 3300025919 | Ga0207657_10087807 | Ga0207657_100878072 | 315 |
| 1028 | 3300025921 | Ga0207652_10092441 | Ga0207652_100924412 | 315 |
| 1029 | 3300025925 | Ga0207650_10110205 | Ga0207650_101102053 | 315 |
| 1030 | 3300025926 | Ga0207659_10118645 | Ga0207659_101186451 | 315 |
| 1031 | 3300025928 | Ga0207700_10205857 | Ga0207700_102058572 | 315 |
| 1032 | 3300025929 | Ga0207664_10293125 | Ga0207664_102931252 | 315 |
| 1033 | 3300025932 | Ga0207690_10023203 | Ga0207690_100232032 | 315 |
| 1034 | 3300025933 | Ga0207706_10025201 | Ga0207706_100252013 | 315 |
| 1035 | 3300025933 | Ga0207706_10049341 | Ga0207706_100493414 | 315 |
| 1036 | 3300025936 | Ga0207670_10047836 | Ga0207670_100478362 | 315 |
| 1037 | 3300025937 | Ga0207669_10276148 | Ga0207669_102761482 | 315 |
| 1038 | 3300025939 | Ga0207665_10026454 | Ga0207665_100264544 | 315 |
| 1039 | 3300025944 | Ga0207661_10189859 | Ga0207661_101898592 | 315 |
| 1040 | 3300025945 | Ga0207679_10087436 | Ga0207679_100874362 | 315 |
| 1041 | 3300025949 | Ga0207667_10153953 | Ga0207667_101539532 | 315 |
| 1042 | 3300025961 | Ga0207712_10056531 | Ga0207712_100565312 | 315 |
| 1043 | 3300025986 | Ga0207658_10094760 | Ga0207658_100947602 | 315 |
| 1044 | 3300026035 | Ga0207703_10155946 | Ga0207703_101559462 | 315 |
| 1045 | 3300026035 | Ga0207703_10222027 | Ga0207703_102220272 | 315 |
| 1046 | 3300026075 | Ga0207708_10006283 | Ga0207708_100062836 | 315 |
| 1047 | 3300026089 | Ga0207648_10080415 | Ga0207648_100804154 | 315 |
| 1048 | 3300026116 | Ga0207674_10136790 | Ga0207674_101367902 | 315 |
| 1049 | 3300026118 | Ga0207675_100033910 | Ga0207675_1000339102 | 315 |
| 1050 | 3300026121 | Ga0207683_10009390 | Ga0207683_100093904 | 315 |
| 1051 | 3300026142 | Ga0207698_10045410 | Ga0207698_100454103 | 315 |
| 1052 | 3300027665 | Ga0209983_1015293 | Ga0209983_10152932 | 315 |
| 1053 | 3300027695 | Ga0209966_1001052 | Ga0209966_10010523 | 315 |
| 1054 | 3300027717 | Ga0209998_10021989 | Ga0209998_100219892 | 315 |
| 1055 | 3300027907 | Ga0207428_10001217 | Ga0207428_1000121713 | 315 |
| 1056 | 3300027907 | Ga0207428_10001773 | Ga0207428_1000177313 | 315 |
| 1057 | 3300028380 | Ga0268265_10101042 | Ga0268265_101010423 | 315 |
| 1058 | 3300028556 | Ga0265337_1000827 | Ga0265337_100082714 | 315 |
| 1059 | 3300031241 | Ga0265325_10000049 | Ga0265325_100000495 | 315 |
| 1060 | 3300031241 | Ga0265325_10000449 | Ga0265325_1000044940 | 315 |
| 1061 | 3300031344 | Ga0265316_10171026 | Ga0265316_101710262 | 315 |
| 1062 | 3300031595 | Ga0265313_10000367 | Ga0265313_1000036741 | 315 |
| 1063 | 3300031595 | Ga0265313_10015742 | Ga0265313_100157422 | 315 |
| 1064 | 3300032133 | Ga0316583_10000628 | Ga0316583_100006284 | 315 |
| 1065 | 3300034816 | Ga0373930_0000371 | Ga0373930_0000371_2907_3854 | 315 |
