F491889

General Info

Members Datasets Scaffolds Average Seq Length
1223 642 981 316

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0000399|Ga0496104_0000399_14801_15859
Length 352
Sequence MLWSAPKERVSKHVAAPSFETAAFRGLLRMRRRKVSMLQLRRLGQSDLHLAPIMLGGNVFGWTIDEKTSFGILDAFVDAGFNAVDTSDSYARWVPGSPGGESETIIGNWIKRSGKRDKVLIATKVGEDMGEGRSLKKDYILRECEASLRRLQTDHIDLYQTHFDDEVTPVEETMQAYAALIKAGKVRAIGASNISPARLKASLAASKQLGLPRYESLQPLYNLSDRKEFETEFAPICREQKLGVINYYSLAAGFLTGKYRSAEEGAKHPGRGGRLKRYLDARGLGILKVVGEVAARHNALPAQIALAWLIARPIVTAPIVSATSLKQLGEILKAPQIKLSPADIAALDAAGS

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
6 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
7 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
8 2512875024 Mesorhizobium loti R88b Isolate Nodule
9 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
10 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
11 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
12 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
13 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
14 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
15 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
16 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
17 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
18 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
19 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
20 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
21 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
22 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
23 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
24 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
25 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
26 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
27 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
28 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
29 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
30 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
31 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
32 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
33 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
34 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
35 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
36 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
37 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
38 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
39 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
40 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
41 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
42 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
43 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
44 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
45 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
46 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
47 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
48 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
49 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
50 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
51 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
52 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
53 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
54 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
55 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
56 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
57 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
58 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
59 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
60 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
61 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
62 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
63 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
64 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
65 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
66 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
67 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
68 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
69 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
70 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
71 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
72 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
73 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
74 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
75 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
76 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
77 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
78 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
79 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
80 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
81 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
82 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
83 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
84 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
85 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
86 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
87 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
88 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
89 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
90 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
91 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
92 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
93 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
94 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
95 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
96 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
97 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
98 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
99 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
100 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
101 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
102 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
103 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
104 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
105 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
106 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
107 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
108 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
109 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
110 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
111 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
112 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
113 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
114 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
115 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
116 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
117 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
118 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
119 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
120 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
121 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
122 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
123 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
124 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
125 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
126 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
127 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
128 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
129 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
130 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
131 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
132 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
133 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
134 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
135 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
136 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
137 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
138 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
139 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
140 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
141 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
142 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
143 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
144 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
145 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
146 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
147 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
148 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
149 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
150 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
151 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
152 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
153 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
154 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
155 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
156 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
157 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
158 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
159 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
160 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
161 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
162 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
163 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
164 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
165 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
166 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
167 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
168 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
169 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
170 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
171 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
172 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
173 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
174 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
175 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
176 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
177 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
178 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
179 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
180 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
181 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
182 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
183 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
184 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
185 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
186 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
187 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
188 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
189 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
190 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
191 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
192 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
193 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
194 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
195 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
196 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
197 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
198 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
199 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
200 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
201 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
202 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
203 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
204 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
205 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
206 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
207 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
208 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
209 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
210 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
211 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
212 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
213 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
214 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
215 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
216 3004167301 Mesorhizobium loti 582 Isolate Unclassified
217 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
218 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
219 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
220 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
221 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
222 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
223 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
224 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
225 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
226 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
227 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
228 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
229 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
230 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
231 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
232 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
233 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
234 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
235 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
236 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
237 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
238 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
239 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
240 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
241 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
242 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
243 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
244 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
245 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
246 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
247 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
248 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
249 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
250 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
251 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
252 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
253 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
254 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
255 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
256 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
257 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
258 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
259 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
260 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
261 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
262 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
263 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
264 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
265 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
266 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
267 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
268 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
269 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
270 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
271 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
272 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
273 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
274 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
275 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
276 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
277 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
278 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
279 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
280 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
281 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
282 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
283 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
284 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
285 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
286 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
287 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
288 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
289 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
290 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
291 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
292 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
293 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
294 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
295 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
296 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
297 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
298 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
299 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
300 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
301 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
302 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
303 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
304 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
305 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
306 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
307 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
308 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
309 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
310 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
311 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
312 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
313 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
314 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
315 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
316 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
317 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
318 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
319 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
320 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
321 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
322 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
323 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
324 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
325 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
326 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
327 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
328 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
329 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
330 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
331 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
332 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
333 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
334 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
