F491861

General Info

Members Datasets Scaffolds Average Seq Length
1221 384 1220 176

Family's Representative Sequence

Representative Sequence 3300048918|Ga0496115_0303524|Ga0496115_0303524_243_767
Length 174
Sequence MTPAQKNEAIEVLKGKFAQYDNFYVTNTESLTVEQVSKLRRLCFEKNVEMKVAKNTLIKKALESFNDEKYTGVYDALHGVTALMFSDSPKEPALILASFRKEAKDKPTLKAALIGTDVFSGDNQLDALTKIKTKNELIGEVIGLLQSPAKRVLAALLHXXEQKAGETAEAPAAE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
23 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
39 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
51 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
58 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
84 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
85 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
86 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
87 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
92 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
93 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
131 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
132 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
133 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
134 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
137 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
139 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
206 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
207 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
208 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
209 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
210 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
211 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
212 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
213 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
214 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
215 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
216 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
217 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
218 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
219 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
220 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
221 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
222 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
223 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
224 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
225 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
226 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
227 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
229 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
230 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
231 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
232 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
233 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
234 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
235 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
236 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
237 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
238 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
239 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
240 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
241 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
242 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
243 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
244 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
245 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
246 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
247 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
248 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
249 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
250 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
251 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
252 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
253 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
254 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
255 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
256 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
257 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
258 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
259 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
260 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
261 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
262 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
263 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
264 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
265 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
266 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
267 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
268 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
269 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
270 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
271 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
272 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
273 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
274 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
275 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
276 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
277 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
278 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
279 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
280 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
281 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
282 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
283 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
284 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
285 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
286 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
287 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
288 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
298 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
333 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
334 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
335 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
336 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
337 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
338 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
339 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
340 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
341 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
342 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
343 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
344 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
345 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
346 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
347 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
348 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
349 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
350 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
351 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
352 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
353 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
354 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
355 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
356 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
357 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
358 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
362 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
363 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
364 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
365 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
366 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
367 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
368 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
369 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
370 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
371 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
372 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
373 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
374 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
375 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
376 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
377 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
378 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
379 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
384 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.51
Metatranscriptomes 5.41
Isolates 0.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.78
Nodule 0
Rhizoplane 0.74
Rhizosphere 94.51
Stem 0
Stem Tuber 0
Unclassified 1.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1663050 2162886007 Bacteria 482194
2 JGI24739J22299_10000798 3300001989 Bacteria 11508
3 JGI24739J22299_10003052 3300001989 Bacteria 6394
4 JGI24751J29686_10000803 3300002459 Bacteria 7347
5 JGI25154J39366_1000001 3300002738 Bacteria 483450
6 JGI25157J39369_1003512 3300002741 Bacteria 3168
7 Ga0006759J45824_1097056 3300003163 Bacteria 1422
8 JGI25406J46586_10003914 3300003203 Bacteria 6961
9 JGI25153J46596_10001870 3300003215 Bacteria 12472
10 JGI25153J46596_10005056 3300003215 Bacteria 6977
11 rootH1_10114210 3300003316 Bacteria 1061
12 rootH2_10059898 3300003320 Bacteria 1595
13 rootH2_10204928 3300003320 Bacteria 1132
14 rootL2_10239916 3300003322 Bacteria 1045
15 rootH1_10032943 3300003323 Bacteria 3829
16 JGI25160J50197_1000508 3300003354 Bacteria 23038
17 JGI25160J50197_1008979 3300003354 Bacteria 3752
18 JGI25160J50197_1018530 3300003354 Bacteria 2165
19 Ga0055526_1016300 3300003771 Bacteria 2918
20 Ga0055528_1009578 3300003790 Bacteria 4032
21 Ga0055531_10020429 3300003794 Bacteria 2619
22 Ga0055543_1038139 3300004625 Bacteria 818
23 Ga0065165_1000112 3300005262 Bacteria 135988
24 Ga0065714_10201259 3300005288 Bacteria 894
25 Ga0065704_10070140 3300005289 Bacteria 482257
26 Ga0065704_10414176 3300005289 Unclassified 738
27 Ga0065712_10004615 3300005290 Bacteria 5996
28 Ga0065712_10206809 3300005290 Bacteria 1087
29 Ga0065712_10401979 3300005290 Bacteria 730
30 Ga0065712_10561093 3300005290 Bacteria 609
31 Ga0065715_10130180 3300005293 Bacteria 2008
32 Ga0065715_10164987 3300005293 Bacteria 1590
33 Ga0065715_10223950 3300005293 Bacteria 1260
34 Ga0065707_10156493 3300005295 Bacteria 1604
35 Ga0070658_10000420 3300005327 Bacteria 36817
36 Ga0070658_10013800 3300005327 Bacteria 6482
37 Ga0070658_10601651 3300005327 Bacteria 953
38 Ga0070676_10005499 3300005328 Bacteria 6747
39 Ga0070676_10036189 3300005328 Bacteria 2843
40 Ga0070676_10235057 3300005328 Bacteria 1216
41 Ga0070676_10258521 3300005328 Bacteria 1165
42 Ga0070676_10343053 3300005328 Bacteria 1025
43 Ga0070683_100000417 3300005329 Bacteria 29450
44 Ga0070683_100010447 3300005329 Bacteria 7982
45 Ga0070683_100011895 3300005329 Bacteria 7545
46 Ga0070683_100018251 3300005329 Bacteria 6211
47 Ga0070683_100042173 3300005329 Bacteria 4201
48 Ga0070690_100028796 3300005330 Bacteria 3442
49 Ga0070690_100095882 3300005330 Bacteria 1960
50 Ga0070690_100243997 3300005330 Bacteria 1268
51 Ga0070690_100346682 3300005330 Bacteria 1077
52 Ga0070690_100607660 3300005330 Bacteria 831
53 Ga0070690_100629979 3300005330 Bacteria 817
54 Ga0070670_100066660 3300005331 Bacteria 3089
55 Ga0070670_100102347 3300005331 Bacteria 2467
56 Ga0070670_100106412 3300005331 Bacteria 2417
57 Ga0070670_100121376 3300005331 Bacteria 2254
58 Ga0070670_100256225 3300005331 Bacteria 1525
59 Ga0070670_100489652 3300005331 Bacteria 1093
60 Ga0070670_100607988 3300005331 Bacteria 979
61 Ga0070677_10105973 3300005333 Bacteria 1247
62 Ga0070677_10122797 3300005333 Bacteria 1175
63 Ga0068869_100019533 3300005334 Bacteria 4632
64 Ga0068869_100028140 3300005334 Bacteria 3924
65 Ga0068869_100056223 3300005334 Bacteria 2869
66 Ga0068869_100060658 3300005334 Bacteria 2773
67 Ga0068869_100133844 3300005334 Bacteria 1908
68 Ga0068869_100419337 3300005334 Bacteria 1104
69 Ga0068869_100613964 3300005334 Bacteria 920
70 Ga0068869_100754069 3300005334 Bacteria 834
71 Ga0068869_101482645 3300005334 Bacteria 602
72 Ga0070666_10000303 3300005335 Bacteria 31938
73 Ga0070666_10012379 3300005335 Bacteria 5379
74 Ga0070666_10038579 3300005335 Bacteria 3179
75 Ga0070666_10040888 3300005335 Bacteria 3096
76 Ga0070666_10140866 3300005335 Bacteria 1680
77 Ga0070666_10251363 3300005335 Bacteria 1252
78 Ga0070680_100000212 3300005336 Bacteria 38186
79 Ga0070680_100202632 3300005336 Bacteria 1674
80 Ga0070680_100373394 3300005336 Bacteria 1214
81 Ga0070682_100000101 3300005337 Bacteria 76535
82 Ga0070682_100000651 3300005337 Bacteria 21124
83 Ga0070682_100154126 3300005337 Bacteria 1580
84 Ga0070682_100172793 3300005337 Bacteria 1503
85 Ga0068868_100000177 3300005338 Bacteria 42348
86 Ga0068868_100001935 3300005338 Bacteria 14217
87 Ga0068868_100017469 3300005338 Bacteria 5346
88 Ga0068868_100023646 3300005338 Bacteria 4652
89 Ga0068868_100035202 3300005338 Bacteria 3869
90 Ga0068868_100041901 3300005338 Bacteria 3570
91 Ga0068868_100146447 3300005338 Bacteria 1942
92 Ga0068868_100250304 3300005338 Bacteria 1491
93 Ga0068868_100391798 3300005338 Bacteria 1197
94 Ga0070660_100003304 3300005339 Bacteria 11084
95 Ga0070660_100097120 3300005339 Bacteria 2330
96 Ga0070660_100396663 3300005339 Bacteria 1140
97 Ga0070689_100043517 3300005340 Bacteria 3452
98 Ga0070689_100067689 3300005340 Bacteria 2784
99 Ga0070689_101332879 3300005340 Unclassified 647
100 Ga0070691_10005105 3300005341 Bacteria 5966
101 Ga0070691_10038700 3300005341 Bacteria 2252
102 Ga0070691_10187150 3300005341 Bacteria 1081
103 Ga0070687_100219001 3300005343 Bacteria 1164
104 Ga0070661_100000686 3300005344 Bacteria 24845
105 Ga0070661_100005063 3300005344 Bacteria 9092
106 Ga0070661_100033517 3300005344 Bacteria 3720
107 Ga0070661_100066001 3300005344 Bacteria 2659
108 Ga0070661_100134540 3300005344 Bacteria 1859
109 Ga0070668_100000022 3300005347 Bacteria 96336
110 Ga0070668_100011383 3300005347 Bacteria 6627
111 Ga0070668_100030037 3300005347 Bacteria 4130
112 Ga0070669_100012393 3300005353 Bacteria 6047
113 Ga0070669_100172763 3300005353 Bacteria 1686
114 Ga0070669_100470126 3300005353 Bacteria 1039
115 Ga0070669_100560973 3300005353 Bacteria 953
116 Ga0070669_100641183 3300005353 Bacteria 893
117 Ga0070675_100003907 3300005354 Bacteria 11295
118 Ga0070675_100038447 3300005354 Bacteria 3900
119 Ga0070675_100041999 3300005354 Bacteria 3736
120 Ga0070675_100053739 3300005354 Bacteria 3313
121 Ga0070675_100065083 3300005354 Bacteria 3014
122 Ga0070675_100106195 3300005354 Bacteria 2370
123 Ga0070675_100130430 3300005354 Bacteria 2142
124 Ga0070675_100359411 3300005354 Bacteria 1293
125 Ga0070675_100692711 3300005354 Bacteria 928
126 Ga0070671_100028318 3300005355 Bacteria 4614
127 Ga0070671_100037941 3300005355 Bacteria 3998
128 Ga0070671_100071753 3300005355 Bacteria 2891
129 Ga0070671_100381457 3300005355 Bacteria 1205
130 Ga0070671_100389713 3300005355 Bacteria 1191
131 Ga0070671_100424095 3300005355 Bacteria 1139
132 Ga0070671_100505169 3300005355 Bacteria 1040
133 Ga0070671_100654251 3300005355 Bacteria 910
134 Ga0070671_101201239 3300005355 Bacteria 667
135 Ga0070671_101267937 3300005355 Unclassified 649
136 Ga0070674_100003780 3300005356 Bacteria 8551
137 Ga0070674_100036667 3300005356 Bacteria 3293
138 Ga0070674_101128809 3300005356 Bacteria 693
139 Ga0070673_100000090 3300005364 Bacteria 39776
140 Ga0070673_100005548 3300005364 Bacteria 8089
141 Ga0070673_100006318 3300005364 Bacteria 7695
142 Ga0070673_100030181 3300005364 Bacteria 4052
143 Ga0070673_100041325 3300005364 Bacteria 3546
144 Ga0070673_100048741 3300005364 Bacteria 3304
145 Ga0070673_100876534 3300005364 Bacteria 831
146 Ga0070673_100921135 3300005364 Bacteria 811
147 Ga0070688_100004674 3300005365 Bacteria 7149
148 Ga0070688_100110409 3300005365 Bacteria 1828
149 Ga0070688_100113200 3300005365 Bacteria 1807
150 Ga0070688_100319010 3300005365 Bacteria 1128
151 Ga0070688_100618541 3300005365 Bacteria 831
152 Ga0070659_100004989 3300005366 Bacteria 9506
153 Ga0070659_100006423 3300005366 Bacteria 8488
154 Ga0070659_100012440 3300005366 Bacteria 6311
155 Ga0070659_100218796 3300005366 Bacteria 1571
156 Ga0070667_100003830 3300005367 Bacteria 12781
157 Ga0070667_100104894 3300005367 Bacteria 2446
158 Ga0070667_100115377 3300005367 Bacteria 2332
159 Ga0070667_100227413 3300005367 Bacteria 1662
160 Ga0070667_100263519 3300005367 Bacteria 1544
161 Ga0070667_100325968 3300005367 Bacteria 1386
162 Ga0070667_101015626 3300005367 Bacteria 774
163 Ga0070701_10025221 3300005438 Bacteria 2884
164 Ga0070701_10046223 3300005438 Bacteria 2237
165 Ga0070705_100204328 3300005440 Bacteria 1357
166 Ga0070705_100308405 3300005440 Bacteria 1137
167 Ga0070705_100587688 3300005440 Bacteria 859
168 Ga0070663_100205300 3300005455 Bacteria 1540
169 Ga0070663_100264164 3300005455 Bacteria 1366
170 Ga0070663_100377419 3300005455 Bacteria 1154
171 Ga0070678_100007545 3300005456 Bacteria 6459
172 Ga0070678_100076673 3300005456 Bacteria 2519
173 Ga0070678_100086310 3300005456 Bacteria 2394
174 Ga0070678_100222188 3300005456 Bacteria 1570
175 Ga0070678_100993393 3300005456 Bacteria 771
176 Ga0070662_100009127 3300005457 Bacteria 6475
177 Ga0070662_100012996 3300005457 Bacteria 5532
178 Ga0070662_100036168 3300005457 Bacteria 3491
179 Ga0070662_100038739 3300005457 Bacteria 3387
180 Ga0070662_100044153 3300005457 Bacteria 3192
181 Ga0070662_100150293 3300005457 Bacteria 1812
182 Ga0070662_100163457 3300005457 Bacteria 1743
183 Ga0070681_10001590 3300005458 Bacteria 20192