| 1066 | 3300034817 | Ga0373948_0000135 | Ga0373948_0000135_3573_4520 | 315 |
| 1067 | 3300034818 | Ga0373950_0000327 | Ga0373950_0000327_2620_3567 | 315 |
| 1068 | 3300034818 | Ga0373950_0008917 | Ga0373950_0008917_522_1472 | 315 |
| 1069 | 3300034819 | Ga0373958_0000084 | Ga0373958_0000084_2847_3794 | 315 |
| 1070 | 3300034819 | Ga0373958_0008916 | Ga0373958_0008916_113_1060 | 315 |
| 1071 | 3300034957 | Ga0373938_0000013 | Ga0373938_0000013_17714_18661 | 315 |
| 1072 | 3300035084 | Ga0373928_0001053 | Ga0373928_0001053_186_1133 | 315 |
| 1073 | 3300035086 | Ga0373934_0020165 | Ga0373934_0020165_1357_2304 | 315 |
| 1074 | 3300035088 | Ga0373940_0002191 | Ga0373940_0002191_1195_2142 | 315 |
| 1075 | 3300035090 | Ga0373949_0001274 | Ga0373949_0001274_5038_5985 | 315 |
| 1076 | 3300035092 | Ga0373952_0000880 | Ga0373952_0000880_1184_2131 | 315 |
| 1077 | 3300035115 | Ga0373941_0000125 | Ga0373941_0000125_11293_12240 | 315 |
| 1078 | 3300035117 | Ga0373953_0005292 | Ga0373953_0005292_805_1803 | 315 |
| 1079 | 3300035119 | Ga0373956_0004976 | Ga0373956_0004976_441_1439 | 315 |
| 1080 | 3300035120 | Ga0373957_0028363 | Ga0373957_0028363_360_1358 | 315 |
| 1081 | 3300035172 | Ga0373955_0009608 | Ga0373955_0009608_3577_4524 | 315 |
| 1082 | 3300035241 | Ga0373961_0000638 | Ga0373961_0000638_737_1684 | 315 |
| 1083 | 3300035242 | Ga0373962_0000542 | Ga0373962_0000542_1076_2023 | 315 |
| 1084 | 3300035724 | Ga0373933_0003247 | Ga0373933_0003247_6702_7649 | 315 |
| 1085 | 3300035724 | Ga0373933_0011036 | Ga0373933_0011036_450_1448 | 315 |
| 1086 | 3300035725 | Ga0373947_0116294 | Ga0373947_0116294_421_1368 | 315 |
| 1087 | 3300036401 | Ga0373937_0003502 | Ga0373937_0003502_1626_2573 | 315 |
| 1088 | 3300036401 | Ga0373937_0073217 | Ga0373937_0073217_675_1622 | 315 |
| 1089 | 3300036401 | Ga0373937_0361944 | Ga0373937_0361944_210_1157 | 315 |
| 1090 | 3300037068 | Ga0373925_0004688 | Ga0373925_0004688_7002_7949 | 315 |
| 1091 | 3300037068 | Ga0373925_0094420 | Ga0373925_0094420_1027_1974 | 315 |
| 1092 | 3300038996 | Ga0242420_002459 | Ga0242420_002459_1032_1979 | 315 |
| 1093 | 3300042001 | Ga0439441_010371 | Ga0439441_010371_168_1115 | 315 |
| 1094 | 3300042016 | Ga0439463_025969 | Ga0439463_025969_366_1313 | 315 |
| 1095 | 3300042439 | Ga0439464_0036453 | Ga0439464_0036453_238_1185 | 315 |
| 1096 | 3300044694 | Ga0466963_0006183 | Ga0466963_0006183_1963_2958 | 315 |
| 1097 | 3300044712 | Ga0453684_0117665 | Ga0453684_0117665_795_1742 | 315 |
| 1098 | 3300044842 | Ga0466957_0082975 | Ga0466957_0082975_775_1770 | 315 |
| 1099 | 3300045051 | Ga0451576_0006125 | Ga0451576_0006125_1263_2210 | 315 |
| 1100 | 3300045976 | Ga0466967_0146415 | Ga0466967_0146415_725_1720 | 315 |
| 1101 | 3300046454 | Ga0495592_0063389 | Ga0495592_0063389_1164_2111 | 315 |
| 1102 | 3300046459 | Ga0495629_0046557 | Ga0495629_0046557_1469_2416 | 315 |