335 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
336 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
337 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
338 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
339 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
340 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
341 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
342 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
343 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
344 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
345 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
346 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
347 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
348 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
349 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
350 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
351 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
352 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
353 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
354 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
355 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
356 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
357 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
358 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
359 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
360 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
361 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
362 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
363 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
364 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
365 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
366 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
367 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
368 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
369 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
371 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
372 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
373 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
385 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
400 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
402 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
403 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
404 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
405 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
406 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
407 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
408 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
409 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
410 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
411 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
412 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
413 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
414 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
415 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
416 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
417 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
418 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
419 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
420 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
421 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
422 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
423 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
424 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
425 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
426 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
427 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
428 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
429 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
430 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
431 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
432 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
433 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
434 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
435 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
436 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
437 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
438 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
439 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
440 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
441 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
442 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
443 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
444 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
445 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
446 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
447 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
448 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
449 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
450 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
451 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
452 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
453 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
454 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
455 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
456 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
457 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
458 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
459 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
460 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
461 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
462 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
463 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
464 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
465 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
466 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
467 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
468 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
469 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
470 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
471 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
472 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
473 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
474 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
475 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
476 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
477 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
478 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
479 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
480 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
481 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
482 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
483 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
484 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
485 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
486 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
487 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
488 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
489 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
490 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
491 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
492 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
493 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
494 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
495 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
496 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
497 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
498 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
499 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
500 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
501 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
502 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
503 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
504 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
505 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
506 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
507 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
508 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
509 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
510 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
511 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
512 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
513 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
514 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
515 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
516 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
517 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
518 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
519 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
520 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
521 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
522 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
523 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
524 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
525 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
526 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
527 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
528 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
529 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
530 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
531 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
532 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
533 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
534 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
535 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
536 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
537 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
538 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
539 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
540 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
541 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
542 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
543 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
544 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
545 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
546 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
547 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
548 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
549 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
550 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
551 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
552 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
553 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
554 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
555 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
556 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
557 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
558 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
559 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
560 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
561 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
562 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
563 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
564 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
565 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
566 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
567 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
568 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
569 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
570 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
571 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
572 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
573 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
574 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
575 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
576 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
577 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
578 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
579 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
580 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
581 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
582 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
583 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
584 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
585 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
586 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
587 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
588 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
589 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
590 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
591 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
592 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
593 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
594 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
595 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
596 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
597 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
598 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
599 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
600 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
601 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
602 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
603 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
604 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
605 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
606 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
607 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
608 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
609 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
610 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
611 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
612 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
613 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
614 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
615 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
616 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
617 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
618 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
619 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
620 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
621 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
622 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
623 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
624 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
625 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
626 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
627 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
628 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
629 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
630 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
631 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
632 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
633 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
634 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
635 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
636 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
637 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
638 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
639 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
640 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
641 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
642 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.05
Metatranscriptomes 0.16
Isolates 19.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.19
Nodule 16.52
Rhizoplane 5.4
Rhizosphere 71.3
Stem 0
Stem Tuber 0
Unclassified 3.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214711591 2209111006 Bacteria 4350
2 ARcpr5oldR_c000035 3300000041 Bacteria 26838
3 ARSoilYngRDRAFT_c00458 3300000042 Bacteria 4991
4 ARSoilOldRDRAFT_c000053 3300000044 Bacteria 23841
5 ARCol0yngRDRAFT_1000025 3300000652 Bacteria 26845
6 JGI24752J21851_1003441 3300001976 Bacteria 2082
7 JGI24739J22299_10018162 3300001989 Bacteria 2531
8 JGI24737J22298_10000053 3300001990 Bacteria 34054
9 JGI24737J22298_10004052 3300001990 Bacteria 5124
10 JGI24735J21928_10013098 3300002067 Bacteria 2612
11 JGI24738J21930_10002204 3300002075 Bacteria 5182
12 JGI24749J21850_1000375 3300002076 Bacteria 6658
13 JGI24034J26672_10000960 3300002239 Bacteria 3760
14 JGI24742J22300_10000216 3300002244 Bacteria 8591
15 JGI25157J39369_1001732 3300002741 Bacteria 7216
16 JGI25406J46586_10028248 3300003203 Bacteria 2140
17 JGI25165J46597_1000097 3300003214 Bacteria 161115
18 Ga0006562J51391_1053984 3300003578 Bacteria 1828
19 Ga0065712_10071633 3300005290 Bacteria 5146
20 Ga0065712_10172224 3300005290 Bacteria 1217
21 Ga0065715_10003868 3300005293 Bacteria 9723
22 Ga0065715_10093047 3300005293 Bacteria 4830
23 Ga0070658_10011015 3300005327 Bacteria 7249
24 Ga0070658_10019708 3300005327 Bacteria 5401
25 Ga0070658_10077237 3300005327 Bacteria 2731
26 Ga0070676_10004729 3300005328 Bacteria 7199
27 Ga0070676_10006093 3300005328 Bacteria 6438
28 Ga0070683_100001083 3300005329 Bacteria 20468
29 Ga0070683_100016216 3300005329 Bacteria 6564
30 Ga0070683_100176436 3300005329 Bacteria 2028
31 Ga0070683_100341950 3300005329 Bacteria 1425
32 Ga0070690_100002762 3300005330 Bacteria 9483
33 Ga0070670_100003174 3300005331 Bacteria 13579
34 Ga0070670_100005035 3300005331 Bacteria 11118
35 Ga0070670_100173359 3300005331 Bacteria 1871
36 Ga0070670_100188058 3300005331 Bacteria 1793
37 Ga0070677_10002672 3300005333 Bacteria 5704
38 Ga0070677_10015355 3300005333 Bacteria 2713
39 Ga0068869_100000279 3300005334 Bacteria 27008
40 Ga0068869_100002437 3300005334 Bacteria 11217
41 Ga0068869_100009143 3300005334 Bacteria 6420
42 Ga0070666_10009526 3300005335 Bacteria 6058
43 Ga0070666_10069794 3300005335 Bacteria 2390
44 Ga0070666_10232201 3300005335 Bacteria 1303
45 Ga0070680_100021592 3300005336 Bacteria 5119
46 Ga0070680_100121685 3300005336 Bacteria 2179
47 Ga0070682_100066117 3300005337 Bacteria 2299
48 Ga0068868_100002361 3300005338 Bacteria 13072
49 Ga0068868_100004075 3300005338 Bacteria 10198
50 Ga0068868_100021850 3300005338 Bacteria 4823
51 Ga0068868_100155201 3300005338 Bacteria 1887
52 Ga0070660_100000245 3300005339 Bacteria 35915
53 Ga0070660_100019914 3300005339 Bacteria 4923
54 Ga0070660_100030071 3300005339 Bacteria 4072
55 Ga0070660_100060582 3300005339 Bacteria 2938
56 Ga0070689_100026576 3300005340 Bacteria 4358
57 Ga0070689_100043413 3300005340 Bacteria 3455
58 Ga0070691_10006681 3300005341 Bacteria 5279
59 Ga0070691_10113767 3300005341 Bacteria 1356
60 Ga0070687_100000348 3300005343 Bacteria 15751
61 Ga0070687_100026749 3300005343 Bacteria 2781
62 Ga0070661_100000017 3300005344 Bacteria 153232
63 Ga0070661_100011716 3300005344 Bacteria 6117