184 Ga0070681_10218197 3300005458 Bacteria 1823
185 Ga0068867_100014418 3300005459 Bacteria 5601
186 Ga0070685_10014019 3300005466 Bacteria 4242
187 Ga0070685_10266083 3300005466 Bacteria 1142
188 Ga0070685_10666046 3300005466 Bacteria 755
189 Ga0070698_100019462 3300005471 Bacteria 7126
190 Ga0070698_100194357 3300005471 Bacteria 1966
191 Ga0070698_100196931 3300005471 Bacteria 1951
192 Ga0070679_100000449 3300005530 Bacteria 34845
193 Ga0070684_100000433 3300005535 Bacteria 28743
194 Ga0070684_100053633 3300005535 Bacteria 3511
195 Ga0070684_100088767 3300005535 Bacteria 2747
196 Ga0070684_100523034 3300005535 Bacteria 1100
197 Ga0068853_100017053 3300005539 Bacteria 5990
198 Ga0068853_100025858 3300005539 Bacteria 4928
199 Ga0068853_100034146 3300005539 Bacteria 4317
200 Ga0068853_100077988 3300005539 Bacteria 2895
201 Ga0068853_100125496 3300005539 Bacteria 2292
202 Ga0068853_100135069 3300005539 Bacteria 2210
203 Ga0068853_100249320 3300005539 Bacteria 1629
204 Ga0068853_100308797 3300005539 Bacteria 1463
205 Ga0068853_100652233 3300005539 Bacteria 1002
206 Ga0068853_101444809 3300005539 Bacteria 665
207 Ga0070672_100000149 3300005543 Bacteria 38128
208 Ga0070672_100015120 3300005543 Bacteria 5486
209 Ga0070672_100085853 3300005543 Bacteria 2530
210 Ga0070672_100130450 3300005543 Bacteria 2065
211 Ga0070672_100156175 3300005543 Bacteria 1890
212 Ga0070672_100295707 3300005543 Bacteria 1372
213 Ga0070672_100603758 3300005543 Bacteria 956
214 Ga0070686_100059005 3300005544 Bacteria 2471
215 Ga0070686_100084279 3300005544 Bacteria 2111
216 Ga0070686_100458147 3300005544 Bacteria 982
217 Ga0070693_100019024 3300005547 Bacteria 3594
218 Ga0070665_100000001 3300005548 Bacteria 1083363
219 Ga0070665_100001508 3300005548 Bacteria 27075
220 Ga0070665_100007085 3300005548 Bacteria 11393
221 Ga0070665_100111581 3300005548 Bacteria 2737
222 Ga0070665_100226309 3300005548 Bacteria 1871
223 Ga0068855_100001939 3300005563 Bacteria 25691
224 Ga0068855_100017503 3300005563 Bacteria 8618
225 Ga0068855_100065715 3300005563 Bacteria 4229
226 Ga0068855_100088304 3300005563 Bacteria 3581
227 Ga0068855_100182062 3300005563 Bacteria 2375
228 Ga0068855_100194649 3300005563 Bacteria 2285
229 Ga0068855_100285669 3300005563 Bacteria 1831
230 Ga0068855_100376721 3300005563 Bacteria 1559
231 Ga0068855_101082927 3300005563 Bacteria 839
232 Ga0070664_100004734 3300005564 Bacteria 10910
233 Ga0070664_100014730 3300005564 Bacteria 6386
234 Ga0070664_100043986 3300005564 Bacteria 3770
235 Ga0070664_100060954 3300005564 Bacteria 3214
236 Ga0070664_100246857 3300005564 Bacteria 1604
237 Ga0070664_100511002 3300005564 Bacteria 1108
238 Ga0070664_100707668 3300005564 Bacteria 939
239 Ga0070664_101146843 3300005564 Unclassified 733
240 Ga0068857_100019362 3300005577 Bacteria 5975
241 Ga0068857_100027233 3300005577 Bacteria 5041
242 Ga0068857_100030836 3300005577 Bacteria 4736
243 Ga0068857_100307241 3300005577 Bacteria 1463
244 Ga0068857_101512742 3300005577 Bacteria 654
245 Ga0068854_100035001 3300005578 Bacteria 3513
246 Ga0068854_100036442 3300005578 Bacteria 3449
247 Ga0068854_100117058 3300005578 Bacteria 2018
248 Ga0068854_100909404 3300005578 Bacteria 774
249 Ga0068856_100137028 3300005614 Bacteria 2453
250 Ga0068856_100788325 3300005614 Bacteria 970
251 Ga0068856_101207603 3300005614 Bacteria 772
252 Ga0070702_100173234 3300005615 Bacteria 1406
253 Ga0070702_100497692 3300005615 Unclassified 894
254 Ga0068852_100025320 3300005616 Bacteria 4807
255 Ga0068852_100099003 3300005616 Bacteria 2627
256 Ga0068852_100135992 3300005616 Bacteria 2269
257 Ga0068852_100136365 3300005616 Bacteria 2266
258 Ga0068852_100154924 3300005616 Bacteria 2134
259 Ga0068852_100186021 3300005616 Bacteria 1956
260 Ga0068852_100222464 3300005616 Bacteria 1796
261 Ga0068852_100236418 3300005616 Bacteria 1744
262 Ga0068852_100357185 3300005616 Bacteria 1428
263 Ga0068859_100012809 3300005617 Bacteria 8423
264 Ga0068859_100018668 3300005617 Bacteria 6970
265 Ga0068859_100018814 3300005617 Bacteria 6940
266 Ga0068859_100022225 3300005617 Bacteria 6359
267 Ga0068859_100042598 3300005617 Bacteria 4560
268 Ga0068859_100156505 3300005617 Bacteria 2356
269 Ga0068859_100496143 3300005617 Unclassified 1316
270 Ga0068859_100694729 3300005617 Bacteria 1108
271 Ga0068859_101089472 3300005617 Bacteria 878
272 Ga0068859_101154537 3300005617 Bacteria 853
273 Ga0068859_101574425 3300005617 Bacteria 726
274 Ga0068864_100000404 3300005618 Bacteria 37446
275 Ga0068864_100006928 3300005618 Bacteria 9298
276 Ga0068864_100013283 3300005618 Bacteria 6821
277 Ga0068864_100053850 3300005618 Bacteria 3472
278 Ga0068864_100195296 3300005618 Bacteria 1857
279 Ga0068864_100483784 3300005618 Bacteria 1188
280 Ga0068864_100505123 3300005618 Bacteria 1164
281 Ga0068864_100759750 3300005618 Bacteria 950
282 Ga0068864_100806914 3300005618 Bacteria 923
283 Ga0068864_100823598 3300005618 Bacteria 913
284 Ga0068866_10003292 3300005718 Bacteria 6635
285 Ga0068866_10065942 3300005718 Bacteria 1895
286 Ga0068866_10165631 3300005718 Bacteria 1293
287 Ga0068861_100014937 3300005719 Bacteria 5459
288 Ga0068861_100049974 3300005719 Bacteria 3168
289 Ga0068861_100063618 3300005719 Bacteria 2836
290 Ga0068861_100217217 3300005719 Bacteria 1614
291 Ga0068851_10000712 3300005834 Bacteria 14185
292 Ga0068851_10053471 3300005834 Bacteria 2056
293 Ga0068851_10143981 3300005834 Bacteria 1298
294 Ga0068851_10200429 3300005834 Bacteria 1114
295 Ga0068870_10039922 3300005840 Bacteria 2431
296 Ga0068870_10109137 3300005840 Bacteria 1577
297 Ga0068870_10131451 3300005840 Bacteria 1454
298 Ga0068870_10338430 3300005840 Bacteria 962
299 Ga0068863_100000216 3300005841 Bacteria 61837
300 Ga0068863_100038413 3300005841 Bacteria 4554
301 Ga0068863_100062485 3300005841 Bacteria 3522
302 Ga0068863_100194332 3300005841 Bacteria 1951
303 Ga0068863_100258872 3300005841 Bacteria 1682
304 Ga0068863_100344864 3300005841 Bacteria 1449
305 Ga0068863_100465408 3300005841 Bacteria 1242
306 Ga0068858_100006030 3300005842 Bacteria 11816
307 Ga0068858_100018008 3300005842 Bacteria 6615
308 Ga0068858_100226880 3300005842 Bacteria 1770
309 Ga0068858_100667249 3300005842 Bacteria 1011
310 Ga0068858_100673468 3300005842 Bacteria 1006
311 Ga0068858_100790306 3300005842 Bacteria 926
312 Ga0068858_101334152 3300005842 Bacteria 706
313 Ga0068860_100000241 3300005843 Bacteria 83429
314 Ga0068860_100013270 3300005843 Bacteria 8084
315 Ga0068860_100016199 3300005843 Bacteria 7271
316 Ga0068860_100019189 3300005843 Bacteria 6637
317 Ga0068860_100152641 3300005843 Bacteria 2225
318 Ga0068860_100195522 3300005843 Bacteria 1959
319 Ga0068860_100365657 3300005843 Bacteria 1422
320 Ga0068860_100560611 3300005843 Bacteria 1145
321 Ga0068860_101584588 3300005843 Unclassified 677
322 Ga0068862_100008729 3300005844 Bacteria 8389
323 Ga0068862_100162459 3300005844 Bacteria 1995
324 Ga0068862_100444919 3300005844 Bacteria 1220
325 Ga0068862_100491805 3300005844 Bacteria 1163
326 Ga0081540_1022869 3300005983 Bacteria 3678
327 Ga0081539_10000925 3300005985 Bacteria 55202
328 Ga0075432_10155346 3300006058 Unclassified 882
329 Ga0070715_10184222 3300006163 Bacteria 1049
330 Ga0075366_10012601 3300006195 Bacteria 4800
331 Ga0075366_10172410 3300006195 Bacteria 1313
332 Ga0097621_100000334 3300006237 Bacteria 32025
333 Ga0097621_100000488 3300006237 Bacteria 27766
334 Ga0097621_100003690 3300006237 Bacteria 10590
335 Ga0097621_100026314 3300006237 Bacteria 4562
336 Ga0097621_100051732 3300006237 Bacteria 3344
337 Ga0097621_100060738 3300006237 Bacteria 3099
338 Ga0097621_100071150 3300006237 Bacteria 2874
339 Ga0097621_100150455 3300006237 Bacteria 1996
340 Ga0097621_100230321 3300006237 Bacteria 1617
341 Ga0097621_101085349 3300006237 Bacteria 751
342 Ga0075370_10348022 3300006353 Bacteria 885
343 Ga0068871_100000381 3300006358 Bacteria 31089
344 Ga0068871_100007174 3300006358 Bacteria 7951
345 Ga0068871_100008487 3300006358 Bacteria 7390
346 Ga0068871_100022850 3300006358 Bacteria 4827
347 Ga0068871_100210555 3300006358 Bacteria 1681
348 Ga0068871_100905334 3300006358 Bacteria 818
349 Ga0075428_100064685 3300006844 Bacteria 4006
350 Ga0075428_100169954 3300006844 Bacteria 2364
351 Ga0075428_100374101 3300006844 Bacteria 1527
352 Ga0075428_100439566 3300006844 Bacteria 1397
353 Ga0075430_100180402 3300006846 Bacteria 1756
354 Ga0075431_100051328 3300006847 Bacteria 4254
355 Ga0075429_100032949 3300006880 Bacteria 4503
356 Ga0075429_100757593 3300006880 Bacteria 850
357 Ga0068865_100016572 3300006881 Bacteria 4718
358 Ga0068865_100079282 3300006881 Bacteria 2352
359 Ga0068865_100095346 3300006881 Bacteria 2167
360 Ga0068865_100361162 3300006881 Bacteria 1179
361 Ga0068865_100733527 3300006881 Bacteria 847
362 Ga0068865_100851108 3300006881 Bacteria 790
363 Ga0097620_100012809 3300006931 Bacteria 8423
364 Ga0097620_100018668 3300006931 Bacteria 6970
365 Ga0097620_100018813 3300006931 Bacteria 6940
366 Ga0097620_100022228 3300006931 Bacteria 6359
367 Ga0097620_100042600 3300006931 Bacteria 4560
368 Ga0097620_100156508 3300006931 Bacteria 2356
369 Ga0097620_100496185 3300006931 Unclassified 1316
370 Ga0097620_100694617 3300006931 Bacteria 1108
371 Ga0097620_101089524 3300006931 Bacteria 878
372 Ga0097620_101154443 3300006931 Bacteria 853
373 Ga0097620_101574302 3300006931 Bacteria 726
374 Ga0105251_10330869 3300009011 Bacteria 693
375 Ga0105240_10000078 3300009093 Bacteria 196646
376 Ga0105240_10006513 3300009093 Bacteria 17149
377 Ga0105240_10014605 3300009093 Bacteria 10715
378 Ga0105240_10027503 3300009093 Bacteria 7444
379 Ga0105240_10036655 3300009093 Bacteria 6306
380 Ga0105240_10038251 3300009093 Bacteria 6155
381 Ga0105240_10038564 3300009093 Bacteria 6127
382 Ga0105240_10099086 3300009093 Bacteria 3548
383 Ga0105240_10158659 3300009093 Bacteria 2689
384 Ga0105240_10262532 3300009093 Bacteria 1991
385 Ga0105240_10352502 3300009093 Bacteria 1669
386 Ga0105240_10591030 3300009093 Bacteria 1223
387 Ga0105240_11260722 3300009093 Bacteria 781
388 Ga0111539_10053820 3300009094 Bacteria 4791
389 Ga0111539_10097257 3300009094 Bacteria 3458
390 Ga0111539_10235363 3300009094 Bacteria 2132
391 Ga0111539_11487499 3300009094 Bacteria 785
392 Ga0111539_12082726 3300009094 Bacteria 658
393 Ga0105245_10344923 3300009098 Bacteria 1474
394 Ga0105245_11140814 3300009098 Unclassified 826
395 Ga0105247_10001018 3300009101 Bacteria 21121
396 Ga0105247_10023608 3300009101 Bacteria 3705
397 Ga0105247_10274601 3300009101 Unclassified 1161
398 Ga0105247_10360463 3300009101 Bacteria 1025
399 Ga0114129_10149925 3300009147 Bacteria 3192
400 Ga0114129_10281430 3300009147 Bacteria 2222
401 Ga0105241_10000105 3300009174 Bacteria 60020
402 Ga0105241_10000409 3300009174 Bacteria 32453
403 Ga0105241_10128074 3300009174 Bacteria 2052
404 Ga0105241_10508904 3300009174 Bacteria 1075
405 Ga0105242_10015763 3300009176 Bacteria 5871
406 Ga0105242_10032865 3300009176 Bacteria 4151
407 Ga0105242_10138406 3300009176 Bacteria 2110
408 Ga0105242_10153451 3300009176 Bacteria 2010
409 Ga0105242_10340756 3300009176 Bacteria 1381
410 Ga0105242_10363839 3300009176 Bacteria 1339
411 Ga0105242_10869702 3300009176 Bacteria 899
412 Ga0105248_10017734 3300009177 Bacteria 7851
413 Ga0105248_11136403 3300009177 Unclassified 883
414 Ga0105248_11814899 3300009177 Bacteria 692
415 Ga0105237_10004076 3300009545 Bacteria 17037
416 Ga0105237_10023667 3300009545 Bacteria 6290
417 Ga0105237_10048216 3300009545 Bacteria 4281
418 Ga0105237_10076060 3300009545 Bacteria 3348
419 Ga0105237_10101891 3300009545 Bacteria 2863
420 Ga0105237_10271562 3300009545 Bacteria 1698
421 Ga0105237_11773460 3300009545 Bacteria 625
422 Ga0105238_10088462 3300009551 Bacteria 3084
423 Ga0105238_10095813 3300009551 Bacteria 2954
424 Ga0105238_10338288 3300009551 Bacteria 1493
425 Ga0105238_10551558 3300009551 Bacteria 1157
426 Ga0105249_10001776 3300009553 Bacteria 18798
427 Ga0105249_10005977 3300009553 Bacteria 10546
428 Ga0105249_10011518 3300009553 Bacteria 7772
429 Ga0105249_10073101 3300009553 Bacteria 3171
430 Ga0105249_10233662 3300009553 Bacteria 1814
431 Ga0105249_10260342 3300009553 Bacteria 1723
432 Ga0105249_10304678 3300009553 Bacteria 1599
433 Ga0105249_10479288 3300009553 Bacteria 1287
434 Ga0105249_11590074 3300009553 Bacteria 726
435 Ga0105239_10000169 3300010375 Bacteria 93659
436 Ga0105239_10060010 3300010375 Bacteria 4174
437 Ga0105239_10092220 3300010375 Bacteria 3343
438 Ga0105239_10106272 3300010375 Bacteria 3109
439 Ga0105239_10165836 3300010375 Bacteria 2470
440 Ga0105239_10836402 3300010375 Bacteria 1055
441 Ga0105239_11196954 3300010375 Bacteria 875
442 Ga0105246_10019205 3300011119 Bacteria 4363
443 Ga0105246_10238300 3300011119 Bacteria 1437
444 Ga0105246_10665523 3300011119 Bacteria 908
445 Ga0157373_10108073 3300013100 Bacteria 1956
446 Ga0157373_10160933 3300013100 Bacteria 1579
447 Ga0157373_10215081 3300013100 Bacteria 1355
448 Ga0157373_10483951 3300013100 Bacteria 893
449 Ga0157371_10008021 3300013102 Bacteria 8454
450 Ga0157371_10092139 3300013102 Bacteria 2147
451 Ga0157371_10130865 3300013102 Bacteria 1785
452 Ga0157371_10159985 3300013102 Bacteria 1608
453 Ga0157371_10686210 3300013102 Bacteria 766
454 Ga0157370_10000702 3300013104 Bacteria 41838
455 Ga0157370_10003524 3300013104 Bacteria 18349
456 Ga0157370_10033102 3300013104 Bacteria 5039
457 Ga0157370_10409490 3300013104 Bacteria 1248
458 Ga0157370_10583025 3300013104 Bacteria 1024
459 Ga0157370_10585237 3300013104 Bacteria 1022
460 Ga0157370_10765700 3300013104 Bacteria 879
461 Ga0157370_11031861 3300013104 Bacteria 744
462 Ga0157369_10030867 3300013105 Bacteria 5908
463 Ga0157369_10053158 3300013105 Bacteria 4379
464 Ga0157369_10111735 3300013105 Bacteria 2904
465 Ga0157369_10116206 3300013105 Bacteria 2841
466 Ga0157369_10209164 3300013105 Bacteria 2045
467 Ga0157369_10424662 3300013105 Bacteria 1378
468 Ga0157369_10431956 3300013105 Bacteria 1365
469 Ga0157369_10556095 3300013105 Bacteria 1186
470 Ga0157369_10733862 3300013105 Bacteria 1017
471 Ga0157369_10760484 3300013105 Bacteria 996
472 Ga0157369_10923213 3300013105 Bacteria 895
473 Ga0157374_10000001 3300013296 Bacteria 1077351
474 Ga0157374_10000467 3300013296 Bacteria 36724
475 Ga0157374_10006039 3300013296 Bacteria 10246
476 Ga0157374_10010548 3300013296 Bacteria 7953
477 Ga0157374_10011894 3300013296 Bacteria 7552
478 Ga0157374_10013945 3300013296 Bacteria 7025
479 Ga0157374_10025397 3300013296 Bacteria 5319
480 Ga0157374_10030157 3300013296 Bacteria 4921
481 Ga0157374_10191681 3300013296 Bacteria 2000
482 Ga0157374_11222886 3300013296 Bacteria 773
483 Ga0157374_11285650 3300013296 Bacteria 753
484 Ga0157378_10004966 3300013297 Bacteria 11663
485 Ga0157378_10006197 3300013297 Bacteria 10468
486 Ga0157378_10007156 3300013297 Bacteria 9746
487 Ga0157378_10018840 3300013297 Bacteria 6067
488 Ga0157378_10029260 3300013297 Bacteria 4862
489 Ga0157378_10053226 3300013297 Bacteria 3604
490 Ga0157378_10079954 3300013297 Bacteria 2952
491 Ga0157378_10091216 3300013297 Bacteria 2770
492 Ga0157378_10099175 3300013297 Bacteria 2657
493 Ga0157378_10239975 3300013297 Bacteria 1731
494 Ga0157378_10306130 3300013297 Bacteria 1539
495 Ga0157378_10564528 3300013297 Unclassified 1145
496 Ga0157378_10809866 3300013297 Unclassified 963
497 Ga0157378_11266256 3300013297 Bacteria 778
498 Ga0163162_10000216 3300013306 Bacteria 52917
499 Ga0163162_10000340 3300013306 Bacteria 42478
500 Ga0163162_10014241 3300013306 Bacteria 7769
501 Ga0163162_10015824 3300013306 Bacteria 7370
502 Ga0163162_10016379 3300013306 Bacteria 7245
503 Ga0163162_10025721 3300013306 Bacteria 5819
504 Ga0163162_10029068 3300013306 Bacteria 5469
505 Ga0163162_10030765 3300013306 Bacteria 5319
506 Ga0163162_10085780 3300013306 Bacteria 3226
507 Ga0163162_10151654 3300013306 Bacteria 2436
508 Ga0163162_10179822 3300013306 Bacteria 2241
509 Ga0163162_10193340 3300013306 Bacteria 2162
510 Ga0163162_10246087 3300013306 Bacteria 1920
511 Ga0163162_10275675 3300013306 Bacteria 1814
512 Ga0163162_10356500 3300013306 Bacteria 1595
513 Ga0163162_10853390 3300013306 Bacteria 1026
514 Ga0163162_11059365 3300013306 Unclassified 918
515 Ga0157372_10000644 3300013307 Bacteria 38351
516 Ga0157372_10008033 3300013307 Bacteria 11221
517 Ga0157372_10008498 3300013307 Bacteria 10897
518 Ga0157372_10020735 3300013307 Bacteria 7095
519 Ga0157372_10037566 3300013307 Bacteria 5343
520 Ga0157372_10037958 3300013307 Bacteria 5315
521 Ga0157372_10083781 3300013307 Bacteria 3612
522 Ga0157372_10129397 3300013307 Bacteria 2904
523 Ga0157372_10190275 3300013307 Bacteria 2377
524 Ga0157372_10227672 3300013307 Bacteria 2161
525 Ga0157372_10375413 3300013307 Bacteria 1657
526 Ga0157372_10392189 3300013307 Bacteria 1618
527 Ga0157372_10454228 3300013307 Bacteria 1493
528 Ga0157372_10462667 3300013307 Bacteria 1478
529 Ga0157372_10501245 3300013307 Bacteria 1416
530 Ga0157372_10529591 3300013307 Bacteria 1373
531 Ga0157372_10844337 3300013307 Bacteria 1063
532 Ga0157372_11006915 3300013307 Bacteria 965
533 Ga0157372_11073744 3300013307 Bacteria 932
534 Ga0157372_11533599 3300013307 Bacteria 767
535 Ga0157372_11708176 3300013307 Bacteria 724
536 Ga0157372_11975846 3300013307 Bacteria 670
537 Ga0157375_10000073 3300013308 Bacteria 105972
538 Ga0157375_10004239 3300013308 Bacteria 12439
539 Ga0157375_10009790 3300013308 Bacteria 8426
540 Ga0157375_10024709 3300013308 Bacteria 5566
541 Ga0157375_10040227 3300013308 Bacteria 4505
542 Ga0157375_10041079 3300013308 Bacteria 4464
543 Ga0157375_10147483 3300013308 Bacteria 2485
544 Ga0157375_10163864 3300013308 Bacteria 2367
545 Ga0157375_10214304 3300013308 Bacteria 2083
546 Ga0157375_10240866 3300013308 Bacteria 1969
547 Ga0157375_10294176 3300013308 Bacteria 1787
548 Ga0157375_10461375 3300013308 Bacteria 1436
549 Ga0157375_10780719 3300013308 Bacteria 1105
550 Ga0163163_10000198 3300014325 Bacteria 62120
551 Ga0163163_10000317 3300014325 Bacteria 47023
552 Ga0163163_10000349 3300014325 Bacteria 44503
553 Ga0163163_10073545 3300014325 Bacteria 3409
554 Ga0163163_10166550 3300014325 Bacteria 2250
555 Ga0163163_10345148 3300014325 Bacteria 1544
556 Ga0163163_10541579 3300014325 Bacteria 1226
557 Ga0163163_10831602 3300014325 Bacteria 987
558 Ga0157380_10014224 3300014326 Bacteria 5820
559 Ga0157380_10158134 3300014326 Bacteria 1966
560 Ga0157380_10172983 3300014326 Bacteria 1889
561 Ga0157380_10410428 3300014326 Bacteria 1288
562 Ga0157377_10005505 3300014745 Bacteria 5959
563 Ga0157377_10021020 3300014745 Bacteria 3427
564 Ga0157377_10024497 3300014745 Bacteria 3208
565 Ga0157377_10030355 3300014745 Bacteria 2927
566 Ga0157377_10152721 3300014745 Bacteria 1429
567 Ga0157377_10203908 3300014745 Bacteria 1257
568 Ga0157377_10258777 3300014745 Bacteria 1131
569 Ga0157377_10441861 3300014745 Bacteria 896
570 Ga0157379_10000068 3300014968 Bacteria 65388
571 Ga0157379_10100975 3300014968 Bacteria 2589
572 Ga0157379_10103098 3300014968 Bacteria 2560
573 Ga0157379_10121430 3300014968 Bacteria 2350
574 Ga0157379_10740742 3300014968 Bacteria 925
575 Ga0157376_10000743 3300014969 Bacteria 21197
576 Ga0157376_10003830 3300014969 Bacteria 10401
577 Ga0157376_10036543 3300014969 Bacteria 3980
578 Ga0157376_10118858 3300014969 Bacteria 2339
579 Ga0157376_10210757 3300014969 Bacteria 1794
580 Ga0157376_10268264 3300014969 Bacteria 1602
581 Ga0157376_10282613 3300014969 Bacteria 1563
582 Ga0157376_10378867 3300014969 Bacteria 1362
583 Ga0157376_10382771 3300014969 Bacteria 1356
584 Ga0157376_10485072 3300014969 Bacteria 1212
585 Ga0157376_10559517 3300014969 Bacteria 1133
586 Ga0157376_10886761 3300014969 Bacteria 909
587 Ga0157376_11055359 3300014969 Bacteria 837
588 Ga0157376_11287436 3300014969 Bacteria 761
589 Ga0182006_1074727 3300015261 Bacteria 1248
590 Ga0163161_10004591 3300017792 Bacteria 9611
591 Ga0163161_10082195 3300017792 Bacteria 2373
592 Ga0163161_10106832 3300017792 Bacteria 2089
593 Ga0163161_10129337 3300017792 Bacteria 1903
594 Ga0163161_10134377 3300017792 Bacteria 1868
595 Ga0163161_10172690 3300017792 Bacteria 1653
596 Ga0163161_10830251 3300017792 Bacteria 779
597 Ga0163161_11456010 3300017792 Unclassified 600
598 Ga0206356_11546257 3300020070 Bacteria 1070
599 Ga0206352_10812222 3300020078 Bacteria 2503
600 Ga0206350_11250461 3300020080 Bacteria 1292
601 Ga0213876_10005547 3300021384 Bacteria 6926
602 Ga0213876_10057389 3300021384 Bacteria 2055
603 Ga0209646_1000002 3300025246 Bacteria 1425781
604 Ga0209026_1000636 3300025250 Bacteria 21832
605 Ga0209129_1006296 3300025258 Bacteria 3890
606 Ga0209673_1000096 3300025273 Bacteria 194819
607 Ga0209564_1004313 3300025295 Bacteria 8791
608 Ga0209758_1006557 3300025297 Bacteria 8284
609 Ga0209050_1000207 3300025298 Bacteria 131328
610 Ga0207426_1000032 3300025302 Bacteria 457997
611 Ga0207426_1000571 3300025302 Bacteria 49864
612 Ga0207426_1001515 3300025302 Bacteria 18962
613 Ga0207426_1128265 3300025302 Bacteria 618
614 Ga0209051_1036433 3300025303 Bacteria 1816
615 Ga0209257_1002636 3300025304 Bacteria 17286
616 Ga0207697_10082832 3300025315 Bacteria 1353
617 Ga0207697_10111384 3300025315 Bacteria 1172
618 Ga0207656_10001620 3300025321 Bacteria 7493
619 Ga0207656_10185129 3300025321 Bacteria 1001
620 Ga0207682_10003590 3300025893 Bacteria 6705
621 Ga0207682_10005649 3300025893 Bacteria 5086
622 Ga0207682_10020997 3300025893 Bacteria 2568
623 Ga0207682_10035862 3300025893 Bacteria 2005
624 Ga0207642_10147140 3300025899 Bacteria 1249
625 Ga0207642_10368812 3300025899 Unclassified 852
626 Ga0207710_10000660 3300025900 Bacteria 19517
627 Ga0207688_10054638 3300025901 Bacteria 2241
628 Ga0207688_10142761 3300025901 Bacteria 1410
629 Ga0207680_10000358 3300025903 Bacteria 21841
630 Ga0207680_10177361 3300025903 Bacteria 1439
631 Ga0207647_10026855 3300025904 Bacteria 3761
632 Ga0207647_10043529 3300025904 Bacteria 2809
633 Ga0207647_10073901 3300025904 Bacteria 2054
634 Ga0207647_10175810 3300025904 Bacteria 1245
635 Ga0207647_10212752 3300025904 Bacteria 1116
636 Ga0207685_10089665 3300025905 Bacteria 1291
637 Ga0207645_10001770 3300025907 Bacteria 17477
638 Ga0207645_10005531 3300025907 Bacteria 9152
639 Ga0207645_10009423 3300025907 Bacteria 6754
640 Ga0207645_10032558 3300025907 Bacteria 3351
641 Ga0207645_10036823 3300025907 Bacteria 3141
642 Ga0207645_10455260 3300025907 Bacteria 864
643 Ga0207643_10051826 3300025908 Bacteria 2330
644 Ga0207643_10067206 3300025908 Bacteria 2057
645 Ga0207705_10001320 3300025909 Bacteria 19878
646 Ga0207705_10852783 3300025909 Bacteria 706
647 Ga0207654_10004759 3300025911 Bacteria 6876
648 Ga0207654_10010844 3300025911 Bacteria 4640
649 Ga0207654_10420566 3300025911 Bacteria 932
650 Ga0207654_10455608 3300025911 Bacteria 897
651 Ga0207707_10000508 3300025912 Bacteria 39968
652 Ga0207707_10163668 3300025912 Bacteria 1944
653 Ga0207695_10000064 3300025913 Bacteria 346010
654 Ga0207695_10000232 3300025913 Bacteria 147559
655 Ga0207695_10000962 3300025913 Bacteria 51331
656 Ga0207695_10001292 3300025913 Bacteria 42510
657 Ga0207695_10007602 3300025913 Bacteria 13737
658 Ga0207695_10021717 3300025913 Bacteria 7316
659 Ga0207695_10039381 3300025913 Bacteria 5081
660 Ga0207695_10092967 3300025913 Bacteria 3026
661 Ga0207695_10169923 3300025913 Bacteria 2106
662 Ga0207695_10234773 3300025913 Bacteria 1737
663 Ga0207695_10306208 3300025913 Bacteria 1479
664 Ga0207695_10776616 3300025913 Bacteria 838
665 Ga0207671_10011633 3300025914 Bacteria 7142
666 Ga0207671_10045087 3300025914 Bacteria 3260
667 Ga0207671_10053729 3300025914 Bacteria 2985
668 Ga0207671_10120255 3300025914 Bacteria 2007
669 Ga0207671_10127010 3300025914 Bacteria 1954
670 Ga0207671_10232143 3300025914 Bacteria 1448
671 Ga0207663_10735304 3300025916 Bacteria 783
672 Ga0207660_10000325 3300025917 Bacteria 30850
673 Ga0207660_10053302 3300025917 Bacteria 2882
674 Ga0207662_10026414 3300025918 Bacteria 3349
675 Ga0207657_10007324 3300025919 Bacteria 11321
676 Ga0207657_10623355 3300025919 Bacteria 841
677 Ga0207649_10020991 3300025920 Bacteria 3752
678 Ga0207649_10037078 3300025920 Bacteria 2942
679 Ga0207649_10193168 3300025920 Bacteria 1433
680 Ga0207649_10367567 3300025920 Bacteria 1069
681 Ga0207652_10000186 3300025921 Bacteria 65493
682 Ga0207652_10028861 3300025921 Bacteria 4631
683 Ga0207652_10335846 3300025921 Bacteria 1364
684 Ga0207681_10004291 3300025923 Bacteria 8799
685 Ga0207681_10078362 3300025923 Bacteria 2325
686 Ga0207681_10115209 3300025923 Bacteria 1962
687 Ga0207681_10247944 3300025923 Bacteria 1389
688 Ga0207681_10344589 3300025923 Bacteria 1191
689 Ga0207694_10019981 3300025924 Bacteria 5067
690 Ga0207694_10063603 3300025924 Bacteria 2874
691 Ga0207694_10121635 3300025924 Bacteria 2085
692 Ga0207650_10024745 3300025925 Bacteria 4272
693 Ga0207650_10047200 3300025925 Bacteria 3173
694 Ga0207650_10076949 3300025925 Bacteria 2521
695 Ga0207650_10089102 3300025925 Bacteria 2354
696 Ga0207650_10132694 3300025925 Bacteria 1951
697 Ga0207650_10199954 3300025925 Bacteria 1600
698 Ga0207650_10211526 3300025925 Bacteria 1557
699 Ga0207650_10448912 3300025925 Bacteria 1073
700 Ga0207650_10545425 3300025925 Unclassified 972
701 Ga0207650_10599240 3300025925 Bacteria 926
702 Ga0207650_10881349 3300025925 Bacteria 760
703 Ga0207659_10012333 3300025926 Bacteria 5435
704 Ga0207659_10032047 3300025926 Bacteria 3604
705 Ga0207659_10033426 3300025926 Bacteria 3540
706 Ga0207659_10042754 3300025926 Bacteria 3178
707 Ga0207659_10057528 3300025926 Bacteria 2788
708 Ga0207659_10103650 3300025926 Bacteria 2150
709 Ga0207659_10205603 3300025926 Bacteria 1575
710 Ga0207659_10283219 3300025926 Bacteria 1356
711 Ga0207659_10553967 3300025926 Bacteria 977
712 Ga0207659_10571116 3300025926 Bacteria 962
713 Ga0207659_11329623 3300025926 Bacteria 617
714 Ga0207687_10201639 3300025927 Bacteria 1555
715 Ga0207687_10928734 3300025927 Unclassified 745
716 Ga0207700_10752904 3300025928 Bacteria 870
717 Ga0207644_10011186 3300025931 Bacteria 5931
718 Ga0207644_10087334 3300025931 Bacteria 2318
719 Ga0207644_10519265 3300025931 Bacteria 984
720 Ga0207644_10698764 3300025931 Bacteria 846
721 Ga0207644_10700500 3300025931 Bacteria 844
722 Ga0207644_10940290 3300025931 Bacteria 725
723 Ga0207690_10016626 3300025932 Bacteria 4481
724 Ga0207690_10018204 3300025932 Bacteria 4306
725 Ga0207690_10060439 3300025932 Bacteria 2572
726 Ga0207690_10195529 3300025932 Bacteria 1532
727 Ga0207690_10250183 3300025932 Bacteria 1369
728 Ga0207706_10000817 3300025933 Bacteria 32335
729 Ga0207706_10014975 3300025933 Bacteria 7022
730 Ga0207706_10023585 3300025933 Bacteria 5525
731 Ga0207706_10023834 3300025933 Bacteria 5491
732 Ga0207706_10039589 3300025933 Bacteria 4179
733 Ga0207706_10069820 3300025933 Bacteria 3090
734 Ga0207706_10363858 3300025933 Bacteria 1256
735 Ga0207706_10470393 3300025933 Bacteria 1086
736 Ga0207706_10914297 3300025933 Bacteria 741
737 Ga0207686_10013527 3300025934 Bacteria 4517
738 Ga0207686_10037065 3300025934 Bacteria 2940
739 Ga0207686_10058746 3300025934 Bacteria 2426
740 Ga0207686_10339804 3300025934 Bacteria 1127
741 Ga0207686_10387450 3300025934 Bacteria 1061
742 Ga0207686_10941078 3300025934 Bacteria 699
743 Ga0207670_10011420 3300025936 Bacteria 5156
744 Ga0207670_10032249 3300025936 Bacteria 3367
745 Ga0207670_10066017 3300025936 Bacteria 2485
746 Ga0207670_10327013 3300025936 Bacteria 1208
747 Ga0207670_10436479 3300025936 Bacteria 1053
748 Ga0207670_10570414 3300025936 Bacteria 927
749 Ga0207670_11065018 3300025936 Unclassified 682
750 Ga0207669_10011306 3300025937 Bacteria 4337
751 Ga0207704_10059774 3300025938 Bacteria 2355
752 Ga0207704_10060251 3300025938 Bacteria 2347
753 Ga0207704_10331775 3300025938 Bacteria 1177
754 Ga0207704_10594348 3300025938 Bacteria 905
755 Ga0207704_10659050 3300025938 Bacteria 863
756 Ga0207704_11358113 3300025938 Bacteria 608
757 Ga0207691_10000113 3300025940 Bacteria 72765
758 Ga0207691_10026487 3300025940 Bacteria 5439
759 Ga0207691_10040071 3300025940 Bacteria 4331
760 Ga0207691_10061953 3300025940 Bacteria 3396
761 Ga0207691_10108177 3300025940 Bacteria 2475
762 Ga0207691_10133438 3300025940 Bacteria 2192
763 Ga0207691_10137359 3300025940 Bacteria 2155
764 Ga0207691_10241404 3300025940 Bacteria 1562
765 Ga0207691_10255036 3300025940 Bacteria 1513
766 Ga0207691_11010424 3300025940 Bacteria 694
767 Ga0207711_10021040 3300025941 Bacteria 5448
768 Ga0207711_10131935 3300025941 Bacteria 2241
769 Ga0207689_10001136 3300025942 Bacteria 25671
770 Ga0207689_10010264 3300025942 Bacteria 8067
771 Ga0207689_10024823 3300025942 Bacteria 5025
772 Ga0207689_10026316 3300025942 Bacteria 4871
773 Ga0207689_10072661 3300025942 Bacteria 2826
774 Ga0207689_10100304 3300025942 Bacteria 2379
775 Ga0207689_10186232 3300025942 Bacteria 1712
776 Ga0207689_10378777 3300025942 Bacteria 1178
777 Ga0207689_10432450 3300025942 Unclassified 1099
778 Ga0207689_10477186 3300025942 Bacteria 1044
779 Ga0207661_10003908 3300025944 Bacteria 10400
780 Ga0207661_10013720 3300025944 Bacteria 5917
781 Ga0207661_10091142 3300025944 Bacteria 2539
782 Ga0207661_10262038 3300025944 Bacteria 1540
783 Ga0207661_10407822 3300025944 Bacteria 1233
784 Ga0207661_11070118 3300025944 Unclassified 743
785 Ga0207679_10013851 3300025945 Bacteria 5288
786 Ga0207679_10034020 3300025945 Bacteria 3592
787 Ga0207679_10042990 3300025945 Bacteria 3250
788 Ga0207679_10229675 3300025945 Bacteria 1566
789 Ga0207679_10565632 3300025945 Bacteria 1021
790 Ga0207679_10635601 3300025945 Bacteria 964
791 Ga0207679_10827836 3300025945 Bacteria 845
792 Ga0207679_10933429 3300025945 Unclassified 794
793 Ga0207667_10000111 3300025949 Bacteria 131758
794 Ga0207667_10001859 3300025949 Bacteria 26535
795 Ga0207667_10019146 3300025949 Bacteria 7655
796 Ga0207667_10032868 3300025949 Bacteria 5584
797 Ga0207667_10082302 3300025949 Bacteria 3335
798 Ga0207667_10178668 3300025949 Bacteria 2180
799 Ga0207651_10001967 3300025960 Bacteria 9662
800 Ga0207651_10044765 3300025960 Bacteria 2965
801 Ga0207651_10056442 3300025960 Bacteria 2703
802 Ga0207651_10098903 3300025960 Bacteria 2159
803 Ga0207651_10115601 3300025960 Bacteria 2023
804 Ga0207651_10211469 3300025960 Bacteria 1561
805 Ga0207651_10246036 3300025960 Bacteria 1460
806 Ga0207651_10418444 3300025960 Bacteria 1143
807 Ga0207651_10509342 3300025960 Bacteria 1042
808 Ga0207712_10006120 3300025961 Bacteria 7587
809 Ga0207712_10011688 3300025961 Bacteria 5598
810 Ga0207712_10058784 3300025961 Bacteria 2718
811 Ga0207712_10086477 3300025961 Bacteria 2296
812 Ga0207712_10096035 3300025961 Bacteria 2193
813 Ga0207712_10119075 3300025961 Bacteria 1994
814 Ga0207712_10148782 3300025961 Bacteria 1806
815 Ga0207712_10449733 3300025961 Bacteria 1092
816 Ga0207668_10003018 3300025972 Bacteria 9866
817 Ga0207668_10134873 3300025972 Bacteria 1890
818 Ga0207640_10064000 3300025981 Bacteria 2447
819 Ga0207640_10147802 3300025981 Bacteria 1722
820 Ga0207640_10233590 3300025981 Bacteria 1416
821 Ga0207640_10249993 3300025981 Bacteria 1375
822 Ga0207640_10528620 3300025981 Bacteria 987
823 Ga0207640_10640949 3300025981 Bacteria 904
824 Ga0207658_10000759 3300025986 Bacteria 27690
825 Ga0207658_10013459 3300025986 Bacteria 5589
826 Ga0207658_10027901 3300025986 Bacteria 3971
827 Ga0207658_10089800 3300025986 Bacteria 2380
828 Ga0207658_10089965 3300025986 Bacteria 2378
829 Ga0207658_10261211 3300025986 Bacteria 1476
830 Ga0207658_10276433 3300025986 Bacteria 1438
831 Ga0207658_10282066 3300025986 Bacteria 1424
832 Ga0207658_10464408 3300025986 Bacteria 1122
833 Ga0207658_10470979 3300025986 Bacteria 1115
834 Ga0207677_10005254 3300026023 Bacteria 7013
835 Ga0207677_10007331 3300026023 Bacteria 6092
836 Ga0207677_10020140 3300026023 Bacteria 4045
837 Ga0207677_10146203 3300026023 Bacteria 1817
838 Ga0207677_10147283 3300026023 Bacteria 1811
839 Ga0207677_10211811 3300026023 Bacteria 1548
840 Ga0207677_10301311 3300026023 Bacteria 1324
841 Ga0207677_10514140 3300026023 Bacteria 1038
842 Ga0207677_10558142 3300026023 Bacteria 999
843 Ga0207703_10000316 3300026035 Bacteria 52401
844 Ga0207703_10075755 3300026035 Bacteria 2789
845 Ga0207703_10089339 3300026035 Bacteria 2587
846 Ga0207703_10259307 3300026035 Bacteria 1571
847 Ga0207703_10467784 3300026035 Unclassified 1180
848 Ga0207703_10834260 3300026035 Bacteria 881
849 Ga0207703_10947963 3300026035 Bacteria 825
850 Ga0207703_10961762 3300026035 Bacteria 819
851 Ga0207639_10007654 3300026041 Bacteria 7372
852 Ga0207639_10053604 3300026041 Bacteria 3078
853 Ga0207639_10095370 3300026041 Bacteria 2391
854 Ga0207639_10137876 3300026041 Bacteria 2029
855 Ga0207639_10178279 3300026041 Bacteria 1805
856 Ga0207639_10180942 3300026041 Bacteria 1793
857 Ga0207639_10374565 3300026041 Bacteria 1277
858 Ga0207639_10903340 3300026041 Unclassified 825
859 Ga0207639_11685054 3300026041 Unclassified 594
860 Ga0207678_10092984 3300026067 Bacteria 2577
861 Ga0207678_10241065 3300026067 Bacteria 1548
862 Ga0207678_10599780 3300026067 Bacteria 965
863 Ga0207708_10929874 3300026075 Bacteria 753
864 Ga0207702_10681920 3300026078 Bacteria 1012
865 Ga0207641_10001605 3300026088 Bacteria 22069
866 Ga0207641_10094324 3300026088 Bacteria 2624
867 Ga0207641_10218501 3300026088 Bacteria 1766
868 Ga0207641_10313954 3300026088 Bacteria 1484
869 Ga0207641_10443252 3300026088 Bacteria 1254
870 Ga0207641_10844298 3300026088 Bacteria 907
871 Ga0207648_10002305 3300026089 Bacteria 20617
872 Ga0207648_10004992 3300026089 Bacteria 13485
873 Ga0207648_10026128 3300026089 Bacteria 5192
874 Ga0207648_10047900 3300026089 Bacteria 3745
875 Ga0207648_10226031 3300026089 Bacteria 1664
876 Ga0207648_10260108 3300026089 Bacteria 1548
877 Ga0207648_10320590 3300026089 Bacteria 1393
878 Ga0207648_10473225 3300026089 Bacteria 1143
879 Ga0207648_11037937 3300026089 Bacteria 768
880 Ga0207648_11080762 3300026089 Unclassified 752
881 Ga0207676_10001882 3300026095 Bacteria 15352
882 Ga0207676_10018209 3300026095 Bacteria 5102
883 Ga0207676_10036382 3300026095 Bacteria 3744
884 Ga0207676_10076264 3300026095 Bacteria 2708
885 Ga0207676_10285216 3300026095 Bacteria 1501
886 Ga0207676_10421966 3300026095 Bacteria 1251
887 Ga0207676_10502293 3300026095 Bacteria 1152
888 Ga0207676_10653346 3300026095 Bacteria 1015
889 Ga0207676_10757211 3300026095 Bacteria 945
890 Ga0207676_11575664 3300026095 Bacteria 654
891 Ga0207674_10033492 3300026116 Bacteria 5379
892 Ga0207674_10042278 3300026116 Bacteria 4709
893 Ga0207674_10057753 3300026116 Bacteria 3933
894 Ga0207674_10060076 3300026116 Bacteria 3845
895 Ga0207674_10064716 3300026116 Bacteria 3688
896 Ga0207674_10072102 3300026116 Bacteria 3470
897 Ga0207674_10147964 3300026116 Bacteria 2306
898 Ga0207674_10154088 3300026116 Bacteria 2253
899 Ga0207674_10438332 3300026116 Bacteria 1263
900 Ga0207674_10989212 3300026116 Bacteria 810
901 Ga0207675_100027050 3300026118 Bacteria 5340
902 Ga0207675_100067158 3300026118 Bacteria 3352
903 Ga0207675_100082295 3300026118 Bacteria 3019
904 Ga0207675_100098413 3300026118 Bacteria 2755
905 Ga0207675_100204103 3300026118 Bacteria 1899
906 Ga0207675_100773435 3300026118 Bacteria 972
907 Ga0207675_100898518 3300026118 Bacteria 902
908 Ga0207675_101493494 3300026118 Bacteria 696
909 Ga0207683_10002777 3300026121 Bacteria 15302
910 Ga0207683_10013775 3300026121 Bacteria 6896
911 Ga0207683_10063785 3300026121 Bacteria 3246
912 Ga0207683_10103776 3300026121 Bacteria 2540
913 Ga0207683_10134494 3300026121 Bacteria 2225
914 Ga0207683_10234419 3300026121 Bacteria 1674
915 Ga0207683_10268474 3300026121 Bacteria 1558
916 Ga0207683_10303993 3300026121 Bacteria 1459
917 Ga0207683_10514957 3300026121 Bacteria 1105
918 Ga0207683_10638169 3300026121 Bacteria 986
919 Ga0207683_10806538 3300026121 Bacteria 871
920 Ga0207698_10027714 3300026142 Bacteria 4027
921 Ga0207698_10122727 3300026142 Bacteria 2202
922 Ga0207698_10163450 3300026142 Bacteria 1950
923 Ga0207698_10232715 3300026142 Bacteria 1674
924 Ga0207698_10278184 3300026142 Bacteria 1546
925 Ga0207698_10285256 3300026142 Bacteria 1529
926 Ga0207698_10317791 3300026142 Bacteria 1457
927 Ga0207698_10503364 3300026142 Bacteria 1179
928 Ga0207698_11360889 3300026142 Unclassified 725
929 Ga0209999_1032362 3300027543 Bacteria 972
930 Ga0209974_10095085 3300027876 Bacteria 1036
931 Ga0209974_10181214 3300027876 Bacteria 772
932 Ga0268266_10000102 3300028379 Bacteria 179754
933 Ga0268266_10001351 3300028379 Bacteria 29632
934 Ga0268266_10034094 3300028379 Bacteria 4328
935 Ga0268266_10234120 3300028379 Bacteria 1692
936 Ga0268266_10342648 3300028379 Bacteria 1403
937 Ga0268266_10734045 3300028379 Bacteria 953
938 Ga0268266_11290011 3300028379 Bacteria 706
939 Ga0268265_10204126 3300028380 Unclassified 1717
940 Ga0268265_10303711 3300028380 Bacteria 1438
941 Ga0268265_11252394 3300028380 Bacteria 741
942 Ga0268264_10000011 3300028381 Bacteria 580884
943 Ga0268264_10003097 3300028381 Bacteria 14394
944 Ga0268264_10011453 3300028381 Bacteria 7322
945 Ga0268264_10055897 3300028381 Bacteria 3299
946 Ga0268264_10178045 3300028381 Bacteria 1929
947 Ga0268264_11056395 3300028381 Bacteria 820
948 Ga0307517_10050018 3300028786 Bacteria 4259
949 Ga0307517_10116843 3300028786 Bacteria 1994
950 Ga0307517_10269983 3300028786 Bacteria 979
951 Ga0307515_10000010 3300028794 Bacteria 651586
952 Ga0307511_10002902 3300030521 Bacteria 17761
953 Ga0265327_10000084 3300031251 Bacteria 204433
954 Ga0265327_10000366 3300031251 Bacteria 85818
955 Ga0265313_10065844 3300031595 Bacteria 1681
956 Ga0307407_11126864 3300031903 Bacteria 611
957 Ga0307416_101106975 3300032002 Bacteria 897
958 Ga0307414_10320339 3300032004 Bacteria 1319
959 Ga0307507_10414985 3300033179 Bacteria 759
960 Ga0307510_10000119 3300033180 Bacteria 62835
961 Ga0307510_10320608 3300033180 Bacteria 1007
962 Ga0373934_0012385 3300035086 Bacteria 3220
963 Ga0373944_0084007 3300035089 Unclassified 1056
964 Ga0373952_0058148 3300035092 Bacteria 939
965 Ga0373936_0081449 3300035113 Bacteria 1348
966 Ga0373956_0086936 3300035119 Bacteria 1439
967 Ga0373957_0044854 3300035120 Bacteria 1674
968 Ga0373946_0098014 3300035171 Bacteria 1310
969 Ga0373961_0174354 3300035241 Bacteria 746
970 Ga0373935_0351882 3300035692 Bacteria 1050
971 Ga0373927_0314130 3300035695 Bacteria 1032
972 Ga0373933_0045334 3300035724 Bacteria 2607
973 Ga0373947_0159532 3300035725 Bacteria 1458
974 Ga0373937_0061306 3300036401 Bacteria 3457
975 Ga0373937_0356071 3300036401 Bacteria 1387
976 Ga0373937_0869688 3300036401 Bacteria 850
977 Ga0395900_0312296 3300037418 Bacteria 1555
978 Ga0395900_0929139 3300037418 Bacteria 792
979 Ga0395901_0463913 3300038443 Bacteria 1294
980 Ga0436365_0140747 3300039437 Bacteria 24514
981 Ga0436365_1548207 3300039437 Unclassified 932
982 Ga0436365_1929414 3300039437 Bacteria 3775
983 Ga0439436_0082955 3300041404 Bacteria 892
984 Ga0451843_0361727 3300041509 Bacteria 1226
985 Ga0451853_2186715 3300041512 Bacteria 975
986 Ga0439448_0039246 3300042005 Bacteria 1526
987 Ga0439449_0001430 3300042007 Bacteria 9333
988 Ga0439457_028358 3300042014 Bacteria 1239
989 Ga0450922_002800 3300042124 Bacteria 1618
990 Ga0450923_016086 3300042125 Bacteria 1405
991 Ga0439446_0095064 3300042156 Bacteria 937
992 Ga0439435_0075688 3300042436 Bacteria 1003
993 Ga0451577_0671070 3300042876 Bacteria 939
994 Ga0451577_1016883 3300042876 Bacteria 744
995 Ga0466969_0130720 3300044656 Bacteria 1164
996 Ga0466972_0002446 3300044658 Bacteria 9175
997 Ga0466972_0103905 3300044658 Bacteria 1344
998 Ga0466972_0113644 3300044658 Bacteria 1279
999 Ga0453683_0030589 3300044673 Bacteria 3403
1000 Ga0453683_0100341 3300044673 Bacteria 1817
1001 Ga0466965_0027073 3300044683 Bacteria 2781
1002 Ga0466965_0051633 3300044683 Bacteria 2040
1003 Ga0466966_0090599 3300044684 Bacteria 1899
1004 Ga0466966_0329937 3300044684 Bacteria 917
1005 Ga0453684_0238530 3300044712 Bacteria 2094
1006 Ga0453684_0241045 3300044712 Bacteria 2081
1007 Ga0453684_1196284 3300044712 Bacteria 798
1008 Ga0466971_0064131 3300044719 Bacteria 1663
1009 Ga0466968_0061112 3300044735 Bacteria 1625
1010 Ga0466970_0000280 3300044765 Bacteria 24871
1011 Ga0466970_0041827 3300044765 Bacteria 2436
1012 Ga0466970_0139410 3300044765 Bacteria 1335
1013 Ga0466960_0339967 3300044901 Bacteria 854
1014 Ga0466959_0056262 3300045049 Bacteria 2870
1015 Ga0466959_0238188 3300045049 Bacteria 1258
1016 Ga0451576_0257274 3300045051 Bacteria 1825
1017 Ga0466967_0225813 3300045976 Bacteria 1781
1018 Ga0495638_0189260 3300046460 Bacteria 1168
1019 Ga0495580_0465691 3300046472 Bacteria 847
1020 Ga0495664_0296697 3300046477 Bacteria 976
1021 Ga0495594_0075506 3300046499 Bacteria 1879
1022 Ga0495606_0005477 3300046507 Bacteria 12152
1023 Ga0495618_0299897 3300046514 Bacteria 999
1024 Ga0495628_0064246 3300046516 Bacteria 2874
1025 Ga0495630_0131704 3300046517 Bacteria 1899
1026 Ga0495630_0183739 3300046517 Bacteria 1595
1027 Ga0495648_0002633 3300046524 Bacteria 16312
1028 Ga0495586_0059232 3300046535 Bacteria 2081
1029 Ga0495587_0118440 3300046536 Bacteria 1517
1030 Ga0495633_0082064 3300046558 Bacteria 1500
1031 Ga0495668_0000650 3300046616 Bacteria 41696
1032 Ga0495634_0466056 3300046642 Bacteria 744
1033 Ga0495657_0332921 3300046675 Bacteria 901
1034 Ga0495599_0117581 3300046678 Bacteria 1654
1035 Ga0495658_0658293 3300046683 Bacteria 671
1036 Ga0495670_0293978 3300046691 Unclassified 870
1037 Ga0495600_0108701 3300046809 Bacteria 1806
1038 Ga0495636_0000045 3300047318 Bacteria 53503
1039 Ga0495674_0626302 3300047319 Bacteria 850
1040 Ga0495672_0021174 3300047320 Bacteria 4245
1041 Ga0495687_000001 3300047443 Bacteria 1215582
1042 Ga0495684_0073050 3300047471 Bacteria 2606
1043 Ga0495686_0000004 3300047472 Bacteria 869019
1044 Ga0495686_0228891 3300047472 Bacteria 1054
1045 Ga0496100_0010695 3300048903 Bacteria 5204
1046 Ga0496101_0174307 3300048904 Bacteria 1654
1047 Ga0496102_0532146 3300048905 Bacteria 1098
1048 Ga0496104_0392944 3300048907 Bacteria 1299
1049 Ga0496107_0501628 3300048910 Bacteria 900
1050 Ga0496108_0925538 3300048911 Bacteria 747
1051 Ga0496110_0034483 3300048913 Bacteria 4384
1052 Ga0496115_0303524 3300048918 Bacteria 1308
1053 Ga0496115_0545777 3300048918 Bacteria 927
1054 Ga0501306_001423 3300049127 Bacteria 2251
1055 Ga0501306_027935 3300049127 Bacteria 824
1056 Ga0501308_002937 3300049128 Bacteria 1539
1057 Ga0501308_008913 3300049128 Bacteria 1085
1058 Ga0501309_004541 3300049129 Bacteria 1622
1059 Ga0501310_008601 3300049130 Bacteria 1111
1060 Ga0501341_00741 3300049131 Bacteria 1468
1061 Ga0501343_002166 3300049132 Bacteria 1388
1062 Ga0501304_005103 3300049160 Bacteria 1019
1063 Ga0501304_006763 3300049160 Bacteria 932
1064 Ga0501305_001466 3300049161 Bacteria 2316
1065 Ga0501305_011062 3300049161 Bacteria 1213
1066 Ga0501305_014914 3300049161 Bacteria 1092
1067 Ga0501305_025284 3300049161 Bacteria 899
1068 Ga0501307_003819 3300049162 Bacteria 1502
1069 Ga0501307_008465 3300049162 Bacteria 1156
1070 Ga0501298_038960 3300049521 Bacteria 959
1071 Ga0501311_007435 3300049527 Bacteria 1261
1072 Ga0501312_006714 3300049528 Bacteria 1446
1073 Ga0501312_012573 3300049528 Bacteria 1166
1074 Ga0501313_003764 3300049529 Bacteria 1526
1075 Ga0501314_003156 3300049530 Bacteria 1317
1076 Ga0501314_004211 3300049530 Bacteria 1187
1077 Ga0501315_002099 3300049531 Bacteria 1829
1078 Ga0501315_003222 3300049531 Bacteria 1615
1079 Ga0501315_006311 3300049531 Bacteria 1314
1080 Ga0501315_010570 3300049531 Bacteria 1112
1081 Ga0501315_020326 3300049531 Bacteria 890
1082 Ga0501315_034237 3300049531 Bacteria 745
1083 Ga0501315_071676 3300049531 Bacteria 576
1084 Ga0501316_004650 3300049532 Bacteria 1387
1085 Ga0501317_000922 3300049533 Bacteria 2337
1086 Ga0501317_003672 3300049533 Bacteria 1548
1087 Ga0501318_008846 3300049534 Bacteria 1086
1088 Ga0501320_003434 3300049536 Bacteria 1343
1089 Ga0501320_003694 3300049536 Bacteria 1313
1090 Ga0501321_000711 3300049537 Bacteria 2309
1091 Ga0501322_010240 3300049538 Bacteria 720
1092 Ga0501323_004486 3300049539 Bacteria 1481
1093 Ga0501324_001617 3300049540 Bacteria 1530
1094 Ga0501325_002569 3300049541 Bacteria 1254
1095 Ga0501325_005609 3300049541 Bacteria 1003
1096 Ga0501329_01899 3300049545 Bacteria 962
1097 Ga0501330_001281 3300049546 Bacteria 1278
1098 Ga0501332_00970 3300049548 Bacteria 1412
1099 Ga0501332_01863 3300049548 Bacteria 1145
1100 Ga0501334_00963 3300049550 Bacteria 1501
1101 Ga0501334_02415 3300049550 Bacteria 1108
1102 Ga0501335_002286 3300049551 Bacteria 1544
1103 Ga0501335_006219 3300049551 Bacteria 1083
1104 Ga0501335_007004 3300049551 Bacteria 1035
1105 Ga0501335_007190 3300049551 Bacteria 1025
1106 Ga0501335_021289 3300049551 Bacteria 694
1107 Ga0501336_003553 3300049552 Bacteria 1060
1108 Ga0501336_003599 3300049552 Bacteria 1056
1109 Ga0501336_005029 3300049552 Bacteria 945
1110 Ga0501337_001150 3300049553 Bacteria 1470
1111 Ga0501338_00443 3300049554 Bacteria 1859
1112 Ga0501338_02541 3300049554 Bacteria 1043
1113 Ga0501031_0038037 3300049568 Bacteria 3140
1114 Ga0501032_0019262 3300049569 Bacteria 4775
1115 Ga0501032_0055273 3300049569 Unclassified 2670
1116 Ga0501032_0237218 3300049569 Bacteria 1185
1117 Ga0501033_0038999 3300049570 Bacteria 3549
1118 Ga0501033_0363888 3300049570 Bacteria 1012
1119 Ga0501034_0010008 3300049571 Bacteria 9906
1120 Ga0501034_0075740 3300049571 Bacteria 3371
1121 Ga0501034_0142610 3300049571 Bacteria 2374
1122 Ga0501034_0650504 3300049571 Bacteria 956
1123 Ga0501036_0045514 3300049572 Bacteria 3717
1124 Ga0501036_0125079 3300049572 Bacteria 2171
1125 Ga0501037_0009556 3300049573 Bacteria 7119
1126 Ga0501037_0037559 3300049573 Bacteria 3571
1127 Ga0501037_0059629 3300049573 Bacteria 2783
1128 Ga0501037_0092023 3300049573 Bacteria 2194
1129 Ga0501038_0025986 3300049574 Bacteria 5215
1130 Ga0501038_0109514 3300049574 Bacteria 2288
1131 Ga0501039_0050368 3300049575 Bacteria 3222
1132 Ga0501039_0094760 3300049575 Bacteria 2327
1133 Ga0501039_0105234 3300049575 Bacteria 2203
1134 Ga0501043_0004087 3300049579 Bacteria 11922
1135 Ga0501043_0012420 3300049579 Bacteria 6661
1136 Ga0501043_0013840 3300049579 Bacteria 6314
1137 Ga0501043_0044533 3300049579 Bacteria 3489
1138 Ga0501046_0017480 3300049580 Bacteria 5983
1139 Ga0501046_0026251 3300049580 Bacteria 4758
1140 Ga0501047_0003665 3300049581 Bacteria 14478
1141 Ga0501047_0030096 3300049581 Bacteria 5234
1142 Ga0501047_0040101 3300049581 Bacteria 4529
1143 Ga0501048_0050802 3300049582 Bacteria 2952
1144 Ga0501067_0006420 3300049583 Bacteria 6514
1145 Ga0501068_0036447 3300049584 Bacteria 2941
1146 Ga0501068_0101475 3300049584 Bacteria 1784
1147 Ga0501069_0075930 3300049585 Bacteria 1889
1148 Ga0501070_0028792 3300049586 Bacteria 4657
1149 Ga0501072_0073516 3300049588 Bacteria 2703
1150 Ga0501073_0005302 3300049589 Bacteria 9668
1151 Ga0501073_0101797 3300049589 Bacteria 1995
1152 Ga0501073_0162982 3300049589 Bacteria 1544
1153 Ga0501074_0000797 3300049590 Bacteria 19923
1154 Ga0501074_0033875 3300049590 Bacteria 3703
1155 Ga0501198_021401 3300049649 Bacteria 1031
1156 Ga0501207_002993 3300049654 Bacteria 2214
1157 Ga0501217_244982 3300049661 Bacteria 575
1158 Ga0501227_054758 3300049665 Bacteria 1013
1159 Ga0501228_003544 3300049666 Bacteria 1291
1160 Ga0501228_007798 3300049666 Bacteria 1010
1161 Ga0501235_001267 3300049669 Bacteria 5327
1162 Ga0501240_042527 3300049673 Bacteria 759
1163 Ga0501242_005146 3300049674 Bacteria 1464
1164 Ga0501251_028613 3300049681 Unclassified 783
1165 Ga0501261_003348 3300049690 Bacteria 1966
1166 Ga0501221_000112 3300049704 Bacteria 9948
1167 Ga0501221_016364 3300049704 Bacteria 1403
1168 Ga0501225_0002315 3300049705 Bacteria 5881
1169 Ga0501234_008670 3300049707 Bacteria 1584
1170 Ga0501245_005940 3300049708 Bacteria 1699
1171 Ga0501079_0360765 3300049741 Bacteria 1139
1172 Ga0501080_0035757 3300049742 Bacteria 4637
1173 Ga0501080_0052791 3300049742 Bacteria 3783
1174 Ga0501080_0460567 3300049742 Bacteria 1139
1175 Ga0501080_0795674 3300049742 Bacteria 830
1176 Ga0501083_0044352 3300049744 Bacteria 3010
1177 Ga0501272_004633 3300049769 Bacteria 1433
1178 Ga0501279_022600 3300049775 Bacteria 904
1179 Ga0501035_0025721 3300049822 Bacteria 5395
1180 Ga0501035_0067435 3300049822 Bacteria 3175
1181 Ga0501035_0153636 3300049822 Bacteria 1996
1182 Ga0501044_0005733 3300049823 Bacteria 13754
1183 Ga0501044_0015563 3300049823 Bacteria 8195
1184 Ga0501044_0050286 3300049823 Bacteria 4302
1185 Ga0501044_0303588 3300049823 Bacteria 1525
1186 Ga0501044_0405255 3300049823 Bacteria 1276
1187 Ga0501044_0512738 3300049823 Bacteria 1099
1188 Ga0501044_0576844 3300049823 Bacteria 1020
1189 Ga0501045_0165790 3300049824 Bacteria 1645
1190 Ga0501226_031499 3300049853 Unclassified 603
1191 nmdc:mga0k408_446153_c1 3300050493 Bacteria 768
1192 nmdc:mga0k408_47999_c1 3300050493 Bacteria 2469
1193 nmdc:mga07m45_34215_c1 3300050496 Bacteria 2824
1194 nmdc:mga05p37_231260_c1 3300050507 Bacteria 2227
1195 nmdc:mga05p37_281992_c1 3300050507 Bacteria 1981
1196 nmdc:mga09592_45343_c1 3300050508 Bacteria 3704
1197 nmdc:mga09592_49621_c1 3300050508 Bacteria 3539
1198 nmdc:mga09592_682730_c1 3300050508 Unclassified 875
1199 nmdc:mga0qj67_157636_c1 3300050509 Bacteria 1843
1200 nmdc:mga06r32_32850_c2 3300050510 Bacteria 2887
1201 nmdc:mga08y16_1217278_c1 3300050511 Bacteria 723
1202 nmdc:mga08y16_202537_c1 3300050511 Bacteria 2057
1203 nmdc:mga08y16_824739_c1 3300050511 Bacteria 919
1204 nmdc:mga0n895_585434_c1 3300050512 Bacteria 1119
1205 nmdc:mga0a205_1285274_c1 3300050515 Bacteria 579
1206 Ga0495619_0041370 3300053085 Bacteria 3014
1207 Ga0500646_0012093 3300053090 Bacteria 2226
1208 Ga0500583_0005990 3300053092 Bacteria 4136
1209 Ga0500641_0025200 3300053096 Bacteria 2300
1210 Ga0500652_015822 3300053131 Bacteria 2732
1211 Ga0500568_0016248 3300053139 Bacteria 3315
1212 Ga0500622_0000782 3300053156 Bacteria 27616
1213 Ga0500622_0000852 3300053156 Bacteria 26070
1214 Ga0501084_0131031 3300054114 Bacteria 2110
1215 Ga0587073_0060123 3300059492 Bacteria 889
1216 Ga0587077_002325 3300059493 Bacteria 2235
1217 Ga0587090_033183 3300059510 Bacteria 874
1218 Ga0587128_072393 3300059630 Bacteria 674
1219 Ga0501082_0035882 3300060353 Bacteria 4273
1220 Ga0466962_0029755 3300061719 Bacteria 2615

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046558 Ga0495633_0082064 Ga0495633_0082064_356_892 153
2 3300046691 Ga0495670_0293978 Ga0495670_0293978_321_857 153
3 3300047318 Ga0495636_0000045 Ga0495636_0000045_45582_46118 153
4 3300026121 Ga0207683_10234419 Ga0207683_102344193 156
5 3300050515 nmdc:mga0a205_1285274_c1 nmdc:mga0a205_1285274_c1_14_520 159
6 3300003163 Ga0006759J45824_1097056 Ga0006759J45824_10970562 160
7 3300013307 Ga0157372_10392189 Ga0157372_103921892 161
8 3300049570 Ga0501033_0038999 Ga0501033_0038999_1486_2013 161
9 3300049569 Ga0501032_0237218 Ga0501032_0237218_130_654 162
10 3300049572 Ga0501036_0045514 Ga0501036_0045514_2697_3221 162
11 3300049573 Ga0501037_0009556 Ga0501037_0009556_5792_6316 162
12 3300049575 Ga0501039_0105234 Ga0501039_0105234_985_1509 162
13 3300049581 Ga0501047_0040101 Ga0501047_0040101_2230_2754 162
14 3300049742 Ga0501080_0035757 Ga0501080_0035757_2433_2957 162
15 3300049823 Ga0501044_0015563 Ga0501044_0015563_6210_6734 162
16 3300013307 Ga0157372_10454228 Ga0157372_104542281 163
17 3300021384 Ga0213876_10005547 Ga0213876_100055472 164
18 3300039437 Ga0436365_0140747 Ga0436365_0140747_14029_14553 164
19 3300046616 Ga0495668_0000650 Ga0495668_0000650_8879_9481 164
20 3300005367 Ga0070667_100325968 Ga0070667_1003259682 165
21 3300006237 Ga0097621_100026314 Ga0097621_1000263144 165
22 3300006358 Ga0068871_100007174 Ga0068871_1000071744 165
23 3300013297 Ga0157378_10006197 Ga0157378_100061976 165
24 3300013297 Ga0157378_10029260 Ga0157378_100292604 165
25 3300013306 Ga0163162_10246087 Ga0163162_102460873 165
26 3300014968 Ga0157379_10103098 Ga0157379_101030983 165
27 3300017792 Ga0163161_10134377 Ga0163161_101343772 165
28 3300025986 Ga0207658_10276433 Ga0207658_102764332 165
29 3300026023 Ga0207677_10514140 Ga0207677_105141401 165
30 3300026121 Ga0207683_10514957 Ga0207683_105149572 165
31 3300048918 Ga0496115_0303524 Ga0496115_0303524_243_767 165
32 3300049533 Ga0501317_003672 Ga0501317_003672_406_975 165
33 iso_pu_bacteria 2881955468 2881955503 165
34 3300005293 Ga0065715_10223950 Ga0065715_102239502 166
35 3300005329 Ga0070683_100042173 Ga0070683_1000421734 166
36 3300005330 Ga0070690_100629979 Ga0070690_1006299791 166
37 3300005331 Ga0070670_100607988 Ga0070670_1006079881 166
38 3300005354 Ga0070675_100041999 Ga0070675_1000419996 166
39 3300005355 Ga0070671_100028318 Ga0070671_1000283181 166
40 3300005355 Ga0070671_100071753 Ga0070671_1000717534 166
41 3300005455 Ga0070663_100377419 Ga0070663_1003774191 166
42 3300005535 Ga0070684_100523034 Ga0070684_1005230341 166
43 3300005543 Ga0070672_100156175 Ga0070672_1001561754 166
44 3300005578 Ga0068854_100909404 Ga0068854_1009094041 166
45 3300005616 Ga0068852_100135992 Ga0068852_1001359923 166
46 3300005618 Ga0068864_100195296 Ga0068864_1001952961 166
47 3300005618 Ga0068864_100483784 Ga0068864_1004837842 166
48 3300005840 Ga0068870_10109137 Ga0068870_101091372 166
49 3300006358 Ga0068871_100905334 Ga0068871_1009053341 166
50 3300013100 Ga0157373_10215081 Ga0157373_102150812 166
51 3300013102 Ga0157371_10159985 Ga0157371_101599852 166
52 3300013104 Ga0157370_10409490 Ga0157370_104094902 166
53 3300013104 Ga0157370_10765700 Ga0157370_107657002 166
54 3300013296 Ga0157374_10030157 Ga0157374_100301572 166
55 3300013296 Ga0157374_11285650 Ga0157374_112856501 166
56 3300013297 Ga0157378_10053226 Ga0157378_100532265 166
57 3300013307 Ga0157372_10083781 Ga0157372_100837812 166
58 3300013307 Ga0157372_11073744 Ga0157372_110737442 166
59 3300013307 Ga0157372_11975846 Ga0157372_119758461 166
60 3300014325 Ga0163163_10073545 Ga0163163_100735452 166
61 3300014745 Ga0157377_10441861 Ga0157377_104418612 166
62 3300025893 Ga0207682_10005649 Ga0207682_100056495 166
63 3300025925 Ga0207650_10024745 Ga0207650_100247453 166
64 3300025925 Ga0207650_10881349 Ga0207650_108813492 166
65 3300025926 Ga0207659_10032047 Ga0207659_100320475 166
66 3300025926 Ga0207659_10571116 Ga0207659_105711162 166
67 3300025933 Ga0207706_10914297 Ga0207706_109142971 166
68 3300025934 Ga0207686_10941078 Ga0207686_109410781 166
69 3300025940 Ga0207691_10255036 Ga0207691_102550362 166
70 3300025940 Ga0207691_11010424 Ga0207691_110104241 166
71 3300025944 Ga0207661_10262038 Ga0207661_102620382 166
72 3300025944 Ga0207661_10407822 Ga0207661_104078222 166
73 3300025945 Ga0207679_10013851 Ga0207679_100138513 166
74 3300025945 Ga0207679_10565632 Ga0207679_105656322 166
75 3300025945 Ga0207679_10827836 Ga0207679_108278361 166
76 3300026089 Ga0207648_11037937 Ga0207648_110379372 166
77 3300026116 Ga0207674_10042278 Ga0207674_100422782 166
78 3300026121 Ga0207683_10268474 Ga0207683_102684741 166
79 3300026142 Ga0207698_10503364 Ga0207698_105033642 166
80 3300033179 Ga0307507_10414985 Ga0307507_104149852 166
81 3300041404 Ga0439436_0082955 Ga0439436_0082955_127_654 166
82 3300041512 Ga0451853_2186715 Ga0451853_2186715_150_677 166
83 3300042007 Ga0439449_0001430 Ga0439449_0001430_2666_3193 166
84 3300042014 Ga0439457_028358 Ga0439457_028358_324_851 166
85 3300042876 Ga0451577_1016883 Ga0451577_1016883_53_580 166
86 3300044712 Ga0453684_1196284 Ga0453684_1196284_16_543 166
87 3300045049 Ga0466959_0238188 Ga0466959_0238188_396_923 166
88 3300048911 Ga0496108_0925538 Ga0496108_0925538_55_582 166
89 3300049128 Ga0501308_002937 Ga0501308_002937_461_988 166
90 3300049160 Ga0501304_005103 Ga0501304_005103_105_632 166
91 3300049161 Ga0501305_014914 Ga0501305_014914_48_575 166
92 3300049161 Ga0501305_025284 Ga0501305_025284_284_811 166
93 3300049528 Ga0501312_006714 Ga0501312_006714_570_1097 166
94 3300049531 Ga0501315_006311 Ga0501315_006311_529_1056 166
95 3300049541 Ga0501325_002569 Ga0501325_002569_356_883 166
96 3300049551 Ga0501335_002286 Ga0501335_002286_406_933 166
97 3300049551 Ga0501335_007190 Ga0501335_007190_251_778 166
98 3300049570 Ga0501033_0363888 Ga0501033_0363888_394_921 166
99 3300049573 Ga0501037_0092023 Ga0501037_0092023_1578_2105 166
100 3300049589 Ga0501073_0101797 Ga0501073_0101797_1448_1975 166
101 3300049742 Ga0501080_0795674 Ga0501080_0795674_98_625 166
102 3300049823 Ga0501044_0576844 Ga0501044_0576844_222_749 166
103 3300002459 JGI24751J29686_10000803 JGI24751J29686_100008037 167
104 3300003203 JGI25406J46586_10003914 JGI25406J46586_1000391411 167
105 3300003316 rootH1_10114210 rootH1_101142102 167
106 3300003320 rootH2_10059898 rootH2_100598982 167
107 3300003320 rootH2_10204928 rootH2_102049282 167
108 3300003322 rootL2_10239916 rootL2_102399162 167
109 3300003354 JGI25160J50197_1000508 JGI25160J50197_100050814 167
110 3300005288 Ga0065714_10201259 Ga0065714_102012591 167
111 3300005290 Ga0065712_10206809 Ga0065712_102068091 167
112 3300005295 Ga0065707_10156493 Ga0065707_101564932 167
113 3300005327 Ga0070658_10000420 Ga0070658_100004203 167
114 3300005327 Ga0070658_10013800 Ga0070658_100138004 167
115 3300005327 Ga0070658_10601651 Ga0070658_106016512 167
116 3300005328 Ga0070676_10005499 Ga0070676_100054993 167
117 3300005328 Ga0070676_10036189 Ga0070676_100361893 167
118 3300005328 Ga0070676_10258521 Ga0070676_102585212 167
119 3300005329 Ga0070683_100011895 Ga0070683_1000118954 167
120 3300005330 Ga0070690_100243997 Ga0070690_1002439971 167
121 3300005330 Ga0070690_100346682 Ga0070690_1003466822 167
122 3300005331 Ga0070670_100066660 Ga0070670_1000666602 167
123 3300005331 Ga0070670_100102347 Ga0070670_1001023472 167
124 3300005334 Ga0068869_100019533 Ga0068869_1000195335 167
125 3300005334 Ga0068869_100056223 Ga0068869_1000562232 167
126 3300005334 Ga0068869_100133844 Ga0068869_1001338442 167
127 3300005334 Ga0068869_100613964 Ga0068869_1006139641 167
128 3300005335 Ga0070666_10000303 Ga0070666_1000030313 167
129 3300005335 Ga0070666_10012379 Ga0070666_100123796 167
130 3300005335 Ga0070666_10251363 Ga0070666_102513631 167
131 3300005336 Ga0070680_100202632 Ga0070680_1002026323 167
132 3300005336 Ga0070680_100373394 Ga0070680_1003733942 167
133 3300005337 Ga0070682_100154126 Ga0070682_1001541262 167
134 3300005338 Ga0068868_100000177 Ga0068868_10000017719 167
135 3300005338 Ga0068868_100017469 Ga0068868_1000174695 167
136 3300005338 Ga0068868_100023646 Ga0068868_1000236462 167
137 3300005338 Ga0068868_100035202 Ga0068868_1000352023 167
138 3300005339 Ga0070660_100003304 Ga0070660_1000033047 167
139 3300005340 Ga0070689_100043517 Ga0070689_1000435174 167
140 3300005340 Ga0070689_101332879 Ga0070689_1013328791 167
141 3300005344 Ga0070661_100005063 Ga0070661_1000050635 167
142 3300005344 Ga0070661_100066001 Ga0070661_1000660013 167
143 3300005344 Ga0070661_100134540 Ga0070661_1001345403 167
144 3300005347 Ga0070668_100000022 Ga0070668_10000002220 167
145 3300005347 Ga0070668_100011383 Ga0070668_1000113833 167
146 3300005347 Ga0070668_100030037 Ga0070668_1000300373 167
147 3300005353 Ga0070669_100012393 Ga0070669_1000123934 167
148 3300005353 Ga0070669_100560973 Ga0070669_1005609732 167
149 3300005354 Ga0070675_100003907 Ga0070675_10000390710 167
150 3300005354 Ga0070675_100065083 Ga0070675_1000650832 167
151 3300005354 Ga0070675_100359411 Ga0070675_1003594111 167
152 3300005354 Ga0070675_100692711 Ga0070675_1006927111 167
153 3300005355 Ga0070671_100389713 Ga0070671_1003897131 167
154 3300005355 Ga0070671_100505169 Ga0070671_1005051692 167
155 3300005355 Ga0070671_100654251 Ga0070671_1006542511 167
156 3300005356 Ga0070674_100003780 Ga0070674_1000037803 167
157 3300005356 Ga0070674_100036667 Ga0070674_1000366673 167
158 3300005356 Ga0070674_101128809 Ga0070674_1011288091 167
159 3300005364 Ga0070673_100000090 Ga0070673_10000009041 167
160 3300005364 Ga0070673_100005548 Ga0070673_1000055484 167
161 3300005364 Ga0070673_100006318 Ga0070673_1000063183 167
162 3300005364 Ga0070673_100030181 Ga0070673_1000301818 167
163 3300005364 Ga0070673_100921135 Ga0070673_1009211352 167
164 3300005365 Ga0070688_100004674 Ga0070688_1000046747 167
165 3300005365 Ga0070688_100618541 Ga0070688_1006185411 167
166 3300005366 Ga0070659_100012440 Ga0070659_1000124401 167
167 3300005366 Ga0070659_100218796 Ga0070659_1002187963 167
168 3300005367 Ga0070667_100003830 Ga0070667_1000038304 167
169 3300005367 Ga0070667_100104894 Ga0070667_1001048942 167
170 3300005367 Ga0070667_100227413 Ga0070667_1002274132 167
171 3300005438 Ga0070701_10025221 Ga0070701_100252212 167
172 3300005438 Ga0070701_10046223 Ga0070701_100462232 167
173 3300005440 Ga0070705_100587688 Ga0070705_1005876882 167
174 3300005456 Ga0070678_100086310 Ga0070678_1000863103 167
175 3300005456 Ga0070678_100222188 Ga0070678_1002221882 167
176 3300005456 Ga0070678_100993393 Ga0070678_1009933931 167
177 3300005457 Ga0070662_100009127 Ga0070662_1000091274 167
178 3300005457 Ga0070662_100012996 Ga0070662_1000129963 167
179 3300005457 Ga0070662_100036168 Ga0070662_1000361681 167
180 3300005457 Ga0070662_100038739 Ga0070662_1000387392 167
181 3300005459 Ga0068867_100014418 Ga0068867_1000144184 167
182 3300005466 Ga0070685_10266083 Ga0070685_102660832 167
183 3300005466 Ga0070685_10666046 Ga0070685_106660461 167
184 3300005471 Ga0070698_100019462 Ga0070698_10001946211 167
185 3300005471 Ga0070698_100194357 Ga0070698_1001943573 167
186 3300005471 Ga0070698_100196931 Ga0070698_1001969313 167
187 3300005539 Ga0068853_100017053 Ga0068853_1000170537 167
188 3300005539 Ga0068853_100025858 Ga0068853_1000258588 167
189 3300005539 Ga0068853_100077988 Ga0068853_1000779884 167
190 3300005543 Ga0070672_100000149 Ga0070672_10000014937 167
191 3300005543 Ga0070672_100015120 Ga0070672_1000151204 167
192 3300005543 Ga0070672_100085853 Ga0070672_1000858535 167
193 3300005548 Ga0070665_100001508 Ga0070665_10000150827 167
194 3300005548 Ga0070665_100007085 Ga0070665_1000070855 167
195 3300005563 Ga0068855_100017503 Ga0068855_1000175035 167
196 3300005563 Ga0068855_100065715 Ga0068855_1000657153 167
197 3300005563 Ga0068855_100182062 Ga0068855_1001820623 167
198 3300005563 Ga0068855_100376721 Ga0068855_1003767214 167
199 3300005564 Ga0070664_100014730 Ga0070664_1000147304 167
200 3300005564 Ga0070664_100511002 Ga0070664_1005110021 167
201 3300005577 Ga0068857_100307241 Ga0068857_1003072412 167
202 3300005578 Ga0068854_100036442 Ga0068854_1000364422 167
203 3300005615 Ga0070702_100173234 Ga0070702_1001732342 167
204 3300005615 Ga0070702_100497692 Ga0070702_1004976921 167
205 3300005616 Ga0068852_100154924 Ga0068852_1001549242 167
206 3300005616 Ga0068852_100222464 Ga0068852_1002224643 167
207 3300005616 Ga0068852_100236418 Ga0068852_1002364183 167
208 3300005616 Ga0068852_100357185 Ga0068852_1003571852 167
209 3300005617 Ga0068859_100042598 Ga0068859_1000425983 167
210 3300005617 Ga0068859_100694729 Ga0068859_1006947292 167
211 3300005617 Ga0068859_101154537 Ga0068859_1011545371 167
212 3300005617 Ga0068859_101574425 Ga0068859_1015744251 167
213 3300005618 Ga0068864_100000404 Ga0068864_1000004043 167
214 3300005618 Ga0068864_100053850 Ga0068864_1000538503 167
215 3300005618 Ga0068864_100505123 Ga0068864_1005051232 167
216 3300005618 Ga0068864_100759750 Ga0068864_1007597502 167
217 3300005718 Ga0068866_10003292 Ga0068866_100032924 167
218 3300005718 Ga0068866_10165631 Ga0068866_101656312 167
219 3300005719 Ga0068861_100014937 Ga0068861_1000149376 167
220 3300005719 Ga0068861_100063618 Ga0068861_1000636183 167
221 3300005719 Ga0068861_100217217 Ga0068861_1002172172 167
222 3300005834 Ga0068851_10000712 Ga0068851_100007125 167
223 3300005834 Ga0068851_10053471 Ga0068851_100534712 167
224 3300005834 Ga0068851_10143981 Ga0068851_101439812 167
225 3300005834 Ga0068851_10200429 Ga0068851_102004291 167
226 3300005840 Ga0068870_10039922 Ga0068870_100399223 167
227 3300005840 Ga0068870_10131451 Ga0068870_101314512 167
228 3300005841 Ga0068863_100000216 Ga0068863_10000021660 167
229 3300005841 Ga0068863_100062485 Ga0068863_1000624855 167
230 3300005841 Ga0068863_100465408 Ga0068863_1004654082 167
231 3300005842 Ga0068858_100006030 Ga0068858_1000060304 167
232 3300005842 Ga0068858_100018008 Ga0068858_10001800811 167
233 3300005842 Ga0068858_100667249 Ga0068858_1006672491 167
234 3300005842 Ga0068858_101334152 Ga0068858_1013341522 167
235 3300005843 Ga0068860_100019189 Ga0068860_1000191898 167
236 3300005843 Ga0068860_100195522 Ga0068860_1001955223 167
237 3300005843 Ga0068860_100365657 Ga0068860_1003656573 167
238 3300005843 Ga0068860_100560611 Ga0068860_1005606112 167
239 3300005844 Ga0068862_100008729 Ga0068862_1000087294 167
240 3300005844 Ga0068862_100162459 Ga0068862_1001624592 167
241 3300005985 Ga0081539_10000925 Ga0081539_1000092552 167
242 3300006195 Ga0075366_10172410 Ga0075366_101724101 167
243 3300006237 Ga0097621_100000334 Ga0097621_10000033418 167
244 3300006237 Ga0097621_100003690 Ga0097621_1000036905 167
245 3300006237 Ga0097621_100051732 Ga0097621_1000517321 167
246 3300006237 Ga0097621_100071150 Ga0097621_1000711504 167
247 3300006237 Ga0097621_100150455 Ga0097621_1001504554 167
248 3300006358 Ga0068871_100000381 Ga0068871_10000038133 167
249 3300006358 Ga0068871_100008487 Ga0068871_1000084873 167
250 3300006358 Ga0068871_100022850 Ga0068871_1000228504 167
251 3300006358 Ga0068871_100210555 Ga0068871_1002105552 167
252 3300006844 Ga0075428_100064685 Ga0075428_1000646853 167
253 3300006844 Ga0075428_100169954 Ga0075428_1001699544 167
254 3300006844 Ga0075428_100439566 Ga0075428_1004395662 167
255 3300006846 Ga0075430_100180402 Ga0075430_1001804021 167
256 3300006847 Ga0075431_100051328 Ga0075431_1000513283 167
257 3300006880 Ga0075429_100032949 Ga0075429_1000329492 167
258 3300006880 Ga0075429_100757593 Ga0075429_1007575932 167
259 3300006881 Ga0068865_100016572 Ga0068865_1000165724 167
260 3300006881 Ga0068865_100361162 Ga0068865_1003611622 167
261 3300006881 Ga0068865_100733527 Ga0068865_1007335272 167
262 3300006881 Ga0068865_100851108 Ga0068865_1008511082 167
263 3300006931 Ga0097620_100042600 Ga0097620_1000426003 167
264 3300006931 Ga0097620_100694617 Ga0097620_1006946172 167
265 3300006931 Ga0097620_101154443 Ga0097620_1011544431 167
266 3300006931 Ga0097620_101574302 Ga0097620_1015743021 167
267 3300009011 Ga0105251_10330869 Ga0105251_103308691 167
268 3300009093 Ga0105240_10027503 Ga0105240_100275033 167
269 3300009093 Ga0105240_10036655 Ga0105240_100366553 167
270 3300009093 Ga0105240_10038564 Ga0105240_100385643 167
271 3300009093 Ga0105240_10099086 Ga0105240_100990863 167
272 3300009093 Ga0105240_10158659 Ga0105240_101586593 167
273 3300009093 Ga0105240_10591030 Ga0105240_105910301 167
274 3300009093 Ga0105240_11260722 Ga0105240_112607222 167
275 3300009094 Ga0111539_10053820 Ga0111539_1005382010 167
276 3300009094 Ga0111539_10097257 Ga0111539_100972572 167
277 3300009094 Ga0111539_11487499 Ga0111539_114874991 167
278 3300009098 Ga0105245_10344923 Ga0105245_103449232 167
279 3300009098 Ga0105245_11140814 Ga0105245_111408141 167
280 3300009101 Ga0105247_10023608 Ga0105247_100236083 167
281 3300009147 Ga0114129_10149925 Ga0114129_101499252 167
282 3300009147 Ga0114129_10281430 Ga0114129_102814303 167
283 3300009174 Ga0105241_10508904 Ga0105241_105089042 167
284 3300009176 Ga0105242_10032865 Ga0105242_100328653 167
285 3300009176 Ga0105242_10138406 Ga0105242_101384062 167
286 3300009176 Ga0105242_10869702 Ga0105242_108697022 167
287 3300009177 Ga0105248_11136403 Ga0105248_111364031 167
288 3300009545 Ga0105237_10023667 Ga0105237_100236673 167
289 3300009545 Ga0105237_10048216 Ga0105237_100482162 167
290 3300009545 Ga0105237_10101891 Ga0105237_101018913 167
291 3300009545 Ga0105237_10271562 Ga0105237_102715622 167
292 3300009551 Ga0105238_10088462 Ga0105238_100884623 167
293 3300009551 Ga0105238_10338288 Ga0105238_103382882 167
294 3300009553 Ga0105249_10001776 Ga0105249_100017764 167
295 3300009553 Ga0105249_10005977 Ga0105249_100059777 167
296 3300009553 Ga0105249_10011518 Ga0105249_100115185 167
297 3300009553 Ga0105249_10260342 Ga0105249_102603423 167
298 3300009553 Ga0105249_10479288 Ga0105249_104792882 167
299 3300009553 Ga0105249_11590074 Ga0105249_115900742 167
300 3300010375 Ga0105239_10000169 Ga0105239_1000016946 167
301 3300010375 Ga0105239_10060010 Ga0105239_100600103 167
302 3300010375 Ga0105239_10106272 Ga0105239_101062722 167
303 3300011119 Ga0105246_10019205 Ga0105246_100192054 167
304 3300011119 Ga0105246_10238300 Ga0105246_102383002 167
305 3300013102 Ga0157371_10008021 Ga0157371_100080215 167
306 3300013102 Ga0157371_10130865 Ga0157371_101308653 167
307 3300013104 Ga0157370_10033102 Ga0157370_100331022 167
308 3300013104 Ga0157370_10585237 Ga0157370_105852372 167
309 3300013105 Ga0157369_10053158 Ga0157369_100531583 167
310 3300013105 Ga0157369_10116206 Ga0157369_101162062 167
311 3300013105 Ga0157369_10556095 Ga0157369_105560952 167
312 3300013105 Ga0157369_10733862 Ga0157369_107338622 167
313 3300013105 Ga0157369_10923213 Ga0157369_109232132 167
314 3300013296 Ga0157374_10000001 Ga0157374_10000001522 167
315 3300013296 Ga0157374_10000467 Ga0157374_1000046719 167
316 3300013296 Ga0157374_10011894 Ga0157374_100118945 167
317 3300013296 Ga0157374_10013945 Ga0157374_100139458 167
318 3300013296 Ga0157374_10025397 Ga0157374_100253972 167
319 3300013297 Ga0157378_10007156 Ga0157378_100071563 167
320 3300013297 Ga0157378_10018840 Ga0157378_100188407 167
321 3300013297 Ga0157378_10091216 Ga0157378_100912164 167
322 3300013297 Ga0157378_10099175 Ga0157378_100991753 167
323 3300013297 Ga0157378_10809866 Ga0157378_108098661 167
324 3300013297 Ga0157378_11266256 Ga0157378_112662562 167
325 3300013306 Ga0163162_10000340 Ga0163162_1000034014 167
326 3300013306 Ga0163162_10029068 Ga0163162_100290688 167
327 3300013306 Ga0163162_10085780 Ga0163162_100857802 167
328 3300013306 Ga0163162_10853390 Ga0163162_108533902 167
329 3300013307 Ga0157372_10000644 Ga0157372_1000064425 167
330 3300013307 Ga0157372_10227672 Ga0157372_102276722 167
331 3300013307 Ga0157372_10375413 Ga0157372_103754131 167
332 3300013307 Ga0157372_10501245 Ga0157372_105012453 167
333 3300013307 Ga0157372_10529591 Ga0157372_105295912 167
334 3300013307 Ga0157372_11708176 Ga0157372_117081761 167
335 3300013308 Ga0157375_10004239 Ga0157375_100042395 167
336 3300013308 Ga0157375_10009790 Ga0157375_100097903 167
337 3300013308 Ga0157375_10040227 Ga0157375_100402272 167
338 3300013308 Ga0157375_10147483 Ga0157375_101474832 167
339 3300013308 Ga0157375_10214304 Ga0157375_102143042 167
340 3300013308 Ga0157375_10240866 Ga0157375_102408662 167
341 3300013308 Ga0157375_10294176 Ga0157375_102941763 167
342 3300014325 Ga0163163_10000349 Ga0163163_1000034928 167
343 3300014325 Ga0163163_10541579 Ga0163163_105415792 167
344 3300014325 Ga0163163_10831602 Ga0163163_108316022 167
345 3300014326 Ga0157380_10014224 Ga0157380_1001422414 167
346 3300014326 Ga0157380_10172983 Ga0157380_101729833 167
347 3300014745 Ga0157377_10021020 Ga0157377_100210202 167
348 3300014745 Ga0157377_10030355 Ga0157377_100303554 167
349 3300014745 Ga0157377_10203908 Ga0157377_102039082 167
350 3300014745 Ga0157377_10258777 Ga0157377_102587772 167
351 3300014968 Ga0157379_10000068 Ga0157379_1000006814 167
352 3300014969 Ga0157376_10000743 Ga0157376_1000074323 167
353 3300014969 Ga0157376_10003830 Ga0157376_100038304 167
354 3300014969 Ga0157376_10210757 Ga0157376_102107572 167
355 3300014969 Ga0157376_10378867 Ga0157376_103788672 167
356 3300014969 Ga0157376_10382771 Ga0157376_103827712 167
357 3300014969 Ga0157376_10559517 Ga0157376_105595172 167
358 3300014969 Ga0157376_10886761 Ga0157376_108867612 167
359 3300015261 Ga0182006_1074727 Ga0182006_10747272 167
360 3300017792 Ga0163161_10082195 Ga0163161_100821952 167
361 3300017792 Ga0163161_10172690 Ga0163161_101726902 167
362 3300017792 Ga0163161_10830251 Ga0163161_108302511 167
363 3300017792 Ga0163161_11456010 Ga0163161_114560101 167
364 3300021384 Ga0213876_10057389 Ga0213876_100573893 167
365 3300025302 Ga0207426_1000032 Ga0207426_1000032168 167
366 3300025302 Ga0207426_1128265 Ga0207426_11282651 167
367 3300025315 Ga0207697_10082832 Ga0207697_100828322 167
368 3300025321 Ga0207656_10001620 Ga0207656_100016208 167
369 3300025321 Ga0207656_10185129 Ga0207656_101851292 167
370 3300025893 Ga0207682_10020997 Ga0207682_100209973 167
371 3300025901 Ga0207688_10054638 Ga0207688_100546384 167
372 3300025901 Ga0207688_10142761 Ga0207688_101427612 167
373 3300025903 Ga0207680_10000358 Ga0207680_1000035814 167
374 3300025904 Ga0207647_10026855 Ga0207647_100268553 167
375 3300025904 Ga0207647_10073901 Ga0207647_100739012 167
376 3300025904 Ga0207647_10175810 Ga0207647_101758102 167
377 3300025907 Ga0207645_10001770 Ga0207645_100017706 167
378 3300025907 Ga0207645_10005531 Ga0207645_100055315 167
379 3300025907 Ga0207645_10009423 Ga0207645_100094233 167
380 3300025907 Ga0207645_10036823 Ga0207645_100368231 167
381 3300025908 Ga0207643_10067206 Ga0207643_100672062 167
382 3300025909 Ga0207705_10001320 Ga0207705_1000132018 167
383 3300025911 Ga0207654_10455608 Ga0207654_104556081 167
384 3300025912 Ga0207707_10163668 Ga0207707_101636683 167
385 3300025913 Ga0207695_10000962 Ga0207695_1000096231 167
386 3300025913 Ga0207695_10007602 Ga0207695_100076029 167
387 3300025913 Ga0207695_10092967 Ga0207695_100929673 167
388 3300025913 Ga0207695_10169923 Ga0207695_101699232 167
389 3300025913 Ga0207695_10306208 Ga0207695_103062082 167
390 3300025914 Ga0207671_10045087 Ga0207671_100450873 167
391 3300025914 Ga0207671_10120255 Ga0207671_101202552 167
392 3300025914 Ga0207671_10127010 Ga0207671_101270103 167
393 3300025914 Ga0207671_10232143 Ga0207671_102321432 167
394 3300025916 Ga0207663_10735304 Ga0207663_107353042 167
395 3300025917 Ga0207660_10053302 Ga0207660_100533023 167
396 3300025919 Ga0207657_10007324 Ga0207657_100073247 167
397 3300025920 Ga0207649_10193168 Ga0207649_101931682 167
398 3300025921 Ga0207652_10335846 Ga0207652_103358462 167
399 3300025923 Ga0207681_10004291 Ga0207681_1000429118 167
400 3300025923 Ga0207681_10078362 Ga0207681_100783622 167
401 3300025924 Ga0207694_10063603 Ga0207694_100636032 167
402 3300025925 Ga0207650_10047200 Ga0207650_100472003 167
403 3300025925 Ga0207650_10545425 Ga0207650_105454252 167
404 3300025926 Ga0207659_10057528 Ga0207659_100575283 167
405 3300025926 Ga0207659_10205603 Ga0207659_102056032 167
406 3300025926 Ga0207659_10283219 Ga0207659_102832192 167
407 3300025926 Ga0207659_10553967 Ga0207659_105539671 167
408 3300025927 Ga0207687_10201639 Ga0207687_102016391 167
409 3300025927 Ga0207687_10928734 Ga0207687_109287341 167
410 3300025931 Ga0207644_10519265 Ga0207644_105192652 167
411 3300025931 Ga0207644_10940290 Ga0207644_109402902 167
412 3300025932 Ga0207690_10016626 Ga0207690_100166262 167
413 3300025933 Ga0207706_10000817 Ga0207706_1000081720 167
414 3300025933 Ga0207706_10023585 Ga0207706_100235853 167
415 3300025933 Ga0207706_10039589 Ga0207706_100395895 167
416 3300025933 Ga0207706_10470393 Ga0207706_104703931 167
417 3300025934 Ga0207686_10037065 Ga0207686_100370653 167
418 3300025936 Ga0207670_10032249 Ga0207670_100322493 167
419 3300025936 Ga0207670_10327013 Ga0207670_103270132 167
420 3300025936 Ga0207670_11065018 Ga0207670_110650181 167
421 3300025937 Ga0207669_10011306 Ga0207669_100113063 167
422 3300025938 Ga0207704_10060251 Ga0207704_100602512 167
423 3300025938 Ga0207704_11358113 Ga0207704_113581131 167
424 3300025940 Ga0207691_10000113 Ga0207691_1000011325 167
425 3300025940 Ga0207691_10026487 Ga0207691_100264874 167
426 3300025940 Ga0207691_10133438 Ga0207691_101334384 167
427 3300025940 Ga0207691_10241404 Ga0207691_102414042 167
428 3300025942 Ga0207689_10001136 Ga0207689_100011365 167
429 3300025942 Ga0207689_10024823 Ga0207689_100248235 167
430 3300025942 Ga0207689_10072661 Ga0207689_100726612 167
431 3300025942 Ga0207689_10186232 Ga0207689_101862322 167
432 3300025945 Ga0207679_10635601 Ga0207679_106356012 167
433 3300025949 Ga0207667_10019146 Ga0207667_100191462 167
434 3300025949 Ga0207667_10178668 Ga0207667_101786682 167
435 3300025960 Ga0207651_10001967 Ga0207651_100019673 167
436 3300025960 Ga0207651_10044765 Ga0207651_100447653 167
437 3300025960 Ga0207651_10115601 Ga0207651_101156012 167
438 3300025960 Ga0207651_10418444 Ga0207651_104184442 167
439 3300025961 Ga0207712_10006120 Ga0207712_100061202 167
440 3300025961 Ga0207712_10011688 Ga0207712_100116884 167
441 3300025961 Ga0207712_10096035 Ga0207712_100960351 167
442 3300025961 Ga0207712_10119075 Ga0207712_101190752 167
443 3300025961 Ga0207712_10449733 Ga0207712_104497331 167
444 3300025972 Ga0207668_10003018 Ga0207668_100030182 167
445 3300025972 Ga0207668_10134873 Ga0207668_101348732 167
446 3300025981 Ga0207640_10064000 Ga0207640_100640004 167
447 3300025981 Ga0207640_10233590 Ga0207640_102335902 167
448 3300025981 Ga0207640_10640949 Ga0207640_106409492 167
449 3300025986 Ga0207658_10000759 Ga0207658_1000075915 167
450 3300025986 Ga0207658_10089800 Ga0207658_100898004 167
451 3300025986 Ga0207658_10089965 Ga0207658_100899653 167
452 3300025986 Ga0207658_10464408 Ga0207658_104644082 167
453 3300025986 Ga0207658_10470979 Ga0207658_104709792 167
454 3300026023 Ga0207677_10005254 Ga0207677_100052548 167
455 3300026023 Ga0207677_10147283 Ga0207677_101472832 167
456 3300026023 Ga0207677_10211811 Ga0207677_102118112 167
457 3300026035 Ga0207703_10000316 Ga0207703_1000031634 167
458 3300026035 Ga0207703_10259307 Ga0207703_102593073 167
459 3300026035 Ga0207703_10947963 Ga0207703_109479631 167
460 3300026035 Ga0207703_10961762 Ga0207703_109617621 167
461 3300026041 Ga0207639_10007654 Ga0207639_100076542 167
462 3300026041 Ga0207639_10137876 Ga0207639_101378763 167
463 3300026041 Ga0207639_10374565 Ga0207639_103745651 167
464 3300026067 Ga0207678_10599780 Ga0207678_105997802 167
465 3300026075 Ga0207708_10929874 Ga0207708_109298741 167
466 3300026088 Ga0207641_10001605 Ga0207641_100016057 167
467 3300026088 Ga0207641_10094324 Ga0207641_100943243 167
468 3300026088 Ga0207641_10443252 Ga0207641_104432521 167
469 3300026089 Ga0207648_10002305 Ga0207648_1000230511 167
470 3300026089 Ga0207648_10004992 Ga0207648_100049926 167
471 3300026089 Ga0207648_10226031 Ga0207648_102260311 167
472 3300026089 Ga0207648_10260108 Ga0207648_102601082 167
473 3300026089 Ga0207648_10320590 Ga0207648_103205902 167
474 3300026095 Ga0207676_10001882 Ga0207676_1000188218 167
475 3300026095 Ga0207676_10036382 Ga0207676_100363825 167
476 3300026095 Ga0207676_10076264 Ga0207676_100762644 167
477 3300026095 Ga0207676_10285216 Ga0207676_102852162 167
478 3300026095 Ga0207676_10421966 Ga0207676_104219662 167
479 3300026095 Ga0207676_10757211 Ga0207676_107572111 167
480 3300026116 Ga0207674_10033492 Ga0207674_100334925 167
481 3300026116 Ga0207674_10147964 Ga0207674_101479644 167
482 3300026116 Ga0207674_10438332 Ga0207674_104383322 167
483 3300026116 Ga0207674_10989212 Ga0207674_109892121 167
484 3300026118 Ga0207675_100027050 Ga0207675_1000270509 167
485 3300026118 Ga0207675_100067158 Ga0207675_1000671586 167
486 3300026118 Ga0207675_100098413 Ga0207675_1000984133 167
487 3300026118 Ga0207675_100204103 Ga0207675_1002041032 167
488 3300026118 Ga0207675_100773435 Ga0207675_1007734352 167
489 3300026118 Ga0207675_101493494 Ga0207675_1014934941 167
490 3300026121 Ga0207683_10002777 Ga0207683_100027779 167
491 3300026121 Ga0207683_10063785 Ga0207683_100637855 167
492 3300026121 Ga0207683_10103776 Ga0207683_101037763 167
493 3300026121 Ga0207683_10303993 Ga0207683_103039932 167
494 3300026121 Ga0207683_10806538 Ga0207683_108065381 167
495 3300026142 Ga0207698_10232715 Ga0207698_102327152 167
496 3300026142 Ga0207698_10278184 Ga0207698_102781842 167
497 3300026142 Ga0207698_10285256 Ga0207698_102852561 167
498 3300026142 Ga0207698_10317791 Ga0207698_103177912 167
499 3300026142 Ga0207698_11360889 Ga0207698_113608892 167
500 3300027543 Ga0209999_1032362 Ga0209999_10323622 167
501 3300027876 Ga0209974_10095085 Ga0209974_100950852 167
502 3300027876 Ga0209974_10181214 Ga0209974_101812142 167
503 3300028379 Ga0268266_10001351 Ga0268266_1000135117 167
504 3300028379 Ga0268266_10234120 Ga0268266_102341203 167
505 3300028379 Ga0268266_11290011 Ga0268266_112900112 167
506 3300028380 Ga0268265_10303711 Ga0268265_103037112 167
507 3300028380 Ga0268265_11252394 Ga0268265_112523941 167
508 3300028381 Ga0268264_10055897 Ga0268264_100558972 167
509 3300028381 Ga0268264_10178045 Ga0268264_101780452 167
510 3300028381 Ga0268264_11056395 Ga0268264_110563952 167
511 3300031251 Ga0265327_10000366 Ga0265327_1000036637 167
512 3300031903 Ga0307407_11126864 Ga0307407_111268641 167
513 3300032002 Ga0307416_101106975 Ga0307416_1011069751 167
514 3300035092 Ga0373952_0058148 Ga0373952_0058148_320_850 167
515 3300035241 Ga0373961_0174354 Ga0373961_0174354_190_720 167
516 3300036401 Ga0373937_0356071 Ga0373937_0356071_726_1256 167
517 3300036401 Ga0373937_0869688 Ga0373937_0869688_104_619 167
518 3300037418 Ga0395900_0929139 Ga0395900_0929139_165_695 167
519 3300039437 Ga0436365_1548207 Ga0436365_1548207_274_804 167
520 3300039437 Ga0436365_1929414 Ga0436365_1929414_3156_3686 167
521 3300042125 Ga0450923_016086 Ga0450923_016086_313_828 167
522 3300042156 Ga0439446_0095064 Ga0439446_0095064_98_613 167
523 3300042436 Ga0439435_0075688 Ga0439435_0075688_358_876 167
524 3300044658 Ga0466972_0103905 Ga0466972_0103905_583_1113 167
525 3300044673 Ga0453683_0030589 Ga0453683_0030589_697_1227 167
526 3300044673 Ga0453683_0100341 Ga0453683_0100341_492_1007 167
527 3300044683 Ga0466965_0051633 Ga0466965_0051633_119_649 167
528 3300044684 Ga0466966_0329937 Ga0466966_0329937_90_620 167
529 3300044712 Ga0453684_0238530 Ga0453684_0238530_1276_1806 167
530 3300044735 Ga0466968_0061112 Ga0466968_0061112_1084_1614 167
531 3300044765 Ga0466970_0139410 Ga0466970_0139410_753_1283 167
532 3300045976 Ga0466967_0225813 Ga0466967_0225813_222_752 167
533 3300046517 Ga0495630_0183739 Ga0495630_0183739_60_590 167
534 3300046642 Ga0495634_0466056 Ga0495634_0466056_12_527 167
535 3300048905 Ga0496102_0532146 Ga0496102_0532146_182_712 167
536 3300048910 Ga0496107_0501628 Ga0496107_0501628_26_556 167
537 3300049127 Ga0501306_001423 Ga0501306_001423_474_1004 167
538 3300049127 Ga0501306_027935 Ga0501306_027935_260_790 167
539 3300049128 Ga0501308_008913 Ga0501308_008913_328_858 167
540 3300049129 Ga0501309_004541 Ga0501309_004541_503_1033 167
541 3300049130 Ga0501310_008601 Ga0501310_008601_104_634 167
542 3300049131 Ga0501341_00741 Ga0501341_00741_392_922 167
543 3300049132 Ga0501343_002166 Ga0501343_002166_333_863 167
544 3300049160 Ga0501304_006763 Ga0501304_006763_370_900 167
545 3300049161 Ga0501305_001466 Ga0501305_001466_504_1034 167
546 3300049161 Ga0501305_011062 Ga0501305_011062_237_767 167
547 3300049162 Ga0501307_003819 Ga0501307_003819_504_1034 167
548 3300049521 Ga0501298_038960 Ga0501298_038960_32_562 167
549 3300049527 Ga0501311_007435 Ga0501311_007435_236_766 167
550 3300049529 Ga0501313_003764 Ga0501313_003764_493_1023 167
551 3300049530 Ga0501314_003156 Ga0501314_003156_326_856 167
552 3300049531 Ga0501315_002099 Ga0501315_002099_840_1370 167
553 3300049531 Ga0501315_003222 Ga0501315_003222_594_1124 167
554 3300049531 Ga0501315_020326 Ga0501315_020326_35_565 167
555 3300049531 Ga0501315_034237 Ga0501315_034237_17_547 167
556 3300049531 Ga0501315_071676 Ga0501315_071676_35_565 167
557 3300049532 Ga0501316_004650 Ga0501316_004650_390_920 167
558 3300049533 Ga0501317_000922 Ga0501317_000922_1301_1831 167
559 3300049534 Ga0501318_008846 Ga0501318_008846_522_1052 167
560 3300049537 Ga0501321_000711 Ga0501321_000711_1273_1803 167
561 3300049539 Ga0501323_004486 Ga0501323_004486_470_1000 167
562 3300049540 Ga0501324_001617 Ga0501324_001617_514_1044 167
563 3300049545 Ga0501329_01899 Ga0501329_01899_318_848 167
564 3300049546 Ga0501330_001281 Ga0501330_001281_392_922 167
565 3300049548 Ga0501332_00970 Ga0501332_00970_474_1004 167
566 3300049548 Ga0501332_01863 Ga0501332_01863_228_758 167
567 3300049550 Ga0501334_00963 Ga0501334_00963_510_1040 167
568 3300049550 Ga0501334_02415 Ga0501334_02415_101_631 167
569 3300049551 Ga0501335_006219 Ga0501335_006219_513_1043 167
570 3300049551 Ga0501335_021289 Ga0501335_021289_41_571 167
571 3300049552 Ga0501336_003553 Ga0501336_003553_60_590 167
572 3300049552 Ga0501336_005029 Ga0501336_005029_330_860 167
573 3300049553 Ga0501337_001150 Ga0501337_001150_441_971 167
574 3300049554 Ga0501338_00443 Ga0501338_00443_1247_1777 167
575 3300049554 Ga0501338_02541 Ga0501338_02541_449_979 167
576 3300049569 Ga0501032_0019262 Ga0501032_0019262_1656_2171 167
577 3300049571 Ga0501034_0010008 Ga0501034_0010008_3417_3932 167
578 3300049572 Ga0501036_0125079 Ga0501036_0125079_1275_1790 167
579 3300049573 Ga0501037_0059629 Ga0501037_0059629_836_1351 167
580 3300049574 Ga0501038_0109514 Ga0501038_0109514_1371_1886 167
581 3300049575 Ga0501039_0050368 Ga0501039_0050368_491_1006 167
582 3300049579 Ga0501043_0004087 Ga0501043_0004087_8008_8523 167
583 3300049580 Ga0501046_0017480 Ga0501046_0017480_538_1053 167
584 3300049581 Ga0501047_0003665 Ga0501047_0003665_13858_14373 167
585 3300049582 Ga0501048_0050802 Ga0501048_0050802_476_991 167
586 3300049583 Ga0501067_0006420 Ga0501067_0006420_4578_5093 167
587 3300049584 Ga0501068_0101475 Ga0501068_0101475_44_559 167
588 3300049586 Ga0501070_0028792 Ga0501070_0028792_1982_2497 167
589 3300049589 Ga0501073_0005302 Ga0501073_0005302_538_1053 167
590 3300049590 Ga0501074_0000797 Ga0501074_0000797_15262_15777 167
591 3300049649 Ga0501198_021401 Ga0501198_021401_96_626 167
592 3300049654 Ga0501207_002993 Ga0501207_002993_916_1446 167
593 3300049661 Ga0501217_244982 Ga0501217_244982_35_565 167
594 3300049665 Ga0501227_054758 Ga0501227_054758_338_868 167
595 3300049666 Ga0501228_003544 Ga0501228_003544_43_573 167
596 3300049666 Ga0501228_007798 Ga0501228_007798_44_574 167
597 3300049669 Ga0501235_001267 Ga0501235_001267_1024_1554 167
598 3300049674 Ga0501242_005146 Ga0501242_005146_109_639 167
599 3300049681 Ga0501251_028613 Ga0501251_028613_214_744 167
600 3300049690 Ga0501261_003348 Ga0501261_003348_584_1114 167
601 3300049704 Ga0501221_000112 Ga0501221_000112_3175_3705 167
602 3300049704 Ga0501221_016364 Ga0501221_016364_860_1390 167
603 3300049705 Ga0501225_0002315 Ga0501225_0002315_98_628 167
604 3300049707 Ga0501234_008670 Ga0501234_008670_1037_1567 167
605 3300049708 Ga0501245_005940 Ga0501245_005940_13_543 167
606 3300049742 Ga0501080_0052791 Ga0501080_0052791_3214_3729 167
607 3300049742 Ga0501080_0460567 Ga0501080_0460567_135_665 167
608 3300049744 Ga0501083_0044352 Ga0501083_0044352_725_1240 167
609 3300049775 Ga0501279_022600 Ga0501279_022600_262_792 167
610 3300049822 Ga0501035_0153636 Ga0501035_0153636_245_775 167
611 3300049824 Ga0501045_0165790 Ga0501045_0165790_762_1277 167
612 3300049853 Ga0501226_031499 Ga0501226_031499_40_570 167
613 3300050507 nmdc:mga05p37_231260_c1 nmdc:mga05p37_231260_c1_1287_1802 167
614 3300050507 nmdc:mga05p37_281992_c1 nmdc:mga05p37_281992_c1_149_667 167
615 3300050508 nmdc:mga09592_45343_c1 nmdc:mga09592_45343_c1_3038_3553 167
616 3300050508 nmdc:mga09592_49621_c1 nmdc:mga09592_49621_c1_536_1054 167
617 3300050508 nmdc:mga09592_682730_c1 nmdc:mga09592_682730_c1_45_575 167
618 3300050509 nmdc:mga0qj67_157636_c1 nmdc:mga0qj67_157636_c1_380_895 167
619 3300050510 nmdc:mga06r32_32850_c2 nmdc:mga06r32_32850_c2_308_823 167
620 3300050511 nmdc:mga08y16_202537_c1 nmdc:mga08y16_202537_c1_782_1312 167
621 3300053096 Ga0500641_0025200 Ga0500641_0025200_298_828 167
622 3300059492 Ga0587073_0060123 Ga0587073_0060123_189_719 167
623 3300059493 Ga0587077_002325 Ga0587077_002325_1278_1808 167
624 3300059510 Ga0587090_033183 Ga0587090_033183_249_779 167
625 3300059630 Ga0587128_072393 Ga0587128_072393_96_626 167
626 3300001989 JGI24739J22299_10000798 JGI24739J22299_1000079815 168
627 3300001989 JGI24739J22299_10003052 JGI24739J22299_100030524 168
628 3300002738 JGI25154J39366_1000001 JGI25154J39366_1000001382 168
629 3300002741 JGI25157J39369_1003512 JGI25157J39369_10035123 168
630 3300003215 JGI25153J46596_10001870 JGI25153J46596_100018704 168
631 3300003215 JGI25153J46596_10005056 JGI25153J46596_100050561 168
632 3300003323 rootH1_10032943 rootH1_100329434 168
633 3300003354 JGI25160J50197_1008979 JGI25160J50197_10089794 168
634 3300003354 JGI25160J50197_1018530 JGI25160J50197_10185303 168
635 3300003771 Ga0055526_1016300 Ga0055526_10163001 168
636 3300003790 Ga0055528_1009578 Ga0055528_10095783 168
637 3300003794 Ga0055531_10020429 Ga0055531_100204291 168
638 3300004625 Ga0055543_1038139 Ga0055543_10381391 168
639 3300005262 Ga0065165_1000112 Ga0065165_10001129 168
640 3300005289 Ga0065704_10414176 Ga0065704_104141761 168
641 3300005290 Ga0065712_10004615 Ga0065712_100046158 168
642 3300005290 Ga0065712_10401979 Ga0065712_104019791 168
643 3300005290 Ga0065712_10561093 Ga0065712_105610931 168
644 3300005293 Ga0065715_10130180 Ga0065715_101301802 168
645 3300005293 Ga0065715_10164987 Ga0065715_101649873 168
646 3300005328 Ga0070676_10235057 Ga0070676_102350572 168
647 3300005328 Ga0070676_10343053 Ga0070676_103430532 168
648 3300005329 Ga0070683_100000417 Ga0070683_1000004173 168
649 3300005329 Ga0070683_100018251 Ga0070683_1000182513 168
650 3300005330 Ga0070690_100028796 Ga0070690_1000287963 168
651 3300005330 Ga0070690_100095882 Ga0070690_1000958823 168
652 3300005330 Ga0070690_100607660 Ga0070690_1006076602 168
653 3300005331 Ga0070670_100121376 Ga0070670_1001213762 168
654 3300005331 Ga0070670_100256225 Ga0070670_1002562252 168
655 3300005331 Ga0070670_100489652 Ga0070670_1004896522 168
656 3300005333 Ga0070677_10105973 Ga0070677_101059731 168
657 3300005333 Ga0070677_10122797 Ga0070677_101227972 168
658 3300005334 Ga0068869_100028140 Ga0068869_1000281405 168
659 3300005334 Ga0068869_100060658 Ga0068869_1000606584 168
660 3300005334 Ga0068869_100419337 Ga0068869_1004193372 168
661 3300005334 Ga0068869_100754069 Ga0068869_1007540691 168
662 3300005335 Ga0070666_10038579 Ga0070666_100385792 168
663 3300005335 Ga0070666_10140866 Ga0070666_101408662 168
664 3300005337 Ga0070682_100000101 Ga0070682_10000010180 168
665 3300005337 Ga0070682_100172793 Ga0070682_1001727932 168
666 3300005338 Ga0068868_100001935 Ga0068868_1000019357 168
667 3300005338 Ga0068868_100041901 Ga0068868_1000419015 168
668 3300005338 Ga0068868_100146447 Ga0068868_1001464472 168
669 3300005338 Ga0068868_100250304 Ga0068868_1002503041 168
670 3300005338 Ga0068868_100391798 Ga0068868_1003917982 168
671 3300005339 Ga0070660_100097120 Ga0070660_1000971203 168
672 3300005340 Ga0070689_100067689 Ga0070689_1000676893 168
673 3300005341 Ga0070691_10187150 Ga0070691_101871501 168
674 3300005343 Ga0070687_100219001 Ga0070687_1002190012 168
675 3300005344 Ga0070661_100000686 Ga0070661_1000006863 168
676 3300005344 Ga0070661_100033517 Ga0070661_1000335174 168
677 3300005353 Ga0070669_100172763 Ga0070669_1001727633 168
678 3300005353 Ga0070669_100470126 Ga0070669_1004701262 168
679 3300005353 Ga0070669_100641183 Ga0070669_1006411831 168
680 3300005354 Ga0070675_100038447 Ga0070675_1000384474 168
681 3300005354 Ga0070675_100053739 Ga0070675_1000537393 168
682 3300005354 Ga0070675_100106195 Ga0070675_1001061951 168
683 3300005354 Ga0070675_100130430 Ga0070675_1001304304 168
684 3300005355 Ga0070671_100381457 Ga0070671_1003814571 168
685 3300005355 Ga0070671_100424095 Ga0070671_1004240952 168
686 3300005355 Ga0070671_101201239 Ga0070671_1012012391 168
687 3300005355 Ga0070671_101267937 Ga0070671_1012679371 168
688 3300005364 Ga0070673_100041325 Ga0070673_1000413252 168
689 3300005364 Ga0070673_100048741 Ga0070673_1000487413 168
690 3300005365 Ga0070688_100110409 Ga0070688_1001104093 168
691 3300005365 Ga0070688_100113200 Ga0070688_1001132003 168
692 3300005365 Ga0070688_100319010 Ga0070688_1003190102 168
693 3300005366 Ga0070659_100004989 Ga0070659_1000049894 168
694 3300005367 Ga0070667_100115377 Ga0070667_1001153773 168
695 3300005367 Ga0070667_100263519 Ga0070667_1002635192 168
696 3300005367 Ga0070667_101015626 Ga0070667_1010156261 168
697 3300005440 Ga0070705_100204328 Ga0070705_1002043282 168
698 3300005440 Ga0070705_100308405 Ga0070705_1003084052 168
699 3300005455 Ga0070663_100205300 Ga0070663_1002053002 168
700 3300005456 Ga0070678_100007545 Ga0070678_1000075456 168
701 3300005457 Ga0070662_100044153 Ga0070662_1000441533 168
702 3300005457 Ga0070662_100150293 Ga0070662_1001502932 168
703 3300005457 Ga0070662_100163457 Ga0070662_1001634573 168
704 3300005458 Ga0070681_10218197 Ga0070681_102181972 168
705 3300005466 Ga0070685_10014019 Ga0070685_100140194 168
706 3300005535 Ga0070684_100000433 Ga0070684_10000043328 168
707 3300005535 Ga0070684_100053633 Ga0070684_1000536333 168
708 3300005539 Ga0068853_100034146 Ga0068853_1000341463 168
709 3300005539 Ga0068853_100308797 Ga0068853_1003087972 168
710 3300005539 Ga0068853_100652233 Ga0068853_1006522332 168
711 3300005539 Ga0068853_101444809 Ga0068853_1014448091 168
712 3300005543 Ga0070672_100130450 Ga0070672_1001304504 168
713 3300005543 Ga0070672_100603758 Ga0070672_1006037582 168
714 3300005544 Ga0070686_100059005 Ga0070686_1000590053 168
715 3300005544 Ga0070686_100084279 Ga0070686_1000842793 168
716 3300005544 Ga0070686_100458147 Ga0070686_1004581472 168
717 3300005548 Ga0070665_100000001 Ga0070665_100000001285 168
718 3300005548 Ga0070665_100111581 Ga0070665_1001115813 168
719 3300005548 Ga0070665_100226309 Ga0070665_1002263092 168
720 3300005563 Ga0068855_100088304 Ga0068855_1000883047 168
721 3300005563 Ga0068855_100194649 Ga0068855_1001946491 168
722 3300005563 Ga0068855_101082927 Ga0068855_1010829271 168
723 3300005564 Ga0070664_100004734 Ga0070664_1000047343 168
724 3300005564 Ga0070664_100060954 Ga0070664_1000609543 168
725 3300005564 Ga0070664_100707668 Ga0070664_1007076682 168
726 3300005577 Ga0068857_100019362 Ga0068857_1000193624 168
727 3300005577 Ga0068857_100027233 Ga0068857_1000272333 168
728 3300005577 Ga0068857_100030836 Ga0068857_1000308363 168
729 3300005578 Ga0068854_100035001 Ga0068854_1000350017 168
730 3300005578 Ga0068854_100117058 Ga0068854_1001170583 168
731 3300005614 Ga0068856_101207603 Ga0068856_1012076032 168
732 3300005616 Ga0068852_100025320 Ga0068852_1000253201 168
733 3300005616 Ga0068852_100099003 Ga0068852_1000990032 168
734 3300005616 Ga0068852_100136365 Ga0068852_1001363653 168
735 3300005617 Ga0068859_100012809 Ga0068859_1000128092 168
736 3300005617 Ga0068859_100018668 Ga0068859_1000186683 168
737 3300005617 Ga0068859_100018814 Ga0068859_1000188145 168
738 3300005617 Ga0068859_100022225 Ga0068859_1000222255 168
739 3300005617 Ga0068859_100156505 Ga0068859_1001565053 168
740 3300005617 Ga0068859_100496143 Ga0068859_1004961432 168
741 3300005617 Ga0068859_101089472 Ga0068859_1010894722 168
742 3300005618 Ga0068864_100006928 Ga0068864_1000069283 168
743 3300005618 Ga0068864_100013283 Ga0068864_1000132833 168
744 3300005618 Ga0068864_100806914 Ga0068864_1008069142 168
745 3300005718 Ga0068866_10065942 Ga0068866_100659423 168
746 3300005719 Ga0068861_100049974 Ga0068861_1000499743 168
747 3300005840 Ga0068870_10338430 Ga0068870_103384301 168
748 3300005841 Ga0068863_100038413 Ga0068863_1000384133 168
749 3300005841 Ga0068863_100194332 Ga0068863_1001943322 168
750 3300005841 Ga0068863_100344864 Ga0068863_1003448642 168
751 3300005842 Ga0068858_100226880 Ga0068858_1002268803 168
752 3300005842 Ga0068858_100673468 Ga0068858_1006734681 168
753 3300005842 Ga0068858_100790306 Ga0068858_1007903062 168
754 3300005843 Ga0068860_100000241 Ga0068860_10000024136 168
755 3300005843 Ga0068860_100013270 Ga0068860_1000132701 168
756 3300005843 Ga0068860_100016199 Ga0068860_10001619913 168
757 3300005843 Ga0068860_100152641 Ga0068860_1001526412 168
758 3300005843 Ga0068860_101584588 Ga0068860_1015845881 168
759 3300005844 Ga0068862_100444919 Ga0068862_1004449192 168
760 3300005844 Ga0068862_100491805 Ga0068862_1004918052 168
761 3300006058 Ga0075432_10155346 Ga0075432_101553462 168
762 3300006163 Ga0070715_10184222 Ga0070715_101842222 168
763 3300006195 Ga0075366_10012601 Ga0075366_100126014 168
764 3300006237 Ga0097621_100060738 Ga0097621_1000607384 168
765 3300006237 Ga0097621_100230321 Ga0097621_1002303211 168
766 3300006353 Ga0075370_10348022 Ga0075370_103480221 168
767 3300006844 Ga0075428_100374101 Ga0075428_1003741013 168
768 3300006881 Ga0068865_100095346 Ga0068865_1000953463 168
769 3300006931 Ga0097620_100012809 Ga0097620_1000128095 168
770 3300006931 Ga0097620_100018668 Ga0097620_1000186683 168
771 3300006931 Ga0097620_100018813 Ga0097620_1000188135 168
772 3300006931 Ga0097620_100022228 Ga0097620_1000222283 168
773 3300006931 Ga0097620_100156508 Ga0097620_1001565083 168
774 3300006931 Ga0097620_100496185 Ga0097620_1004961852 168
775 3300006931 Ga0097620_101089524 Ga0097620_1010895242 168
776 3300009093 Ga0105240_10262532 Ga0105240_102625322 168
777 3300009093 Ga0105240_10352502 Ga0105240_103525023 168
778 3300009094 Ga0111539_10235363 Ga0111539_102353633 168
779 3300009094 Ga0111539_12082726 Ga0111539_120827261 168
780 3300009101 Ga0105247_10001018 Ga0105247_1000101815 168
781 3300009101 Ga0105247_10360463 Ga0105247_103604632 168
782 3300009174 Ga0105241_10128074 Ga0105241_101280741 168
783 3300009176 Ga0105242_10153451 Ga0105242_101534513 168
784 3300009176 Ga0105242_10340756 Ga0105242_103407562 168
785 3300009176 Ga0105242_10363839 Ga0105242_103638392 168
786 3300009545 Ga0105237_11773460 Ga0105237_117734601 168
787 3300009551 Ga0105238_10551558 Ga0105238_105515582 168
788 3300009553 Ga0105249_10073101 Ga0105249_100731011 168
789 3300009553 Ga0105249_10233662 Ga0105249_102336623 168
790 3300009553 Ga0105249_10304678 Ga0105249_103046781 168
791 3300010375 Ga0105239_10165836 Ga0105239_101658362 168
792 3300010375 Ga0105239_10836402 Ga0105239_108364022 168
793 3300013100 Ga0157373_10108073 Ga0157373_101080733 168
794 3300013104 Ga0157370_10000702 Ga0157370_1000070213 168
795 3300013104 Ga0157370_11031861 Ga0157370_110318612 168
796 3300013105 Ga0157369_10431956 Ga0157369_104319562 168
797 3300013296 Ga0157374_10006039 Ga0157374_100060393 168
798 3300013296 Ga0157374_10010548 Ga0157374_100105489 168
799 3300013296 Ga0157374_10191681 Ga0157374_101916812 168
800 3300013297 Ga0157378_10079954 Ga0157378_100799544 168
801 3300013297 Ga0157378_10239975 Ga0157378_102399752 168
802 3300013297 Ga0157378_10306130 Ga0157378_103061301 168
803 3300013297 Ga0157378_10564528 Ga0157378_105645282 168
804 3300013306 Ga0163162_10000216 Ga0163162_1000021655 168
805 3300013306 Ga0163162_10014241 Ga0163162_100142414 168
806 3300013306 Ga0163162_10016379 Ga0163162_100163798 168
807 3300013306 Ga0163162_10025721 Ga0163162_100257213 168
808 3300013306 Ga0163162_10030765 Ga0163162_100307651 168
809 3300013306 Ga0163162_10179822 Ga0163162_101798224 168
810 3300013306 Ga0163162_10193340 Ga0163162_101933403 168
811 3300013306 Ga0163162_10275675 Ga0163162_102756753 168
812 3300013307 Ga0157372_10008498 Ga0157372_100084983 168
813 3300013307 Ga0157372_10129397 Ga0157372_101293972 168
814 3300013307 Ga0157372_11533599 Ga0157372_115335991 168
815 3300013308 Ga0157375_10024709 Ga0157375_100247095 168
816 3300013308 Ga0157375_10041079 Ga0157375_100410792 168
817 3300013308 Ga0157375_10163864 Ga0157375_101638643 168
818 3300013308 Ga0157375_10461375 Ga0157375_104613752 168
819 3300013308 Ga0157375_10780719 Ga0157375_107807192 168
820 3300014325 Ga0163163_10000198 Ga0163163_1000019864 168
821 3300014325 Ga0163163_10166550 Ga0163163_101665502 168
822 3300014325 Ga0163163_10345148 Ga0163163_103451483 168
823 3300014326 Ga0157380_10158134 Ga0157380_101581342 168
824 3300014326 Ga0157380_10410428 Ga0157380_104104282 168
825 3300014745 Ga0157377_10005505 Ga0157377_100055057 168
826 3300014745 Ga0157377_10024497 Ga0157377_100244973 168
827 3300014745 Ga0157377_10152721 Ga0157377_101527212 168
828 3300014968 Ga0157379_10100975 Ga0157379_101009753 168
829 3300014968 Ga0157379_10121430 Ga0157379_101214302 168
830 3300014968 Ga0157379_10740742 Ga0157379_107407422 168
831 3300014969 Ga0157376_10118858 Ga0157376_101188582 168
832 3300014969 Ga0157376_10268264 Ga0157376_102682642 168
833 3300014969 Ga0157376_10485072 Ga0157376_104850722 168
834 3300014969 Ga0157376_11055359 Ga0157376_110553592 168
835 3300017792 Ga0163161_10106832 Ga0163161_101068323 168
836 3300017792 Ga0163161_10129337 Ga0163161_101293371 168
837 3300025246 Ga0209646_1000002 Ga0209646_1000002379 168
838 3300025250 Ga0209026_1000636 Ga0209026_10006363 168
839 3300025258 Ga0209129_1006296 Ga0209129_10062963 168
840 3300025273 Ga0209673_1000096 Ga0209673_1000096104 168
841 3300025295 Ga0209564_1004313 Ga0209564_10043135 168
842 3300025297 Ga0209758_1006557 Ga0209758_10065574 168
843 3300025298 Ga0209050_1000207 Ga0209050_1000207106 168
844 3300025302 Ga0207426_1000571 Ga0207426_10005714 168
845 3300025302 Ga0207426_1001515 Ga0207426_10015154 168
846 3300025303 Ga0209051_1036433 Ga0209051_10364333 168
847 3300025304 Ga0209257_1002636 Ga0209257_10026363 168
848 3300025315 Ga0207697_10111384 Ga0207697_101113842 168
849 3300025893 Ga0207682_10003590 Ga0207682_100035907 168
850 3300025899 Ga0207642_10147140 Ga0207642_101471402 168
851 3300025900 Ga0207710_10000660 Ga0207710_1000066015 168
852 3300025903 Ga0207680_10177361 Ga0207680_101773611 168
853 3300025904 Ga0207647_10043529 Ga0207647_100435293 168
854 3300025905 Ga0207685_10089665 Ga0207685_100896652 168
855 3300025907 Ga0207645_10032558 Ga0207645_100325582 168
856 3300025907 Ga0207645_10455260 Ga0207645_104552602 168
857 3300025908 Ga0207643_10051826 Ga0207643_100518264 168
858 3300025911 Ga0207654_10420566 Ga0207654_104205661 168
859 3300025913 Ga0207695_10039381 Ga0207695_100393812 168
860 3300025913 Ga0207695_10234773 Ga0207695_102347732 168
861 3300025913 Ga0207695_10776616 Ga0207695_107766162 168
862 3300025918 Ga0207662_10026414 Ga0207662_100264142 168
863 3300025919 Ga0207657_10623355 Ga0207657_106233551 168
864 3300025920 Ga0207649_10020991 Ga0207649_100209913 168
865 3300025920 Ga0207649_10037078 Ga0207649_100370782 168
866 3300025920 Ga0207649_10367567 Ga0207649_103675671 168
867 3300025923 Ga0207681_10115209 Ga0207681_101152092 168
868 3300025923 Ga0207681_10247944 Ga0207681_102479441 168
869 3300025923 Ga0207681_10344589 Ga0207681_103445892 168
870 3300025924 Ga0207694_10121635 Ga0207694_101216352 168
871 3300025925 Ga0207650_10076949 Ga0207650_100769493 168
872 3300025925 Ga0207650_10132694 Ga0207650_101326942 168
873 3300025925 Ga0207650_10199954 Ga0207650_101999542 168
874 3300025925 Ga0207650_10448912 Ga0207650_104489121 168
875 3300025925 Ga0207650_10599240 Ga0207650_105992402 168
876 3300025926 Ga0207659_10012333 Ga0207659_100123332 168
877 3300025926 Ga0207659_10033426 Ga0207659_100334263 168
878 3300025926 Ga0207659_10042754 Ga0207659_100427544 168
879 3300025926 Ga0207659_10103650 Ga0207659_101036504 168
880 3300025926 Ga0207659_11329623 Ga0207659_113296231 168
881 3300025931 Ga0207644_10087334 Ga0207644_100873341 168
882 3300025931 Ga0207644_10698764 Ga0207644_106987642 168
883 3300025931 Ga0207644_10700500 Ga0207644_107005001 168
884 3300025932 Ga0207690_10060439 Ga0207690_100604393 168
885 3300025932 Ga0207690_10195529 Ga0207690_101955293 168
886 3300025933 Ga0207706_10014975 Ga0207706_100149755 168
887 3300025933 Ga0207706_10023834 Ga0207706_100238343 168
888 3300025933 Ga0207706_10069820 Ga0207706_100698203 168
889 3300025933 Ga0207706_10363858 Ga0207706_103638583 168
890 3300025934 Ga0207686_10013527 Ga0207686_100135274 168
891 3300025934 Ga0207686_10058746 Ga0207686_100587463 168
892 3300025934 Ga0207686_10339804 Ga0207686_103398042 168
893 3300025936 Ga0207670_10011420 Ga0207670_100114203 168
894 3300025936 Ga0207670_10066017 Ga0207670_100660171 168
895 3300025936 Ga0207670_10436479 Ga0207670_104364791 168
896 3300025936 Ga0207670_10570414 Ga0207670_105704141 168
897 3300025938 Ga0207704_10331775 Ga0207704_103317752 168
898 3300025938 Ga0207704_10594348 Ga0207704_105943481 168
899 3300025938 Ga0207704_10659050 Ga0207704_106590501 168
900 3300025940 Ga0207691_10040071 Ga0207691_100400714 168
901 3300025940 Ga0207691_10108177 Ga0207691_101081773 168
902 3300025941 Ga0207711_10131935 Ga0207711_101319352 168
903 3300025942 Ga0207689_10010264 Ga0207689_100102647 168
904 3300025942 Ga0207689_10026316 Ga0207689_100263163 168
905 3300025942 Ga0207689_10100304 Ga0207689_101003043 168
906 3300025942 Ga0207689_10378777 Ga0207689_103787772 168
907 3300025942 Ga0207689_10432450 Ga0207689_104324502 168
908 3300025942 Ga0207689_10477186 Ga0207689_104771861 168
909 3300025944 Ga0207661_10013720 Ga0207661_100137203 168
910 3300025944 Ga0207661_10091142 Ga0207661_100911422 168
911 3300025945 Ga0207679_10034020 Ga0207679_100340203 168
912 3300025945 Ga0207679_10042990 Ga0207679_100429903 168
913 3300025945 Ga0207679_10933429 Ga0207679_109334292 168
914 3300025949 Ga0207667_10001859 Ga0207667_100018593 168
915 3300025960 Ga0207651_10056442 Ga0207651_100564424 168
916 3300025960 Ga0207651_10098903 Ga0207651_100989032 168
917 3300025960 Ga0207651_10211469 Ga0207651_102114693 168
918 3300025960 Ga0207651_10246036 Ga0207651_102460362 168
919 3300025961 Ga0207712_10058784 Ga0207712_100587843 168
920 3300025961 Ga0207712_10086477 Ga0207712_100864773 168
921 3300025961 Ga0207712_10148782 Ga0207712_101487821 168
922 3300025981 Ga0207640_10147802 Ga0207640_101478022 168
923 3300025981 Ga0207640_10249993 Ga0207640_102499932 168
924 3300025986 Ga0207658_10027901 Ga0207658_100279014 168
925 3300025986 Ga0207658_10261211 Ga0207658_102612112 168
926 3300025986 Ga0207658_10282066 Ga0207658_102820662 168
927 3300026023 Ga0207677_10007331 Ga0207677_100073315 168
928 3300026023 Ga0207677_10020140 Ga0207677_100201404 168
929 3300026023 Ga0207677_10146203 Ga0207677_101462032 168
930 3300026023 Ga0207677_10301311 Ga0207677_103013112 168
931 3300026035 Ga0207703_10075755 Ga0207703_100757552 168
932 3300026035 Ga0207703_10089339 Ga0207703_100893392 168
933 3300026035 Ga0207703_10467784 Ga0207703_104677842 168
934 3300026035 Ga0207703_10834260 Ga0207703_108342601 168
935 3300026041 Ga0207639_10095370 Ga0207639_100953703 168
936 3300026041 Ga0207639_10180942 Ga0207639_101809422 168
937 3300026041 Ga0207639_11685054 Ga0207639_116850541 168
938 3300026067 Ga0207678_10092984 Ga0207678_100929843 168
939 3300026088 Ga0207641_10218501 Ga0207641_102185011 168
940 3300026088 Ga0207641_10844298 Ga0207641_108442982 168
941 3300026089 Ga0207648_10026128 Ga0207648_100261283 168
942 3300026089 Ga0207648_10047900 Ga0207648_100479001 168
943 3300026089 Ga0207648_10473225 Ga0207648_104732251 168
944 3300026095 Ga0207676_10018209 Ga0207676_100182092 168
945 3300026095 Ga0207676_10502293 Ga0207676_105022932 168
946 3300026095 Ga0207676_11575664 Ga0207676_115756641 168
947 3300026116 Ga0207674_10057753 Ga0207674_100577532 168
948 3300026116 Ga0207674_10060076 Ga0207674_100600766 168
949 3300026116 Ga0207674_10064716 Ga0207674_100647163 168
950 3300026116 Ga0207674_10072102 Ga0207674_100721023 168
951 3300026118 Ga0207675_100082295 Ga0207675_1000822954 168
952 3300026118 Ga0207675_100898518 Ga0207675_1008985182 168
953 3300026121 Ga0207683_10013775 Ga0207683_100137755 168
954 3300026142 Ga0207698_10027714 Ga0207698_100277143 168
955 3300026142 Ga0207698_10122727 Ga0207698_101227272 168
956 3300028379 Ga0268266_10000102 Ga0268266_1000010281 168
957 3300028379 Ga0268266_10034094 Ga0268266_100340943 168
958 3300028379 Ga0268266_10342648 Ga0268266_103426482 168
959 3300028380 Ga0268265_10204126 Ga0268265_102041263 168
960 3300028381 Ga0268264_10000011 Ga0268264_10000011396 168
961 3300028381 Ga0268264_10003097 Ga0268264_1000309720 168
962 3300028381 Ga0268264_10011453 Ga0268264_100114539 168
963 3300028786 Ga0307517_10116843 Ga0307517_101168433 168
964 3300028794 Ga0307515_10000010 Ga0307515_100000109 168
965 3300031595 Ga0265313_10065844 Ga0265313_100658443 168
966 3300035086 Ga0373934_0012385 Ga0373934_0012385_530_1063 168
967 3300035089 Ga0373944_0084007 Ga0373944_0084007_332_865 168
968 3300035113 Ga0373936_0081449 Ga0373936_0081449_67_600 168
969 3300035119 Ga0373956_0086936 Ga0373956_0086936_663_1196 168
970 3300035120 Ga0373957_0044854 Ga0373957_0044854_434_967 168
971 3300035171 Ga0373946_0098014 Ga0373946_0098014_629_1162 168
972 3300035695 Ga0373927_0314130 Ga0373927_0314130_126_659 168
973 3300035724 Ga0373933_0045334 Ga0373933_0045334_1543_2076 168
974 3300035725 Ga0373947_0159532 Ga0373947_0159532_347_880 168
975 3300036401 Ga0373937_0061306 Ga0373937_0061306_2308_2841 168
976 3300042005 Ga0439448_0039246 Ga0439448_0039246_537_1052 168
977 3300044656 Ga0466969_0130720 Ga0466969_0130720_233_766 168
978 3300044658 Ga0466972_0113644 Ga0466972_0113644_439_954 168
979 3300044683 Ga0466965_0027073 Ga0466965_0027073_1210_1725 168
980 3300044684 Ga0466966_0090599 Ga0466966_0090599_1334_1867 168
981 3300044719 Ga0466971_0064131 Ga0466971_0064131_818_1351 168
982 3300044765 Ga0466970_0000280 Ga0466970_0000280_8917_9435 168
983 3300044765 Ga0466970_0041827 Ga0466970_0041827_1350_1883 168
984 3300045049 Ga0466959_0056262 Ga0466959_0056262_855_1388 168
985 3300046460 Ga0495638_0189260 Ga0495638_0189260_196_729 168
986 3300046472 Ga0495580_0465691 Ga0495580_0465691_203_736 168
987 3300046477 Ga0495664_0296697 Ga0495664_0296697_297_830 168
988 3300046499 Ga0495594_0075506 Ga0495594_0075506_703_1224 168
989 3300046514 Ga0495618_0299897 Ga0495618_0299897_65_598 168
990 3300046516 Ga0495628_0064246 Ga0495628_0064246_2322_2855 168
991 3300046517 Ga0495630_0131704 Ga0495630_0131704_805_1338 168
992 3300046524 Ga0495648_0002633 Ga0495648_0002633_10549_11082 168
993 3300046535 Ga0495586_0059232 Ga0495586_0059232_662_1195 168
994 3300046536 Ga0495587_0118440 Ga0495587_0118440_933_1466 168
995 3300046675 Ga0495657_0332921 Ga0495657_0332921_49_582 168
996 3300046678 Ga0495599_0117581 Ga0495599_0117581_379_912 168
997 3300046683 Ga0495658_0658293 Ga0495658_0658293_80_613 168
998 3300046809 Ga0495600_0108701 Ga0495600_0108701_819_1352 168
999 3300047319 Ga0495674_0626302 Ga0495674_0626302_239_772 168
1000 3300047443 Ga0495687_000001 Ga0495687_000001_907336_907869 168
1001 3300047471 Ga0495684_0073050 Ga0495684_0073050_15_548 168
1002 3300048904 Ga0496101_0174307 Ga0496101_0174307_751_1284 168
1003 3300048913 Ga0496110_0034483 Ga0496110_0034483_1269_1802 168
1004 3300049162 Ga0501307_008465 Ga0501307_008465_286_801 168
1005 3300049528 Ga0501312_012573 Ga0501312_012573_568_1095 168
1006 3300049530 Ga0501314_004211 Ga0501314_004211_177_692 168
1007 3300049531 Ga0501315_010570 Ga0501315_010570_406_930 168
1008 3300049536 Ga0501320_003434 Ga0501320_003434_162_686 168
1009 3300049538 Ga0501322_010240 Ga0501322_010240_37_570 168
1010 3300049541 Ga0501325_005609 Ga0501325_005609_99_623 168
1011 3300049551 Ga0501335_007004 Ga0501335_007004_336_860 168
1012 3300049552 Ga0501336_003599 Ga0501336_003599_429_953 168
1013 3300049568 Ga0501031_0038037 Ga0501031_0038037_1586_2110 168
1014 3300049571 Ga0501034_0075740 Ga0501034_0075740_985_1509 168
1015 3300049579 Ga0501043_0012420 Ga0501043_0012420_5629_6153 168
1016 3300049673 Ga0501240_042527 Ga0501240_042527_154_678 168
1017 3300049769 Ga0501272_004633 Ga0501272_004633_78_602 168
1018 3300049822 Ga0501035_0025721 Ga0501035_0025721_4129_4653 168
1019 3300049823 Ga0501044_0050286 Ga0501044_0050286_819_1346 168
1020 3300049823 Ga0501044_0512738 Ga0501044_0512738_307_834 168
1021 3300050493 nmdc:mga0k408_446153_c1 nmdc:mga0k408_446153_c1_67_600 168
1022 3300050493 nmdc:mga0k408_47999_c1 nmdc:mga0k408_47999_c1_1607_2122 168
1023 3300050496 nmdc:mga07m45_34215_c1 nmdc:mga07m45_34215_c1_40_555 168
1024 3300050511 nmdc:mga08y16_1217278_c1 nmdc:mga08y16_1217278_c1_136_657 168
1025 3300050511 nmdc:mga08y16_824739_c1 nmdc:mga08y16_824739_c1_241_762 168
1026 3300053085 Ga0495619_0041370 Ga0495619_0041370_1326_1859 168
1027 3300053090 Ga0500646_0012093 Ga0500646_0012093_1431_1964 168
1028 3300053092 Ga0500583_0005990 Ga0500583_0005990_3227_3760 168
1029 3300053131 Ga0500652_015822 Ga0500652_015822_1762_2286 168
1030 3300053139 Ga0500568_0016248 Ga0500568_0016248_2628_3161 168
1031 3300053156 Ga0500622_0000782 Ga0500622_0000782_2029_2562 168
1032 3300061719 Ga0466962_0029755 Ga0466962_0029755_1487_2020 168
1033 2162886007 SwRhRL2b_contig_1663050 SwRhRL2b_0644.00008760 169
1034 3300005289 Ga0065704_10070140 Ga0065704_1007014055 169
1035 3300005329 Ga0070683_100010447 Ga0070683_1000104472 169
1036 3300005331 Ga0070670_100106412 Ga0070670_1001064123 169
1037 3300005334 Ga0068869_101482645 Ga0068869_1014826451 169
1038 3300005335 Ga0070666_10040888 Ga0070666_100408885 169
1039 3300005336 Ga0070680_100000212 Ga0070680_10000021217 169
1040 3300005337 Ga0070682_100000651 Ga0070682_10000065113 169
1041 3300005339 Ga0070660_100396663 Ga0070660_1003966632 169
1042 3300005341 Ga0070691_10005105 Ga0070691_100051058 169
1043 3300005341 Ga0070691_10038700 Ga0070691_100387002 169
1044 3300005355 Ga0070671_100037941 Ga0070671_1000379412 169
1045 3300005364 Ga0070673_100876534 Ga0070673_1008765342 169
1046 3300005366 Ga0070659_100006423 Ga0070659_1000064231 169
1047 3300005455 Ga0070663_100264164 Ga0070663_1002641642 169
1048 3300005456 Ga0070678_100076673 Ga0070678_1000766733 169
1049 3300005458 Ga0070681_10001590 Ga0070681_1000159014 169
1050 3300005530 Ga0070679_100000449 Ga0070679_10000044918 169
1051 3300005535 Ga0070684_100088767 Ga0070684_1000887674 169
1052 3300005539 Ga0068853_100125496 Ga0068853_1001254963 169
1053 3300005539 Ga0068853_100135069 Ga0068853_1001350693 169
1054 3300005539 Ga0068853_100249320 Ga0068853_1002493202 169
1055 3300005543 Ga0070672_100295707 Ga0070672_1002957072 169
1056 3300005547 Ga0070693_100019024 Ga0070693_1000190242 169
1057 3300005563 Ga0068855_100001939 Ga0068855_10000193928 169
1058 3300005563 Ga0068855_100285669 Ga0068855_1002856692 169
1059 3300005564 Ga0070664_100043986 Ga0070664_1000439863 169
1060 3300005564 Ga0070664_100246857 Ga0070664_1002468571 169
1061 3300005564 Ga0070664_101146843 Ga0070664_1011468431 169
1062 3300005577 Ga0068857_101512742 Ga0068857_1015127421 169
1063 3300005614 Ga0068856_100137028 Ga0068856_1001370283 169
1064 3300005614 Ga0068856_100788325 Ga0068856_1007883252 169
1065 3300005616 Ga0068852_100186021 Ga0068852_1001860213 169
1066 3300005618 Ga0068864_100823598 Ga0068864_1008235982 169
1067 3300005841 Ga0068863_100258872 Ga0068863_1002588722 169
1068 3300005983 Ga0081540_1022869 Ga0081540_10228696 169
1069 3300006237 Ga0097621_100000488 Ga0097621_10000048814 169
1070 3300006237 Ga0097621_101085349 Ga0097621_1010853492 169
1071 3300006881 Ga0068865_100079282 Ga0068865_1000792823 169
1072 3300009093 Ga0105240_10000078 Ga0105240_10000078138 169
1073 3300009093 Ga0105240_10006513 Ga0105240_1000651320 169
1074 3300009093 Ga0105240_10014605 Ga0105240_1001460511 169
1075 3300009093 Ga0105240_10038251 Ga0105240_100382514 169
1076 3300009101 Ga0105247_10274601 Ga0105247_102746012 169
1077 3300009174 Ga0105241_10000105 Ga0105241_100001053 169
1078 3300009174 Ga0105241_10000409 Ga0105241_100004094 169
1079 3300009176 Ga0105242_10015763 Ga0105242_100157639 169
1080 3300009177 Ga0105248_10017734 Ga0105248_100177344 169
1081 3300009177 Ga0105248_11814899 Ga0105248_118148991 169
1082 3300009545 Ga0105237_10004076 Ga0105237_100040765 169
1083 3300009545 Ga0105237_10076060 Ga0105237_100760604 169
1084 3300009551 Ga0105238_10095813 Ga0105238_100958132 169
1085 3300010375 Ga0105239_10092220 Ga0105239_100922203 169
1086 3300010375 Ga0105239_11196954 Ga0105239_111969541 169
1087 3300011119 Ga0105246_10665523 Ga0105246_106655232 169
1088 3300013100 Ga0157373_10160933 Ga0157373_101609333 169
1089 3300013100 Ga0157373_10483951 Ga0157373_104839511 169
1090 3300013102 Ga0157371_10092139 Ga0157371_100921392 169
1091 3300013102 Ga0157371_10686210 Ga0157371_106862101 169
1092 3300013104 Ga0157370_10003524 Ga0157370_100035243 169
1093 3300013104 Ga0157370_10583025 Ga0157370_105830252 169
1094 3300013105 Ga0157369_10030867 Ga0157369_100308673 169
1095 3300013105 Ga0157369_10111735 Ga0157369_101117353 169
1096 3300013105 Ga0157369_10209164 Ga0157369_102091644 169
1097 3300013105 Ga0157369_10424662 Ga0157369_104246622 169
1098 3300013105 Ga0157369_10760484 Ga0157369_107604842 169
1099 3300013296 Ga0157374_11222886 Ga0157374_112228861 169
1100 3300013297 Ga0157378_10004966 Ga0157378_100049663 169
1101 3300013306 Ga0163162_10015824 Ga0163162_100158249 169
1102 3300013306 Ga0163162_10151654 Ga0163162_101516542 169
1103 3300013306 Ga0163162_10356500 Ga0163162_103565003 169
1104 3300013306 Ga0163162_11059365 Ga0163162_110593652 169
1105 3300013307 Ga0157372_10008033 Ga0157372_100080333 169
1106 3300013307 Ga0157372_10020735 Ga0157372_100207351 169
1107 3300013307 Ga0157372_10037566 Ga0157372_1003756610 169
1108 3300013307 Ga0157372_10037958 Ga0157372_100379582 169
1109 3300013307 Ga0157372_10190275 Ga0157372_101902753 169
1110 3300013307 Ga0157372_10462667 Ga0157372_104626672 169
1111 3300013307 Ga0157372_10844337 Ga0157372_108443372 169
1112 3300013307 Ga0157372_11006915 Ga0157372_110069152 169
1113 3300013308 Ga0157375_10000073 Ga0157375_1000007399 169
1114 3300014325 Ga0163163_10000317 Ga0163163_1000031725 169
1115 3300014969 Ga0157376_10036543 Ga0157376_100365432 169
1116 3300014969 Ga0157376_10282613 Ga0157376_102826132 169
1117 3300014969 Ga0157376_11287436 Ga0157376_112874362 169
1118 3300017792 Ga0163161_10004591 Ga0163161_100045913 169
1119 3300020070 Ga0206356_11546257 Ga0206356_115462572 169
1120 3300020078 Ga0206352_10812222 Ga0206352_108122222 169
1121 3300020080 Ga0206350_11250461 Ga0206350_112504612 169
1122 3300025893 Ga0207682_10035862 Ga0207682_100358623 169
1123 3300025899 Ga0207642_10368812 Ga0207642_103688122 169
1124 3300025904 Ga0207647_10212752 Ga0207647_102127522 169
1125 3300025909 Ga0207705_10852783 Ga0207705_108527831 169
1126 3300025911 Ga0207654_10004759 Ga0207654_100047595 169
1127 3300025911 Ga0207654_10010844 Ga0207654_100108444 169
1128 3300025912 Ga0207707_10000508 Ga0207707_1000050831 169
1129 3300025913 Ga0207695_10000064 Ga0207695_1000006465 169
1130 3300025913 Ga0207695_10000232 Ga0207695_1000023229 169
1131 3300025913 Ga0207695_10001292 Ga0207695_1000129225 169
1132 3300025913 Ga0207695_10021717 Ga0207695_100217173 169
1133 3300025914 Ga0207671_10011633 Ga0207671_100116334 169
1134 3300025914 Ga0207671_10053729 Ga0207671_100537294 169
1135 3300025917 Ga0207660_10000325 Ga0207660_1000032518 169
1136 3300025921 Ga0207652_10000186 Ga0207652_1000018617 169
1137 3300025921 Ga0207652_10028861 Ga0207652_100288613 169
1138 3300025924 Ga0207694_10019981 Ga0207694_100199812 169
1139 3300025925 Ga0207650_10089102 Ga0207650_100891021 169
1140 3300025925 Ga0207650_10211526 Ga0207650_102115262 169
1141 3300025928 Ga0207700_10752904 Ga0207700_107529041 169
1142 3300025931 Ga0207644_10011186 Ga0207644_100111867 169
1143 3300025932 Ga0207690_10018204 Ga0207690_100182045 169
1144 3300025932 Ga0207690_10250183 Ga0207690_102501832 169
1145 3300025934 Ga0207686_10387450 Ga0207686_103874502 169
1146 3300025938 Ga0207704_10059774 Ga0207704_100597742 169
1147 3300025940 Ga0207691_10061953 Ga0207691_100619533 169
1148 3300025940 Ga0207691_10137359 Ga0207691_101373592 169
1149 3300025941 Ga0207711_10021040 Ga0207711_100210403 169
1150 3300025944 Ga0207661_10003908 Ga0207661_1000390814 169
1151 3300025944 Ga0207661_11070118 Ga0207661_110701181 169
1152 3300025945 Ga0207679_10229675 Ga0207679_102296751 169
1153 3300025949 Ga0207667_10000111 Ga0207667_1000011130 169
1154 3300025949 Ga0207667_10032868 Ga0207667_100328682 169
1155 3300025949 Ga0207667_10082302 Ga0207667_100823025 169
1156 3300025960 Ga0207651_10509342 Ga0207651_105093421 169
1157 3300025981 Ga0207640_10528620 Ga0207640_105286201 169
1158 3300025986 Ga0207658_10013459 Ga0207658_100134593 169
1159 3300026023 Ga0207677_10558142 Ga0207677_105581421 169
1160 3300026041 Ga0207639_10053604 Ga0207639_100536043 169
1161 3300026041 Ga0207639_10178279 Ga0207639_101782793 169
1162 3300026041 Ga0207639_10903340 Ga0207639_109033402 169
1163 3300026067 Ga0207678_10241065 Ga0207678_102410653 169
1164 3300026078 Ga0207702_10681920 Ga0207702_106819202 169
1165 3300026088 Ga0207641_10313954 Ga0207641_103139542 169
1166 3300026089 Ga0207648_11080762 Ga0207648_110807621 169
1167 3300026095 Ga0207676_10653346 Ga0207676_106533462 169
1168 3300026116 Ga0207674_10154088 Ga0207674_101540883 169
1169 3300026121 Ga0207683_10134494 Ga0207683_101344942 169
1170 3300026121 Ga0207683_10638169 Ga0207683_106381692 169
1171 3300026142 Ga0207698_10163450 Ga0207698_101634501 169
1172 3300028379 Ga0268266_10734045 Ga0268266_107340451 169
1173 3300028786 Ga0307517_10050018 Ga0307517_100500185 169
1174 3300028786 Ga0307517_10269983 Ga0307517_102699832 169
1175 3300030521 Ga0307511_10002902 Ga0307511_1000290212 169
1176 3300031251 Ga0265327_10000084 Ga0265327_1000008415 169
1177 3300032004 Ga0307414_10320339 Ga0307414_103203392 169
1178 3300033180 Ga0307510_10000119 Ga0307510_1000011948 169
1179 3300033180 Ga0307510_10320608 Ga0307510_103206081 169
1180 3300035692 Ga0373935_0351882 Ga0373935_0351882_256_795 169
1181 3300037418 Ga0395900_0312296 Ga0395900_0312296_272_811 169
1182 3300038443 Ga0395901_0463913 Ga0395901_0463913_452_979 169
1183 3300041509 Ga0451843_0361727 Ga0451843_0361727_565_1146 169
1184 3300042124 Ga0450922_002800 Ga0450922_002800_596_1123 169
1185 3300042876 Ga0451577_0671070 Ga0451577_0671070_156_788 169
1186 3300044658 Ga0466972_0002446 Ga0466972_0002446_1628_2167 169
1187 3300044712 Ga0453684_0241045 Ga0453684_0241045_603_1238 169
1188 3300044901 Ga0466960_0339967 Ga0466960_0339967_231_770 169
1189 3300045051 Ga0451576_0257274 Ga0451576_0257274_37_669 169
1190 3300046507 Ga0495606_0005477 Ga0495606_0005477_2238_2777 169
1191 3300047320 Ga0495672_0021174 Ga0495672_0021174_388_918 169
1192 3300047472 Ga0495686_0000004 Ga0495686_0000004_88397_88939 169
1193 3300047472 Ga0495686_0228891 Ga0495686_0228891_310_870 169
1194 3300048903 Ga0496100_0010695 Ga0496100_0010695_2880_3404 169
1195 3300048907 Ga0496104_0392944 Ga0496104_0392944_271_795 169
1196 3300048918 Ga0496115_0545777 Ga0496115_0545777_339_878 169
1197 3300049536 Ga0501320_003694 Ga0501320_003694_465_1070 169
1198 3300049569 Ga0501032_0055273 Ga0501032_0055273_171_707 169
1199 3300049571 Ga0501034_0142610 Ga0501034_0142610_1006_1542 169
1200 3300049571 Ga0501034_0650504 Ga0501034_0650504_16_552 169
1201 3300049573 Ga0501037_0037559 Ga0501037_0037559_57_593 169
1202 3300049574 Ga0501038_0025986 Ga0501038_0025986_3185_3721 169
1203 3300049575 Ga0501039_0094760 Ga0501039_0094760_960_1496 169
1204 3300049579 Ga0501043_0013840 Ga0501043_0013840_1322_1858 169
1205 3300049579 Ga0501043_0044533 Ga0501043_0044533_301_837 169
1206 3300049580 Ga0501046_0026251 Ga0501046_0026251_885_1421 169
1207 3300049581 Ga0501047_0030096 Ga0501047_0030096_849_1385 169
1208 3300049584 Ga0501068_0036447 Ga0501068_0036447_2382_2918 169
1209 3300049585 Ga0501069_0075930 Ga0501069_0075930_565_1101 169
1210 3300049588 Ga0501072_0073516 Ga0501072_0073516_1097_1633 169
1211 3300049589 Ga0501073_0162982 Ga0501073_0162982_794_1330 169
1212 3300049590 Ga0501074_0033875 Ga0501074_0033875_2871_3407 169
1213 3300049741 Ga0501079_0360765 Ga0501079_0360765_106_642 169
1214 3300049822 Ga0501035_0067435 Ga0501035_0067435_1187_1723 169
1215 3300049823 Ga0501044_0005733 Ga0501044_0005733_3783_4319 169
1216 3300049823 Ga0501044_0303588 Ga0501044_0303588_261_953 169
1217 3300049823 Ga0501044_0405255 Ga0501044_0405255_399_935 169
1218 3300050512 nmdc:mga0n895_585434_c1 nmdc:mga0n895_585434_c1_373_909 169
1219 3300053156 Ga0500622_0000852 Ga0500622_0000852_7474_8088 169
1220 3300054114 Ga0501084_0131031 Ga0501084_0131031_1312_1848 169
1221 3300060353 Ga0501082_0035882 Ga0501082_0035882_3541_4077 169

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00466

Ribosomal_L10

Ribosomal protein L10

1

101

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ug7-assembly1.cif.gz_LJ 70s ribosome complex in an intermediate state of translocation bound to ef-g(gdp) stalled by argyrin b 0.899 2 132
8phj-assembly1.cif.gz_5 ca4-bound cami1 in complex with 70s ribosome 0.8964 1 133
7as8-assembly1.cif.gz_L bacillus subtilis ribosome quality control complex state b. ribosomal 50s subunit with p-trna, rqch, and rqcp/yabo 0.8911 4 130
5gad-assembly1.cif.gz_I rnc-srp-sr complex early state 0.8879 1 128
5zeb-assembly1.cif.gz_I m. smegmatis p/p state 70s ribosome structure 0.8862 1 132
ID Description Score Start End Superfamily
af_Q9VPL3_26_196_3.30.70.1730 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain 0.8565 1 132 3.30.70.1730
5oolI00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain 0.8523 3 132 3.30.70.1730
1zaxA01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain 0.8517 4 132 3.30.70.1730
6dzpI00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain 0.8473 1 132 3.30.70.1730
af_Q9FY50_43_174_3.30.70.1730 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain 0.8468 1 135 3.30.70.1730
ID Description Score Start End GO Terms
AF-A0A4Q3RPJ2-F1-model_v4 50S ribosomal protein L10 0.9782 1 121 GO:0003735
GO:0006412
GO:0015934
AF-A0A4Q3RPJ2-F1-model_v4 50S ribosomal protein L10 0.9703 1 121 GO:0003735
GO:0006412
GO:0015934
AF-A0A0R2S5T3-F1-model_v4 Large ribosomal subunit protein uL10 (50S ribosomal protein L10) 0.9648 1 134 GO:0005840
GO:1990904
AF-A0A537J6C1-F1-model_v4 50S ribosomal protein L10 0.9638 1 138 GO:0003735
GO:0006412
GO:0015934
AF-A0A497CSE5-F1-model_v4 Large ribosomal subunit protein uL10 (50S ribosomal protein L10) 0.9589 1 120 GO:0005840
GO:1990904

Feature Viewer

pLDDT pTM Quality
82.07 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map