| 1103 | 3300046462 | Ga0495651_0001390 | Ga0495651_0001390_4531_5529 | 315 |
| 1104 | 3300046462 | Ga0495651_0003040 | Ga0495651_0003040_11468_12415 | 315 |
| 1105 | 3300046463 | Ga0495653_0002914 | Ga0495653_0002914_218_1216 | 315 |
| 1106 | 3300046463 | Ga0495653_0237990 | Ga0495653_0237990_47_1006 | 315 |
| 1107 | 3300046477 | Ga0495664_0050005 | Ga0495664_0050005_302_1249 | 315 |
| 1108 | 3300046499 | Ga0495594_0085893 | Ga0495594_0085893_109_1056 | 315 |
| 1109 | 3300046511 | Ga0495608_0002575 | Ga0495608_0002575_1764_2762 | 315 |
| 1110 | 3300046511 | Ga0495608_0188263 | Ga0495608_0188263_96_1043 | 315 |
| 1111 | 3300046514 | Ga0495618_0033729 | Ga0495618_0033729_1737_2735 | 315 |
| 1112 | 3300046514 | Ga0495618_0199864 | Ga0495618_0199864_284_1231 | 315 |
| 1113 | 3300046516 | Ga0495628_0018554 | Ga0495628_0018554_3531_4478 | 315 |
| 1114 | 3300046517 | Ga0495630_0381737 | Ga0495630_0381737_120_1067 | 315 |
| 1115 | 3300046529 | Ga0495652_0017992 | Ga0495652_0017992_3062_4009 | 315 |
| 1116 | 3300046529 | Ga0495652_0114884 | Ga0495652_0114884_97_1095 | 315 |
| 1117 | 3300046531 | Ga0495665_0051314 | Ga0495665_0051314_237_1184 | 315 |
| 1118 | 3300046533 | Ga0495640_0004112 | Ga0495640_0004112_1707_2705 | 315 |
| 1119 | 3300046533 | Ga0495640_0016677 | Ga0495640_0016677_3289_4248 | 315 |
| 1120 | 3300046536 | Ga0495587_0000592 | Ga0495587_0000592_22099_23097 | 315 |
| 1121 | 3300046543 | Ga0495645_0009188 | Ga0495645_0009188_2790_3737 | 315 |
| 1122 | 3300046559 | Ga0495667_0015047 | Ga0495667_0015047_3684_4682 | 315 |
| 1123 | 3300046559 | Ga0495667_0066259 | Ga0495667_0066259_1204_2151 | 315 |
| 1124 | 3300046559 | Ga0495667_0131527 | Ga0495667_0131527_553_1500 | 315 |
| 1125 | 3300046675 | Ga0495657_0034526 | Ga0495657_0034526_2010_2957 | 315 |
| 1126 | 3300046675 | Ga0495657_0044791 | Ga0495657_0044791_13_960 | 315 |
| 1127 | 3300046679 | Ga0495623_0000569 | Ga0495623_0000569_1385_2383 | 315 |
| 1128 | 3300046679 | Ga0495623_0120930 | Ga0495623_0120930_531_1478 | 315 |
| 1129 | 3300046680 | Ga0495646_0013966 | Ga0495646_0013966_3170_4168 | 315 |
| 1130 | 3300046680 | Ga0495646_0072760 | Ga0495646_0072760_342_1289 | 315 |
| 1131 | 3300046689 | Ga0495613_0133762 | Ga0495613_0133762_271_1269 | 315 |
| 1132 | 3300046809 | Ga0495600_0021660 | Ga0495600_0021660_682_1680 | 315 |
| 1133 | 3300046809 | Ga0495600_0162683 | Ga0495600_0162683_83_1030 | 315 |
| 1134 | 3300047315 | Ga0495581_0075165 | Ga0495581_0075165_696_1643 | 315 |
| 1135 | 3300047317 | Ga0495604_0126039 | Ga0495604_0126039_454_1401 | 315 |
| 1136 | 3300047319 | Ga0495674_0060491 | Ga0495674_0060491_1706_2665 | 315 |
| 1137 | 3300047319 | Ga0495674_0091058 | Ga0495674_0091058_1385_2383 | 315 |
| 1138 | 3300047321 | Ga0495676_0078385 | Ga0495676_0078385_430_1428 | 315 |