64 Ga0070661_100048950 3300005344 Bacteria 3095
65 Ga0070661_100102973 3300005344 Bacteria 2126
66 Ga0070661_100148435 3300005344 Bacteria 1771
67 Ga0070661_100212771 3300005344 Bacteria 1480
68 Ga0070661_100290992 3300005344 Bacteria 1269
69 Ga0070692_10000101 3300005345 Bacteria 19118
70 Ga0070668_100003604 3300005347 Bacteria 11429
71 Ga0070668_100004663 3300005347 Bacteria 10156
72 Ga0070668_100017165 3300005347 Bacteria 5418
73 Ga0070669_100000314 3300005353 Bacteria 37924
74 Ga0070669_100001878 3300005353 Bacteria 15141
75 Ga0070669_100010555 3300005353 Bacteria 6558
76 Ga0070675_100000161 3300005354 Bacteria 40950
77 Ga0070675_100009512 3300005354 Bacteria 7565
78 Ga0070671_100000313 3300005355 Bacteria 32932
79 Ga0070671_100053208 3300005355 Bacteria 3365
80 Ga0070671_100116746 3300005355 Bacteria 2244
81 Ga0070674_100001686 3300005356 Bacteria 11955
82 Ga0070674_100006198 3300005356 Bacteria 6958
83 Ga0070674_100099854 3300005356 Bacteria 2112
84 Ga0070674_100243015 3300005356 Bacteria 1410
85 Ga0070673_100000272 3300005364 Bacteria 26555
86 Ga0070673_100006863 3300005364 Bacteria 7446
87 Ga0070673_100012960 3300005364 Bacteria 5746
88 Ga0070673_100091896 3300005364 Bacteria 2481
89 Ga0070673_100344750 3300005364 Bacteria 1321
90 Ga0070688_100000991 3300005365 Bacteria 14237
91 Ga0070659_100006215 3300005366 Bacteria 8627
92 Ga0070667_100021659 3300005367 Bacteria 5334
93 Ga0070667_100024052 3300005367 Bacteria 5059
94 Ga0070667_100187175 3300005367 Bacteria 1832
95 Ga0070714_100030068 3300005435 Bacteria 4520
96 Ga0070713_100008870 3300005436 Bacteria 7159
97 Ga0070713_100052266 3300005436 Bacteria 3382
98 Ga0070701_10000204 3300005438 Bacteria 18457
99 Ga0070701_10211640 3300005438 Bacteria 1151
100 Ga0070711_100053807 3300005439 Bacteria 2775
101 Ga0070711_100082880 3300005439 Bacteria 2290
102 Ga0070711_100177141 3300005439 Bacteria 1630
103 Ga0070700_100000856 3300005441 Bacteria 15021
104 Ga0070700_100017272 3300005441 Bacteria 4121
105 Ga0070700_100098822 3300005441 Bacteria 1919
106 Ga0070694_100002279 3300005444 Bacteria 11339
107 Ga0070708_100142114 3300005445 Bacteria 2226
108 Ga0070663_100000945 3300005455 Bacteria 15785
109 Ga0070663_100087170 3300005455 Bacteria 2307
110 Ga0070663_100181347 3300005455 Bacteria 1634
111 Ga0070678_100002374 3300005456 Bacteria 10296
112 Ga0070678_100006220 3300005456 Bacteria 6983
113 Ga0070678_100111091 3300005456 Bacteria 2144
114 Ga0070662_100003593 3300005457 Bacteria 9675
115 Ga0070662_100004917 3300005457 Bacteria 8490
116 Ga0070662_100011596 3300005457 Bacteria 5817
117 Ga0070662_100015465 3300005457 Bacteria 5112
118 Ga0070662_100031459 3300005457 Bacteria 3724
119 Ga0070681_10038476 3300005458 Bacteria 4796
120 Ga0070681_10049176 3300005458 Bacteria 4212
121 Ga0068867_100002227 3300005459 Bacteria 13620
122 Ga0068867_100029790 3300005459 Bacteria 3934
123 Ga0068867_100044752 3300005459 Bacteria 3243
124 Ga0068867_100148888 3300005459 Bacteria 1837
125 Ga0068867_100159729 3300005459 Bacteria 1777
126 Ga0070685_10031229 3300005466 Bacteria 2974
127 Ga0070679_100002050 3300005530 Bacteria 18095
128 Ga0070679_100021093 3300005530 Bacteria 6357
129 Ga0070679_100100453 3300005530 Bacteria 2879
130 Ga0070679_100171854 3300005530 Bacteria 2140
131 Ga0070679_100267966 3300005530 Bacteria 1662
132 Ga0070679_100419515 3300005530 Bacteria 1283
133 Ga0070684_100000365 3300005535 Bacteria 31110
134 Ga0070684_100031623 3300005535 Bacteria 4507
135 Ga0070684_100190808 3300005535 Bacteria 1864
136 Ga0068853_100000523 3300005539 Bacteria 25970
137 Ga0068853_100001161 3300005539 Bacteria 18726
138 Ga0068853_100005637 3300005539 Bacteria 9836
139 Ga0068853_100051530 3300005539 Bacteria 3543
140 Ga0068853_100065961 3300005539 Bacteria 3142
141 Ga0068853_100198124 3300005539 Bacteria 1827
142 Ga0070672_100000709 3300005543 Bacteria 19721
143 Ga0070672_100003804 3300005543 Bacteria 9826
144 Ga0070672_100033253 3300005543 Bacteria 3903
145 Ga0070672_100067211 3300005543 Bacteria 2840
146 Ga0070686_100007788 3300005544 Bacteria 5986
147 Ga0070686_100279823 3300005544 Bacteria 1230
148 Ga0070695_100001044 3300005545 Bacteria 15130
149 Ga0070695_100148466 3300005545 Bacteria 1633
150 Ga0070696_100021689 3300005546 Bacteria 4356
151 Ga0070696_100134489 3300005546 Bacteria 1802
152 Ga0070693_100000905 3300005547 Bacteria 13209
153 Ga0070693_100022703 3300005547 Bacteria 3341
154 Ga0070665_100041750 3300005548 Bacteria 4611
155 Ga0070665_100064470 3300005548 Bacteria 3674
156 Ga0070704_100017774 3300005549 Bacteria 4532
157 Ga0070704_100216206 3300005549 Bacteria 1556
158 Ga0068855_100011208 3300005563 Bacteria 10824
159 Ga0068855_100040932 3300005563 Bacteria 5495
160 Ga0068855_100166115 3300005563 Bacteria 2502
161 Ga0070664_100002074 3300005564 Bacteria 16005
162 Ga0070664_100155231 3300005564 Bacteria 2022
163 Ga0068857_100050390 3300005577 Bacteria 3694
164 Ga0068857_100461132 3300005577 Bacteria 1189
165 Ga0068854_100000749 3300005578 Bacteria 19195
166 Ga0068854_100006483 3300005578 Bacteria 7448
167 Ga0068856_100000902 3300005614 Bacteria 31812
168 Ga0068856_100039818 3300005614 Bacteria 4614
169 Ga0068856_100174369 3300005614 Bacteria 2163
170 Ga0068856_100203581 3300005614 Bacteria 1994
171 Ga0070702_100002928 3300005615 Bacteria 7519
172 Ga0068852_100002308 3300005616 Bacteria 13115
173 Ga0068852_100015241 3300005616 Bacteria 5953
174 Ga0068852_100026542 3300005616 Bacteria 4710
175 Ga0068852_100048482 3300005616 Bacteria 3629
176 Ga0068852_100050517 3300005616 Bacteria 3563
177 Ga0068852_100070611 3300005616 Bacteria 3064
178 Ga0068852_100212963 3300005616 Bacteria 1834
179 Ga0068859_100008773 3300005617 Bacteria 10209
180 Ga0068859_100085817 3300005617 Bacteria 3193
181 Ga0068864_100000546 3300005618 Bacteria 32083
182 Ga0068864_100000595 3300005618 Bacteria 30701
183 Ga0068864_100030198 3300005618 Bacteria 4593
184 Ga0068864_100032654 3300005618 Bacteria 4423
185 Ga0068866_10001825 3300005718 Bacteria 8959
186 Ga0068866_10002012 3300005718 Bacteria 8459
187 Ga0068861_100000825 3300005719 Bacteria 18722
188 Ga0068861_100001557 3300005719 Bacteria 14574
189 Ga0068861_100003439 3300005719 Bacteria 10510
190 Ga0068870_10000112 3300005840 Bacteria 27710
191 Ga0068870_10211528 3300005840 Bacteria 1182
192 Ga0068863_100000703 3300005841 Bacteria 33695
193 Ga0068863_100006906 3300005841 Bacteria 11124
194 Ga0068863_100507583 3300005841 Bacteria 1188
195 Ga0068858_100002003 3300005842 Bacteria 20846
196 Ga0068858_100008283 3300005842 Bacteria 9996
197 Ga0068858_100228418 3300005842 Bacteria 1764
198 Ga0068860_100006736 3300005843 Bacteria 11522
199 Ga0068860_100007376 3300005843 Bacteria 10995
200 Ga0068860_100023722 3300005843 Bacteria 5931
201 Ga0068860_100049862 3300005843 Bacteria 3986
202 Ga0068860_100174138 3300005843 Bacteria 2079
203 Ga0068862_100006290 3300005844 Bacteria 9882
204 Ga0068862_100146665 3300005844 Bacteria 2098
205 Ga0068862_100170220 3300005844 Bacteria 1950
206 Ga0081455_10000048 3300005937 Bacteria 126551
207 Ga0081455_10003554 3300005937 Bacteria 17889
208 Ga0081455_10021067 3300005937 Bacteria 6121
209 Ga0081455_10102220 3300005937 Bacteria 2298
210 Ga0081539_10007581 3300005985 Bacteria 9810
211 Ga0070717_10220513 3300006028 Bacteria 1667
212 Ga0075365_10036995 3300006038 Bacteria 3166
213 Ga0075365_10037327 3300006038 Bacteria 3154
214 Ga0075365_10199791 3300006038 Bacteria 1400
215 Ga0075365_10277252 3300006038 Bacteria 1179
216 Ga0075363_100013824 3300006048 Bacteria 3928
217 Ga0075364_10007466 3300006051 Bacteria 6494
218 Ga0070715_10068351 3300006163 Bacteria 1580
219 Ga0070712_100019604 3300006175 Bacteria 4415
220 Ga0075367_10005318 3300006178 Bacteria 6376
221 Ga0075367_10043746 3300006178 Bacteria 2623
222 Ga0075367_10117360 3300006178 Bacteria 1638
223 Ga0075367_10256332 3300006178 Bacteria 1097
224 Ga0075369_10004969 3300006186 Bacteria 4947
225 Ga0075369_10051358 3300006186 Bacteria 1785
226 Ga0075369_10084149 3300006186 Bacteria 1413
227 Ga0097621_100000473 3300006237 Bacteria 28196
228 Ga0097621_100003287 3300006237 Bacteria 11118
229 Ga0097621_100006173 3300006237 Bacteria 8491
230 Ga0097621_100047825 3300006237 Bacteria 3467
231 Ga0097621_100058617 3300006237 Bacteria 3150
232 Ga0075370_10005271 3300006353 Bacteria 6404
233 Ga0068871_100000118 3300006358 Bacteria 49211
234 Ga0075428_100028450 3300006844 Bacteria 6184
235 Ga0075430_100000196 3300006846 Bacteria 40930
236 Ga0075431_100001183 3300006847 Bacteria 23547
237 Ga0075431_100109721 3300006847 Bacteria 2848
238 Ga0075431_100311688 3300006847 Bacteria 1588
239 Ga0075431_100387536 3300006847 Bacteria 1400
240 Ga0075433_10000991 3300006852 Bacteria 20176
241 Ga0075433_10037073 3300006852 Bacteria 4204
242 Ga0075434_100001106 3300006871 Bacteria 22102
243 Ga0075434_100013398 3300006871 Bacteria 7801
244 Ga0075434_100028901 3300006871 Bacteria 5452
245 Ga0075434_100047743 3300006871 Bacteria 4248
246 Ga0075434_100060504 3300006871 Bacteria 3767
247 Ga0075434_100090524 3300006871 Bacteria 3061
248 Ga0075434_100315712 3300006871 Bacteria 1583
249 Ga0068865_100051161 3300006881 Bacteria 2858
250 Ga0068865_100110247 3300006881 Bacteria 2029
251 Ga0097620_100008773 3300006931 Bacteria 10209
252 Ga0097620_100085816 3300006931 Bacteria 3193
253 Ga0075435_100066202 3300007076 Bacteria 2939
254 Ga0105251_10027020 3300009011 Bacteria 2915
255 Ga0105250_10045964 3300009092 Bacteria 1750
256 Ga0105240_10064698 3300009093 Bacteria 4543
257 Ga0105240_10079927 3300009093 Bacteria 4022
258 Ga0105240_10087185 3300009093 Bacteria 3823
259 Ga0105240_10558510 3300009093 Bacteria 1266
260 Ga0111539_10000683 3300009094 Bacteria 43914
261 Ga0111539_10001167 3300009094 Bacteria 34770
262 Ga0111539_10004804 3300009094 Bacteria 17625
263 Ga0111539_10485927 3300009094 Bacteria 1438
264 Ga0105245_10001982 3300009098 Bacteria 18594
265 Ga0105245_10308175 3300009098 Bacteria 1556
266 Ga0105247_10015215 3300009101 Bacteria 4613
267 Ga0105247_10028209 3300009101 Bacteria 3396
268 Ga0114129_10036793 3300009147 Bacteria 6911
269 Ga0114129_10194026 3300009147 Bacteria 2755
270 Ga0114129_10743300 3300009147 Bacteria 1256
271 Ga0105243_10002278 3300009148 Bacteria 16096
272 Ga0105243_10015285 3300009148 Bacteria 5808
273 Ga0105243_10085153 3300009148 Bacteria 2590
274 Ga0105241_10003555 3300009174 Bacteria 11590
275 Ga0105241_10470278 3300009174 Bacteria 1115
276 Ga0105242_10001156 3300009176 Bacteria 20789
277 Ga0105242_10029797 3300009176 Bacteria 4354
278 Ga0105242_10083983 3300009176 Bacteria 2667
279 Ga0105242_10258309 3300009176 Bacteria 1572
280 Ga0105248_10020934 3300009177 Bacteria 7249
281 Ga0105248_10278606 3300009177 Bacteria 1883
282 Ga0105248_10294030 3300009177 Bacteria 1829
283 Ga0105248_10395258 3300009177 Bacteria 1557
284 Ga0105237_10005748 3300009545 Bacteria 13935
285 Ga0105237_10041035 3300009545 Bacteria 4668
286 Ga0105237_10072571 3300009545 Bacteria 3436
287 Ga0105237_10202482 3300009545 Bacteria 1985
288 Ga0105237_10414798 3300009545 Bacteria 1352
289 Ga0105238_10007631 3300009551 Bacteria 10837
290 Ga0105238_10053124 3300009551 Bacteria 4072
291 Ga0105238_10068987 3300009551 Bacteria 3536
292 Ga0105249_10001021 3300009553 Bacteria 24754
293 Ga0105249_10006960 3300009553 Bacteria 9861
294 Ga0105249_10041930 3300009553 Bacteria 4162
295 Ga0105239_10008950 3300010375 Bacteria 11329
296 Ga0105239_10010109 3300010375 Bacteria 10577
297 Ga0105239_10046440 3300010375 Bacteria 4759
298 Ga0105239_10083831 3300010375 Bacteria 3511
299 Ga0105239_10136101 3300010375 Bacteria 2735
300 Ga0105239_10170670 3300010375 Bacteria 2432
301 Ga0105246_10003701 3300011119 Bacteria 9254
302 Ga0105246_10254631 3300011119 Bacteria 1395
303 Ga0157371_10031202 3300013102 Bacteria 3840
304 Ga0157371_10060452 3300013102 Bacteria 2687
305 Ga0157371_10093722 3300013102 Bacteria 2128
306 Ga0157371_10192287 3300013102 Bacteria 1461
307 Ga0157370_10090616 3300013104 Bacteria 2871
308 Ga0157370_10287651 3300013104 Bacteria 1518
309 Ga0157369_10014889 3300013105 Bacteria 8779
310 Ga0157369_10290972 3300013105 Bacteria 1700
311 Ga0157369_10618529 3300013105 Bacteria 1118
312 Ga0157369_10768354 3300013105 Bacteria 991
313 Ga0157374_10005306 3300013296 Bacteria 10823
314 Ga0157374_10015941 3300013296 Bacteria 6602
315 Ga0157378_10002986 3300013297 Bacteria 15027
316 Ga0157378_10079081 3300013297 Bacteria 2968
317 Ga0163162_10007593 3300013306 Bacteria 10554
318 Ga0163162_10009522 3300013306 Bacteria 9448
319 Ga0163162_10066320 3300013306 Bacteria 3658
320 Ga0163162_10109954 3300013306 Bacteria 2853
321 Ga0157372_10008348 3300013307 Bacteria 11015
322 Ga0157372_10048370 3300013307 Bacteria 4727
323 Ga0157372_10132943 3300013307 Bacteria 2864
324 Ga0157375_10000508 3300013308 Bacteria 35108
325 Ga0157375_10002379 3300013308 Bacteria 16278
326 Ga0157375_10041288 3300013308 Bacteria 4453
327 Ga0157375_10055341 3300013308 Bacteria 3911
328 Ga0157375_10268905 3300013308 Bacteria 1867
329 Ga0163163_10082125 3300014325 Bacteria 3226
330 Ga0163163_10102744 3300014325 Bacteria 2882
331 Ga0157380_10000212 3300014326 Bacteria 34358
332 Ga0157380_10008734 3300014326 Bacteria 7241
333 Ga0182008_10036668 3300014497 Bacteria 2453
334 Ga0157377_10000287 3300014745 Bacteria 24040
335 Ga0157379_10008690 3300014968 Bacteria 8847
336 Ga0157379_10023266 3300014968 Bacteria 5496
337 Ga0157379_10024668 3300014968 Bacteria 5337
338 Ga0157379_10065966 3300014968 Bacteria 3236
339 Ga0157379_10141716 3300014968 Bacteria 2167
340 Ga0157376_10004642 3300014969 Bacteria 9575
341 Ga0157376_10010411 3300014969 Bacteria 6803
342 Ga0157376_10044552 3300014969 Bacteria 3648
343 Ga0182006_1023464 3300015261 Bacteria 2555
344 Ga0182007_10017175 3300015262 Bacteria 2651
345 Ga0163161_10000415 3300017792 Bacteria 35797
346 Ga0206353_10023203 3300020082 Bacteria 2965
347 Ga0209026_1000041 3300025250 Bacteria 275745
348 Ga0209148_1000069 3300025254 Bacteria 334444
349 Ga0209759_1000183 3300025256 Bacteria 102218
350 Ga0209233_1000030 3300025261 Bacteria 636702
351 Ga0209233_1008564 3300025261 Bacteria 3154
352 Ga0209233_1009332 3300025261 Bacteria 2991
353 Ga0207666_1000073 3300025271 Bacteria 16742
354 Ga0207666_1000396 3300025271 Bacteria 5740
355 Ga0209455_1000161 3300025272 Bacteria 117353
356 Ga0207673_1000295 3300025290 Bacteria 5011
357 Ga0209758_1005328 3300025297 Bacteria 10011
358 Ga0207697_10000061 3300025315 Bacteria 45271
359 Ga0207697_10005956 3300025315 Bacteria 5594
360 Ga0207696_1062241 3300025711 Bacteria 1048
361 Ga0207653_10066499 3300025885 Bacteria 1225
362 Ga0207682_10002961 3300025893 Bacteria 7454
363 Ga0207682_10008495 3300025893 Bacteria 4059
364 Ga0207682_10013203 3300025893 Bacteria 3220
365 Ga0207642_10001238 3300025899 Bacteria 7906
366 Ga0207642_10007466 3300025899 Bacteria 3696
367 Ga0207642_10051660 3300025899 Bacteria 1861
368 Ga0207710_10014209 3300025900 Bacteria 3355
369 Ga0207710_10015430 3300025900 Bacteria 3228
370 Ga0207688_10000001 3300025901 Bacteria 107505
371 Ga0207688_10015574 3300025901 Bacteria 4122
372 Ga0207688_10029501 3300025901 Bacteria 3020
373 Ga0207688_10039415 3300025901 Bacteria 2624
374 Ga0207680_10001817 3300025903 Bacteria 10043
375 Ga0207680_10004563 3300025903 Bacteria 6577
376 Ga0207680_10230206 3300025903 Bacteria 1274
377 Ga0207647_10002852 3300025904 Bacteria 13027
378 Ga0207647_10009210 3300025904 Bacteria 7025
379 Ga0207647_10020047 3300025904 Bacteria 4488
380 Ga0207685_10020978 3300025905 Bacteria 2181
381 Ga0207685_10023072 3300025905 Bacteria 2113
382 Ga0207645_10000222 3300025907 Bacteria 47139
383 Ga0207645_10007540 3300025907 Bacteria 7676
384 Ga0207643_10000009 3300025908 Bacteria 160496
385 Ga0207643_10029264 3300025908 Bacteria 3063
386 Ga0207705_10019295 3300025909 Bacteria 4875
387 Ga0207705_10135527 3300025909 Bacteria 1835
388 Ga0207654_10001390 3300025911 Bacteria 12824
389 Ga0207654_10054567 3300025911 Bacteria 2310
390 Ga0207707_10004174 3300025912 Bacteria 12795
391 Ga0207707_10007205 3300025912 Bacteria 9680
392 Ga0207707_10095845 3300025912 Bacteria 2593
393 Ga0207707_10098046 3300025912 Bacteria 2562
394 Ga0207695_10041473 3300025913 Bacteria 4927
395 Ga0207695_10054337 3300025913 Bacteria 4183
396 Ga0207671_10003241 3300025914 Bacteria 16375
397 Ga0207671_10167142 3300025914 Bacteria 1706
398 Ga0207671_10321818 3300025914 Bacteria 1224
399 Ga0207693_10003519 3300025915 Bacteria 13369
400 Ga0207693_10056703 3300025915 Bacteria 3071
401 Ga0207663_10018683 3300025916 Bacteria 3891
402 Ga0207663_10027568 3300025916 Bacteria 3313
403 Ga0207663_10034887 3300025916 Bacteria 3013
404 Ga0207663_10042477 3300025916 Bacteria 2777
405 Ga0207660_10000197 3300025917 Bacteria 38486
406 Ga0207660_10029243 3300025917 Bacteria 3777
407 Ga0207660_10040842 3300025917 Bacteria 3249
408 Ga0207660_10065669 3300025917 Bacteria 2623
409 Ga0207662_10001861 3300025918 Bacteria 10377
410 Ga0207662_10002878 3300025918 Bacteria 8720
411 Ga0207662_10011648 3300025918 Bacteria 4885
412 Ga0207657_10000776 3300025919 Bacteria 33868
413 Ga0207657_10024538 3300025919 Bacteria 5577
414 Ga0207657_10040737 3300025919 Bacteria 4113
415 Ga0207657_10042331 3300025919 Bacteria 4020
416 Ga0207657_10042811 3300025919 Bacteria 3992
417 Ga0207657_10058761 3300025919 Bacteria 3308
418 Ga0207657_10087807 3300025919 Bacteria 2601
419 Ga0207657_10101928 3300025919 Bacteria 2381
420 Ga0207649_10000052 3300025920 Bacteria 106800
421 Ga0207649_10090569 3300025920 Bacteria 2002
422 Ga0207649_10090776 3300025920 Bacteria 2000
423 Ga0207652_10001438 3300025921 Bacteria 21098
424 Ga0207652_10026866 3300025921 Bacteria 4797
425 Ga0207652_10028531 3300025921 Bacteria 4657
426 Ga0207652_10092441 3300025921 Bacteria 2661
427 Ga0207681_10001008 3300025923 Bacteria 18376
428 Ga0207681_10096122 3300025923 Bacteria 2126
429 Ga0207694_10062975 3300025924 Bacteria 2888
430 Ga0207650_10006131 3300025925 Bacteria 8190
431 Ga0207650_10110205 3300025925 Bacteria 2130
432 Ga0207659_10000132 3300025926 Bacteria 43798
433 Ga0207659_10017260 3300025926 Bacteria 4712
434 Ga0207659_10029958 3300025926 Bacteria 3713
435 Ga0207659_10118645 3300025926 Bacteria 2024
436 Ga0207687_10000174 3300025927 Bacteria 42351
437 Ga0207687_10117028 3300025927 Bacteria 1988
438 Ga0207700_10009939 3300025928 Bacteria 5974
439 Ga0207700_10060096 3300025928 Bacteria 2877
440 Ga0207700_10205857 3300025928 Bacteria 1660
441 Ga0207664_10293125 3300025929 Bacteria 1430
442 Ga0207644_10000212 3300025931 Bacteria 40175
443 Ga0207644_10083949 3300025931 Bacteria 2360
444 Ga0207644_10161389 3300025931 Bacteria 1742
445 Ga0207690_10000148 3300025932 Bacteria 56244
446 Ga0207690_10023203 3300025932 Bacteria 3870
447 Ga0207706_10000788 3300025933 Bacteria 32791
448 Ga0207706_10001360 3300025933 Bacteria 24441
449 Ga0207706_10006177 3300025933 Bacteria 11123
450 Ga0207706_10013452 3300025933 Bacteria 7437
451 Ga0207706_10025201 3300025933 Bacteria 5332
452 Ga0207706_10049341 3300025933 Bacteria 3720
453 Ga0207686_10001289 3300025934 Bacteria 14380
454 Ga0207686_10122465 3300025934 Bacteria 1772
455 Ga0207686_10167481 3300025934 Bacteria 1546
456 Ga0207709_10000530 3300025935 Bacteria 33097
457 Ga0207709_10016430 3300025935 Bacteria 4114
458 Ga0207709_10026603 3300025935 Bacteria 3325
459 Ga0207670_10000523 3300025936 Bacteria 21171
460 Ga0207670_10047836 3300025936 Bacteria 2851
461 Ga0207670_10097235 3300025936 Bacteria 2095
462 Ga0207669_10000857 3300025937 Bacteria 12949
463 Ga0207669_10011343 3300025937 Bacteria 4331
464 Ga0207669_10276148 3300025937 Bacteria 1265
465 Ga0207704_10000198 3300025938 Bacteria 31182
466 Ga0207665_10000273 3300025939 Bacteria 35752
467 Ga0207665_10026454 3300025939 Bacteria 3829
468 Ga0207691_10000517 3300025940 Bacteria 38398
469 Ga0207691_10008786 3300025940 Bacteria 9690
470 Ga0207691_10120748 3300025940 Bacteria 2323
471 Ga0207691_10458060 3300025940 Bacteria 1085
472 Ga0207711_10008997 3300025941 Bacteria 8349
473 Ga0207711_10134794 3300025941 Bacteria 2217
474 Ga0207711_10206302 3300025941 Bacteria 1795
475 Ga0207711_10319028 3300025941 Bacteria 1436
476 Ga0207689_10000031 3300025942 Bacteria 97131
477 Ga0207689_10000358 3300025942 Bacteria 42928
478 Ga0207689_10004425 3300025942 Bacteria 12751
479 Ga0207661_10189859 3300025944 Bacteria 1801
480 Ga0207679_10000183 3300025945 Bacteria 51645
481 Ga0207679_10024542 3300025945 Bacteria 4135
482 Ga0207679_10027807 3300025945 Bacteria 3917
483 Ga0207679_10066848 3300025945 Bacteria 2695
484 Ga0207679_10072670 3300025945 Bacteria 2599
485 Ga0207679_10087436 3300025945 Bacteria 2400
486 Ga0207679_10089341 3300025945 Bacteria 2378
487 Ga0207679_10260355 3300025945 Bacteria 1479
488 Ga0207667_10057690 3300025949 Bacteria 4074
489 Ga0207667_10153953 3300025949 Bacteria 2366
490 Ga0207667_10236604 3300025949 Bacteria 1869
491 Ga0207651_10000051 3300025960 Bacteria 54163
492 Ga0207651_10070958 3300025960 Bacteria 2467
493 Ga0207712_10000738 3300025961 Bacteria 24767
494 Ga0207712_10056531 3300025961 Bacteria 2765
495 Ga0207668_10000664 3300025972 Bacteria 21087
496 Ga0207668_10005924 3300025972 Bacteria 7203
497 Ga0207668_10007445 3300025972 Bacteria 6511
498 Ga0207668_10169535 3300025972 Bacteria 1711
499 Ga0207640_10002152 3300025981 Bacteria 10584
500 Ga0207658_10016338 3300025986 Bacteria 5104
501 Ga0207658_10023034 3300025986 Bacteria 4342
502 Ga0207658_10094760 3300025986 Bacteria 2324
503 Ga0207658_10098984 3300025986 Bacteria 2280
504 Ga0207677_10075252 3300026023 Bacteria 2399
505 Ga0207677_10196088 3300026023 Bacteria 1601
506 Ga0207703_10004462 3300026035 Bacteria 11493
507 Ga0207703_10015159 3300026035 Bacteria 6015
508 Ga0207703_10051485 3300026035 Bacteria 3337
509 Ga0207703_10068565 3300026035 Bacteria 2923
510 Ga0207703_10095892 3300026035 Bacteria 2503
511 Ga0207703_10155946 3300026035 Bacteria 1995
512 Ga0207703_10222027 3300026035 Bacteria 1690
513 Ga0207639_10001257 3300026041 Bacteria 17164
514 Ga0207639_10003583 3300026041 Bacteria 10427
515 Ga0207639_10011340 3300026041 Bacteria 6186
516 Ga0207639_10328023 3300026041 Bacteria 1361
517 Ga0207678_10000531 3300026067 Bacteria 34761
518 Ga0207678_10000889 3300026067 Bacteria 27495
519 Ga0207678_10005685 3300026067 Bacteria 11142
520 Ga0207678_10072422 3300026067 Bacteria 2953
521 Ga0207708_10000573 3300026075 Bacteria 28465
522 Ga0207708_10006283 3300026075 Bacteria 8804
523 Ga0207702_10003284 3300026078 Bacteria 14915
524 Ga0207702_10116321 3300026078 Bacteria 2386
525 Ga0207702_10173574 3300026078 Bacteria 1979
526 Ga0207641_10001041 3300026088 Bacteria 28118
527 Ga0207641_10045137 3300026088 Bacteria 3709
528 Ga0207648_10000581 3300026089 Bacteria 41019
529 Ga0207648_10056497 3300026089 Bacteria 3425
530 Ga0207648_10080415 3300026089 Bacteria 2843
531 Ga0207648_10299183 3300026089 Bacteria 1443
532 Ga0207676_10000124 3300026095 Bacteria 67747
533 Ga0207676_10038983 3300026095 Bacteria 3631
534 Ga0207676_10041569 3300026095 Bacteria 3530
535 Ga0207676_10099964 3300026095 Bacteria 2402
536 Ga0207674_10000095 3300026116 Bacteria 99278
537 Ga0207674_10136790 3300026116 Bacteria 2411
538 Ga0207675_100000414 3300026118 Bacteria 41042
539 Ga0207675_100000774 3300026118 Bacteria 31932
540 Ga0207675_100006890 3300026118 Bacteria 10763
541 Ga0207675_100033910 3300026118 Bacteria 4757
542 Ga0207683_10000242 3300026121 Bacteria 48576
543 Ga0207683_10001174 3300026121 Bacteria 23704
544 Ga0207683_10009390 3300026121 Bacteria 8332
545 Ga0207683_10010671 3300026121 Bacteria 7829
546 Ga0207683_10142415 3300026121 Bacteria 2161
547 Ga0207683_10178426 3300026121 Bacteria 1925
548 Ga0207698_10000951 3300026142 Bacteria 16837
549 Ga0207698_10024205 3300026142 Bacteria 4257
550 Ga0207698_10040475 3300026142 Bacteria 3464
551 Ga0207698_10045410 3300026142 Bacteria 3310
552 Ga0207698_10175166 3300026142 Bacteria 1893
553 Ga0210002_1001450 3300027617 Bacteria 3346
554 Ga0209983_1015293 3300027665 Bacteria 1582
555 Ga0209966_1001052 3300027695 Bacteria 5088
556 Ga0209998_10021989 3300027717 Bacteria 1373
557 Ga0209974_10006235 3300027876 Bacteria 4171
558 Ga0207428_10000037 3300027907 Bacteria 218857
559 Ga0207428_10001217 3300027907 Bacteria 27628
560 Ga0207428_10001773 3300027907 Bacteria 22109
561 Ga0207428_10111969 3300027907 Bacteria 2100
562 Ga0268266_10010785 3300028379 Bacteria 7962
563 Ga0268266_10030986 3300028379 Bacteria 4542
564 Ga0268266_10046350 3300028379 Bacteria 3722
565 Ga0268265_10000757 3300028380 Bacteria 31383
566 Ga0268265_10077792 3300028380 Bacteria 2607
567 Ga0268265_10101042 3300028380 Bacteria 2329
568 Ga0268264_10002331 3300028381 Bacteria 16789
569 Ga0268264_10002813 3300028381 Bacteria 15201
570 Ga0265337_1000827 3300028556 Bacteria 16247
571 Ga0265325_10000049 3300031241 Bacteria 80854
572 Ga0265325_10000449 3300031241 Bacteria 29667
573 Ga0265325_10146745 3300031241 Bacteria 1118
574 Ga0265339_10010187 3300031249 Bacteria 5852
575 Ga0265316_10096444 3300031344 Bacteria 2252
576 Ga0265316_10171026 3300031344 Bacteria 1621
577 Ga0265313_10000367 3300031595 Bacteria 48929
578 Ga0265313_10003967 3300031595 Bacteria 11626
579 Ga0265313_10015742 3300031595 Bacteria 4383
580 Ga0265342_10000677 3300031712 Bacteria 35579
581 Ga0307516_10050383 3300031730 Bacteria 4086
582 Ga0307416_100010572 3300032002 Bacteria 6105
583 Ga0307416_100105843 3300032002 Bacteria 2464
584 Ga0307414_10082841 3300032004 Bacteria 2353
585 Ga0307414_10179314 3300032004 Bacteria 1702
586 Ga0307415_100002198 3300032126 Bacteria 9657
587 Ga0316583_10000628 3300032133 Bacteria 10789
588 Ga0373930_0000371 3300034816 Bacteria 5868
589 Ga0373948_0000135 3300034817 Bacteria 7792
590 Ga0373948_0011654 3300034817 Bacteria 1559
591 Ga0373950_0000327 3300034818 Bacteria 5972
592 Ga0373950_0008917 3300034818 Bacteria 1589
593 Ga0373958_0000084 3300034819 Bacteria 9758
594 Ga0373958_0001069 3300034819 Bacteria 3596
595 Ga0373958_0007148 3300034819 Bacteria 1767
596 Ga0373958_0008916 3300034819 Bacteria 1639
597 Ga0373938_0000013 3300034957 Bacteria 24269
598 Ga0373928_0001053 3300035084 Bacteria 5442
599 Ga0373928_0013678 3300035084 Bacteria 1631
600 Ga0373934_0020165 3300035086 Bacteria 2562
601 Ga0373940_0002191 3300035088 Bacteria 3746
602 Ga0373949_0001199 3300035090 Bacteria 7686
603 Ga0373949_0001274 3300035090 Bacteria 7344
604 Ga0373952_0000880 3300035092 Bacteria 5466
605 Ga0373952_0008037 3300035092 Bacteria 1992
606 Ga0373923_0001378 3300035111 Bacteria 6932
607 Ga0373932_0001840 3300035112 Bacteria 5677
608 Ga0373939_0001777 3300035114 Bacteria 5188
609 Ga0373941_0000125 3300035115 Bacteria 13305
610 Ga0373941_0002154 3300035115 Bacteria 4294
611 Ga0373941_0009277 3300035115 Bacteria 2473
612 Ga0373953_0005292 3300035117 Bacteria 4176
613 Ga0373956_0004976 3300035119 Bacteria 5327
614 Ga0373957_0028363 3300035120 Bacteria 2039
615 Ga0373960_0006378 3300035121 Bacteria 2766
616 Ga0373943_0059752 3300035170 Bacteria 1901
617 Ga0373946_0063744 3300035171 Bacteria 1575
618 Ga0373955_0009608 3300035172 Bacteria 4539
619 Ga0373942_0008302 3300035207 Bacteria 2420
620 Ga0373961_0000638 3300035241 Bacteria 12665
621 Ga0373961_0016882 3300035241 Bacteria 1885
622 Ga0373962_0000542 3300035242 Bacteria 8470
623 Ga0373962_0000610 3300035242 Bacteria 8072
624 Ga0373924_0170015 3300035410 Bacteria 958
625 Ga0373931_0001856 3300035691 Bacteria 9202
626 Ga0373931_0002178 3300035691 Bacteria 8639
627 Ga0373931_0062411 3300035691 Bacteria 2012
628 Ga0373931_0098181 3300035691 Bacteria 1643
629 Ga0373935_0015566 3300035692 Bacteria 4598
630 Ga0373927_0000951 3300035695 Bacteria 22059
631 Ga0373927_0186281 3300035695 Bacteria 1362
632 Ga0373933_0003247 3300035724 Bacteria 9080
633 Ga0373933_0011036 3300035724 Bacteria 4964
634 Ga0373947_0001613 3300035725 Bacteria 13832
635 Ga0373947_0053957 3300035725 Bacteria 2425
636 Ga0373947_0116294 3300035725 Bacteria 1696
637 Ga0373937_0003502 3300036401 Bacteria 13198
638 Ga0373937_0070411 3300036401 Bacteria 3226
639 Ga0373937_0073217 3300036401 Bacteria 3160
640 Ga0373937_0361944 3300036401 Bacteria 1375
641 Ga0373925_0004688 3300037068 Bacteria 10316
642 Ga0373925_0063632 3300037068 Bacteria 2776
643 Ga0373925_0094420 3300037068 Bacteria 2290
644 Ga0395900_0017348 3300037418 Bacteria 7350
645 Ga0395898_0006718 3300037466 Bacteria 12266
646 Ga0395898_0014233 3300037466 Bacteria 8177
647 Ga0395898_0075499 3300037466 Bacteria 3256
648 Ga0395905_0003688 3300037471 Bacteria 16210
649 Ga0395905_0105739 3300037471 Bacteria 2643
650 Ga0395905_0124190 3300037471 Bacteria 2427
651 Ga0395901_0022367 3300038443 Bacteria 6478
652 Ga0395901_0097496 3300038443 Bacteria 3082
653 Ga0395901_0268937 3300038443 Bacteria 1773
654 Ga0242420_002459 3300038996 Bacteria 2643
655 Ga0439441_010371 3300042001 Bacteria 1561
656 Ga0439463_025969 3300042016 Bacteria 1471
657 Ga0439464_0036453 3300042439 Bacteria 1391
658 Ga0466972_0015182 3300044658 Bacteria 3850
659 Ga0466965_0107678 3300044683 Bacteria 1430
660 Ga0466963_0006183 3300044694 Bacteria 7068
661 Ga0453684_0117665 3300044712 Bacteria 3216
662 Ga0466968_0175285 3300044735 Unclassified 995
663 Ga0466957_0082975 3300044842 Bacteria 1998
664 Ga0466960_0026170 3300044901 Bacteria 2647
665 Ga0451576_0006125 3300045051 Bacteria 14822
666 Ga0466967_0146415 3300045976 Bacteria 2203
667 Ga0495592_0063389 3300046454 Bacteria 2711
668 Ga0495603_0073075 3300046455 Bacteria 2015
669 Ga0495629_0016760 3300046459 Bacteria 5258
670 Ga0495629_0027053 3300046459 Bacteria 4074
671 Ga0495629_0046557 3300046459 Bacteria 3042
672 Ga0495638_0085840 3300046460 Bacteria 1903
673 Ga0495651_0001390 3300046462 Bacteria 18780
674 Ga0495651_0003040 3300046462 Bacteria 12936
675 Ga0495651_0037130 3300046462 Bacteria 3793
676 Ga0495653_0002914 3300046463 Bacteria 13682
677 Ga0495653_0025910 3300046463 Bacteria 4705
678 Ga0495653_0237990 3300046463 Bacteria 1215
679 Ga0495582_0012076 3300046473 Bacteria 4759
680 Ga0495664_0050005 3300046477 Bacteria 2481
681 Ga0495594_0085893 3300046499 Bacteria 1760
682 Ga0495594_0105719 3300046499 Bacteria 1585
683 Ga0495608_0002575 3300046511 Bacteria 13014
684 Ga0495608_0049633 3300046511 Bacteria 2786
685 Ga0495608_0188263 3300046511 Bacteria 1304
686 Ga0495618_0033729 3300046514 Bacteria 3210
687 Ga0495618_0199864 3300046514 Bacteria 1265
688 Ga0495628_0018554 3300046516 Bacteria 5760
689 Ga0495630_0011811 3300046517 Bacteria 6329
690 Ga0495630_0381737 3300046517 Bacteria 1079
691 Ga0495643_0001057 3300046522 Bacteria 27702
692 Ga0495643_0037183 3300046522 Bacteria 2672
693 Ga0495642_0099534 3300046528 Bacteria 1236
694 Ga0495652_0017992 3300046529 Bacteria 6305
695 Ga0495652_0114884 3300046529 Bacteria 2158
696 Ga0495665_0008400 3300046531 Bacteria 5600
697 Ga0495665_0051314 3300046531 Bacteria 2185
698 Ga0495640_0004112 3300046533 Bacteria 11640
699 Ga0495640_0016677 3300046533 Bacteria 5494
700 Ga0495640_0178579 3300046533 Bacteria 1354
701 Ga0495586_0013941 3300046535 Bacteria 4265
702 Ga0495587_0000592 3300046536 Bacteria 24861
703 Ga0495598_0034242 3300046537 Bacteria 1447
704 Ga0495597_0009494 3300046542 Bacteria 4802
705 Ga0495645_0009188 3300046543 Bacteria 6907
706 Ga0495633_0000840 3300046558 Bacteria 27053
707 Ga0495667_0015047 3300046559 Bacteria 5222
708 Ga0495667_0066259 3300046559 Bacteria 2361
709 Ga0495667_0131527 3300046559 Bacteria 1614
710 Ga0495668_0035104 3300046616 Bacteria 2810
711 Ga0495668_0069815 3300046616 Bacteria 1932
712 Ga0495625_0257737 3300046660 Bacteria 1130
713 Ga0495625_0285823 3300046660 Bacteria 1060
714 Ga0495635_0089136 3300046663 Bacteria 2110
715 Ga0495661_0009254 3300046665 Bacteria 6767
716 Ga0495657_0034526 3300046675 Bacteria 3512
717 Ga0495657_0044791 3300046675 Bacteria 3007
718 Ga0495657_0115655 3300046675 Bacteria 1694
719 Ga0495623_0000569 3300046679 Bacteria 24558
720 Ga0495623_0028202 3300046679 Bacteria 3612
721 Ga0495623_0120930 3300046679 Bacteria 1576
722 Ga0495646_0013966 3300046680 Bacteria 5103
723 Ga0495646_0069877 3300046680 Bacteria 2070
724 Ga0495646_0072760 3300046680 Bacteria 2021
725 Ga0495647_0025500 3300046681 Bacteria 2160
726 Ga0495658_0001364 3300046683 Bacteria 12807
727 Ga0495658_0009773 3300046683 Bacteria 4783
728 Ga0495669_0007219 3300046684 Bacteria 4657
729 Ga0495613_0093917 3300046689 Bacteria 2171
730 Ga0495613_0133762 3300046689 Bacteria 1775
731 Ga0495600_0021660 3300046809 Bacteria 4120
732 Ga0495600_0162683 3300046809 Bacteria 1442
733 Ga0495660_0048035 3300046810 Bacteria 2335
734 Ga0495581_0075165 3300047315 Bacteria 1955
735 Ga0495604_0015813 3300047317 Bacteria 6022
736 Ga0495604_0126039 3300047317 Bacteria 1846
737 Ga0495674_0060491 3300047319 Bacteria 3305
738 Ga0495674_0091058 3300047319 Bacteria 2605
739 Ga0495674_0183316 3300047319 Bacteria 1742
740 Ga0495676_0078385 3300047321 Bacteria 2516
741 Ga0495680_0013849 3300047322 Bacteria 7016
742 Ga0495680_0016164 3300047322 Bacteria 6416
743 Ga0495680_0017538 3300047322 Bacteria 6108
744 Ga0495675_0000815 3300047444 Bacteria 19215
745 Ga0495675_0125243 3300047444 Bacteria 1599
746 Ga0495684_0013859 3300047471 Bacteria 6201
747 Ga0495684_0067831 3300047471 Bacteria 2713
748 Ga0495602_0075852 3300048088 Bacteria 2852
749 Ga0495614_0011254 3300048089 Bacteria 3937
750 Ga0495615_0026860 3300048090 Bacteria 1347
751 Ga0496100_0000345 3300048903 Bacteria 22686
752 Ga0496100_0009503 3300048903 Bacteria 5464
753 Ga0496101_0000866 3300048904 Bacteria 17903
754 Ga0496101_0082414 3300048904 Bacteria 2380
755 Ga0496102_0001833 3300048905 Bacteria 18355
756 Ga0496102_0009757 3300048905 Bacteria 8255
757 Ga0496102_0149148 3300048905 Bacteria 2196
758 Ga0496102_0152829 3300048905 Bacteria 2169
759 Ga0496103_0001022 3300048906 Bacteria 19583
760 Ga0496103_0011074 3300048906 Bacteria 5341
761 Ga0496103_0114002 3300048906 Bacteria 1718
762 Ga0496103_0139041 3300048906 Bacteria 1552
763 Ga0496103_0273803 3300048906 Bacteria 1086
764 Ga0496104_0000399 3300048907 Bacteria 38066
765 Ga0496104_0019547 3300048907 Bacteria 6200
766 Ga0496104_0072995 3300048907 Bacteria 3264
767 Ga0496104_0090384 3300048907 Bacteria 2925
768 Ga0496104_0183110 3300048907 Bacteria 2005
769 Ga0496104_0525705 3300048907 Bacteria 1094
770 Ga0496105_0007591 3300048908 Bacteria 8406
771 Ga0496105_0277548 3300048908 Bacteria 1352
772 Ga0496106_0002528 3300048909 Bacteria 13620
773 Ga0496106_0011874 3300048909 Bacteria 6431
774 Ga0496106_0046057 3300048909 Bacteria 3277
775 Ga0496107_0013104 3300048910 Bacteria 5792
776 Ga0496107_0045820 3300048910 Bacteria 3146
777 Ga0496107_0155049 3300048910 Bacteria 1695
778 Ga0496108_0006961 3300048911 Bacteria 9152
779 Ga0496108_0107612 3300048911 Bacteria 2381
780 Ga0496108_0153348 3300048911 Bacteria 1988
781 Ga0496108_0179411 3300048911 Bacteria 1833
782 Ga0496108_0195394 3300048911 Bacteria 1754
783 Ga0496108_0227434 3300048911 Bacteria 1621
784 Ga0496108_0308844 3300048911 Bacteria 1378
785 Ga0496109_0000086 3300048912 Bacteria 95253
786 Ga0496109_0002193 3300048912 Bacteria 16208
787 Ga0496109_0002269 3300048912 Bacteria 15980
788 Ga0496109_0062339 3300048912 Bacteria 3409
789 Ga0496109_0068652 3300048912 Bacteria 3248
790 Ga0496109_0189441 3300048912 Bacteria 1933
791 Ga0496109_0309053 3300048912 Bacteria 1491
792 Ga0496110_0011525 3300048913 Bacteria 7242
793 Ga0496110_0026044 3300048913 Bacteria 5001
794 Ga0496110_0142283 3300048913 Bacteria 2168
795 Ga0496110_0192968 3300048913 Bacteria 1849
796 Ga0496111_0067217 3300048914 Bacteria 2604
797 Ga0496111_0193652 3300048914 Bacteria 1511
798 Ga0496111_0309637 3300048914 Bacteria 1170
799 Ga0496112_0003327 3300048915 Bacteria 13267
800 Ga0496112_0033949 3300048915 Bacteria 4963
801 Ga0496112_0213360 3300048915 Bacteria 1887
802 Ga0496112_0238048 3300048915 Bacteria 1773
803 Ga0496112_0268323 3300048915 Bacteria 1655
804 Ga0496113_0003576 3300048916 Bacteria 9327
805 Ga0496113_0324098 3300048916 Bacteria 1235
806 Ga0496114_0019405 3300048917 Bacteria 5508
807 Ga0496114_0027893 3300048917 Bacteria 4628
808 Ga0496114_0047784 3300048917 Bacteria 3559
809 Ga0496114_0093376 3300048917 Bacteria 2558
810 Ga0496114_0102844 3300048917 Bacteria 2441
811 Ga0496115_0000967 3300048918 Bacteria 20862
812 Ga0496115_0012638 3300048918 Bacteria 6362
813 Ga0496115_0020459 3300048918 Bacteria 5106
814 Ga0496115_0171791 3300048918 Bacteria 1792
815 Ga0496115_0520116 3300048918 Bacteria 954
816 Ga0496117_0203750 3300048920 Bacteria 1116
817 Ga0496120_0002681 3300048923 Bacteria 17483
818 Ga0496120_0053840 3300048923 Bacteria 2284
819 Ga0496122_0002952 3300048925 Bacteria 23182
820 Ga0496123_0002116 3300048926 Bacteria 25471
821 Ga0496126_0010620 3300048929 Bacteria 9629
822 Ga0501031_0000011 3300049568 Bacteria 142761
823 Ga0501031_0006154 3300049568 Bacteria 7834
824 Ga0501032_0000006 3300049569 Bacteria 261727
825 Ga0501032_0000029 3300049569 Bacteria 130865
826 Ga0501032_0063621 3300049569 Bacteria 2469
827 Ga0501032_0070967 3300049569 Bacteria 2322
828 Ga0501033_0000039 3300049570 Bacteria 142732
829 Ga0501033_0000168 3300049570 Bacteria 62921
830 Ga0501033_0011727 3300049570 Bacteria 6702
831 Ga0501034_0000030 3300049571 Bacteria 248180
832 Ga0501034_0000434 3300049571 Bacteria 69367
833 Ga0501034_0011360 3300049571 Bacteria 9234
834 Ga0501034_0021075 3300049571 Bacteria 6651
835 Ga0501034_0135160 3300049571 Bacteria 2447
836 Ga0501036_0000003 3300049572 Bacteria 261545
837 Ga0501036_0000444 3300049572 Bacteria 29528
838 Ga0501036_0000999 3300049572 Bacteria 21368
839 Ga0501036_0011708 3300049572 Bacteria 7269
840 Ga0501036_0238748 3300049572 Bacteria 1524
841 Ga0501037_0000003 3300049573 Bacteria 261548
842 Ga0501037_0000872 3300049573 Bacteria 22530
843 Ga0501037_0025532 3300049573 Bacteria 4364
844 Ga0501037_0104914 3300049573 Bacteria 2037
845 Ga0501037_0134748 3300049573 Bacteria 1769
846 Ga0501038_0000004 3300049574 Bacteria 261289
847 Ga0501038_0000397 3300049574 Bacteria 37858
848 Ga0501038_0064483 3300049574 Bacteria 3124
849 Ga0501038_0069640 3300049574 Bacteria 2988
850 Ga0501039_0000008 3300049575 Bacteria 274778
851 Ga0501039_0000040 3300049575 Bacteria 115567
852 Ga0501039_0017409 3300049575 Bacteria 5511
853 Ga0501039_0020496 3300049575 Bacteria 5066
854 Ga0501039_0228716 3300049575 Bacteria 1462
855 Ga0501040_0021742 3300049576 Bacteria 4289
856 Ga0501040_0066210 3300049576 Bacteria 2489
857 Ga0501042_0280874 3300049578 Bacteria 1202
858 Ga0501043_0000177 3300049579 Bacteria 56981
859 Ga0501043_0000560 3300049579 Bacteria 33338
860 Ga0501043_0056663 3300049579 Bacteria 3078
861 Ga0501043_0085563 3300049579 Bacteria 2477
862 Ga0501046_0027824 3300049580 Bacteria 4608
863 Ga0501046_0029478 3300049580 Bacteria 4460
864 Ga0501046_0042624 3300049580 Bacteria 3618
865 Ga0501046_0055891 3300049580 Bacteria 3099
866 Ga0501046_0113288 3300049580 Bacteria 2070
867 Ga0501047_0000235 3300049581 Bacteria 65603
868 Ga0501047_0002232 3300049581 Bacteria 18536
869 Ga0501047_0013069 3300049581 Bacteria 7863
870 Ga0501047_0028366 3300049581 Bacteria 5395
871 Ga0501047_0080796 3300049581 Bacteria 3125
872 Ga0501047_0085667 3300049581 Bacteria 3027
873 Ga0501047_0086031 3300049581 Bacteria 3020
874 Ga0501048_0001478 3300049582 Bacteria 17828
875 Ga0501048_0018257 3300049582 Bacteria 5160
876 Ga0501048_0184007 3300049582 Bacteria 1481
877 Ga0501067_0107194 3300049583 Bacteria 1553
878 Ga0501068_0008698 3300049584 Bacteria 5661
879 Ga0501069_0031216 3300049585 Bacteria 2929
880 Ga0501070_0003834 3300049586 Bacteria 12978
881 Ga0501070_0006925 3300049586 Bacteria 9649
882 Ga0501070_0016166 3300049586 Bacteria 6270
883 Ga0501070_0054553 3300049586 Bacteria 3314
884 Ga0501070_0079535 3300049586 Bacteria 2713
885 Ga0501070_0087292 3300049586 Bacteria 2582
886 Ga0501070_0216481 3300049586 Bacteria 1571
887 Ga0501070_0291310 3300049586 Bacteria 1330
888 Ga0501071_0056645 3300049587 Bacteria 2832
889 Ga0501071_0091436 3300049587 Bacteria 2235
890 Ga0501072_0122600 3300049588 Bacteria 2071
891 Ga0501073_0095188 3300049589 Bacteria 2068
892 Ga0501074_0015817 3300049590 Bacteria 5486
893 Ga0501074_0080424 3300049590 Bacteria 2338
894 Ga0501074_0116677 3300049590 Bacteria 1910
895 Ga0501079_0400073 3300049741 Bacteria 1077
896 Ga0501080_0001954 3300049742 Bacteria 17798
897 Ga0501080_0028000 3300049742 Bacteria 5240
898 Ga0501080_0189677 3300049742 Bacteria 1889
899 Ga0501083_0003735 3300049744 Bacteria 10694
900 Ga0501083_0034611 3300049744 Bacteria 3453
901 Ga0501083_0048003 3300049744 Bacteria 2883
902 Ga0501035_0000112 3300049822 Bacteria 99138
903 Ga0501035_0000144 3300049822 Bacteria 86257
904 Ga0501035_0001116 3300049822 Bacteria 28096
905 Ga0501035_0017005 3300049822 Bacteria 6702
906 Ga0501035_0024179 3300049822 Bacteria 5572
907 Ga0501035_0203969 3300049822 Bacteria 1694
908 Ga0501035_0226799 3300049822 Bacteria 1593
909 Ga0501044_0000008 3300049823 Bacteria 274778
910 Ga0501044_0005687 3300049823 Bacteria 13819
911 Ga0501044_0005957 3300049823 Bacteria 13490
912 Ga0501044_0022594 3300049823 Bacteria 6702
913 Ga0501044_0061369 3300049823 Bacteria 3846
914 Ga0501044_0072080 3300049823 Bacteria 3513
915 Ga0501044_0137971 3300049823 Bacteria 2428
916 nmdc:mga00v17_5132_c1 3300050491 Bacteria 4712
917 nmdc:mga0yw44_1475_c1 3300050492 Bacteria 9373
918 nmdc:mga0yw44_16078_c1 3300050492 Bacteria 4032
919 nmdc:mga0yw44_186545_c1 3300050492 Bacteria 1367
920 nmdc:mga06z11_276429_c1 3300050494 Bacteria 994
921 nmdc:mga06z11_28859_c1 3300050494 Bacteria 2666
922 nmdc:mga07m45_14713_c1 3300050496 Bacteria 4175
923 nmdc:mga07m45_147922_c1 3300050496 Bacteria 1362
924 nmdc:mga05p37_11291_c1 3300050507 Bacteria 10625
925 nmdc:mga05p37_1975_c1 3300050507 Bacteria 23914
926 nmdc:mga05p37_43110_c1 3300050507 Bacteria 5549
927 nmdc:mga05p37_540205_c1 3300050507 Bacteria 1329
928 nmdc:mga09592_1638_c1 3300050508 Bacteria 18033
929 nmdc:mga09592_183144_c1 3300050508 Bacteria 1812
930 nmdc:mga0qj67_969_c1 3300050509 Bacteria 19753
931 nmdc:mga06r32_47690_c1 3300050510 Bacteria 4093
932 nmdc:mga06r32_5519_c1 3300050510 Bacteria 11399
933 nmdc:mga06r32_638_c1 3300050510 Bacteria 30472
934 nmdc:mga08y16_13712_c1 3300050511 Bacteria 8533
935 nmdc:mga08y16_16181_c1 3300050511 Bacteria 7841
936 nmdc:mga08y16_333_c1 3300050511 Bacteria 42807
937 nmdc:mga08y16_549_c1 3300050511 Bacteria 34756
938 nmdc:mga0n895_110078_c1 3300050512 Bacteria 2770
939 nmdc:mga0n895_1174_c1 3300050512 Bacteria 19193
940 nmdc:mga0n895_230391_c1 3300050512 Bacteria 1880
941 nmdc:mga0n895_233805_c1 3300050512 Bacteria 1865
942 nmdc:mga0n895_45441_c1 3300050512 Bacteria 4286
943 nmdc:mga0n895_807_c1 3300050512 Bacteria 22393
944 nmdc:mga0n895_86938_c1 3300050512 Bacteria 3123
945 nmdc:mga0n895_97850_c1 3300050512 Bacteria 2940
946 nmdc:mga0rr50_108639_c1 3300050513 Bacteria 2192
947 nmdc:mga0rr50_135891_c1 3300050513 Bacteria 1973
948 nmdc:mga0rr50_2201_c1 3300050513 Bacteria 10932
949 nmdc:mga0a205_42015_c1 3300050515 Bacteria 4405
950 nmdc:mga0a205_53174_c1 3300050515 Bacteria 3908
951 nmdc:mga0a205_745_c1 3300050515 Bacteria 26246
952 nmdc:mga0sz30_25203_c1 3300050516 Bacteria 2432
953 Ga0495601_0001138 3300053077 Bacteria 14570
954 Ga0495601_0004969 3300053077 Bacteria 7717
955 Ga0495601_0013085 3300053077 Bacteria 4987
956 Ga0495612_0007560 3300053078 Bacteria 4441
957 Ga0495612_0010175 3300053078 Bacteria 3804
958 Ga0495612_0012061 3300053078 Bacteria 3481
959 Ga0495612_0018057 3300053078 Bacteria 2823
960 Ga0495612_0019860 3300053078 Bacteria 2692
961 Ga0500610_0019799 3300053079 Bacteria 3275
962 Ga0495655_0005186 3300053083 Bacteria 2286
963 Ga0495595_0000967 3300053084 Bacteria 11043
964 Ga0495595_0004707 3300053084 Bacteria 5490
965 Ga0495595_0008594 3300053084 Bacteria 4199
966 Ga0495619_0000349 3300053085 Bacteria 32210
967 Ga0495619_0000430 3300053085 Bacteria 28482
968 Ga0495619_0004620 3300053085 Bacteria 8778
969 Ga0495619_0005118 3300053085 Bacteria 8322
970 Ga0495619_0034792 3300053085 Bacteria 3275
971 Ga0495619_0091252 3300053085 Bacteria 2062
972 Ga0495619_0217143 3300053085 Bacteria 1324
973 Ga0500643_008569 3300053087 Bacteria 4008
974 Ga0500641_0010774 3300053096 Bacteria 3311
975 Ga0500595_000016 3300053119 Bacteria 211397
976 Ga0500595_026251 3300053119 Bacteria 2009
977 Ga0500620_000454 3300053155 Bacteria 7381
978 Ga0500620_001650 3300053155 Bacteria 4210
979 Ga0500627_0015934 3300053158 Bacteria 2920
980 Ga0500609_008607 3300053731 Bacteria 1377
981 Ga0501082_0227623 3300060353 Bacteria 1623

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046675 Ga0495657_0115655 Ga0495657_0115655_901_1680 258
2 iso_pu_bacteria 2906427513 2906428389 261
3 3300032002 Ga0307416_100010572 Ga0307416_1000105725 264
4 3300032126 Ga0307415_100002198 Ga0307415_1000021987 264
5 iso_pu_bacteria 2881853255 2881859010 265
6 iso_pu_bacteria 2977828996 2977835763 266
7 3300005530 Ga0070679_100267966 Ga0070679_1002679662 269
8 3300025921 Ga0207652_10026866 Ga0207652_100268662 269
9 3300032004 Ga0307414_10179314 Ga0307414_101793142 270
10 3300005364 Ga0070673_100344750 Ga0070673_1003447501 272
11 3300005543 Ga0070672_100067211 Ga0070672_1000672112 272
12 3300025940 Ga0207691_10458060 Ga0207691_104580601 273
13 iso_pu_bacteria 2968138860 2968145209 274
14 3300037068 Ga0373925_0063632 Ga0373925_0063632_1309_2334 275
15 3300046459 Ga0495629_0027053 Ga0495629_0027053_2389_3414 275
16 3300046533 Ga0495640_0178579 Ga0495640_0178579_42_1067 275
17 3300046683 Ga0495658_0009773 Ga0495658_0009773_45_1070 275
18 3300013102 Ga0157371_10060452 Ga0157371_100604522 280
19 3300005335 Ga0070666_10069794 Ga0070666_100697942 281
20 3300005344 Ga0070661_100212771 Ga0070661_1002127712 281
21 3300005355 Ga0070671_100053208 Ga0070671_1000532083 281
22 3300005564 Ga0070664_100155231 Ga0070664_1001552312 281
23 3300005616 Ga0068852_100048482 Ga0068852_1000484824 281
24 3300006237 Ga0097621_100047825 Ga0097621_1000478252 281
25 3300013105 Ga0157369_10618529 Ga0157369_106185292 281
26 3300025945 Ga0207679_10260355 Ga0207679_102603552 281
27 3300026023 Ga0207677_10196088 Ga0207677_101960882 281
28 3300035695 Ga0373927_0186281 Ga0373927_0186281_309_1334 281
29 3300048912 Ga0496109_0189441 Ga0496109_0189441_682_1707 281
30 3300025901 Ga0207688_10039415 Ga0207688_100394153 282
31 3300025933 Ga0207706_10006177 Ga0207706_100061775 282
32 iso_pu_bacteria 2958144490 2958150547 283
33 3300009147 Ga0114129_10743300 Ga0114129_107433001 284
34 3300050512 nmdc:mga0n895_110078_c1 nmdc:mga0n895_110078_c1_1761_2723 284
35 3300050515 nmdc:mga0a205_53174_c1 nmdc:mga0a205_53174_c1_1081_2043 284
36 iso_pu_bacteria 2874131515 2874132644 284
37 3300005356 Ga0070674_100243015 Ga0070674_1002430152 286
38 3300005364 Ga0070673_100091896 Ga0070673_1000918962 286
39 3300006237 Ga0097621_100058617 Ga0097621_1000586173 287
40 3300006871 Ga0075434_100315712 Ga0075434_1003157122 287
41 3300005329 Ga0070683_100176436 Ga0070683_1001764361 289
42 3300005334 Ga0068869_100002437 Ga0068869_1000024378 289
43 3300005335 Ga0070666_10009526 Ga0070666_100095266 289
44 3300005338 Ga0068868_100021850 Ga0068868_1000218505 289
45 3300005343 Ga0070687_100026749 Ga0070687_1000267492 289
46 3300005347 Ga0070668_100004663 Ga0070668_1000046638 289
47 3300005353 Ga0070669_100010555 Ga0070669_1000105556 289
48 3300005356 Ga0070674_100006198 Ga0070674_1000061988 289
49 3300005367 Ga0070667_100021659 Ga0070667_1000216594 289
50 3300005457 Ga0070662_100011596 Ga0070662_1000115963 289
51 3300005459 Ga0068867_100044752 Ga0068867_1000447523 289
52 3300005543 Ga0070672_100003804 Ga0070672_1000038045 289
53 3300005577 Ga0068857_100461132 Ga0068857_1004611321 289
54 3300005617 Ga0068859_100085817 Ga0068859_1000858172 289
55 3300005618 Ga0068864_100030198 Ga0068864_1000301983 289
56 3300005718 Ga0068866_10001825 Ga0068866_100018253 289
57 3300005719 Ga0068861_100003439 Ga0068861_1000034399 289
58 3300005841 Ga0068863_100006906 Ga0068863_1000069068 289
59 3300005842 Ga0068858_100002003 Ga0068858_1000020036 289
60 3300005843 Ga0068860_100007376 Ga0068860_1000073768 289
61 3300005844 Ga0068862_100146665 Ga0068862_1001466652 289
62 3300006931 Ga0097620_100085816 Ga0097620_1000858162 289
63 3300009094 Ga0111539_10485927 Ga0111539_104859272 289
64 3300009148 Ga0105243_10015285 Ga0105243_100152852 289
65 3300009176 Ga0105242_10258309 Ga0105242_102583092 289
66 3300009553 Ga0105249_10041930 Ga0105249_100419304 289
67 3300013306 Ga0163162_10109954 Ga0163162_101099542 289
68 3300013308 Ga0157375_10002379 Ga0157375_100023798 289
69 3300014326 Ga0157380_10008734 Ga0157380_100087345 289
70 3300014968 Ga0157379_10023266 Ga0157379_100232666 289
71 3300025893 Ga0207682_10013203 Ga0207682_100132034 289
72 3300025899 Ga0207642_10007466 Ga0207642_100074662 289
73 3300025903 Ga0207680_10004563 Ga0207680_100045636 289
74 3300025918 Ga0207662_10011648 Ga0207662_100116483 289
75 3300025923 Ga0207681_10001008 Ga0207681_1000100815 289
76 3300025933 Ga0207706_10013452 Ga0207706_100134525 289
77 3300025934 Ga0207686_10167481 Ga0207686_101674812 289
78 3300025935 Ga0207709_10016430 Ga0207709_100164304 289
79 3300025937 Ga0207669_10011343 Ga0207669_100113433 289
80 3300025942 Ga0207689_10004425 Ga0207689_100044258 289
81 3300025945 Ga0207679_10072670 Ga0207679_100726702 289
82 3300025972 Ga0207668_10005924 Ga0207668_100059244 289
83 3300026035 Ga0207703_10004462 Ga0207703_1000446212 289
84 3300026089 Ga0207648_10056497 Ga0207648_100564972 289
85 3300026095 Ga0207676_10041569 Ga0207676_100415693 289
86 3300026118 Ga0207675_100006890 Ga0207675_1000068905 289
87 3300028381 Ga0268264_10002813 Ga0268264_100028139 289
88 3300046537 Ga0495598_0034242 Ga0495598_0034242_273_1298 289
89 3300005331 Ga0070670_100003174 Ga0070670_1000031745 290
90 3300005333 Ga0070677_10015355 Ga0070677_100153552 290
91 3300005354 Ga0070675_100009512 Ga0070675_1000095122 290
92 3300005355 Ga0070671_100116746 Ga0070671_1001167462 290
93 3300005364 Ga0070673_100006863 Ga0070673_1000068635 290
94 3300005367 Ga0070667_100187175 Ga0070667_1001871752 290
95 3300005456 Ga0070678_100006220 Ga0070678_1000062202 290
96 3300005543 Ga0070672_100033253 Ga0070672_1000332532 290
97 3300005618 Ga0068864_100032654 Ga0068864_1000326542 290
98 3300005841 Ga0068863_100507583 Ga0068863_1005075831 290
99 3300013308 Ga0157375_10055341 Ga0157375_100553415 290
100 3300014969 Ga0157376_10044552 Ga0157376_100445522 290
101 3300025901 Ga0207688_10029501 Ga0207688_100295013 290
102 3300025926 Ga0207659_10029958 Ga0207659_100299584 290
103 3300025931 Ga0207644_10083949 Ga0207644_100839492 290
104 3300025940 Ga0207691_10008786 Ga0207691_100087865 290
105 3300025986 Ga0207658_10023034 Ga0207658_100230344 290
106 3300026095 Ga0207676_10038983 Ga0207676_100389832 290
107 3300026121 Ga0207683_10010671 Ga0207683_100106715 290
108 3300006871 Ga0075434_100090524 Ga0075434_1000905243 292
109 iso_pu_bacteria 2937891427 2937896710 292
110 3300025945 Ga0207679_10066848 Ga0207679_100668482 293
111 3300035170 Ga0373943_0059752 Ga0373943_0059752_87_1031 294
112 3300035171 Ga0373946_0063744 Ga0373946_0063744_52_996 294
113 3300035725 Ga0373947_0053957 Ga0373947_0053957_763_1707 294
114 3300046455 Ga0495603_0073075 Ga0495603_0073075_624_1568 294
115 3300046459 Ga0495629_0016760 Ga0495629_0016760_3496_4440 294
116 3300046473 Ga0495582_0012076 Ga0495582_0012076_204_1148 294
117 3300046499 Ga0495594_0105719 Ga0495594_0105719_224_1168 294
118 3300046681 Ga0495647_0025500 Ga0495647_0025500_438_1382 294
119 3300046683 Ga0495658_0001364 Ga0495658_0001364_9480_10424 294
120 3300046689 Ga0495613_0093917 Ga0495613_0093917_328_1272 294
121 3300050508 nmdc:mga09592_183144_c1 nmdc:mga09592_183144_c1_742_1734 294
122 3300053085 Ga0495619_0005118 Ga0495619_0005118_2718_3662 294
123 3300005356 Ga0070674_100099854 Ga0070674_1000998542 296
124 iso_pu_bacteria 2924754689 2924762570 296
125 3300005331 Ga0070670_100173359 Ga0070670_1001733591 297
126 3300005337 Ga0070682_100066117 Ga0070682_1000661171 297
127 3300005340 Ga0070689_100026576 Ga0070689_1000265763 297
128 3300005441 Ga0070700_100098822 Ga0070700_1000988222 297
129 3300005549 Ga0070704_100216206 Ga0070704_1002162061 297
130 3300005843 Ga0068860_100174138 Ga0068860_1001741382 297
131 3300025899 Ga0207642_10051660 Ga0207642_100516602 297
132 3300025900 Ga0207710_10015430 Ga0207710_100154302 297
133 3300025905 Ga0207685_10020978 Ga0207685_100209782 297
134 3300025915 Ga0207693_10003519 Ga0207693_100035194 297
135 3300025916 Ga0207663_10018683 Ga0207663_100186833 297
136 3300025919 Ga0207657_10058761 Ga0207657_100587613 297
137 3300025927 Ga0207687_10117028 Ga0207687_101170282 297
138 3300025928 Ga0207700_10009939 Ga0207700_100099393 297
139 3300025931 Ga0207644_10161389 Ga0207644_101613892 297
140 3300025934 Ga0207686_10122465 Ga0207686_101224652 297
141 3300025935 Ga0207709_10026603 Ga0207709_100266034 297
142 3300025936 Ga0207670_10097235 Ga0207670_100972352 297
143 3300025939 Ga0207665_10000273 Ga0207665_1000027332 297
144 3300025941 Ga0207711_10134794 Ga0207711_101347941 297
145 3300025960 Ga0207651_10070958 Ga0207651_100709582 297
146 3300025972 Ga0207668_10169535 Ga0207668_101695352 297
147 3300026035 Ga0207703_10095892 Ga0207703_100958922 297
148 3300026067 Ga0207678_10005685 Ga0207678_100056856 297
149 3300026089 Ga0207648_10299183 Ga0207648_102991832 297
150 3300026121 Ga0207683_10001174 Ga0207683_1000117419 297
151 3300028379 Ga0268266_10030986 Ga0268266_100309862 297
152 3300001976 JGI24752J21851_1003441 JGI24752J21851_10034412 298
153 3300001990 JGI24737J22298_10000053 JGI24737J22298_1000005327 298
154 3300002075 JGI24738J21930_10002204 JGI24738J21930_100022045 298
155 3300002076 JGI24749J21850_1000375 JGI24749J21850_10003758 298
156 3300002239 JGI24034J26672_10000960 JGI24034J26672_100009603 298
157 3300002244 JGI24742J22300_10000216 JGI24742J22300_100002168 298
158 3300005290 Ga0065712_10172224 Ga0065712_101722242 298
159 3300005293 Ga0065715_10093047 Ga0065715_100930476 298
160 3300005328 Ga0070676_10004729 Ga0070676_100047296 298
161 3300005329 Ga0070683_100001083 Ga0070683_1000010838 298
162 3300005330 Ga0070690_100002762 Ga0070690_1000027627 298
163 3300005331 Ga0070670_100005035 Ga0070670_1000050355 298
164 3300005333 Ga0070677_10002672 Ga0070677_100026722 298
165 3300005334 Ga0068869_100000279 Ga0068869_10000027911 298
166 3300005336 Ga0070680_100021592 Ga0070680_1000215926 298
167 3300005338 Ga0068868_100004075 Ga0068868_1000040758 298
168 3300005339 Ga0070660_100000245 Ga0070660_10000024525 298
169 3300005341 Ga0070691_10006681 Ga0070691_100066813 298
170 3300005343 Ga0070687_100000348 Ga0070687_10000034815 298
171 3300005344 Ga0070661_100000017 Ga0070661_100000017154 298
172 3300005345 Ga0070692_10000101 Ga0070692_1000010115 298
173 3300005347 Ga0070668_100003604 Ga0070668_10000360411 298
174 3300005353 Ga0070669_100000314 Ga0070669_10000031428 298
175 3300005354 Ga0070675_100000161 Ga0070675_10000016128 298
176 3300005355 Ga0070671_100000313 Ga0070671_10000031327 298
177 3300005356 Ga0070674_100001686 Ga0070674_1000016868 298
178 3300005364 Ga0070673_100000272 Ga0070673_10000027228 298
179 3300005367 Ga0070667_100024052 Ga0070667_1000240525 298
180 3300005438 Ga0070701_10000204 Ga0070701_1000020422 298
181 3300005441 Ga0070700_100000856 Ga0070700_10000085615 298
182 3300005444 Ga0070694_100002279 Ga0070694_1000022798 298
183 3300005445 Ga0070708_100142114 Ga0070708_1001421142 298
184 3300005455 Ga0070663_100000945 Ga0070663_10000094515 298
185 3300005456 Ga0070678_100002374 Ga0070678_10000237411 298
186 3300005457 Ga0070662_100003593 Ga0070662_1000035938 298
187 3300005459 Ga0068867_100002227 Ga0068867_10000222715 298
188 3300005466 Ga0070685_10031229 Ga0070685_100312293 298
189 3300005530 Ga0070679_100002050 Ga0070679_10000205012 298
190 3300005535 Ga0070684_100000365 Ga0070684_10000036521 298
191 3300005539 Ga0068853_100000523 Ga0068853_10000052325 298
192 3300005545 Ga0070695_100001044 Ga0070695_1000010445 298
193 3300005546 Ga0070696_100021689 Ga0070696_1000216892 298
194 3300005547 Ga0070693_100000905 Ga0070693_1000009053 298
195 3300005615 Ga0070702_100002928 Ga0070702_1000029283 298
196 3300006871 Ga0075434_100013398 Ga0075434_1000133982 298
197 3300035084 Ga0373928_0013678 Ga0373928_0013678_11_907 298
198 3300005331 Ga0070670_100188058 Ga0070670_1001880582 299
199 3300005344 Ga0070661_100290992 Ga0070661_1002909921 299
200 3300005614 Ga0068856_100174369 Ga0068856_1001743693 299
201 3300006871 Ga0075434_100028901 Ga0075434_1000289012 299
202 3300025945 Ga0207679_10027807 Ga0207679_100278072 299
203 3300026095 Ga0207676_10099964 Ga0207676_100999643 299
204 3300035410 Ga0373924_0170015 Ga0373924_0170015_25_924 299
205 3300048917 Ga0496114_0027893 Ga0496114_0027893_1832_2857 299
206 3300048917 Ga0496114_0102844 Ga0496114_0102844_1506_2405 299
207 3300048918 Ga0496115_0520116 Ga0496115_0520116_20_919 299
208 iso_pu_bacteria 8046352972 8046356023 301
209 3300035691 Ga0373931_0062411 Ga0373931_0062411_446_1390 302
210 3300050512 nmdc:mga0n895_86938_c1 nmdc:mga0n895_86938_c1_1770_2714 302
211 3300005439 Ga0070711_100082880 Ga0070711_1000828802 303
212 3300011119 Ga0105246_10254631 Ga0105246_102546312 303
213 3300025916 Ga0207663_10034887 Ga0207663_100348873 303
214 3300035691 Ga0373931_0098181 Ga0373931_0098181_688_1632 303
215 3300037466 Ga0395898_0006718 Ga0395898_0006718_5705_6652 303
216 3300048911 Ga0496108_0227434 Ga0496108_0227434_612_1556 303
217 3300048915 Ga0496112_0238048 Ga0496112_0238048_520_1464 303
218 3300050513 nmdc:mga0rr50_108639_c1 nmdc:mga0rr50_108639_c1_927_1871 303
219 3300005328 Ga0070676_10006093 Ga0070676_100060934 304
220 3300005329 Ga0070683_100016216 Ga0070683_1000162164 304
221 3300005334 Ga0068869_100009143 Ga0068869_1000091434 304
222 3300005335 Ga0070666_10232201 Ga0070666_102322011 304
223 3300005338 Ga0068868_100002361 Ga0068868_1000023616 304
224 3300005338 Ga0068868_100155201 Ga0068868_1001552012 304
225 3300005339 Ga0070660_100030071 Ga0070660_1000300713 304
226 3300005344 Ga0070661_100011716 Ga0070661_1000117163 304
227 3300005344 Ga0070661_100148435 Ga0070661_1001484352 304
228 3300005347 Ga0070668_100017165 Ga0070668_1000171654 304
229 3300005353 Ga0070669_100001878 Ga0070669_10000187815 304
230 3300005366 Ga0070659_100006215 Ga0070659_1000062152 304
231 3300005455 Ga0070663_100087170 Ga0070663_1000871702 304
232 3300005456 Ga0070678_100111091 Ga0070678_1001110912 304
233 3300005457 Ga0070662_100004917 Ga0070662_1000049177 304
234 3300005459 Ga0068867_100148888 Ga0068867_1001488882 304
235 3300005535 Ga0070684_100031623 Ga0070684_1000316232 304
236 3300005535 Ga0070684_100190808 Ga0070684_1001908082 304
237 3300005539 Ga0068853_100005637 Ga0068853_1000056377 304
238 3300005539 Ga0068853_100065961 Ga0068853_1000659612 304
239 3300005547 Ga0070693_100022703 Ga0070693_1000227033 304
240 3300005563 Ga0068855_100011208 Ga0068855_1000112089 304
241 3300005577 Ga0068857_100050390 Ga0068857_1000503902 304
242 3300005578 Ga0068854_100006483 Ga0068854_1000064838 304
243 3300005614 Ga0068856_100203581 Ga0068856_1002035812 304
244 3300005616 Ga0068852_100002308 Ga0068852_1000023089 304
245 3300005618 Ga0068864_100000546 Ga0068864_10000054631 304
246 3300005719 Ga0068861_100001557 Ga0068861_10000155710 304
247 3300005840 Ga0068870_10211528 Ga0068870_102115281 304
248 3300005843 Ga0068860_100023722 Ga0068860_1000237226 304
249 3300005844 Ga0068862_100170220 Ga0068862_1001702202 304
250 3300005937 Ga0081455_10003554 Ga0081455_100035548 304
251 3300006237 Ga0097621_100003287 Ga0097621_1000032874 304
252 3300006847 Ga0075431_100109721 Ga0075431_1001097212 304
253 3300006847 Ga0075431_100311688 Ga0075431_1003116882 304
254 3300006847 Ga0075431_100387536 Ga0075431_1003875361 304
255 3300006852 Ga0075433_10037073 Ga0075433_100370733 304
256 3300006871 Ga0075434_100060504 Ga0075434_1000605042 304
257 3300009174 Ga0105241_10470278 Ga0105241_104702781 304
258 3300009177 Ga0105248_10278606 Ga0105248_102786062 304
259 3300009177 Ga0105248_10395258 Ga0105248_103952582 304
260 3300009545 Ga0105237_10414798 Ga0105237_104147982 304
261 3300009551 Ga0105238_10068987 Ga0105238_100689874 304
262 3300013296 Ga0157374_10005306 Ga0157374_100053069 304
263 3300013306 Ga0163162_10007593 Ga0163162_100075939 304
264 3300013307 Ga0157372_10132943 Ga0157372_101329433 304
265 3300013308 Ga0157375_10041288 Ga0157375_100412886 304
266 3300014969 Ga0157376_10010411 Ga0157376_100104115 304
267 3300025893 Ga0207682_10008495 Ga0207682_100084952 304
268 3300025903 Ga0207680_10230206 Ga0207680_102302061 304
269 3300025907 Ga0207645_10007540 Ga0207645_100075406 304
270 3300025908 Ga0207643_10029264 Ga0207643_100292643 304
271 3300025919 Ga0207657_10024538 Ga0207657_100245385 304
272 3300025919 Ga0207657_10042811 Ga0207657_100428113 304
273 3300025920 Ga0207649_10090569 Ga0207649_100905692 304
274 3300025923 Ga0207681_10096122 Ga0207681_100961222 304
275 3300025924 Ga0207694_10062975 Ga0207694_100629752 304
276 3300025926 Ga0207659_10017260 Ga0207659_100172605 304
277 3300025933 Ga0207706_10000788 Ga0207706_1000078832 304
278 3300025940 Ga0207691_10120748 Ga0207691_101207482 304
279 3300025941 Ga0207711_10206302 Ga0207711_102063022 304
280 3300025941 Ga0207711_10319028 Ga0207711_103190282 304
281 3300025942 Ga0207689_10000358 Ga0207689_1000035815 304
282 3300025945 Ga0207679_10024542 Ga0207679_100245422 304
283 3300025945 Ga0207679_10089341 Ga0207679_100893412 304
284 3300025972 Ga0207668_10007445 Ga0207668_100074455 304
285 3300025986 Ga0207658_10098984 Ga0207658_100989842 304
286 3300026035 Ga0207703_10015159 Ga0207703_100151592 304
287 3300026035 Ga0207703_10051485 Ga0207703_100514852 304
288 3300026041 Ga0207639_10011340 Ga0207639_100113404 304
289 3300026067 Ga0207678_10000889 Ga0207678_1000088928 304
290 3300026067 Ga0207678_10072422 Ga0207678_100724222 304
291 3300026078 Ga0207702_10116321 Ga0207702_101163212 304
292 3300026088 Ga0207641_10045137 Ga0207641_100451372 304
293 3300026118 Ga0207675_100000774 Ga0207675_1000007745 304
294 3300026121 Ga0207683_10142415 Ga0207683_101424152 304
295 3300026121 Ga0207683_10178426 Ga0207683_101784262 304
296 3300026142 Ga0207698_10040475 Ga0207698_100404754 304
297 3300027907 Ga0207428_10111969 Ga0207428_101119692 304
298 3300028380 Ga0268265_10077792 Ga0268265_100777922 304
299 3300035691 Ga0373931_0001856 Ga0373931_0001856_1113_2138 304
300 3300036401 Ga0373937_0070411 Ga0373937_0070411_1388_2413 304
301 3300048905 Ga0496102_0009757 Ga0496102_0009757_134_1159 304
302 3300048909 Ga0496106_0011874 Ga0496106_0011874_443_1468 304
303 3300048910 Ga0496107_0155049 Ga0496107_0155049_536_1561 304
304 3300048911 Ga0496108_0153348 Ga0496108_0153348_949_1974 304
305 3300048912 Ga0496109_0000086 Ga0496109_0000086_78774_79802 304
306 3300048912 Ga0496109_0062339 Ga0496109_0062339_2278_3303 304
307 3300048913 Ga0496110_0011525 Ga0496110_0011525_3431_4456 304
308 3300048915 Ga0496112_0268323 Ga0496112_0268323_281_1306 304
309 3300048918 Ga0496115_0020459 Ga0496115_0020459_1898_2923 304
310 3300050507 nmdc:mga05p37_43110_c1 nmdc:mga05p37_43110_c1_1177_2199 304
311 3300050510 nmdc:mga06r32_47690_c1 nmdc:mga06r32_47690_c1_481_1503 304
312 3300050510 nmdc:mga06r32_5519_c1 nmdc:mga06r32_5519_c1_1533_2561 304
313 3300050511 nmdc:mga08y16_16181_c1 nmdc:mga08y16_16181_c1_842_1864 304
314 3300050512 nmdc:mga0n895_230391_c1 nmdc:mga0n895_230391_c1_104_1129 304
315 iso_pu_bacteria 2937980651 2937981578 304
316 3300037418 Ga0395900_0017348 Ga0395900_0017348_3558_4505 306
317 3300037466 Ga0395898_0014233 Ga0395898_0014233_1159_2106 306
318 3300038443 Ga0395901_0022367 Ga0395901_0022367_2008_2955 306
319 iso_pu_bacteria 2856356410 2856361101 306
320 iso_pu_bacteria 2503198000 2503199600 310
321 iso_pu_bacteria 2508501127 2509142767 310
322 iso_pu_bacteria 2509276018 2509371043 310
323 iso_pu_bacteria 2509276022 2509394524 310
324 iso_pu_bacteria 2510065059 2510319157 310
325 iso_pu_bacteria 2512875016 2512932996 310
326 iso_pu_bacteria 2512875024 2512961017 310
327 iso_pu_bacteria 2513237090 2513611208 310
328 iso_pu_bacteria 2513237164 2514038463 310
329 iso_pu_bacteria 2513237305 2514417195 310
330 iso_pu_bacteria 2588253730 2588519050 310
331 iso_pu_bacteria 2597489875 2597811371 310
332 iso_pu_bacteria 2599185301 2599939066 310
333 iso_pu_bacteria 2643221547 2643755823 310
334 iso_pu_bacteria 2643221551 2643776940 310
335 iso_pu_bacteria 2643221555 2643795388 310
336 iso_pu_bacteria 2643221595 2643986087 310
337 iso_pu_bacteria 2643221627 2644153652 310
338 iso_pu_bacteria 2693429783 2694634265 310
339 iso_pu_bacteria 2693429784 2694637960 310
340 iso_pu_bacteria 2721755686 2723573972 310
341 iso_pu_bacteria 2756170246 2756677386 310
342 iso_pu_bacteria 2791355123 2792748399 310
343 iso_pu_bacteria 2839993093 2839995018 310
344 iso_pu_bacteria 2841734538 2841737343 310
345 iso_pu_bacteria 2844002411 2844009123 310
346 iso_pu_bacteria 2844009547 2844012195 310
347 iso_pu_bacteria 2847670302 2847674615 310
348 iso_pu_bacteria 2847686936 2847690733 310
349 iso_pu_bacteria 2854896431 2854900790 310
350 iso_pu_bacteria 2854916844 2854919562 310
351 iso_pu_bacteria 2856314179 2856317499 310
352 iso_pu_bacteria 2856320880 2856322680 310
353 iso_pu_bacteria 2856342000 2856346014 310
354 iso_pu_bacteria 2856364286 2856366719 310
355 iso_pu_bacteria 2857349434 2857356599 310
356 iso_pu_bacteria 2869162929 2869165157 310
357 iso_pu_bacteria 2869169390 2869171225 310
358 iso_pu_bacteria 2869234852 2869237790 310
359 iso_pu_bacteria 2869242130 2869244240 310
360 iso_pu_bacteria 2869249662 2869250147 310
361 iso_pu_bacteria 2869256925 2869258938 310
362 iso_pu_bacteria 2869264136 2869265315 310
363 iso_pu_bacteria 2869278585 2869285802 310
364 iso_pu_bacteria 2869285874 2869287870 310
365 iso_pu_bacteria 2871429161 2871435818 310
366 iso_pu_bacteria 2871435913 2871441833 310
367 iso_pu_bacteria 2871444079 2871451563 310
368 iso_pu_bacteria 2871451962 2871459482 310
369 iso_pu_bacteria 2871459585 2871465662 310
370 iso_pu_bacteria 2871466892 2871474393 310
371 iso_pu_bacteria 2871474448 2871479403 310
372 iso_pu_bacteria 2871481445 2871483802 310
373 iso_pu_bacteria 2871488783 2871489907 310
374 iso_pu_bacteria 2871495908 2871498021 310
375 iso_pu_bacteria 2874102143 2874102218 310
376 iso_pu_bacteria 2874109183 2874111112 310
377 iso_pu_bacteria 2874116593 2874117235 310
378 iso_pu_bacteria 2874139085 2874141884 310
379 iso_pu_bacteria 2874146452 2874151503 310
380 iso_pu_bacteria 2874155637 2874159135 310
381 iso_pu_bacteria 2874168670 2874175688 310
382 iso_pu_bacteria 2876363079 2876364757 310
383 iso_pu_bacteria 2876369609 2876377128 310
384 iso_pu_bacteria 2876377896 2876378463 310
385 iso_pu_bacteria 2876386047 2876389284 310
386 iso_pu_bacteria 2876392853 2876396187 310
387 iso_pu_bacteria 2876413966 2876417554 310
388 iso_pu_bacteria 2876420981 2876426088 310
389 iso_pu_bacteria 2878035449 2878038537 310
390 iso_pu_bacteria 2878730984 2878731744 310
391 iso_pu_bacteria 2878738818 2878739377 310
392 iso_pu_bacteria 2878745973 2878749381 310
393 iso_pu_bacteria 2878753008 2878754437 310
394 iso_pu_bacteria 2878760144 2878762243 310
395 iso_pu_bacteria 2878767105 2878769210 310
396 iso_pu_bacteria 2878788777 2878790005 310
397 iso_pu_bacteria 2881147464 2881149423 310
398 iso_pu_bacteria 2881155292 2881160631 310
399 iso_pu_bacteria 2881161766 2881166323 310
400 iso_pu_bacteria 2881845957 2881849733 310
401 iso_pu_bacteria 2881861095 2881865584 310
402 iso_pu_bacteria 2882632389 2882634095 310
403 iso_pu_bacteria 2882912400 2882918643 310
404 iso_pu_bacteria 2885305155 2885307754 310
405 iso_pu_bacteria 2885312484 2885313251 310
406 iso_pu_bacteria 2885318864 2885319940 310
407 iso_pu_bacteria 2885334103 2885340190 310
408 iso_pu_bacteria 2885342637 2885345083 310
409 iso_pu_bacteria 2888337043 2888337971 310
410 iso_pu_bacteria 2888343758 2888345271 310
411 iso_pu_bacteria 2888350351 2888354560 310
412 iso_pu_bacteria 2889010040 2889016164 310
413 iso_pu_bacteria 2889016732 2889018795 310
414 iso_pu_bacteria 2903448605 2903449256 310
415 iso_pu_bacteria 2903492973 2903493612 310
416 iso_pu_bacteria 2903492973 2903497642 310
417 iso_pu_bacteria 2903513507 2903519879 310
418 iso_pu_bacteria 2903521522 2903522507 310
419 iso_pu_bacteria 2903528002 2903528886 310
420 iso_pu_bacteria 2903540706 2903542819 310
421 iso_pu_bacteria 2904659560 2904662963 310
422 iso_pu_bacteria 2906308376 2906310419 310
423 iso_pu_bacteria 2906321335 2906324484 310
424 iso_pu_bacteria 2906328253 2906333284 310
425 iso_pu_bacteria 2906354277 2906360008 310
426 iso_pu_bacteria 2906363423 2906363878 310
427 iso_pu_bacteria 2906370794 2906373259 310
428 iso_pu_bacteria 2906393657 2906395715 310
429 iso_pu_bacteria 2906401398 2906405660 310
430 iso_pu_bacteria 2906414383 2906417564 310
431 iso_pu_bacteria 2922130491 2922137262 310
432 iso_pu_bacteria 2922158528 2922162456 310
433 iso_pu_bacteria 2922185730 2922191931 310
434 iso_pu_bacteria 2924710171 2924710992 310
435 iso_pu_bacteria 2924726620 2924727465 310
436 iso_pu_bacteria 2924733363 2924736358 310
437 iso_pu_bacteria 2924741084 2924745283 310
438 iso_pu_bacteria 2924762789 2924769285 310
439 iso_pu_bacteria 2924776078 2924776898 310
440 iso_pu_bacteria 2924784321 2924790175 310
441 iso_pu_bacteria 2937813078 2937817248 310
442 iso_pu_bacteria 2937822353 2937825769 310
443 iso_pu_bacteria 2937836603 2937840727 310
444 iso_pu_bacteria 2937848649 2937855436 310
445 iso_pu_bacteria 2937861824 2937862715 310
446 iso_pu_bacteria 2937877337 2937883501 310
447 iso_pu_bacteria 2937972304 2937973520 310
448 iso_pu_bacteria 2937994558 2937996669 310
449 iso_pu_bacteria 2938014810 2938018576 310
450 iso_pu_bacteria 2958034702 2958041818 310
451 iso_pu_bacteria 2958041894 2958050349 310
452 iso_pu_bacteria 2958041894 2958056483 310
453 iso_pu_bacteria 2958064165 2958065926 310
454 iso_pu_bacteria 2958071322 2958073640 310
455 iso_pu_bacteria 2958084443 2958090669 310
456 iso_pu_bacteria 2958092219 2958100721 310
457 iso_pu_bacteria 2958100919 2958102137 310
458 iso_pu_bacteria 2958108152 2958108307 310
459 iso_pu_bacteria 2958115193 2958120786 310
460 iso_pu_bacteria 2958130278 2958132274 310
461 iso_pu_bacteria 2958165035 2958167141 310
462 iso_pu_bacteria 2958172287 2958174803 310
463 iso_pu_bacteria 2958179912 2958182088 310
464 iso_pu_bacteria 2961077736 2961079932 310
465 iso_pu_bacteria 2961114664 2961117989 310
466 iso_pu_bacteria 2961127735 2961134584 310
467 iso_pu_bacteria 2961163497 2961165610 310
468 iso_pu_bacteria 2961170736 2961171867 310
469 iso_pu_bacteria 2961183825 2961189591 310
470 iso_pu_bacteria 2963644680 2963646213 310
471 iso_pu_bacteria 2965018300 2965020433 310
472 iso_pu_bacteria 2965040258 2965042429 310
473 iso_pu_bacteria 2965062239 2965066127 310
474 iso_pu_bacteria 2965089291 2965089750 310
475 iso_pu_bacteria 2967996073 2967996974 310
476 iso_pu_bacteria 2968003550 2968005035 310
477 iso_pu_bacteria 2968016561 2968016685 310
478 iso_pu_bacteria 2968083720 2968085319 310
479 iso_pu_bacteria 2968091066 2968091437 310
480 iso_pu_bacteria 2968097103 2968099116 310
481 iso_pu_bacteria 2968110612 2968114050 310
482 iso_pu_bacteria 2968117919 2968123240 310
483 iso_pu_bacteria 2968128360 2968129059 310
484 iso_pu_bacteria 2968171901 2968174012 310
485 iso_pu_bacteria 2970469710 2970470027 310
486 iso_pu_bacteria 2970489779 2970492592 310
487 iso_pu_bacteria 2970503327 2970504465 310
488 iso_pu_bacteria 2970510686 2970515177 310
489 iso_pu_bacteria 2970524798 2970526983 310
490 iso_pu_bacteria 2970532167 2970535808 310
491 iso_pu_bacteria 2970540015 2970546952 310
492 iso_pu_bacteria 2970554993 2970557098 310
493 iso_pu_bacteria 2970593180 2970600419 310
494 iso_pu_bacteria 2970619444 2970620133 310
495 iso_pu_bacteria 2970627176 2970631020 310
496 iso_pu_bacteria 2977821940 2977823654 310
497 iso_pu_bacteria 2977843712 2977847536 310
498 iso_pu_bacteria 2977851361 2977856354 310
499 iso_pu_bacteria 2977858184 2977859243 310
500 iso_pu_bacteria 2977864932 2977871017 310
501 iso_pu_bacteria 2977898635 2977904252 310
502 iso_pu_bacteria 2977907340 2977913281 310
503 iso_pu_bacteria 2977915119 2977920158 310
504 iso_pu_bacteria 2977922695 2977928857 310
505 iso_pu_bacteria 2977942078 2977943071 310
506 iso_pu_bacteria 2977950692 2977952243 310
507 iso_pu_bacteria 2977971508 2977976440 310
508 iso_pu_bacteria 2977986579 2977988862 310
509 iso_pu_bacteria 2979710463 2979710543 310
510 iso_pu_bacteria 2979764755 2979768889 310
511 iso_pu_bacteria 2979772303 2979776223 310
512 iso_pu_bacteria 2979779861 2979780527 310
513 iso_pu_bacteria 2979808191 2979809102 310
514 iso_pu_bacteria 2987636660 2987643879 310
515 iso_pu_bacteria 2987652177 2987656448 310
516 iso_pu_bacteria 2987659509 2987661618 310
517 iso_pu_bacteria 2987666974 2987672461 310
518 iso_pu_bacteria 2996310559 2996315722 310
519 iso_pu_bacteria 2996341866 2996347826 310
520 iso_pu_bacteria 2996348954 2996353044 310
521 iso_pu_bacteria 2996386984 2996389660 310
522 iso_pu_bacteria 3000135777 3000141329 310
523 iso_pu_bacteria 3002141150 3002144138 310
524 iso_pu_bacteria 3004167301 3004174362 310
525 iso_pu_bacteria 3004188549 3004190667 310
526 iso_pu_bacteria 3004195979 3004199053 310
527 iso_pu_bacteria 3004203850 3004208028 310
528 iso_pu_bacteria 3004211236 3004211502 310
529 iso_pu_bacteria 3004218560 3004224949 310
530 iso_pu_bacteria 3004232784 3004237404 310
531 iso_pu_bacteria 3004268573 3004270578 310
532 iso_pu_bacteria 3004275668 3004279726 310
533 iso_pu_bacteria 3004289098 3004294022 310
534 iso_pu_bacteria 3004334049 3004336205 310
535 iso_pu_bacteria 637000159 637076077 310
536 iso_pu_bacteria 8004312739 8004316702 310
537 iso_pu_bacteria 8004361976 8004364909 310
538 iso_pu_bacteria 8004374579 8004376013 310
539 iso_pu_bacteria 8004387939 8004389658 310
540 iso_pu_bacteria 8004395343 8004397035 310
541 iso_pu_bacteria 8004445564 8004449945 310
542 iso_pu_bacteria 8004633249 8004636732 310
543 iso_pu_bacteria 8004640170 8004645513 310
544 iso_pu_bacteria 8004703790 8004705667 310
545 iso_pu_bacteria 8004714634 8004718055 310
546 iso_pu_bacteria 8004727605 8004732041 310
547 iso_pu_bacteria 8055617313 8055618833 310
548 iso_pu_bacteria 8056875544 8056878731 310
549 3300009011 Ga0105251_10027020 Ga0105251_100270203 313
550 3300009176 Ga0105242_10083983 Ga0105242_100839832 313
551 3300009177 Ga0105248_10294030 Ga0105248_102940303 313
552 3300009545 Ga0105237_10041035 Ga0105237_100410353 313
553 3300010375 Ga0105239_10170670 Ga0105239_101706702 313
554 3300013104 Ga0157370_10090616 Ga0157370_100906162 313
555 3300013297 Ga0157378_10079081 Ga0157378_100790813 313
556 3300031241 Ga0265325_10146745 Ga0265325_101467452 313
557 3300031249 Ga0265339_10010187 Ga0265339_100101872 313
558 3300031344 Ga0265316_10096444 Ga0265316_100964444 313
559 3300031595 Ga0265313_10003967 Ga0265313_1000396714 313
560 3300034819 Ga0373958_0001069 Ga0373958_0001069_2538_3482 313
561 3300035115 Ga0373941_0009277 Ga0373941_0009277_805_1749 313
562 3300048090 Ga0495615_0026860 Ga0495615_0026860_284_1234 313
563 3300048903 Ga0496100_0009503 Ga0496100_0009503_1703_2647 313
564 3300048904 Ga0496101_0082414 Ga0496101_0082414_737_1681 313
565 3300048905 Ga0496102_0152829 Ga0496102_0152829_116_1066 313
566 3300048906 Ga0496103_0139041 Ga0496103_0139041_131_1075 313
567 3300048906 Ga0496103_0273803 Ga0496103_0273803_50_1000 313
568 3300048907 Ga0496104_0090384 Ga0496104_0090384_766_1710 313
569 3300048907 Ga0496104_0525705 Ga0496104_0525705_43_993 313
570 3300048910 Ga0496107_0013104 Ga0496107_0013104_912_1856 313
571 3300048911 Ga0496108_0179411 Ga0496108_0179411_741_1691 313
572 3300048912 Ga0496109_0068652 Ga0496109_0068652_602_1546 313
573 3300048913 Ga0496110_0142283 Ga0496110_0142283_705_1649 313
574 3300048913 Ga0496110_0192968 Ga0496110_0192968_701_1651 313
575 3300048914 Ga0496111_0067217 Ga0496111_0067217_1098_2042 313
576 3300048914 Ga0496111_0309637 Ga0496111_0309637_130_1080 313
577 3300048917 Ga0496114_0047784 Ga0496114_0047784_310_1254 313
578 3300048918 Ga0496115_0171791 Ga0496115_0171791_310_1254 313
579 3300049568 Ga0501031_0000011 Ga0501031_0000011_54984_55928 313
580 3300049569 Ga0501032_0000006 Ga0501032_0000006_205800_206744 313
581 3300049570 Ga0501033_0000039 Ga0501033_0000039_54984_55928 313
582 3300049571 Ga0501034_0000030 Ga0501034_0000030_28386_29330 313
583 3300049572 Ga0501036_0000003 Ga0501036_0000003_54984_55928 313
584 3300049573 Ga0501037_0000003 Ga0501037_0000003_54984_55928 313
585 3300049574 Ga0501038_0000004 Ga0501038_0000004_54984_55928 313
586 3300049575 Ga0501039_0000008 Ga0501039_0000008_54984_55928 313
587 3300049576 Ga0501040_0066210 Ga0501040_0066210_1120_2064 313
588 3300049579 Ga0501043_0000177 Ga0501043_0000177_36256_37200 313
589 3300049581 Ga0501047_0002232 Ga0501047_0002232_13619_14563 313
590 3300049585 Ga0501069_0031216 Ga0501069_0031216_1484_2425 313
591 3300049586 Ga0501070_0003834 Ga0501070_0003834_11643_12587 313
592 3300049586 Ga0501070_0087292 Ga0501070_0087292_184_1125 313
593 3300049586 Ga0501070_0216481 Ga0501070_0216481_558_1499 313
594 3300049742 Ga0501080_0189677 Ga0501080_0189677_885_1826 313
595 3300049822 Ga0501035_0000112 Ga0501035_0000112_43211_44155 313
596 3300049822 Ga0501035_0001116 Ga0501035_0001116_16068_17009 313
597 3300049823 Ga0501044_0000008 Ga0501044_0000008_54984_55928 313
598 iso_pu_bacteria 2928972540 2928972998 313
599 iso_pu_bacteria 2977240413 2977242779 313
600 3300001989 JGI24739J22299_10018162 JGI24739J22299_100181622 314
601 3300002067 JGI24735J21928_10013098 JGI24735J21928_100130982 314
602 3300002741 JGI25157J39369_1001732 JGI25157J39369_10017326 314
603 3300003203 JGI25406J46586_10028248 JGI25406J46586_100282481 314
604 3300003214 JGI25165J46597_1000097 JGI25165J46597_1000097141 314
605 3300003578 Ga0006562J51391_1053984 Ga0006562J51391_10539842 314
606 3300005327 Ga0070658_10077237 Ga0070658_100772372 314
607 3300005339 Ga0070660_100019914 Ga0070660_1000199145 314
608 3300005339 Ga0070660_100060582 Ga0070660_1000605823 314
609 3300005344 Ga0070661_100048950 Ga0070661_1000489501 314
610 3300005455 Ga0070663_100181347 Ga0070663_1001813471 314
611 3300005459 Ga0068867_100029790 Ga0068867_1000297903 314
612 3300005530 Ga0070679_100021093 Ga0070679_1000210938 314
613 3300005539 Ga0068853_100001161 Ga0068853_1000011617 314
614 3300005539 Ga0068853_100198124 Ga0068853_1001981242 314
615 3300005543 Ga0070672_100000709 Ga0070672_10000070912 314
616 3300005548 Ga0070665_100041750 Ga0070665_1000417503 314
617 3300005548 Ga0070665_100064470 Ga0070665_1000644704 314
618 3300005563 Ga0068855_100166115 Ga0068855_1001661152 314
619 3300005564 Ga0070664_100002074 Ga0070664_10000207418 314
620 3300005578 Ga0068854_100000749 Ga0068854_10000074915 314
621 3300005614 Ga0068856_100000902 Ga0068856_10000090218 314
622 3300005616 Ga0068852_100015241 Ga0068852_1000152415 314
623 3300005616 Ga0068852_100026542 Ga0068852_1000265422 314
624 3300005616 Ga0068852_100070611 Ga0068852_1000706112 314
625 3300005616 Ga0068852_100212963 Ga0068852_1002129632 314
626 3300005618 Ga0068864_100000595 Ga0068864_1000005952 314
627 3300005718 Ga0068866_10002012 Ga0068866_100020128 314
628 3300005719 Ga0068861_100000825 Ga0068861_10000082515 314
629 3300005840 Ga0068870_10000112 Ga0068870_1000011214 314
630 3300005841 Ga0068863_100000703 Ga0068863_10000070311 314
631 3300005842 Ga0068858_100008283 Ga0068858_1000082834 314
632 3300005843 Ga0068860_100006736 Ga0068860_1000067363 314
633 3300005985 Ga0081539_10007581 Ga0081539_100075811 314
634 3300006038 Ga0075365_10036995 Ga0075365_100369953 314
635 3300006038 Ga0075365_10037327 Ga0075365_100373274 314
636 3300006038 Ga0075365_10199791 Ga0075365_101997911 314
637 3300006038 Ga0075365_10277252 Ga0075365_102772521 314
638 3300006048 Ga0075363_100013824 Ga0075363_1000138244 314
639 3300006051 Ga0075364_10007466 Ga0075364_100074662 314
640 3300006178 Ga0075367_10005318 Ga0075367_100053184 314
641 3300006178 Ga0075367_10043746 Ga0075367_100437464 314
642 3300006178 Ga0075367_10117360 Ga0075367_101173601 314
643 3300006178 Ga0075367_10256332 Ga0075367_102563321 314
644 3300006186 Ga0075369_10004969 Ga0075369_100049694 314
645 3300006186 Ga0075369_10051358 Ga0075369_100513582 314
646 3300006186 Ga0075369_10084149 Ga0075369_100841492 314
647 3300006237 Ga0097621_100000473 Ga0097621_10000047328 314
648 3300006353 Ga0075370_10005271 Ga0075370_100052714 314
649 3300006358 Ga0068871_100000118 Ga0068871_10000011836 314
650 3300006881 Ga0068865_100051161 Ga0068865_1000511614 314
651 3300006881 Ga0068865_100110247 Ga0068865_1001102472 314
652 3300009092 Ga0105250_10045964 Ga0105250_100459642 314
653 3300009093 Ga0105240_10064698 Ga0105240_100646983 314
654 3300009093 Ga0105240_10087185 Ga0105240_100871852 314
655 3300009093 Ga0105240_10558510 Ga0105240_105585101 314
656 3300009094 Ga0111539_10001167 Ga0111539_1000116726 314
657 3300009098 Ga0105245_10001982 Ga0105245_100019823 314
658 3300009101 Ga0105247_10028209 Ga0105247_100282092 314
659 3300009147 Ga0114129_10194026 Ga0114129_101940263 314
660 3300009148 Ga0105243_10002278 Ga0105243_1000227815 314
661 3300009148 Ga0105243_10085153 Ga0105243_100851531 314
662 3300009174 Ga0105241_10003555 Ga0105241_100035553 314
663 3300009176 Ga0105242_10001156 Ga0105242_1000115611 314
664 3300009545 Ga0105237_10005748 Ga0105237_100057486 314
665 3300009545 Ga0105237_10202482 Ga0105237_102024822 314
666 3300009551 Ga0105238_10007631 Ga0105238_100076317 314
667 3300009553 Ga0105249_10001021 Ga0105249_1000102111 314
668 3300010375 Ga0105239_10008950 Ga0105239_100089506 314
669 3300010375 Ga0105239_10010109 Ga0105239_100101099 314
670 3300010375 Ga0105239_10046440 Ga0105239_100464405 314
671 3300010375 Ga0105239_10136101 Ga0105239_101361013 314
672 3300011119 Ga0105246_10003701 Ga0105246_100037016 314
673 3300013102 Ga0157371_10031202 Ga0157371_100312024 314
674 3300013104 Ga0157370_10287651 Ga0157370_102876511 314
675 3300013105 Ga0157369_10014889 Ga0157369_100148895 314
676 3300013105 Ga0157369_10290972 Ga0157369_102909722 314
677 3300013105 Ga0157369_10768354 Ga0157369_107683541 314
678 3300013296 Ga0157374_10015941 Ga0157374_100159413 314
679 3300013297 Ga0157378_10002986 Ga0157378_1000298611 314
680 3300013306 Ga0163162_10009522 Ga0163162_100095226 314
681 3300013307 Ga0157372_10008348 Ga0157372_1000834811 314
682 3300013308 Ga0157375_10000508 Ga0157375_1000050811 314
683 3300014325 Ga0163163_10082125 Ga0163163_100821253 314
684 3300014326 Ga0157380_10000212 Ga0157380_1000021226 314
685 3300014497 Ga0182008_10036668 Ga0182008_100366682 314
686 3300014745 Ga0157377_10000287 Ga0157377_1000028717 314
687 3300014968 Ga0157379_10008690 Ga0157379_100086903 314
688 3300014969 Ga0157376_10004642 Ga0157376_100046424 314
689 3300015261 Ga0182006_1023464 Ga0182006_10234642 314
690 3300015262 Ga0182007_10017175 Ga0182007_100171753 314
691 3300017792 Ga0163161_10000415 Ga0163161_1000041531 314
692 3300025250 Ga0209026_1000041 Ga0209026_1000041270 314
693 3300025254 Ga0209148_1000069 Ga0209148_1000069287 314
694 3300025256 Ga0209759_1000183 Ga0209759_100018367 314
695 3300025261 Ga0209233_1000030 Ga0209233_1000030546 314
696 3300025261 Ga0209233_1008564 Ga0209233_10085643 314
697 3300025271 Ga0207666_1000073 Ga0207666_10000734 314
698 3300025272 Ga0209455_1000161 Ga0209455_100016141 314
699 3300025290 Ga0207673_1000295 Ga0207673_10002954 314
700 3300025297 Ga0209758_1005328 Ga0209758_10053286 314
701 3300025315 Ga0207697_10000061 Ga0207697_1000006139 314
702 3300025711 Ga0207696_1062241 Ga0207696_10622411 314
703 3300025893 Ga0207682_10002961 Ga0207682_100029614 314
704 3300025899 Ga0207642_10001238 Ga0207642_100012387 314
705 3300025900 Ga0207710_10014209 Ga0207710_100142092 314
706 3300025901 Ga0207688_10000001 Ga0207688_1000000196 314
707 3300025903 Ga0207680_10001817 Ga0207680_1000181711 314
708 3300025904 Ga0207647_10002852 Ga0207647_100028522 314
709 3300025904 Ga0207647_10009210 Ga0207647_100092103 314
710 3300025907 Ga0207645_10000222 Ga0207645_1000022229 314
711 3300025908 Ga0207643_10000009 Ga0207643_1000000941 314
712 3300025909 Ga0207705_10019295 Ga0207705_100192952 314
713 3300025911 Ga0207654_10001390 Ga0207654_1000139012 314
714 3300025911 Ga0207654_10054567 Ga0207654_100545673 314
715 3300025912 Ga0207707_10004174 Ga0207707_1000417411 314
716 3300025913 Ga0207695_10041473 Ga0207695_100414735 314
717 3300025913 Ga0207695_10054337 Ga0207695_100543372 314
718 3300025914 Ga0207671_10003241 Ga0207671_1000324112 314
719 3300025914 Ga0207671_10321818 Ga0207671_103218181 314
720 3300025916 Ga0207663_10042477 Ga0207663_100424773 314
721 3300025917 Ga0207660_10000197 Ga0207660_1000019711 314
722 3300025917 Ga0207660_10065669 Ga0207660_100656692 314
723 3300025918 Ga0207662_10001861 Ga0207662_1000186111 314
724 3300025919 Ga0207657_10000776 Ga0207657_1000077627 314
725 3300025919 Ga0207657_10040737 Ga0207657_100407375 314
726 3300025919 Ga0207657_10101928 Ga0207657_101019282 314
727 3300025920 Ga0207649_10000052 Ga0207649_1000005289 314
728 3300025920 Ga0207649_10090776 Ga0207649_100907762 314
729 3300025921 Ga0207652_10001438 Ga0207652_1000143824 314
730 3300025921 Ga0207652_10028531 Ga0207652_100285313 314
731 3300025925 Ga0207650_10006131 Ga0207650_100061313 314
732 3300025926 Ga0207659_10000132 Ga0207659_1000013225 314
733 3300025927 Ga0207687_10000174 Ga0207687_1000017424 314
734 3300025928 Ga0207700_10060096 Ga0207700_100600963 314
735 3300025931 Ga0207644_10000212 Ga0207644_1000021211 314
736 3300025932 Ga0207690_10000148 Ga0207690_1000014853 314
737 3300025933 Ga0207706_10001360 Ga0207706_1000136011 314
738 3300025934 Ga0207686_10001289 Ga0207686_100012892 314
739 3300025935 Ga0207709_10000530 Ga0207709_100005306 314
740 3300025936 Ga0207670_10000523 Ga0207670_1000052325 314
741 3300025937 Ga0207669_10000857 Ga0207669_1000085710 314
742 3300025938 Ga0207704_10000198 Ga0207704_1000019840 314
743 3300025940 Ga0207691_10000517 Ga0207691_1000051715 314
744 3300025941 Ga0207711_10008997 Ga0207711_100089972 314
745 3300025942 Ga0207689_10000031 Ga0207689_1000003175 314
746 3300025945 Ga0207679_10000183 Ga0207679_1000018324 314
747 3300025949 Ga0207667_10057690 Ga0207667_100576903 314
748 3300025949 Ga0207667_10236604 Ga0207667_102366042 314
749 3300025960 Ga0207651_10000051 Ga0207651_1000005142 314
750 3300025961 Ga0207712_10000738 Ga0207712_1000073811 314
751 3300025972 Ga0207668_10000664 Ga0207668_1000066424 314
752 3300025981 Ga0207640_10002152 Ga0207640_100021527 314
753 3300025986 Ga0207658_10016338 Ga0207658_100163383 314
754 3300026023 Ga0207677_10075252 Ga0207677_100752522 314
755 3300026035 Ga0207703_10068565 Ga0207703_100685654 314
756 3300026041 Ga0207639_10001257 Ga0207639_100012576 314
757 3300026041 Ga0207639_10003583 Ga0207639_100035837 314
758 3300026041 Ga0207639_10328023 Ga0207639_103280231 314
759 3300026067 Ga0207678_10000531 Ga0207678_1000053111 314
760 3300026075 Ga0207708_10000573 Ga0207708_100005736 314
761 3300026078 Ga0207702_10003284 Ga0207702_1000328415 314
762 3300026078 Ga0207702_10173574 Ga0207702_101735743 314
763 3300026088 Ga0207641_10001041 Ga0207641_100010414 314
764 3300026089 Ga0207648_10000581 Ga0207648_1000058127 314
765 3300026095 Ga0207676_10000124 Ga0207676_1000012441 314
766 3300026116 Ga0207674_10000095 Ga0207674_1000009511 314
767 3300026118 Ga0207675_100000414 Ga0207675_10000041427 314
768 3300026121 Ga0207683_10000242 Ga0207683_1000024236 314
769 3300026142 Ga0207698_10000951 Ga0207698_100009514 314
770 3300026142 Ga0207698_10024205 Ga0207698_100242052 314
771 3300026142 Ga0207698_10175166 Ga0207698_101751662 314
772 3300027617 Ga0210002_1001450 Ga0210002_10014503 314
773 3300027876 Ga0209974_10006235 Ga0209974_100062354 314
774 3300027907 Ga0207428_10000037 Ga0207428_10000037190 314
775 3300028379 Ga0268266_10010785 Ga0268266_100107856 314
776 3300028379 Ga0268266_10046350 Ga0268266_100463504 314
777 3300028380 Ga0268265_10000757 Ga0268265_100007575 314
778 3300028381 Ga0268264_10002331 Ga0268264_100023314 314
779 3300031712 Ga0265342_10000677 Ga0265342_100006772 314
780 3300031730 Ga0307516_10050383 Ga0307516_100503832 314
781 3300032002 Ga0307416_100105843 Ga0307416_1001058433 314
782 3300032004 Ga0307414_10082841 Ga0307414_100828413 314
783 3300034817 Ga0373948_0011654 Ga0373948_0011654_119_1063 314
784 3300034819 Ga0373958_0007148 Ga0373958_0007148_627_1571 314
785 3300035090 Ga0373949_0001199 Ga0373949_0001199_306_1250 314
786 3300035092 Ga0373952_0008037 Ga0373952_0008037_270_1214 314
787 3300035111 Ga0373923_0001378 Ga0373923_0001378_3535_4482 314
788 3300035112 Ga0373932_0001840 Ga0373932_0001840_3216_4160 314
789 3300035114 Ga0373939_0001777 Ga0373939_0001777_3768_4712 314
790 3300035115 Ga0373941_0002154 Ga0373941_0002154_511_1455 314
791 3300035121 Ga0373960_0006378 Ga0373960_0006378_1561_2505 314
792 3300035207 Ga0373942_0008302 Ga0373942_0008302_616_1560 314
793 3300035241 Ga0373961_0016882 Ga0373961_0016882_526_1470 314
794 3300035242 Ga0373962_0000610 Ga0373962_0000610_4984_5928 314
795 3300035691 Ga0373931_0002178 Ga0373931_0002178_4158_5102 314
796 3300035692 Ga0373935_0015566 Ga0373935_0015566_2500_3447 314
797 3300035695 Ga0373927_0000951 Ga0373927_0000951_21048_21995 314
798 3300035725 Ga0373947_0001613 Ga0373947_0001613_8560_9507 314
799 3300037466 Ga0395898_0075499 Ga0395898_0075499_1004_1951 314
800 3300037471 Ga0395905_0003688 Ga0395905_0003688_10457_11419 314
801 3300037471 Ga0395905_0105739 Ga0395905_0105739_293_1240 314
802 3300037471 Ga0395905_0124190 Ga0395905_0124190_669_1616 314
803 3300038443 Ga0395901_0097496 Ga0395901_0097496_176_1123 314
804 3300038443 Ga0395901_0268937 Ga0395901_0268937_697_1644 314
805 3300044658 Ga0466972_0015182 Ga0466972_0015182_1302_2249 314
806 3300044683 Ga0466965_0107678 Ga0466965_0107678_308_1255 314
807 3300044735 Ga0466968_0175285 Ga0466968_0175285_26_976 314
808 3300044901 Ga0466960_0026170 Ga0466960_0026170_453_1400 314
809 3300046460 Ga0495638_0085840 Ga0495638_0085840_674_1621 314
810 3300046462 Ga0495651_0037130 Ga0495651_0037130_2680_3627 314
811 3300046463 Ga0495653_0025910 Ga0495653_0025910_1177_2124 314
812 3300046511 Ga0495608_0049633 Ga0495608_0049633_746_1693 314
813 3300046517 Ga0495630_0011811 Ga0495630_0011811_1305_2252 314
814 3300046522 Ga0495643_0001057 Ga0495643_0001057_26083_27036 314
815 3300046522 Ga0495643_0037183 Ga0495643_0037183_454_1401 314
816 3300046528 Ga0495642_0099534 Ga0495642_0099534_181_1134 314
817 3300046531 Ga0495665_0008400 Ga0495665_0008400_3649_4596 314
818 3300046535 Ga0495586_0013941 Ga0495586_0013941_3055_4002 314
819 3300046542 Ga0495597_0009494 Ga0495597_0009494_3678_4631 314
820 3300046558 Ga0495633_0000840 Ga0495633_0000840_9774_10733 314
821 3300046616 Ga0495668_0035104 Ga0495668_0035104_1078_2025 314
822 3300046616 Ga0495668_0069815 Ga0495668_0069815_599_1546 314
823 3300046660 Ga0495625_0257737 Ga0495625_0257737_158_1105 314
824 3300046660 Ga0495625_0285823 Ga0495625_0285823_34_981 314
825 3300046663 Ga0495635_0089136 Ga0495635_0089136_1152_2099 314
826 3300046665 Ga0495661_0009254 Ga0495661_0009254_252_1205 314
827 3300046679 Ga0495623_0028202 Ga0495623_0028202_2582_3529 314
828 3300046680 Ga0495646_0069877 Ga0495646_0069877_66_1013 314
829 3300046684 Ga0495669_0007219 Ga0495669_0007219_307_1251 314
830 3300046810 Ga0495660_0048035 Ga0495660_0048035_277_1224 314
831 3300047317 Ga0495604_0015813 Ga0495604_0015813_4330_5277 314
832 3300047319 Ga0495674_0183316 Ga0495674_0183316_50_997 314
833 3300048089 Ga0495614_0011254 Ga0495614_0011254_49_996 314
834 3300048903 Ga0496100_0000345 Ga0496100_0000345_766_1710 314
835 3300048904 Ga0496101_0000866 Ga0496101_0000866_12520_13464 314
836 3300048905 Ga0496102_0001833 Ga0496102_0001833_13767_14711 314
837 3300048906 Ga0496103_0001022 Ga0496103_0001022_14328_15272 314
838 3300048907 Ga0496104_0072995 Ga0496104_0072995_392_1336 314
839 3300048909 Ga0496106_0002528 Ga0496106_0002528_12206_13150 314
840 3300048911 Ga0496108_0006961 Ga0496108_0006961_7546_8490 314
841 3300048911 Ga0496108_0308844 Ga0496108_0308844_290_1237 314
842 3300048912 Ga0496109_0002269 Ga0496109_0002269_2974_3918 314
843 3300048913 Ga0496110_0026044 Ga0496110_0026044_3765_4709 314
844 3300048914 Ga0496111_0193652 Ga0496111_0193652_516_1460 314
845 3300048915 Ga0496112_0033949 Ga0496112_0033949_1757_2704 314
846 3300048915 Ga0496112_0213360 Ga0496112_0213360_714_1658 314
847 3300048916 Ga0496113_0324098 Ga0496113_0324098_275_1219 314
848 3300048917 Ga0496114_0093376 Ga0496114_0093376_221_1165 314
849 3300048918 Ga0496115_0000967 Ga0496115_0000967_15537_16481 314
850 3300048918 Ga0496115_0012638 Ga0496115_0012638_4095_5057 314
851 3300048920 Ga0496117_0203750 Ga0496117_0203750_80_1027 314
852 3300048923 Ga0496120_0002681 Ga0496120_0002681_14762_15709 314
853 3300048923 Ga0496120_0053840 Ga0496120_0053840_1125_2072 314
854 3300048925 Ga0496122_0002952 Ga0496122_0002952_19162_20121 314
855 3300048926 Ga0496123_0002116 Ga0496123_0002116_1450_2409 314
856 3300048929 Ga0496126_0010620 Ga0496126_0010620_4448_5395 314
857 3300049568 Ga0501031_0006154 Ga0501031_0006154_3024_3974 314
858 3300049569 Ga0501032_0000029 Ga0501032_0000029_77126_78076 314
859 3300049569 Ga0501032_0063621 Ga0501032_0063621_1172_2128 314
860 3300049570 Ga0501033_0000168 Ga0501033_0000168_15710_16660 314
861 3300049570 Ga0501033_0011727 Ga0501033_0011727_3701_4657 314
862 3300049571 Ga0501034_0000434 Ga0501034_0000434_15711_16661 314
863 3300049571 Ga0501034_0021075 Ga0501034_0021075_3701_4657 314
864 3300049572 Ga0501036_0000999 Ga0501036_0000999_8904_9854 314
865 3300049572 Ga0501036_0011708 Ga0501036_0011708_947_1891 314
866 3300049572 Ga0501036_0238748 Ga0501036_0238748_342_1298 314
867 3300049573 Ga0501037_0000872 Ga0501037_0000872_12778_13728 314
868 3300049573 Ga0501037_0025532 Ga0501037_0025532_2999_3955 314
869 3300049574 Ga0501038_0000397 Ga0501038_0000397_27583_28533 314
870 3300049574 Ga0501038_0064483 Ga0501038_0064483_123_1079 314
871 3300049575 Ga0501039_0000040 Ga0501039_0000040_61174_62124 314
872 3300049575 Ga0501039_0017409 Ga0501039_0017409_2803_3747 314
873 3300049575 Ga0501039_0020496 Ga0501039_0020496_410_1366 314
874 3300049576 Ga0501040_0021742 Ga0501040_0021742_2451_3407 314
875 3300049578 Ga0501042_0280874 Ga0501042_0280874_129_1085 314
876 3300049579 Ga0501043_0000560 Ga0501043_0000560_23694_24644 314
877 3300049580 Ga0501046_0027824 Ga0501046_0027824_1007_1963 314
878 3300049580 Ga0501046_0029478 Ga0501046_0029478_3420_4364 314
879 3300049580 Ga0501046_0055891 Ga0501046_0055891_886_1836 314
880 3300049581 Ga0501047_0013069 Ga0501047_0013069_3217_4161 314
881 3300049581 Ga0501047_0028366 Ga0501047_0028366_3047_4003 314
882 3300049581 Ga0501047_0080796 Ga0501047_0080796_506_1456 314
883 3300049581 Ga0501047_0086031 Ga0501047_0086031_1628_2572 314
884 3300049582 Ga0501048_0018257 Ga0501048_0018257_292_1236 314
885 3300049583 Ga0501067_0107194 Ga0501067_0107194_574_1530 314
886 3300049584 Ga0501068_0008698 Ga0501068_0008698_4082_5038 314
887 3300049586 Ga0501070_0006925 Ga0501070_0006925_5231_6175 314
888 3300049586 Ga0501070_0054553 Ga0501070_0054553_2331_3287 314
889 3300049586 Ga0501070_0291310 Ga0501070_0291310_12_956 314
890 3300049587 Ga0501071_0056645 Ga0501071_0056645_704_1660 314
891 3300049587 Ga0501071_0091436 Ga0501071_0091436_611_1555 314
892 3300049589 Ga0501073_0095188 Ga0501073_0095188_714_1670 314
893 3300049590 Ga0501074_0080424 Ga0501074_0080424_679_1635 314
894 3300049590 Ga0501074_0116677 Ga0501074_0116677_842_1786 314
895 3300049742 Ga0501080_0028000 Ga0501080_0028000_3278_4234 314
896 3300049744 Ga0501083_0034611 Ga0501083_0034611_596_1540 314
897 3300049822 Ga0501035_0000144 Ga0501035_0000144_11593_12543 314
898 3300049822 Ga0501035_0017005 Ga0501035_0017005_2046_3002 314
899 3300049822 Ga0501035_0024179 Ga0501035_0024179_2864_3808 314
900 3300049822 Ga0501035_0203969 Ga0501035_0203969_446_1390 314
901 3300049823 Ga0501044_0005957 Ga0501044_0005957_8966_9916 314
902 3300049823 Ga0501044_0022594 Ga0501044_0022594_2046_3002 314
903 3300049823 Ga0501044_0061369 Ga0501044_0061369_1764_2708 314
904 3300049823 Ga0501044_0072080 Ga0501044_0072080_64_1011 314
905 3300050491 nmdc:mga00v17_5132_c1 nmdc:mga00v17_5132_c1_3222_4169 314
906 3300050492 nmdc:mga0yw44_1475_c1 nmdc:mga0yw44_1475_c1_6146_7093 314
907 3300050492 nmdc:mga0yw44_16078_c1 nmdc:mga0yw44_16078_c1_1143_2114 314
908 3300050492 nmdc:mga0yw44_186545_c1 nmdc:mga0yw44_186545_c1_110_1057 314
909 3300050494 nmdc:mga06z11_276429_c1 nmdc:mga06z11_276429_c1_27_974 314
910 3300050494 nmdc:mga06z11_28859_c1 nmdc:mga06z11_28859_c1_442_1386 314
911 3300050496 nmdc:mga07m45_14713_c1 nmdc:mga07m45_14713_c1_1556_2503 314
912 3300050496 nmdc:mga07m45_147922_c1 nmdc:mga07m45_147922_c1_319_1266 314
913 3300050507 nmdc:mga05p37_540205_c1 nmdc:mga05p37_540205_c1_101_1063 314
914 3300050511 nmdc:mga08y16_333_c1 nmdc:mga08y16_333_c1_17067_18011 314
915 3300050512 nmdc:mga0n895_1174_c1 nmdc:mga0n895_1174_c1_18199_19143 314
916 3300050513 nmdc:mga0rr50_135891_c1 nmdc:mga0rr50_135891_c1_704_1648 314
917 3300050516 nmdc:mga0sz30_25203_c1 nmdc:mga0sz30_25203_c1_535_1482 314
918 3300053078 Ga0495612_0012061 Ga0495612_0012061_151_1098 314
919 3300053079 Ga0500610_0019799 Ga0500610_0019799_640_1587 314
920 3300053083 Ga0495655_0005186 Ga0495655_0005186_556_1503 314
921 3300053096 Ga0500641_0010774 Ga0500641_0010774_2320_3267 314
922 3300053119 Ga0500595_026251 Ga0500595_026251_736_1683 314
923 3300053155 Ga0500620_000454 Ga0500620_000454_3471_4418 314
924 3300053155 Ga0500620_001650 Ga0500620_001650_349_1296 314
925 3300053158 Ga0500627_0015934 Ga0500627_0015934_493_1473 314
926 3300053731 Ga0500609_008607 Ga0500609_008607_105_1052 314
927 2209111006 2214711591 2213723600 315
928 3300000041 ARcpr5oldR_c000035 ARcpr5oldR_0000354 315
929 3300000042 ARSoilYngRDRAFT_c00458 ARSoilYngRDRAFT_004584 315
930 3300000044 ARSoilOldRDRAFT_c000053 ARSoilOldRDRAFT_00005330 315
931 3300000652 ARCol0yngRDRAFT_1000025 ARCol0yngRDRAFT_100002534 315
932 3300001990 JGI24737J22298_10004052 JGI24737J22298_100040525 315
933 3300005290 Ga0065712_10071633 Ga0065712_100716334 315
934 3300005293 Ga0065715_10003868 Ga0065715_100038689 315
935 3300005327 Ga0070658_10011015 Ga0070658_100110155 315
936 3300005327 Ga0070658_10019708 Ga0070658_100197083 315
937 3300005329 Ga0070683_100341950 Ga0070683_1003419502 315
938 3300005336 Ga0070680_100121685 Ga0070680_1001216851 315
939 3300005340 Ga0070689_100043413 Ga0070689_1000434134 315
940 3300005341 Ga0070691_10113767 Ga0070691_101137671 315
941 3300005344 Ga0070661_100102973 Ga0070661_1001029731 315
942 3300005364 Ga0070673_100012960 Ga0070673_1000129602 315
943 3300005365 Ga0070688_100000991 Ga0070688_1000009913 315
944 3300005435 Ga0070714_100030068 Ga0070714_1000300683 315
945 3300005436 Ga0070713_100008870 Ga0070713_1000088703 315
946 3300005436 Ga0070713_100052266 Ga0070713_1000522662 315
947 3300005438 Ga0070701_10211640 Ga0070701_102116402 315
948 3300005439 Ga0070711_100053807 Ga0070711_1000538074 315
949 3300005439 Ga0070711_100177141 Ga0070711_1001771412 315
950 3300005441 Ga0070700_100017272 Ga0070700_1000172722 315
951 3300005457 Ga0070662_100015465 Ga0070662_1000154654 315
952 3300005457 Ga0070662_100031459 Ga0070662_1000314592 315
953 3300005458 Ga0070681_10038476 Ga0070681_100384764 315
954 3300005458 Ga0070681_10049176 Ga0070681_100491763 315
955 3300005459 Ga0068867_100159729 Ga0068867_1001597291 315
956 3300005530 Ga0070679_100100453 Ga0070679_1001004533 315
957 3300005530 Ga0070679_100171854 Ga0070679_1001718543 315
958 3300005530 Ga0070679_100419515 Ga0070679_1004195151 315
959 3300005539 Ga0068853_100051530 Ga0068853_1000515301 315
960 3300005544 Ga0070686_100007788 Ga0070686_1000077882 315
961 3300005544 Ga0070686_100279823 Ga0070686_1002798232 315
962 3300005545 Ga0070695_100148466 Ga0070695_1001484661 315
963 3300005546 Ga0070696_100134489 Ga0070696_1001344892 315
964 3300005549 Ga0070704_100017774 Ga0070704_1000177745 315
965 3300005563 Ga0068855_100040932 Ga0068855_1000409323 315
966 3300005614 Ga0068856_100039818 Ga0068856_1000398187 315
967 3300005616 Ga0068852_100050517 Ga0068852_1000505173 315
968 3300005617 Ga0068859_100008773 Ga0068859_1000087735 315
969 3300005842 Ga0068858_100228418 Ga0068858_1002284182 315
970 3300005843 Ga0068860_100049862 Ga0068860_1000498623 315
971 3300005844 Ga0068862_100006290 Ga0068862_1000062903 315
972 3300005937 Ga0081455_10000048 Ga0081455_1000004873 315
973 3300005937 Ga0081455_10021067 Ga0081455_100210673 315
974 3300005937 Ga0081455_10102220 Ga0081455_101022202 315
975 3300006028 Ga0070717_10220513 Ga0070717_102205133 315
976 3300006163 Ga0070715_10068351 Ga0070715_100683512 315
977 3300006175 Ga0070712_100019604 Ga0070712_1000196042 315
978 3300006237 Ga0097621_100006173 Ga0097621_1000061739 315
979 3300006844 Ga0075428_100028450 Ga0075428_1000284503 315
980 3300006846 Ga0075430_100000196 Ga0075430_10000019612 315
981 3300006847 Ga0075431_100001183 Ga0075431_10000118328 315
982 3300006852 Ga0075433_10000991 Ga0075433_1000099127 315
983 3300006871 Ga0075434_100001106 Ga0075434_10000110612 315
984 3300006871 Ga0075434_100047743 Ga0075434_1000477435 315
985 3300006931 Ga0097620_100008773 Ga0097620_1000087735 315
986 3300007076 Ga0075435_100066202 Ga0075435_1000662024 315
987 3300009093 Ga0105240_10079927 Ga0105240_100799274 315
988 3300009094 Ga0111539_10000683 Ga0111539_1000068342 315
989 3300009094 Ga0111539_10004804 Ga0111539_100048045 315
990 3300009098 Ga0105245_10308175 Ga0105245_103081752 315
991 3300009101 Ga0105247_10015215 Ga0105247_100152156 315
992 3300009147 Ga0114129_10036793 Ga0114129_100367937 315
993 3300009176 Ga0105242_10029797 Ga0105242_100297976 315
994 3300009177 Ga0105248_10020934 Ga0105248_100209345 315
995 3300009545 Ga0105237_10072571 Ga0105237_100725712 315
996 3300009551 Ga0105238_10053124 Ga0105238_100531244 315
997 3300009553 Ga0105249_10006960 Ga0105249_100069609 315
998 3300010375 Ga0105239_10083831 Ga0105239_100838314 315
999 3300013102 Ga0157371_10093722 Ga0157371_100937222 315
1000 3300013102 Ga0157371_10192287 Ga0157371_101922871 315
1001 3300013306 Ga0163162_10066320 Ga0163162_100663202 315
1002 3300013307 Ga0157372_10048370 Ga0157372_100483707 315
1003 3300013308 Ga0157375_10268905 Ga0157375_102689052 315
1004 3300014325 Ga0163163_10102744 Ga0163163_101027442 315
1005 3300014968 Ga0157379_10024668 Ga0157379_100246681 315
1006 3300014968 Ga0157379_10065966 Ga0157379_100659662 315
1007 3300014968 Ga0157379_10141716 Ga0157379_101417162 315
1008 3300020082 Ga0206353_10023203 Ga0206353_100232032 315
1009 3300025261 Ga0209233_1009332 Ga0209233_10093322 315
1010 3300025271 Ga0207666_1000396 Ga0207666_10003966 315
1011 3300025315 Ga0207697_10005956 Ga0207697_100059564 315
1012 3300025885 Ga0207653_10066499 Ga0207653_100664992 315
1013 3300025901 Ga0207688_10015574 Ga0207688_100155743 315
1014 3300025904 Ga0207647_10020047 Ga0207647_100200474 315
1015 3300025905 Ga0207685_10023072 Ga0207685_100230721 315
1016 3300025909 Ga0207705_10135527 Ga0207705_101355272 315
1017 3300025912 Ga0207707_10007205 Ga0207707_100072053 315
1018 3300025912 Ga0207707_10095845 Ga0207707_100958451 315
1019 3300025912 Ga0207707_10098046 Ga0207707_100980464 315
1020 3300025914 Ga0207671_10167142 Ga0207671_101671422 315
1021 3300025915 Ga0207693_10056703 Ga0207693_100567033 315
1022 3300025916 Ga0207663_10027568 Ga0207663_100275683 315
1023 3300025917 Ga0207660_10029243 Ga0207660_100292432 315
1024 3300025917 Ga0207660_10040842 Ga0207660_100408423 315
1025 3300025918 Ga0207662_10002878 Ga0207662_100028789 315
1026 3300025919 Ga0207657_10042331 Ga0207657_100423312 315
1027 3300025919 Ga0207657_10087807 Ga0207657_100878072 315
1028 3300025921 Ga0207652_10092441 Ga0207652_100924412 315
1029 3300025925 Ga0207650_10110205 Ga0207650_101102053 315
1030 3300025926 Ga0207659_10118645 Ga0207659_101186451 315
1031 3300025928 Ga0207700_10205857 Ga0207700_102058572 315
1032 3300025929 Ga0207664_10293125 Ga0207664_102931252 315
1033 3300025932 Ga0207690_10023203 Ga0207690_100232032 315
1034 3300025933 Ga0207706_10025201 Ga0207706_100252013 315
1035 3300025933 Ga0207706_10049341 Ga0207706_100493414 315
1036 3300025936 Ga0207670_10047836 Ga0207670_100478362 315
1037 3300025937 Ga0207669_10276148 Ga0207669_102761482 315
1038 3300025939 Ga0207665_10026454 Ga0207665_100264544 315
1039 3300025944 Ga0207661_10189859 Ga0207661_101898592 315
1040 3300025945 Ga0207679_10087436 Ga0207679_100874362 315
1041 3300025949 Ga0207667_10153953 Ga0207667_101539532 315
1042 3300025961 Ga0207712_10056531 Ga0207712_100565312 315
1043 3300025986 Ga0207658_10094760 Ga0207658_100947602 315
1044 3300026035 Ga0207703_10155946 Ga0207703_101559462 315
1045 3300026035 Ga0207703_10222027 Ga0207703_102220272 315
1046 3300026075 Ga0207708_10006283 Ga0207708_100062836 315
1047 3300026089 Ga0207648_10080415 Ga0207648_100804154 315
1048 3300026116 Ga0207674_10136790 Ga0207674_101367902 315
1049 3300026118 Ga0207675_100033910 Ga0207675_1000339102 315
1050 3300026121 Ga0207683_10009390 Ga0207683_100093904 315
1051 3300026142 Ga0207698_10045410 Ga0207698_100454103 315
1052 3300027665 Ga0209983_1015293 Ga0209983_10152932 315
1053 3300027695 Ga0209966_1001052 Ga0209966_10010523 315
1054 3300027717 Ga0209998_10021989 Ga0209998_100219892 315
1055 3300027907 Ga0207428_10001217 Ga0207428_1000121713 315
1056 3300027907 Ga0207428_10001773 Ga0207428_1000177313 315
1057 3300028380 Ga0268265_10101042 Ga0268265_101010423 315
1058 3300028556 Ga0265337_1000827 Ga0265337_100082714 315
1059 3300031241 Ga0265325_10000049 Ga0265325_100000495 315
1060 3300031241 Ga0265325_10000449 Ga0265325_1000044940 315
1061 3300031344 Ga0265316_10171026 Ga0265316_101710262 315
1062 3300031595 Ga0265313_10000367 Ga0265313_1000036741 315
1063 3300031595 Ga0265313_10015742 Ga0265313_100157422 315
1064 3300032133 Ga0316583_10000628 Ga0316583_100006284 315
1065 3300034816 Ga0373930_0000371 Ga0373930_0000371_2907_3854 315
1066 3300034817 Ga0373948_0000135 Ga0373948_0000135_3573_4520 315
1067 3300034818 Ga0373950_0000327 Ga0373950_0000327_2620_3567 315
1068 3300034818 Ga0373950_0008917 Ga0373950_0008917_522_1472 315
1069 3300034819 Ga0373958_0000084 Ga0373958_0000084_2847_3794 315
1070 3300034819 Ga0373958_0008916 Ga0373958_0008916_113_1060 315
1071 3300034957 Ga0373938_0000013 Ga0373938_0000013_17714_18661 315
1072 3300035084 Ga0373928_0001053 Ga0373928_0001053_186_1133 315
1073 3300035086 Ga0373934_0020165 Ga0373934_0020165_1357_2304 315
1074 3300035088 Ga0373940_0002191 Ga0373940_0002191_1195_2142 315
1075 3300035090 Ga0373949_0001274 Ga0373949_0001274_5038_5985 315
1076 3300035092 Ga0373952_0000880 Ga0373952_0000880_1184_2131 315
1077 3300035115 Ga0373941_0000125 Ga0373941_0000125_11293_12240 315
1078 3300035117 Ga0373953_0005292 Ga0373953_0005292_805_1803 315
1079 3300035119 Ga0373956_0004976 Ga0373956_0004976_441_1439 315
1080 3300035120 Ga0373957_0028363 Ga0373957_0028363_360_1358 315
1081 3300035172 Ga0373955_0009608 Ga0373955_0009608_3577_4524 315
1082 3300035241 Ga0373961_0000638 Ga0373961_0000638_737_1684 315
1083 3300035242 Ga0373962_0000542 Ga0373962_0000542_1076_2023 315
1084 3300035724 Ga0373933_0003247 Ga0373933_0003247_6702_7649 315
1085 3300035724 Ga0373933_0011036 Ga0373933_0011036_450_1448 315
1086 3300035725 Ga0373947_0116294 Ga0373947_0116294_421_1368 315
1087 3300036401 Ga0373937_0003502 Ga0373937_0003502_1626_2573 315
1088 3300036401 Ga0373937_0073217 Ga0373937_0073217_675_1622 315
1089 3300036401 Ga0373937_0361944 Ga0373937_0361944_210_1157 315
1090 3300037068 Ga0373925_0004688 Ga0373925_0004688_7002_7949 315
1091 3300037068 Ga0373925_0094420 Ga0373925_0094420_1027_1974 315
1092 3300038996 Ga0242420_002459 Ga0242420_002459_1032_1979 315
1093 3300042001 Ga0439441_010371 Ga0439441_010371_168_1115 315
1094 3300042016 Ga0439463_025969 Ga0439463_025969_366_1313 315
1095 3300042439 Ga0439464_0036453 Ga0439464_0036453_238_1185 315
1096 3300044694 Ga0466963_0006183 Ga0466963_0006183_1963_2958 315
1097 3300044712 Ga0453684_0117665 Ga0453684_0117665_795_1742 315
1098 3300044842 Ga0466957_0082975 Ga0466957_0082975_775_1770 315
1099 3300045051 Ga0451576_0006125 Ga0451576_0006125_1263_2210 315
1100 3300045976 Ga0466967_0146415 Ga0466967_0146415_725_1720 315
1101 3300046454 Ga0495592_0063389 Ga0495592_0063389_1164_2111 315
1102 3300046459 Ga0495629_0046557 Ga0495629_0046557_1469_2416 315
1103 3300046462 Ga0495651_0001390 Ga0495651_0001390_4531_5529 315
1104 3300046462 Ga0495651_0003040 Ga0495651_0003040_11468_12415 315
1105 3300046463 Ga0495653_0002914 Ga0495653_0002914_218_1216 315
1106 3300046463 Ga0495653_0237990 Ga0495653_0237990_47_1006 315
1107 3300046477 Ga0495664_0050005 Ga0495664_0050005_302_1249 315
1108 3300046499 Ga0495594_0085893 Ga0495594_0085893_109_1056 315
1109 3300046511 Ga0495608_0002575 Ga0495608_0002575_1764_2762 315
1110 3300046511 Ga0495608_0188263 Ga0495608_0188263_96_1043 315
1111 3300046514 Ga0495618_0033729 Ga0495618_0033729_1737_2735 315
1112 3300046514 Ga0495618_0199864 Ga0495618_0199864_284_1231 315
1113 3300046516 Ga0495628_0018554 Ga0495628_0018554_3531_4478 315
1114 3300046517 Ga0495630_0381737 Ga0495630_0381737_120_1067 315
1115 3300046529 Ga0495652_0017992 Ga0495652_0017992_3062_4009 315
1116 3300046529 Ga0495652_0114884 Ga0495652_0114884_97_1095 315
1117 3300046531 Ga0495665_0051314 Ga0495665_0051314_237_1184 315
1118 3300046533 Ga0495640_0004112 Ga0495640_0004112_1707_2705 315
1119 3300046533 Ga0495640_0016677 Ga0495640_0016677_3289_4248 315
1120 3300046536 Ga0495587_0000592 Ga0495587_0000592_22099_23097 315
1121 3300046543 Ga0495645_0009188 Ga0495645_0009188_2790_3737 315
1122 3300046559 Ga0495667_0015047 Ga0495667_0015047_3684_4682 315
1123 3300046559 Ga0495667_0066259 Ga0495667_0066259_1204_2151 315
1124 3300046559 Ga0495667_0131527 Ga0495667_0131527_553_1500 315
1125 3300046675 Ga0495657_0034526 Ga0495657_0034526_2010_2957 315
1126 3300046675 Ga0495657_0044791 Ga0495657_0044791_13_960 315
1127 3300046679 Ga0495623_0000569 Ga0495623_0000569_1385_2383 315
1128 3300046679 Ga0495623_0120930 Ga0495623_0120930_531_1478 315
1129 3300046680 Ga0495646_0013966 Ga0495646_0013966_3170_4168 315
1130 3300046680 Ga0495646_0072760 Ga0495646_0072760_342_1289 315
1131 3300046689 Ga0495613_0133762 Ga0495613_0133762_271_1269 315
1132 3300046809 Ga0495600_0021660 Ga0495600_0021660_682_1680 315
1133 3300046809 Ga0495600_0162683 Ga0495600_0162683_83_1030 315
1134 3300047315 Ga0495581_0075165 Ga0495581_0075165_696_1643 315
1135 3300047317 Ga0495604_0126039 Ga0495604_0126039_454_1401 315
1136 3300047319 Ga0495674_0060491 Ga0495674_0060491_1706_2665 315
1137 3300047319 Ga0495674_0091058 Ga0495674_0091058_1385_2383 315
1138 3300047321 Ga0495676_0078385 Ga0495676_0078385_430_1428 315
1139 3300047322 Ga0495680_0013849 Ga0495680_0013849_5291_6250 315
1140 3300047322 Ga0495680_0016164 Ga0495680_0016164_290_1237 315
1141 3300047322 Ga0495680_0017538 Ga0495680_0017538_1250_2248 315
1142 3300047444 Ga0495675_0000815 Ga0495675_0000815_16190_17188 315
1143 3300047444 Ga0495675_0125243 Ga0495675_0125243_51_998 315
1144 3300047471 Ga0495684_0013859 Ga0495684_0013859_305_1303 315
1145 3300047471 Ga0495684_0067831 Ga0495684_0067831_1556_2503 315
1146 3300048088 Ga0495602_0075852 Ga0495602_0075852_73_1032 315
1147 3300048905 Ga0496102_0149148 Ga0496102_0149148_185_1132 315
1148 3300048906 Ga0496103_0011074 Ga0496103_0011074_1882_2880 315
1149 3300048906 Ga0496103_0114002 Ga0496103_0114002_492_1439 315
1150 3300048907 Ga0496104_0000399 Ga0496104_0000399_14801_15859 315
1151 3300048907 Ga0496104_0019547 Ga0496104_0019547_3292_4290 315
1152 3300048907 Ga0496104_0183110 Ga0496104_0183110_229_1176 315
1153 3300048908 Ga0496105_0007591 Ga0496105_0007591_5987_7045 315
1154 3300048908 Ga0496105_0277548 Ga0496105_0277548_203_1150 315
1155 3300048909 Ga0496106_0046057 Ga0496106_0046057_1889_2836 315
1156 3300048910 Ga0496107_0045820 Ga0496107_0045820_434_1381 315
1157 3300048911 Ga0496108_0107612 Ga0496108_0107612_373_1320 315
1158 3300048911 Ga0496108_0195394 Ga0496108_0195394_414_1361 315
1159 3300048912 Ga0496109_0002193 Ga0496109_0002193_4726_5673 315
1160 3300048912 Ga0496109_0309053 Ga0496109_0309053_185_1132 315
1161 3300048915 Ga0496112_0003327 Ga0496112_0003327_5362_6309 315
1162 3300048916 Ga0496113_0003576 Ga0496113_0003576_893_1840 315
1163 3300048917 Ga0496114_0019405 Ga0496114_0019405_2963_3961 315
1164 3300049569 Ga0501032_0070967 Ga0501032_0070967_1069_2016 315
1165 3300049571 Ga0501034_0011360 Ga0501034_0011360_7202_8149 315
1166 3300049571 Ga0501034_0135160 Ga0501034_0135160_944_1894 315
1167 3300049572 Ga0501036_0000444 Ga0501036_0000444_13307_14254 315
1168 3300049573 Ga0501037_0104914 Ga0501037_0104914_775_1818 315
1169 3300049573 Ga0501037_0134748 Ga0501037_0134748_126_1073 315
1170 3300049574 Ga0501038_0069640 Ga0501038_0069640_669_1712 315
1171 3300049575 Ga0501039_0228716 Ga0501039_0228716_390_1337 315
1172 3300049579 Ga0501043_0056663 Ga0501043_0056663_1848_2891 315
1173 3300049579 Ga0501043_0085563 Ga0501043_0085563_1405_2352 315
1174 3300049580 Ga0501046_0042624 Ga0501046_0042624_872_1915 315
1175 3300049580 Ga0501046_0113288 Ga0501046_0113288_691_1638 315
1176 3300049581 Ga0501047_0000235 Ga0501047_0000235_41826_42773 315
1177 3300049581 Ga0501047_0085667 Ga0501047_0085667_1635_2678 315
1178 3300049582 Ga0501048_0001478 Ga0501048_0001478_3089_4036 315
1179 3300049582 Ga0501048_0184007 Ga0501048_0184007_378_1421 315
1180 3300049586 Ga0501070_0016166 Ga0501070_0016166_1114_2061 315
1181 3300049586 Ga0501070_0079535 Ga0501070_0079535_1187_2137 315
1182 3300049588 Ga0501072_0122600 Ga0501072_0122600_640_1587 315
1183 3300049590 Ga0501074_0015817 Ga0501074_0015817_1351_2298 315
1184 3300049741 Ga0501079_0400073 Ga0501079_0400073_100_1047 315
1185 3300049742 Ga0501080_0001954 Ga0501080_0001954_7995_8942 315
1186 3300049744 Ga0501083_0003735 Ga0501083_0003735_8274_9221 315
1187 3300049744 Ga0501083_0048003 Ga0501083_0048003_151_1119 315
1188 3300049822 Ga0501035_0226799 Ga0501035_0226799_573_1565 315
1189 3300049823 Ga0501044_0005687 Ga0501044_0005687_9688_10635 315
1190 3300049823 Ga0501044_0137971 Ga0501044_0137971_706_1749 315
1191 3300050507 nmdc:mga05p37_11291_c1 nmdc:mga05p37_11291_c1_5165_6112 315
1192 3300050507 nmdc:mga05p37_1975_c1 nmdc:mga05p37_1975_c1_9077_10024 315
1193 3300050508 nmdc:mga09592_1638_c1 nmdc:mga09592_1638_c1_11012_11959 315
1194 3300050509 nmdc:mga0qj67_969_c1 nmdc:mga0qj67_969_c1_5766_6713 315
1195 3300050510 nmdc:mga06r32_638_c1 nmdc:mga06r32_638_c1_27648_28595 315
1196 3300050511 nmdc:mga08y16_13712_c1 nmdc:mga08y16_13712_c1_2408_3355 315
1197 3300050511 nmdc:mga08y16_549_c1 nmdc:mga08y16_549_c1_28044_28991 315
1198 3300050512 nmdc:mga0n895_233805_c1 nmdc:mga0n895_233805_c1_116_1063 315
1199 3300050512 nmdc:mga0n895_45441_c1 nmdc:mga0n895_45441_c1_1465_2412 315
1200 3300050512 nmdc:mga0n895_807_c1 nmdc:mga0n895_807_c1_4431_5378 315
1201 3300050512 nmdc:mga0n895_97850_c1 nmdc:mga0n895_97850_c1_1870_2817 315
1202 3300050513 nmdc:mga0rr50_2201_c1 nmdc:mga0rr50_2201_c1_2877_3824 315
1203 3300050515 nmdc:mga0a205_42015_c1 nmdc:mga0a205_42015_c1_2409_3356 315
1204 3300050515 nmdc:mga0a205_745_c1 nmdc:mga0a205_745_c1_12387_13334 315
1205 3300053077 Ga0495601_0001138 Ga0495601_0001138_3599_4546 315
1206 3300053077 Ga0495601_0004969 Ga0495601_0004969_1556_2503 315
1207 3300053077 Ga0495601_0013085 Ga0495601_0013085_3219_4178 315
1208 3300053078 Ga0495612_0007560 Ga0495612_0007560_1523_2470 315
1209 3300053078 Ga0495612_0010175 Ga0495612_0010175_291_1238 315
1210 3300053078 Ga0495612_0018057 Ga0495612_0018057_555_1553 315
1211 3300053078 Ga0495612_0019860 Ga0495612_0019860_773_1720 315
1212 3300053084 Ga0495595_0000967 Ga0495595_0000967_5336_6295 315
1213 3300053084 Ga0495595_0004707 Ga0495595_0004707_1528_2475 315
1214 3300053084 Ga0495595_0008594 Ga0495595_0008594_1717_2664 315
1215 3300053085 Ga0495619_0000349 Ga0495619_0000349_5207_6166 315
1216 3300053085 Ga0495619_0000430 Ga0495619_0000430_17649_18596 315
1217 3300053085 Ga0495619_0004620 Ga0495619_0004620_3584_4531 315
1218 3300053085 Ga0495619_0034792 Ga0495619_0034792_1864_2862 315
1219 3300053085 Ga0495619_0091252 Ga0495619_0091252_12_959 315
1220 3300053085 Ga0495619_0217143 Ga0495619_0217143_241_1188 315
1221 3300053087 Ga0500643_008569 Ga0500643_008569_2334_3284 315
1222 3300053119 Ga0500595_000016 Ga0500595_000016_132357_133307 315
1223 3300060353 Ga0501082_0227623 Ga0501082_0227623_339_1286 315

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

52

352

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7utf-assembly1.cif.gz_C structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9587 1 315
7utf-assembly2.cif.gz_D structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9575 1 315
7utf-assembly1.cif.gz_A structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9459 1 315
7utf-assembly2.cif.gz_B structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9456 1 315
4xk2-assembly2.cif.gz_B crystal structure of aldo-keto reductase from polaromonas sp. js666 0.9367 1 315
ID Description Score Start End Superfamily
4xk2A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9196 1 315 3.20.20.100
af_C4J2K0_1_323_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9105 1 314 3.20.20.100
af_C4J2K0_1_323_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9049 1 314 3.20.20.100
af_P77735_1_322_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9049 1 313 3.20.20.100
af_P30863_1_265_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9027 14 313 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A2Z6TUM4-F1-model_v4 deleted 0.9828 1 315
AF-A0A379AEG0-F1-model_v4 General stress protein 69 (EC 1.1.1.-) 0.9798 3 180 GO:0005829
GO:0016491
AF-A0A0C1FF59-F1-model_v4 Alcohol dehydrogenase 0.9779 1 315 GO:0005829
AF-B9B0Z6-F1-model_v4 deleted 0.9765 1 315
AF-A0A506Y3H6-F1-model_v4 Aldo/keto reductase 0.9765 2 314 GO:0005829
GO:0016491

Feature Viewer

pLDDT pTM Quality
95.2 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map