| 1139 | 3300047322 | Ga0495680_0013849 | Ga0495680_0013849_5291_6250 | 315 |
| 1140 | 3300047322 | Ga0495680_0016164 | Ga0495680_0016164_290_1237 | 315 |
| 1141 | 3300047322 | Ga0495680_0017538 | Ga0495680_0017538_1250_2248 | 315 |
| 1142 | 3300047444 | Ga0495675_0000815 | Ga0495675_0000815_16190_17188 | 315 |
| 1143 | 3300047444 | Ga0495675_0125243 | Ga0495675_0125243_51_998 | 315 |
| 1144 | 3300047471 | Ga0495684_0013859 | Ga0495684_0013859_305_1303 | 315 |
| 1145 | 3300047471 | Ga0495684_0067831 | Ga0495684_0067831_1556_2503 | 315 |
| 1146 | 3300048088 | Ga0495602_0075852 | Ga0495602_0075852_73_1032 | 315 |
| 1147 | 3300048905 | Ga0496102_0149148 | Ga0496102_0149148_185_1132 | 315 |
| 1148 | 3300048906 | Ga0496103_0011074 | Ga0496103_0011074_1882_2880 | 315 |
| 1149 | 3300048906 | Ga0496103_0114002 | Ga0496103_0114002_492_1439 | 315 |
| 1150 | 3300048907 | Ga0496104_0000399 | Ga0496104_0000399_14801_15859 | 315 |
| 1151 | 3300048907 | Ga0496104_0019547 | Ga0496104_0019547_3292_4290 | 315 |
| 1152 | 3300048907 | Ga0496104_0183110 | Ga0496104_0183110_229_1176 | 315 |
| 1153 | 3300048908 | Ga0496105_0007591 | Ga0496105_0007591_5987_7045 | 315 |
| 1154 | 3300048908 | Ga0496105_0277548 | Ga0496105_0277548_203_1150 | 315 |
| 1155 | 3300048909 | Ga0496106_0046057 | Ga0496106_0046057_1889_2836 | 315 |
| 1156 | 3300048910 | Ga0496107_0045820 | Ga0496107_0045820_434_1381 | 315 |
| 1157 | 3300048911 | Ga0496108_0107612 | Ga0496108_0107612_373_1320 | 315 |
| 1158 | 3300048911 | Ga0496108_0195394 | Ga0496108_0195394_414_1361 | 315 |
| 1159 | 3300048912 | Ga0496109_0002193 | Ga0496109_0002193_4726_5673 | 315 |
| 1160 | 3300048912 | Ga0496109_0309053 | Ga0496109_0309053_185_1132 | 315 |
| 1161 | 3300048915 | Ga0496112_0003327 | Ga0496112_0003327_5362_6309 | 315 |
| 1162 | 3300048916 | Ga0496113_0003576 | Ga0496113_0003576_893_1840 | 315 |
| 1163 | 3300048917 | Ga0496114_0019405 | Ga0496114_0019405_2963_3961 | 315 |
| 1164 | 3300049569 | Ga0501032_0070967 | Ga0501032_0070967_1069_2016 | 315 |
| 1165 | 3300049571 | Ga0501034_0011360 | Ga0501034_0011360_7202_8149 | 315 |
| 1166 | 3300049571 | Ga0501034_0135160 | Ga0501034_0135160_944_1894 | 315 |
| 1167 | 3300049572 | Ga0501036_0000444 | Ga0501036_0000444_13307_14254 | 315 |
| 1168 | 3300049573 | Ga0501037_0104914 | Ga0501037_0104914_775_1818 | 315 |
| 1169 | 3300049573 | Ga0501037_0134748 | Ga0501037_0134748_126_1073 | 315 |
| 1170 | 3300049574 | Ga0501038_0069640 | Ga0501038_0069640_669_1712 | 315 |
| 1171 | 3300049575 | Ga0501039_0228716 | Ga0501039_0228716_390_1337 | 315 |
| 1172 | 3300049579 | Ga0501043_0056663 | Ga0501043_0056663_1848_2891 | 315 |
| 1173 | 3300049579 | Ga0501043_0085563 | Ga0501043_0085563_1405_2352 | 315 |
| 1174 | 3300049580 | Ga0501046_0042624 | Ga0501046_0042624_872_1915 | 315 |
| 1175 | 3300049580 | Ga0501046_0113288 | Ga0501046_0113288_691_1638 | 315 |
| 1176 | 3300049581 | Ga0501047_0000235 | Ga0501047_0000235_41826_42773 | 315 |
| 1177 | 3300049581 | Ga0501047_0085667 | Ga0501047_0085667_1635_2678 | 315 |
| 1178 | 3300049582 | Ga0501048_0001478 | Ga0501048_0001478_3089_4036 | 315 |
| 1179 | 3300049582 | Ga0501048_0184007 | Ga0501048_0184007_378_1421 | 315 |
| 1180 | 3300049586 | Ga0501070_0016166 | Ga0501070_0016166_1114_2061 | 315 |
| 1181 | 3300049586 | Ga0501070_0079535 | Ga0501070_0079535_1187_2137 | 315 |
| 1182 | 3300049588 | Ga0501072_0122600 | Ga0501072_0122600_640_1587 | 315 |
| 1183 | 3300049590 | Ga0501074_0015817 | Ga0501074_0015817_1351_2298 | 315 |
| 1184 | 3300049741 | Ga0501079_0400073 | Ga0501079_0400073_100_1047 | 315 |
| 1185 | 3300049742 | Ga0501080_0001954 | Ga0501080_0001954_7995_8942 | 315 |
| 1186 | 3300049744 | Ga0501083_0003735 | Ga0501083_0003735_8274_9221 | 315 |
| 1187 | 3300049744 | Ga0501083_0048003 | Ga0501083_0048003_151_1119 | 315 |
| 1188 | 3300049822 | Ga0501035_0226799 | Ga0501035_0226799_573_1565 | 315 |
| 1189 | 3300049823 | Ga0501044_0005687 | Ga0501044_0005687_9688_10635 | 315 |
| 1190 | 3300049823 | Ga0501044_0137971 | Ga0501044_0137971_706_1749 | 315 |
| 1191 | 3300050507 | nmdc:mga05p37_11291_c1 | nmdc:mga05p37_11291_c1_5165_6112 | 315 |
| 1192 | 3300050507 | nmdc:mga05p37_1975_c1 | nmdc:mga05p37_1975_c1_9077_10024 | 315 |
| 1193 | 3300050508 | nmdc:mga09592_1638_c1 | nmdc:mga09592_1638_c1_11012_11959 | 315 |
| 1194 | 3300050509 | nmdc:mga0qj67_969_c1 | nmdc:mga0qj67_969_c1_5766_6713 | 315 |
| 1195 | 3300050510 | nmdc:mga06r32_638_c1 | nmdc:mga06r32_638_c1_27648_28595 | 315 |
| 1196 | 3300050511 | nmdc:mga08y16_13712_c1 | nmdc:mga08y16_13712_c1_2408_3355 | 315 |
| 1197 | 3300050511 | nmdc:mga08y16_549_c1 | nmdc:mga08y16_549_c1_28044_28991 | 315 |
| 1198 | 3300050512 | nmdc:mga0n895_233805_c1 | nmdc:mga0n895_233805_c1_116_1063 | 315 |
| 1199 | 3300050512 | nmdc:mga0n895_45441_c1 | nmdc:mga0n895_45441_c1_1465_2412 | 315 |
| 1200 | 3300050512 | nmdc:mga0n895_807_c1 | nmdc:mga0n895_807_c1_4431_5378 | 315 |
| 1201 | 3300050512 | nmdc:mga0n895_97850_c1 | nmdc:mga0n895_97850_c1_1870_2817 | 315 |
| 1202 | 3300050513 | nmdc:mga0rr50_2201_c1 | nmdc:mga0rr50_2201_c1_2877_3824 | 315 |
| 1203 | 3300050515 | nmdc:mga0a205_42015_c1 | nmdc:mga0a205_42015_c1_2409_3356 | 315 |
| 1204 | 3300050515 | nmdc:mga0a205_745_c1 | nmdc:mga0a205_745_c1_12387_13334 | 315 |
| 1205 | 3300053077 | Ga0495601_0001138 | Ga0495601_0001138_3599_4546 | 315 |
| 1206 | 3300053077 | Ga0495601_0004969 | Ga0495601_0004969_1556_2503 | 315 |
| 1207 | 3300053077 | Ga0495601_0013085 | Ga0495601_0013085_3219_4178 | 315 |
| 1208 | 3300053078 | Ga0495612_0007560 | Ga0495612_0007560_1523_2470 | 315 |
| 1209 | 3300053078 | Ga0495612_0010175 | Ga0495612_0010175_291_1238 | 315 |
| 1210 | 3300053078 | Ga0495612_0018057 | Ga0495612_0018057_555_1553 | 315 |
| 1211 | 3300053078 | Ga0495612_0019860 | Ga0495612_0019860_773_1720 | 315 |
| 1212 | 3300053084 | Ga0495595_0000967 | Ga0495595_0000967_5336_6295 | 315 |
| 1213 | 3300053084 | Ga0495595_0004707 | Ga0495595_0004707_1528_2475 | 315 |
| 1214 | 3300053084 | Ga0495595_0008594 | Ga0495595_0008594_1717_2664 | 315 |
| 1215 | 3300053085 | Ga0495619_0000349 | Ga0495619_0000349_5207_6166 | 315 |
| 1216 | 3300053085 | Ga0495619_0000430 | Ga0495619_0000430_17649_18596 | 315 |
| 1217 | 3300053085 | Ga0495619_0004620 | Ga0495619_0004620_3584_4531 | 315 |
| 1218 | 3300053085 | Ga0495619_0034792 | Ga0495619_0034792_1864_2862 | 315 |
| 1219 | 3300053085 | Ga0495619_0091252 | Ga0495619_0091252_12_959 | 315 |
| 1220 | 3300053085 | Ga0495619_0217143 | Ga0495619_0217143_241_1188 | 315 |
| 1221 | 3300053087 | Ga0500643_008569 | Ga0500643_008569_2334_3284 | 315 |
| 1222 | 3300053119 | Ga0500595_000016 | Ga0500595_000016_132357_133307 | 315 |
| 1223 | 3300060353 | Ga0501082_0227623 | Ga0501082_0227623_339_1286 | 315 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7utf-assembly1.cif.gz_C | structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol | 0.9587 | 1 | 315 |
| 7utf-assembly2.cif.gz_D | structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol | 0.9575 | 1 | 315 |
| 7utf-assembly1.cif.gz_A | structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol | 0.9459 | 1 | 315 |
| 7utf-assembly2.cif.gz_B | structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol | 0.9456 | 1 | 315 |
| 4xk2-assembly2.cif.gz_B | crystal structure of aldo-keto reductase from polaromonas sp. js666 | 0.9367 | 1 | 315 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4xk2A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9196 | 1 | 315 | 3.20.20.100 |
| af_C4J2K0_1_323_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9105 | 1 | 314 | 3.20.20.100 |
| af_C4J2K0_1_323_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9049 | 1 | 314 | 3.20.20.100 |
| af_P77735_1_322_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9049 | 1 | 313 | 3.20.20.100 |
| af_P30863_1_265_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9027 | 14 | 313 | 3.20.20.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2Z6TUM4-F1-model_v4 | deleted | 0.9828 | 1 | 315 |
|
| AF-A0A379AEG0-F1-model_v4 | General stress protein 69 (EC 1.1.1.-) | 0.9798 | 3 | 180 |
GO:0005829
GO:0016491 |
| AF-A0A0C1FF59-F1-model_v4 | Alcohol dehydrogenase | 0.9779 | 1 | 315 |
GO:0005829
|
| AF-B9B0Z6-F1-model_v4 | deleted | 0.9765 | 1 | 315 |
|
| AF-A0A506Y3H6-F1-model_v4 | Aldo/keto reductase | 0.9765 | 2 | 314 |
GO:0005829
GO:0016491 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar