F491861
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1221 | 384 | 1220 | 176 |
Family's Representative Sequence
| Representative Sequence | 3300048918|Ga0496115_0303524|Ga0496115_0303524_243_767 |
| Length | 174 |
| Sequence | MTPAQKNEAIEVLKGKFAQYDNFYVTNTESLTVEQVSKLRRLCFEKNVEMKVAKNTLIKKALESFNDEKYTGVYDALHGVTALMFSDSPKEPALILASFRKEAKDKPTLKAALIGTDVFSGDNQLDALTKIKTKNELIGEVIGLLQSPAKRVLAALLHXXEQKAGETAEAPAAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2881955468 | Edaphocola flava HME-24 | Isolate | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 7 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 8 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 9 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 10 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 11 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 12 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 13 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 14 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 15 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 20 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 23 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 32 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 69 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 70 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 71 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 74 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 75 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 76 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 77 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 78 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 79 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 80 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 81 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 82 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 83 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 84 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 85 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 86 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 88 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 90 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 91 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 92 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 93 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 94 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 95 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 96 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 126 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 131 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 132 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 133 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 206 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 207 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 208 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 209 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 210 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 211 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 212 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 213 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 214 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 215 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 216 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 217 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 218 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 219 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 221 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 222 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 223 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 224 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 225 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 226 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 227 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 229 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 230 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 231 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 232 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 233 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 234 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 235 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 236 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 237 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 238 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 239 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 240 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 241 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 242 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 243 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 244 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 245 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 246 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 247 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 248 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 249 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 250 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 251 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 252 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 253 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 254 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 255 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 283 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 284 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 285 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 287 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 288 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 289 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 290 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 291 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300049131 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 293 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 294 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 295 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 296 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 297 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 298 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 299 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 300 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 301 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 302 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 303 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 304 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 305 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 306 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 307 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 308 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 309 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 310 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 311 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 312 | 3300049545 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 313 | 3300049546 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 314 | 3300049548 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 315 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 316 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 317 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 318 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 319 | 3300049554 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 320 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 340 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 341 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 342 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 343 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 344 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 345 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 346 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 347 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 348 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 349 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 350 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 351 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 352 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 353 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 357 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 358 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 362 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 363 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 364 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 373 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 374 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 375 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 376 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 377 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 378 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 380 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.51 |
| Metatranscriptomes | 5.41 |
| Isolates | 0.08 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.78 |
| Nodule | 0 |
| Rhizoplane | 0.74 |
| Rhizosphere | 94.51 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.97 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1663050 | 2162886007 | Bacteria | 482194 |
| 2 | JGI24739J22299_10000798 | 3300001989 | Bacteria | 11508 |
| 3 | JGI24739J22299_10003052 | 3300001989 | Bacteria | 6394 |
| 4 | JGI24751J29686_10000803 | 3300002459 | Bacteria | 7347 |
| 5 | JGI25154J39366_1000001 | 3300002738 | Bacteria | 483450 |
| 6 | JGI25157J39369_1003512 | 3300002741 | Bacteria | 3168 |
| 7 | Ga0006759J45824_1097056 | 3300003163 | Bacteria | 1422 |
| 8 | JGI25406J46586_10003914 | 3300003203 | Bacteria | 6961 |
| 9 | JGI25153J46596_10001870 | 3300003215 | Bacteria | 12472 |
| 10 | JGI25153J46596_10005056 | 3300003215 | Bacteria | 6977 |
| 11 | rootH1_10114210 | 3300003316 | Bacteria | 1061 |
| 12 | rootH2_10059898 | 3300003320 | Bacteria | 1595 |
| 13 | rootH2_10204928 | 3300003320 | Bacteria | 1132 |
| 14 | rootL2_10239916 | 3300003322 | Bacteria | 1045 |
| 15 | rootH1_10032943 | 3300003323 | Bacteria | 3829 |
| 16 | JGI25160J50197_1000508 | 3300003354 | Bacteria | 23038 |
| 17 | JGI25160J50197_1008979 | 3300003354 | Bacteria | 3752 |
| 18 | JGI25160J50197_1018530 | 3300003354 | Bacteria | 2165 |
| 19 | Ga0055526_1016300 | 3300003771 | Bacteria | 2918 |
| 20 | Ga0055528_1009578 | 3300003790 | Bacteria | 4032 |
| 21 | Ga0055531_10020429 | 3300003794 | Bacteria | 2619 |
| 22 | Ga0055543_1038139 | 3300004625 | Bacteria | 818 |
| 23 | Ga0065165_1000112 | 3300005262 | Bacteria | 135988 |
| 24 | Ga0065714_10201259 | 3300005288 | Bacteria | 894 |
| 25 | Ga0065704_10070140 | 3300005289 | Bacteria | 482257 |
| 26 | Ga0065704_10414176 | 3300005289 | Unclassified | 738 |
| 27 | Ga0065712_10004615 | 3300005290 | Bacteria | 5996 |
| 28 | Ga0065712_10206809 | 3300005290 | Bacteria | 1087 |
| 29 | Ga0065712_10401979 | 3300005290 | Bacteria | 730 |
| 30 | Ga0065712_10561093 | 3300005290 | Bacteria | 609 |
| 31 | Ga0065715_10130180 | 3300005293 | Bacteria | 2008 |
| 32 | Ga0065715_10164987 | 3300005293 | Bacteria | 1590 |
| 33 | Ga0065715_10223950 | 3300005293 | Bacteria | 1260 |
| 34 | Ga0065707_10156493 | 3300005295 | Bacteria | 1604 |
| 35 | Ga0070658_10000420 | 3300005327 | Bacteria | 36817 |
| 36 | Ga0070658_10013800 | 3300005327 | Bacteria | 6482 |
| 37 | Ga0070658_10601651 | 3300005327 | Bacteria | 953 |
| 38 | Ga0070676_10005499 | 3300005328 | Bacteria | 6747 |
| 39 | Ga0070676_10036189 | 3300005328 | Bacteria | 2843 |
| 40 | Ga0070676_10235057 | 3300005328 | Bacteria | 1216 |
| 41 | Ga0070676_10258521 | 3300005328 | Bacteria | 1165 |
| 42 | Ga0070676_10343053 | 3300005328 | Bacteria | 1025 |
| 43 | Ga0070683_100000417 | 3300005329 | Bacteria | 29450 |
| 44 | Ga0070683_100010447 | 3300005329 | Bacteria | 7982 |
| 45 | Ga0070683_100011895 | 3300005329 | Bacteria | 7545 |
| 46 | Ga0070683_100018251 | 3300005329 | Bacteria | 6211 |
| 47 | Ga0070683_100042173 | 3300005329 | Bacteria | 4201 |
| 48 | Ga0070690_100028796 | 3300005330 | Bacteria | 3442 |
| 49 | Ga0070690_100095882 | 3300005330 | Bacteria | 1960 |
| 50 | Ga0070690_100243997 | 3300005330 | Bacteria | 1268 |
| 51 | Ga0070690_100346682 | 3300005330 | Bacteria | 1077 |
| 52 | Ga0070690_100607660 | 3300005330 | Bacteria | 831 |
| 53 | Ga0070690_100629979 | 3300005330 | Bacteria | 817 |
| 54 | Ga0070670_100066660 | 3300005331 | Bacteria | 3089 |
| 55 | Ga0070670_100102347 | 3300005331 | Bacteria | 2467 |
| 56 | Ga0070670_100106412 | 3300005331 | Bacteria | 2417 |
| 57 | Ga0070670_100121376 | 3300005331 | Bacteria | 2254 |
| 58 | Ga0070670_100256225 | 3300005331 | Bacteria | 1525 |
| 59 | Ga0070670_100489652 | 3300005331 | Bacteria | 1093 |
| 60 | Ga0070670_100607988 | 3300005331 | Bacteria | 979 |
| 61 | Ga0070677_10105973 | 3300005333 | Bacteria | 1247 |
| 62 | Ga0070677_10122797 | 3300005333 | Bacteria | 1175 |
| 63 | Ga0068869_100019533 | 3300005334 | Bacteria | 4632 |
| 64 | Ga0068869_100028140 | 3300005334 | Bacteria | 3924 |
| 65 | Ga0068869_100056223 | 3300005334 | Bacteria | 2869 |
| 66 | Ga0068869_100060658 | 3300005334 | Bacteria | 2773 |
| 67 | Ga0068869_100133844 | 3300005334 | Bacteria | 1908 |
| 68 | Ga0068869_100419337 | 3300005334 | Bacteria | 1104 |
| 69 | Ga0068869_100613964 | 3300005334 | Bacteria | 920 |
| 70 | Ga0068869_100754069 | 3300005334 | Bacteria | 834 |
| 71 | Ga0068869_101482645 | 3300005334 | Bacteria | 602 |
| 72 | Ga0070666_10000303 | 3300005335 | Bacteria | 31938 |
| 73 | Ga0070666_10012379 | 3300005335 | Bacteria | 5379 |
| 74 | Ga0070666_10038579 | 3300005335 | Bacteria | 3179 |
| 75 | Ga0070666_10040888 | 3300005335 | Bacteria | 3096 |
| 76 | Ga0070666_10140866 | 3300005335 | Bacteria | 1680 |
| 77 | Ga0070666_10251363 | 3300005335 | Bacteria | 1252 |
| 78 | Ga0070680_100000212 | 3300005336 | Bacteria | 38186 |
| 79 | Ga0070680_100202632 | 3300005336 | Bacteria | 1674 |
| 80 | Ga0070680_100373394 | 3300005336 | Bacteria | 1214 |
| 81 | Ga0070682_100000101 | 3300005337 | Bacteria | 76535 |
| 82 | Ga0070682_100000651 | 3300005337 | Bacteria | 21124 |
| 83 | Ga0070682_100154126 | 3300005337 | Bacteria | 1580 |
| 84 | Ga0070682_100172793 | 3300005337 | Bacteria | 1503 |
| 85 | Ga0068868_100000177 | 3300005338 | Bacteria | 42348 |
| 86 | Ga0068868_100001935 | 3300005338 | Bacteria | 14217 |
| 87 | Ga0068868_100017469 | 3300005338 | Bacteria | 5346 |
| 88 | Ga0068868_100023646 | 3300005338 | Bacteria | 4652 |
| 89 | Ga0068868_100035202 | 3300005338 | Bacteria | 3869 |
| 90 | Ga0068868_100041901 | 3300005338 | Bacteria | 3570 |
| 91 | Ga0068868_100146447 | 3300005338 | Bacteria | 1942 |
| 92 | Ga0068868_100250304 | 3300005338 | Bacteria | 1491 |
| 93 | Ga0068868_100391798 | 3300005338 | Bacteria | 1197 |
| 94 | Ga0070660_100003304 | 3300005339 | Bacteria | 11084 |
| 95 | Ga0070660_100097120 | 3300005339 | Bacteria | 2330 |
| 96 | Ga0070660_100396663 | 3300005339 | Bacteria | 1140 |
| 97 | Ga0070689_100043517 | 3300005340 | Bacteria | 3452 |
| 98 | Ga0070689_100067689 | 3300005340 | Bacteria | 2784 |
| 99 | Ga0070689_101332879 | 3300005340 | Unclassified | 647 |
| 100 | Ga0070691_10005105 | 3300005341 | Bacteria | 5966 |
| 101 | Ga0070691_10038700 | 3300005341 | Bacteria | 2252 |
| 102 | Ga0070691_10187150 | 3300005341 | Bacteria | 1081 |
| 103 | Ga0070687_100219001 | 3300005343 | Bacteria | 1164 |
| 104 | Ga0070661_100000686 | 3300005344 | Bacteria | 24845 |
| 105 | Ga0070661_100005063 | 3300005344 | Bacteria | 9092 |
| 106 | Ga0070661_100033517 | 3300005344 | Bacteria | 3720 |
| 107 | Ga0070661_100066001 | 3300005344 | Bacteria | 2659 |
| 108 | Ga0070661_100134540 | 3300005344 | Bacteria | 1859 |
| 109 | Ga0070668_100000022 | 3300005347 | Bacteria | 96336 |
| 110 | Ga0070668_100011383 | 3300005347 | Bacteria | 6627 |
| 111 | Ga0070668_100030037 | 3300005347 | Bacteria | 4130 |
| 112 | Ga0070669_100012393 | 3300005353 | Bacteria | 6047 |
| 113 | Ga0070669_100172763 | 3300005353 | Bacteria | 1686 |
| 114 | Ga0070669_100470126 | 3300005353 | Bacteria | 1039 |
| 115 | Ga0070669_100560973 | 3300005353 | Bacteria | 953 |
| 116 | Ga0070669_100641183 | 3300005353 | Bacteria | 893 |
| 117 | Ga0070675_100003907 | 3300005354 | Bacteria | 11295 |
| 118 | Ga0070675_100038447 | 3300005354 | Bacteria | 3900 |
| 119 | Ga0070675_100041999 | 3300005354 | Bacteria | 3736 |
| 120 | Ga0070675_100053739 | 3300005354 | Bacteria | 3313 |
| 121 | Ga0070675_100065083 | 3300005354 | Bacteria | 3014 |
| 122 | Ga0070675_100106195 | 3300005354 | Bacteria | 2370 |
| 123 | Ga0070675_100130430 | 3300005354 | Bacteria | 2142 |
| 124 | Ga0070675_100359411 | 3300005354 | Bacteria | 1293 |
| 125 | Ga0070675_100692711 | 3300005354 | Bacteria | 928 |
| 126 | Ga0070671_100028318 | 3300005355 | Bacteria | 4614 |
| 127 | Ga0070671_100037941 | 3300005355 | Bacteria | 3998 |
| 128 | Ga0070671_100071753 | 3300005355 | Bacteria | 2891 |
| 129 | Ga0070671_100381457 | 3300005355 | Bacteria | 1205 |
| 130 | Ga0070671_100389713 | 3300005355 | Bacteria | 1191 |
| 131 | Ga0070671_100424095 | 3300005355 | Bacteria | 1139 |
| 132 | Ga0070671_100505169 | 3300005355 | Bacteria | 1040 |
| 133 | Ga0070671_100654251 | 3300005355 | Bacteria | 910 |
| 134 | Ga0070671_101201239 | 3300005355 | Bacteria | 667 |
| 135 | Ga0070671_101267937 | 3300005355 | Unclassified | 649 |
| 136 | Ga0070674_100003780 | 3300005356 | Bacteria | 8551 |
| 137 | Ga0070674_100036667 | 3300005356 | Bacteria | 3293 |
| 138 | Ga0070674_101128809 | 3300005356 | Bacteria | 693 |
| 139 | Ga0070673_100000090 | 3300005364 | Bacteria | 39776 |
| 140 | Ga0070673_100005548 | 3300005364 | Bacteria | 8089 |
| 141 | Ga0070673_100006318 | 3300005364 | Bacteria | 7695 |
| 142 | Ga0070673_100030181 | 3300005364 | Bacteria | 4052 |
| 143 | Ga0070673_100041325 | 3300005364 | Bacteria | 3546 |
| 144 | Ga0070673_100048741 | 3300005364 | Bacteria | 3304 |
| 145 | Ga0070673_100876534 | 3300005364 | Bacteria | 831 |
| 146 | Ga0070673_100921135 | 3300005364 | Bacteria | 811 |
| 147 | Ga0070688_100004674 | 3300005365 | Bacteria | 7149 |
| 148 | Ga0070688_100110409 | 3300005365 | Bacteria | 1828 |
| 149 | Ga0070688_100113200 | 3300005365 | Bacteria | 1807 |
| 150 | Ga0070688_100319010 | 3300005365 | Bacteria | 1128 |
| 151 | Ga0070688_100618541 | 3300005365 | Bacteria | 831 |
| 152 | Ga0070659_100004989 | 3300005366 | Bacteria | 9506 |
| 153 | Ga0070659_100006423 | 3300005366 | Bacteria | 8488 |
| 154 | Ga0070659_100012440 | 3300005366 | Bacteria | 6311 |
| 155 | Ga0070659_100218796 | 3300005366 | Bacteria | 1571 |
| 156 | Ga0070667_100003830 | 3300005367 | Bacteria | 12781 |
| 157 | Ga0070667_100104894 | 3300005367 | Bacteria | 2446 |
| 158 | Ga0070667_100115377 | 3300005367 | Bacteria | 2332 |
| 159 | Ga0070667_100227413 | 3300005367 | Bacteria | 1662 |
| 160 | Ga0070667_100263519 | 3300005367 | Bacteria | 1544 |
| 161 | Ga0070667_100325968 | 3300005367 | Bacteria | 1386 |
| 162 | Ga0070667_101015626 | 3300005367 | Bacteria | 774 |
| 163 | Ga0070701_10025221 | 3300005438 | Bacteria | 2884 |
| 164 | Ga0070701_10046223 | 3300005438 | Bacteria | 2237 |
| 165 | Ga0070705_100204328 | 3300005440 | Bacteria | 1357 |
| 166 | Ga0070705_100308405 | 3300005440 | Bacteria | 1137 |
| 167 | Ga0070705_100587688 | 3300005440 | Bacteria | 859 |
| 168 | Ga0070663_100205300 | 3300005455 | Bacteria | 1540 |
| 169 | Ga0070663_100264164 | 3300005455 | Bacteria | 1366 |
| 170 | Ga0070663_100377419 | 3300005455 | Bacteria | 1154 |
| 171 | Ga0070678_100007545 | 3300005456 | Bacteria | 6459 |
| 172 | Ga0070678_100076673 | 3300005456 | Bacteria | 2519 |
| 173 | Ga0070678_100086310 | 3300005456 | Bacteria | 2394 |
| 174 | Ga0070678_100222188 | 3300005456 | Bacteria | 1570 |
| 175 | Ga0070678_100993393 | 3300005456 | Bacteria | 771 |
| 176 | Ga0070662_100009127 | 3300005457 | Bacteria | 6475 |
| 177 | Ga0070662_100012996 | 3300005457 | Bacteria | 5532 |
| 178 | Ga0070662_100036168 | 3300005457 | Bacteria | 3491 |
| 179 | Ga0070662_100038739 | 3300005457 | Bacteria | 3387 |
| 180 | Ga0070662_100044153 | 3300005457 | Bacteria | 3192 |
| 181 | Ga0070662_100150293 | 3300005457 | Bacteria | 1812 |
| 182 | Ga0070662_100163457 | 3300005457 | Bacteria | 1743 |
| 183 | Ga0070681_10001590 | 3300005458 | Bacteria | 20192 |
| 184 | Ga0070681_10218197 | 3300005458 | Bacteria | 1823 |
| 185 | Ga0068867_100014418 | 3300005459 | Bacteria | 5601 |
| 186 | Ga0070685_10014019 | 3300005466 | Bacteria | 4242 |
| 187 | Ga0070685_10266083 | 3300005466 | Bacteria | 1142 |
| 188 | Ga0070685_10666046 | 3300005466 | Bacteria | 755 |
| 189 | Ga0070698_100019462 | 3300005471 | Bacteria | 7126 |
| 190 | Ga0070698_100194357 | 3300005471 | Bacteria | 1966 |
| 191 | Ga0070698_100196931 | 3300005471 | Bacteria | 1951 |
| 192 | Ga0070679_100000449 | 3300005530 | Bacteria | 34845 |
| 193 | Ga0070684_100000433 | 3300005535 | Bacteria | 28743 |
| 194 | Ga0070684_100053633 | 3300005535 | Bacteria | 3511 |
| 195 | Ga0070684_100088767 | 3300005535 | Bacteria | 2747 |
| 196 | Ga0070684_100523034 | 3300005535 | Bacteria | 1100 |
| 197 | Ga0068853_100017053 | 3300005539 | Bacteria | 5990 |
| 198 | Ga0068853_100025858 | 3300005539 | Bacteria | 4928 |
| 199 | Ga0068853_100034146 | 3300005539 | Bacteria | 4317 |
| 200 | Ga0068853_100077988 | 3300005539 | Bacteria | 2895 |
| 201 | Ga0068853_100125496 | 3300005539 | Bacteria | 2292 |
| 202 | Ga0068853_100135069 | 3300005539 | Bacteria | 2210 |
| 203 | Ga0068853_100249320 | 3300005539 | Bacteria | 1629 |
| 204 | Ga0068853_100308797 | 3300005539 | Bacteria | 1463 |
| 205 | Ga0068853_100652233 | 3300005539 | Bacteria | 1002 |
| 206 | Ga0068853_101444809 | 3300005539 | Bacteria | 665 |
| 207 | Ga0070672_100000149 | 3300005543 | Bacteria | 38128 |
| 208 | Ga0070672_100015120 | 3300005543 | Bacteria | 5486 |
| 209 | Ga0070672_100085853 | 3300005543 | Bacteria | 2530 |
| 210 | Ga0070672_100130450 | 3300005543 | Bacteria | 2065 |
| 211 | Ga0070672_100156175 | 3300005543 | Bacteria | 1890 |
| 212 | Ga0070672_100295707 | 3300005543 | Bacteria | 1372 |
| 213 | Ga0070672_100603758 | 3300005543 | Bacteria | 956 |
| 214 | Ga0070686_100059005 | 3300005544 | Bacteria | 2471 |
| 215 | Ga0070686_100084279 | 3300005544 | Bacteria | 2111 |
| 216 | Ga0070686_100458147 | 3300005544 | Bacteria | 982 |
| 217 | Ga0070693_100019024 | 3300005547 | Bacteria | 3594 |
| 218 | Ga0070665_100000001 | 3300005548 | Bacteria | 1083363 |
| 219 | Ga0070665_100001508 | 3300005548 | Bacteria | 27075 |
| 220 | Ga0070665_100007085 | 3300005548 | Bacteria | 11393 |
| 221 | Ga0070665_100111581 | 3300005548 | Bacteria | 2737 |
| 222 | Ga0070665_100226309 | 3300005548 | Bacteria | 1871 |
| 223 | Ga0068855_100001939 | 3300005563 | Bacteria | 25691 |
| 224 | Ga0068855_100017503 | 3300005563 | Bacteria | 8618 |
| 225 | Ga0068855_100065715 | 3300005563 | Bacteria | 4229 |
| 226 | Ga0068855_100088304 | 3300005563 | Bacteria | 3581 |
| 227 | Ga0068855_100182062 | 3300005563 | Bacteria | 2375 |
| 228 | Ga0068855_100194649 | 3300005563 | Bacteria | 2285 |
| 229 | Ga0068855_100285669 | 3300005563 | Bacteria | 1831 |
| 230 | Ga0068855_100376721 | 3300005563 | Bacteria | 1559 |
| 231 | Ga0068855_101082927 | 3300005563 | Bacteria | 839 |
| 232 | Ga0070664_100004734 | 3300005564 | Bacteria | 10910 |
| 233 | Ga0070664_100014730 | 3300005564 | Bacteria | 6386 |
| 234 | Ga0070664_100043986 | 3300005564 | Bacteria | 3770 |
| 235 | Ga0070664_100060954 | 3300005564 | Bacteria | 3214 |
| 236 | Ga0070664_100246857 | 3300005564 | Bacteria | 1604 |
| 237 | Ga0070664_100511002 | 3300005564 | Bacteria | 1108 |
| 238 | Ga0070664_100707668 | 3300005564 | Bacteria | 939 |
| 239 | Ga0070664_101146843 | 3300005564 | Unclassified | 733 |
| 240 | Ga0068857_100019362 | 3300005577 | Bacteria | 5975 |
| 241 | Ga0068857_100027233 | 3300005577 | Bacteria | 5041 |
| 242 | Ga0068857_100030836 | 3300005577 | Bacteria | 4736 |
| 243 | Ga0068857_100307241 | 3300005577 | Bacteria | 1463 |
| 244 | Ga0068857_101512742 | 3300005577 | Bacteria | 654 |
| 245 | Ga0068854_100035001 | 3300005578 | Bacteria | 3513 |
| 246 | Ga0068854_100036442 | 3300005578 | Bacteria | 3449 |
| 247 | Ga0068854_100117058 | 3300005578 | Bacteria | 2018 |
| 248 | Ga0068854_100909404 | 3300005578 | Bacteria | 774 |
| 249 | Ga0068856_100137028 | 3300005614 | Bacteria | 2453 |
| 250 | Ga0068856_100788325 | 3300005614 | Bacteria | 970 |
| 251 | Ga0068856_101207603 | 3300005614 | Bacteria | 772 |
| 252 | Ga0070702_100173234 | 3300005615 | Bacteria | 1406 |
| 253 | Ga0070702_100497692 | 3300005615 | Unclassified | 894 |
| 254 | Ga0068852_100025320 | 3300005616 | Bacteria | 4807 |
| 255 | Ga0068852_100099003 | 3300005616 | Bacteria | 2627 |
| 256 | Ga0068852_100135992 | 3300005616 | Bacteria | 2269 |
| 257 | Ga0068852_100136365 | 3300005616 | Bacteria | 2266 |
| 258 | Ga0068852_100154924 | 3300005616 | Bacteria | 2134 |
| 259 | Ga0068852_100186021 | 3300005616 | Bacteria | 1956 |
| 260 | Ga0068852_100222464 | 3300005616 | Bacteria | 1796 |
| 261 | Ga0068852_100236418 | 3300005616 | Bacteria | 1744 |
| 262 | Ga0068852_100357185 | 3300005616 | Bacteria | 1428 |
| 263 | Ga0068859_100012809 | 3300005617 | Bacteria | 8423 |
| 264 | Ga0068859_100018668 | 3300005617 | Bacteria | 6970 |
| 265 | Ga0068859_100018814 | 3300005617 | Bacteria | 6940 |
| 266 | Ga0068859_100022225 | 3300005617 | Bacteria | 6359 |
| 267 | Ga0068859_100042598 | 3300005617 | Bacteria | 4560 |
| 268 | Ga0068859_100156505 | 3300005617 | Bacteria | 2356 |
| 269 | Ga0068859_100496143 | 3300005617 | Unclassified | 1316 |
| 270 | Ga0068859_100694729 | 3300005617 | Bacteria | 1108 |
| 271 | Ga0068859_101089472 | 3300005617 | Bacteria | 878 |
| 272 | Ga0068859_101154537 | 3300005617 | Bacteria | 853 |
| 273 | Ga0068859_101574425 | 3300005617 | Bacteria | 726 |
| 274 | Ga0068864_100000404 | 3300005618 | Bacteria | 37446 |
| 275 | Ga0068864_100006928 | 3300005618 | Bacteria | 9298 |
| 276 | Ga0068864_100013283 | 3300005618 | Bacteria | 6821 |
| 277 | Ga0068864_100053850 | 3300005618 | Bacteria | 3472 |
| 278 | Ga0068864_100195296 | 3300005618 | Bacteria | 1857 |
| 279 | Ga0068864_100483784 | 3300005618 | Bacteria | 1188 |
| 280 | Ga0068864_100505123 | 3300005618 | Bacteria | 1164 |
| 281 | Ga0068864_100759750 | 3300005618 | Bacteria | 950 |
| 282 | Ga0068864_100806914 | 3300005618 | Bacteria | 923 |
| 283 | Ga0068864_100823598 | 3300005618 | Bacteria | 913 |
| 284 | Ga0068866_10003292 | 3300005718 | Bacteria | 6635 |
| 285 | Ga0068866_10065942 | 3300005718 | Bacteria | 1895 |
| 286 | Ga0068866_10165631 | 3300005718 | Bacteria | 1293 |
| 287 | Ga0068861_100014937 | 3300005719 | Bacteria | 5459 |
| 288 | Ga0068861_100049974 | 3300005719 | Bacteria | 3168 |
| 289 | Ga0068861_100063618 | 3300005719 | Bacteria | 2836 |
| 290 | Ga0068861_100217217 | 3300005719 | Bacteria | 1614 |
| 291 | Ga0068851_10000712 | 3300005834 | Bacteria | 14185 |
| 292 | Ga0068851_10053471 | 3300005834 | Bacteria | 2056 |
| 293 | Ga0068851_10143981 | 3300005834 | Bacteria | 1298 |
| 294 | Ga0068851_10200429 | 3300005834 | Bacteria | 1114 |
| 295 | Ga0068870_10039922 | 3300005840 | Bacteria | 2431 |
| 296 | Ga0068870_10109137 | 3300005840 | Bacteria | 1577 |
| 297 | Ga0068870_10131451 | 3300005840 | Bacteria | 1454 |
| 298 | Ga0068870_10338430 | 3300005840 | Bacteria | 962 |
| 299 | Ga0068863_100000216 | 3300005841 | Bacteria | 61837 |
| 300 | Ga0068863_100038413 | 3300005841 | Bacteria | 4554 |
| 301 | Ga0068863_100062485 | 3300005841 | Bacteria | 3522 |
| 302 | Ga0068863_100194332 | 3300005841 | Bacteria | 1951 |
| 303 | Ga0068863_100258872 | 3300005841 | Bacteria | 1682 |
| 304 | Ga0068863_100344864 | 3300005841 | Bacteria | 1449 |
| 305 | Ga0068863_100465408 | 3300005841 | Bacteria | 1242 |
| 306 | Ga0068858_100006030 | 3300005842 | Bacteria | 11816 |
| 307 | Ga0068858_100018008 | 3300005842 | Bacteria | 6615 |
| 308 | Ga0068858_100226880 | 3300005842 | Bacteria | 1770 |
| 309 | Ga0068858_100667249 | 3300005842 | Bacteria | 1011 |
| 310 | Ga0068858_100673468 | 3300005842 | Bacteria | 1006 |
| 311 | Ga0068858_100790306 | 3300005842 | Bacteria | 926 |
| 312 | Ga0068858_101334152 | 3300005842 | Bacteria | 706 |
| 313 | Ga0068860_100000241 | 3300005843 | Bacteria | 83429 |
| 314 | Ga0068860_100013270 | 3300005843 | Bacteria | 8084 |
| 315 | Ga0068860_100016199 | 3300005843 | Bacteria | 7271 |
| 316 | Ga0068860_100019189 | 3300005843 | Bacteria | 6637 |
| 317 | Ga0068860_100152641 | 3300005843 | Bacteria | 2225 |
| 318 | Ga0068860_100195522 | 3300005843 | Bacteria | 1959 |
| 319 | Ga0068860_100365657 | 3300005843 | Bacteria | 1422 |
| 320 | Ga0068860_100560611 | 3300005843 | Bacteria | 1145 |
| 321 | Ga0068860_101584588 | 3300005843 | Unclassified | 677 |
| 322 | Ga0068862_100008729 | 3300005844 | Bacteria | 8389 |
| 323 | Ga0068862_100162459 | 3300005844 | Bacteria | 1995 |
| 324 | Ga0068862_100444919 | 3300005844 | Bacteria | 1220 |
| 325 | Ga0068862_100491805 | 3300005844 | Bacteria | 1163 |
| 326 | Ga0081540_1022869 | 3300005983 | Bacteria | 3678 |
| 327 | Ga0081539_10000925 | 3300005985 | Bacteria | 55202 |
| 328 | Ga0075432_10155346 | 3300006058 | Unclassified | 882 |
| 329 | Ga0070715_10184222 | 3300006163 | Bacteria | 1049 |
| 330 | Ga0075366_10012601 | 3300006195 | Bacteria | 4800 |
| 331 | Ga0075366_10172410 | 3300006195 | Bacteria | 1313 |
| 332 | Ga0097621_100000334 | 3300006237 | Bacteria | 32025 |
| 333 | Ga0097621_100000488 | 3300006237 | Bacteria | 27766 |
| 334 | Ga0097621_100003690 | 3300006237 | Bacteria | 10590 |
| 335 | Ga0097621_100026314 | 3300006237 | Bacteria | 4562 |
| 336 | Ga0097621_100051732 | 3300006237 | Bacteria | 3344 |
| 337 | Ga0097621_100060738 | 3300006237 | Bacteria | 3099 |
| 338 | Ga0097621_100071150 | 3300006237 | Bacteria | 2874 |
| 339 | Ga0097621_100150455 | 3300006237 | Bacteria | 1996 |
| 340 | Ga0097621_100230321 | 3300006237 | Bacteria | 1617 |
| 341 | Ga0097621_101085349 | 3300006237 | Bacteria | 751 |
| 342 | Ga0075370_10348022 | 3300006353 | Bacteria | 885 |
| 343 | Ga0068871_100000381 | 3300006358 | Bacteria | 31089 |
| 344 | Ga0068871_100007174 | 3300006358 | Bacteria | 7951 |
| 345 | Ga0068871_100008487 | 3300006358 | Bacteria | 7390 |
| 346 | Ga0068871_100022850 | 3300006358 | Bacteria | 4827 |
| 347 | Ga0068871_100210555 | 3300006358 | Bacteria | 1681 |
| 348 | Ga0068871_100905334 | 3300006358 | Bacteria | 818 |
| 349 | Ga0075428_100064685 | 3300006844 | Bacteria | 4006 |
| 350 | Ga0075428_100169954 | 3300006844 | Bacteria | 2364 |
| 351 | Ga0075428_100374101 | 3300006844 | Bacteria | 1527 |
| 352 | Ga0075428_100439566 | 3300006844 | Bacteria | 1397 |
| 353 | Ga0075430_100180402 | 3300006846 | Bacteria | 1756 |
| 354 | Ga0075431_100051328 | 3300006847 | Bacteria | 4254 |
| 355 | Ga0075429_100032949 | 3300006880 | Bacteria | 4503 |
| 356 | Ga0075429_100757593 | 3300006880 | Bacteria | 850 |
| 357 | Ga0068865_100016572 | 3300006881 | Bacteria | 4718 |
| 358 | Ga0068865_100079282 | 3300006881 | Bacteria | 2352 |
| 359 | Ga0068865_100095346 | 3300006881 | Bacteria | 2167 |
| 360 | Ga0068865_100361162 | 3300006881 | Bacteria | 1179 |
| 361 | Ga0068865_100733527 | 3300006881 | Bacteria | 847 |
| 362 | Ga0068865_100851108 | 3300006881 | Bacteria | 790 |
| 363 | Ga0097620_100012809 | 3300006931 | Bacteria | 8423 |
| 364 | Ga0097620_100018668 | 3300006931 | Bacteria | 6970 |
| 365 | Ga0097620_100018813 | 3300006931 | Bacteria | 6940 |
| 366 | Ga0097620_100022228 | 3300006931 | Bacteria | 6359 |
| 367 | Ga0097620_100042600 | 3300006931 | Bacteria | 4560 |
| 368 | Ga0097620_100156508 | 3300006931 | Bacteria | 2356 |
| 369 | Ga0097620_100496185 | 3300006931 | Unclassified | 1316 |
| 370 | Ga0097620_100694617 | 3300006931 | Bacteria | 1108 |
| 371 | Ga0097620_101089524 | 3300006931 | Bacteria | 878 |
| 372 | Ga0097620_101154443 | 3300006931 | Bacteria | 853 |
| 373 | Ga0097620_101574302 | 3300006931 | Bacteria | 726 |
| 374 | Ga0105251_10330869 | 3300009011 | Bacteria | 693 |
| 375 | Ga0105240_10000078 | 3300009093 | Bacteria | 196646 |
| 376 | Ga0105240_10006513 | 3300009093 | Bacteria | 17149 |
| 377 | Ga0105240_10014605 | 3300009093 | Bacteria | 10715 |
| 378 | Ga0105240_10027503 | 3300009093 | Bacteria | 7444 |
| 379 | Ga0105240_10036655 | 3300009093 | Bacteria | 6306 |
| 380 | Ga0105240_10038251 | 3300009093 | Bacteria | 6155 |
| 381 | Ga0105240_10038564 | 3300009093 | Bacteria | 6127 |
| 382 | Ga0105240_10099086 | 3300009093 | Bacteria | 3548 |
| 383 | Ga0105240_10158659 | 3300009093 | Bacteria | 2689 |
| 384 | Ga0105240_10262532 | 3300009093 | Bacteria | 1991 |
| 385 | Ga0105240_10352502 | 3300009093 | Bacteria | 1669 |
| 386 | Ga0105240_10591030 | 3300009093 | Bacteria | 1223 |
| 387 | Ga0105240_11260722 | 3300009093 | Bacteria | 781 |
| 388 | Ga0111539_10053820 | 3300009094 | Bacteria | 4791 |
| 389 | Ga0111539_10097257 | 3300009094 | Bacteria | 3458 |
| 390 | Ga0111539_10235363 | 3300009094 | Bacteria | 2132 |
| 391 | Ga0111539_11487499 | 3300009094 | Bacteria | 785 |
| 392 | Ga0111539_12082726 | 3300009094 | Bacteria | 658 |
| 393 | Ga0105245_10344923 | 3300009098 | Bacteria | 1474 |
| 394 | Ga0105245_11140814 | 3300009098 | Unclassified | 826 |
| 395 | Ga0105247_10001018 | 3300009101 | Bacteria | 21121 |
| 396 | Ga0105247_10023608 | 3300009101 | Bacteria | 3705 |
| 397 | Ga0105247_10274601 | 3300009101 | Unclassified | 1161 |
| 398 | Ga0105247_10360463 | 3300009101 | Bacteria | 1025 |
| 399 | Ga0114129_10149925 | 3300009147 | Bacteria | 3192 |
| 400 | Ga0114129_10281430 | 3300009147 | Bacteria | 2222 |
| 401 | Ga0105241_10000105 | 3300009174 | Bacteria | 60020 |
| 402 | Ga0105241_10000409 | 3300009174 | Bacteria | 32453 |
| 403 | Ga0105241_10128074 | 3300009174 | Bacteria | 2052 |
| 404 | Ga0105241_10508904 | 3300009174 | Bacteria | 1075 |
| 405 | Ga0105242_10015763 | 3300009176 | Bacteria | 5871 |
| 406 | Ga0105242_10032865 | 3300009176 | Bacteria | 4151 |
| 407 | Ga0105242_10138406 | 3300009176 | Bacteria | 2110 |
| 408 | Ga0105242_10153451 | 3300009176 | Bacteria | 2010 |
| 409 | Ga0105242_10340756 | 3300009176 | Bacteria | 1381 |
| 410 | Ga0105242_10363839 | 3300009176 | Bacteria | 1339 |
| 411 | Ga0105242_10869702 | 3300009176 | Bacteria | 899 |
| 412 | Ga0105248_10017734 | 3300009177 | Bacteria | 7851 |
| 413 | Ga0105248_11136403 | 3300009177 | Unclassified | 883 |
| 414 | Ga0105248_11814899 | 3300009177 | Bacteria | 692 |
| 415 | Ga0105237_10004076 | 3300009545 | Bacteria | 17037 |
| 416 | Ga0105237_10023667 | 3300009545 | Bacteria | 6290 |
| 417 | Ga0105237_10048216 | 3300009545 | Bacteria | 4281 |
| 418 | Ga0105237_10076060 | 3300009545 | Bacteria | 3348 |
| 419 | Ga0105237_10101891 | 3300009545 | Bacteria | 2863 |
| 420 | Ga0105237_10271562 | 3300009545 | Bacteria | 1698 |
| 421 | Ga0105237_11773460 | 3300009545 | Bacteria | 625 |
| 422 | Ga0105238_10088462 | 3300009551 | Bacteria | 3084 |
| 423 | Ga0105238_10095813 | 3300009551 | Bacteria | 2954 |
| 424 | Ga0105238_10338288 | 3300009551 | Bacteria | 1493 |
| 425 | Ga0105238_10551558 | 3300009551 | Bacteria | 1157 |
| 426 | Ga0105249_10001776 | 3300009553 | Bacteria | 18798 |
| 427 | Ga0105249_10005977 | 3300009553 | Bacteria | 10546 |
| 428 | Ga0105249_10011518 | 3300009553 | Bacteria | 7772 |
| 429 | Ga0105249_10073101 | 3300009553 | Bacteria | 3171 |
| 430 | Ga0105249_10233662 | 3300009553 | Bacteria | 1814 |
| 431 | Ga0105249_10260342 | 3300009553 | Bacteria | 1723 |
| 432 | Ga0105249_10304678 | 3300009553 | Bacteria | 1599 |
| 433 | Ga0105249_10479288 | 3300009553 | Bacteria | 1287 |
| 434 | Ga0105249_11590074 | 3300009553 | Bacteria | 726 |
| 435 | Ga0105239_10000169 | 3300010375 | Bacteria | 93659 |
| 436 | Ga0105239_10060010 | 3300010375 | Bacteria | 4174 |
| 437 | Ga0105239_10092220 | 3300010375 | Bacteria | 3343 |
| 438 | Ga0105239_10106272 | 3300010375 | Bacteria | 3109 |
| 439 | Ga0105239_10165836 | 3300010375 | Bacteria | 2470 |
| 440 | Ga0105239_10836402 | 3300010375 | Bacteria | 1055 |
| 441 | Ga0105239_11196954 | 3300010375 | Bacteria | 875 |
| 442 | Ga0105246_10019205 | 3300011119 | Bacteria | 4363 |
| 443 | Ga0105246_10238300 | 3300011119 | Bacteria | 1437 |
| 444 | Ga0105246_10665523 | 3300011119 | Bacteria | 908 |
| 445 | Ga0157373_10108073 | 3300013100 | Bacteria | 1956 |
| 446 | Ga0157373_10160933 | 3300013100 | Bacteria | 1579 |
| 447 | Ga0157373_10215081 | 3300013100 | Bacteria | 1355 |
| 448 | Ga0157373_10483951 | 3300013100 | Bacteria | 893 |
| 449 | Ga0157371_10008021 | 3300013102 | Bacteria | 8454 |
| 450 | Ga0157371_10092139 | 3300013102 | Bacteria | 2147 |
| 451 | Ga0157371_10130865 | 3300013102 | Bacteria | 1785 |
| 452 | Ga0157371_10159985 | 3300013102 | Bacteria | 1608 |
| 453 | Ga0157371_10686210 | 3300013102 | Bacteria | 766 |
| 454 | Ga0157370_10000702 | 3300013104 | Bacteria | 41838 |
| 455 | Ga0157370_10003524 | 3300013104 | Bacteria | 18349 |
| 456 | Ga0157370_10033102 | 3300013104 | Bacteria | 5039 |
| 457 | Ga0157370_10409490 | 3300013104 | Bacteria | 1248 |
| 458 | Ga0157370_10583025 | 3300013104 | Bacteria | 1024 |
| 459 | Ga0157370_10585237 | 3300013104 | Bacteria | 1022 |
| 460 | Ga0157370_10765700 | 3300013104 | Bacteria | 879 |
| 461 | Ga0157370_11031861 | 3300013104 | Bacteria | 744 |
| 462 | Ga0157369_10030867 | 3300013105 | Bacteria | 5908 |
| 463 | Ga0157369_10053158 | 3300013105 | Bacteria | 4379 |
| 464 | Ga0157369_10111735 | 3300013105 | Bacteria | 2904 |
| 465 | Ga0157369_10116206 | 3300013105 | Bacteria | 2841 |
| 466 | Ga0157369_10209164 | 3300013105 | Bacteria | 2045 |
| 467 | Ga0157369_10424662 | 3300013105 | Bacteria | 1378 |
| 468 | Ga0157369_10431956 | 3300013105 | Bacteria | 1365 |
| 469 | Ga0157369_10556095 | 3300013105 | Bacteria | 1186 |
| 470 | Ga0157369_10733862 | 3300013105 | Bacteria | 1017 |
| 471 | Ga0157369_10760484 | 3300013105 | Bacteria | 996 |
| 472 | Ga0157369_10923213 | 3300013105 | Bacteria | 895 |
| 473 | Ga0157374_10000001 | 3300013296 | Bacteria | 1077351 |
| 474 | Ga0157374_10000467 | 3300013296 | Bacteria | 36724 |
| 475 | Ga0157374_10006039 | 3300013296 | Bacteria | 10246 |
| 476 | Ga0157374_10010548 | 3300013296 | Bacteria | 7953 |
| 477 | Ga0157374_10011894 | 3300013296 | Bacteria | 7552 |
| 478 | Ga0157374_10013945 | 3300013296 | Bacteria | 7025 |
| 479 | Ga0157374_10025397 | 3300013296 | Bacteria | 5319 |
| 480 | Ga0157374_10030157 | 3300013296 | Bacteria | 4921 |
| 481 | Ga0157374_10191681 | 3300013296 | Bacteria | 2000 |
| 482 | Ga0157374_11222886 | 3300013296 | Bacteria | 773 |
| 483 | Ga0157374_11285650 | 3300013296 | Bacteria | 753 |
| 484 | Ga0157378_10004966 | 3300013297 | Bacteria | 11663 |
| 485 | Ga0157378_10006197 | 3300013297 | Bacteria | 10468 |
| 486 | Ga0157378_10007156 | 3300013297 | Bacteria | 9746 |
| 487 | Ga0157378_10018840 | 3300013297 | Bacteria | 6067 |
| 488 | Ga0157378_10029260 | 3300013297 | Bacteria | 4862 |
| 489 | Ga0157378_10053226 | 3300013297 | Bacteria | 3604 |
| 490 | Ga0157378_10079954 | 3300013297 | Bacteria | 2952 |
| 491 | Ga0157378_10091216 | 3300013297 | Bacteria | 2770 |
| 492 | Ga0157378_10099175 | 3300013297 | Bacteria | 2657 |
| 493 | Ga0157378_10239975 | 3300013297 | Bacteria | 1731 |
| 494 | Ga0157378_10306130 | 3300013297 | Bacteria | 1539 |
| 495 | Ga0157378_10564528 | 3300013297 | Unclassified | 1145 |
| 496 | Ga0157378_10809866 | 3300013297 | Unclassified | 963 |
| 497 | Ga0157378_11266256 | 3300013297 | Bacteria | 778 |
| 498 | Ga0163162_10000216 | 3300013306 | Bacteria | 52917 |
| 499 | Ga0163162_10000340 | 3300013306 | Bacteria | 42478 |
| 500 | Ga0163162_10014241 | 3300013306 | Bacteria | 7769 |
| 501 | Ga0163162_10015824 | 3300013306 | Bacteria | 7370 |
| 502 | Ga0163162_10016379 | 3300013306 | Bacteria | 7245 |
| 503 | Ga0163162_10025721 | 3300013306 | Bacteria | 5819 |
| 504 | Ga0163162_10029068 | 3300013306 | Bacteria | 5469 |
| 505 | Ga0163162_10030765 | 3300013306 | Bacteria | 5319 |
| 506 | Ga0163162_10085780 | 3300013306 | Bacteria | 3226 |
| 507 | Ga0163162_10151654 | 3300013306 | Bacteria | 2436 |
| 508 | Ga0163162_10179822 | 3300013306 | Bacteria | 2241 |
| 509 | Ga0163162_10193340 | 3300013306 | Bacteria | 2162 |
| 510 | Ga0163162_10246087 | 3300013306 | Bacteria | 1920 |
| 511 | Ga0163162_10275675 | 3300013306 | Bacteria | 1814 |
| 512 | Ga0163162_10356500 | 3300013306 | Bacteria | 1595 |
| 513 | Ga0163162_10853390 | 3300013306 | Bacteria | 1026 |
| 514 | Ga0163162_11059365 | 3300013306 | Unclassified | 918 |
| 515 | Ga0157372_10000644 | 3300013307 | Bacteria | 38351 |
| 516 | Ga0157372_10008033 | 3300013307 | Bacteria | 11221 |
| 517 | Ga0157372_10008498 | 3300013307 | Bacteria | 10897 |
| 518 | Ga0157372_10020735 | 3300013307 | Bacteria | 7095 |
| 519 | Ga0157372_10037566 | 3300013307 | Bacteria | 5343 |
| 520 | Ga0157372_10037958 | 3300013307 | Bacteria | 5315 |
| 521 | Ga0157372_10083781 | 3300013307 | Bacteria | 3612 |
| 522 | Ga0157372_10129397 | 3300013307 | Bacteria | 2904 |
| 523 | Ga0157372_10190275 | 3300013307 | Bacteria | 2377 |
| 524 | Ga0157372_10227672 | 3300013307 | Bacteria | 2161 |
| 525 | Ga0157372_10375413 | 3300013307 | Bacteria | 1657 |
| 526 | Ga0157372_10392189 | 3300013307 | Bacteria | 1618 |
| 527 | Ga0157372_10454228 | 3300013307 | Bacteria | 1493 |
| 528 | Ga0157372_10462667 | 3300013307 | Bacteria | 1478 |
| 529 | Ga0157372_10501245 | 3300013307 | Bacteria | 1416 |
| 530 | Ga0157372_10529591 | 3300013307 | Bacteria | 1373 |
| 531 | Ga0157372_10844337 | 3300013307 | Bacteria | 1063 |
| 532 | Ga0157372_11006915 | 3300013307 | Bacteria | 965 |
| 533 | Ga0157372_11073744 | 3300013307 | Bacteria | 932 |
| 534 | Ga0157372_11533599 | 3300013307 | Bacteria | 767 |
| 535 | Ga0157372_11708176 | 3300013307 | Bacteria | 724 |
| 536 | Ga0157372_11975846 | 3300013307 | Bacteria | 670 |
| 537 | Ga0157375_10000073 | 3300013308 | Bacteria | 105972 |
| 538 | Ga0157375_10004239 | 3300013308 | Bacteria | 12439 |
| 539 | Ga0157375_10009790 | 3300013308 | Bacteria | 8426 |
| 540 | Ga0157375_10024709 | 3300013308 | Bacteria | 5566 |
| 541 | Ga0157375_10040227 | 3300013308 | Bacteria | 4505 |
| 542 | Ga0157375_10041079 | 3300013308 | Bacteria | 4464 |
| 543 | Ga0157375_10147483 | 3300013308 | Bacteria | 2485 |
| 544 | Ga0157375_10163864 | 3300013308 | Bacteria | 2367 |
| 545 | Ga0157375_10214304 | 3300013308 | Bacteria | 2083 |
| 546 | Ga0157375_10240866 | 3300013308 | Bacteria | 1969 |
| 547 | Ga0157375_10294176 | 3300013308 | Bacteria | 1787 |
| 548 | Ga0157375_10461375 | 3300013308 | Bacteria | 1436 |
| 549 | Ga0157375_10780719 | 3300013308 | Bacteria | 1105 |
| 550 | Ga0163163_10000198 | 3300014325 | Bacteria | 62120 |
| 551 | Ga0163163_10000317 | 3300014325 | Bacteria | 47023 |
| 552 | Ga0163163_10000349 | 3300014325 | Bacteria | 44503 |
| 553 | Ga0163163_10073545 | 3300014325 | Bacteria | 3409 |
| 554 | Ga0163163_10166550 | 3300014325 | Bacteria | 2250 |
| 555 | Ga0163163_10345148 | 3300014325 | Bacteria | 1544 |
| 556 | Ga0163163_10541579 | 3300014325 | Bacteria | 1226 |
| 557 | Ga0163163_10831602 | 3300014325 | Bacteria | 987 |
| 558 | Ga0157380_10014224 | 3300014326 | Bacteria | 5820 |
| 559 | Ga0157380_10158134 | 3300014326 | Bacteria | 1966 |
| 560 | Ga0157380_10172983 | 3300014326 | Bacteria | 1889 |
| 561 | Ga0157380_10410428 | 3300014326 | Bacteria | 1288 |
| 562 | Ga0157377_10005505 | 3300014745 | Bacteria | 5959 |
| 563 | Ga0157377_10021020 | 3300014745 | Bacteria | 3427 |
| 564 | Ga0157377_10024497 | 3300014745 | Bacteria | 3208 |
| 565 | Ga0157377_10030355 | 3300014745 | Bacteria | 2927 |
| 566 | Ga0157377_10152721 | 3300014745 | Bacteria | 1429 |
| 567 | Ga0157377_10203908 | 3300014745 | Bacteria | 1257 |
| 568 | Ga0157377_10258777 | 3300014745 | Bacteria | 1131 |
| 569 | Ga0157377_10441861 | 3300014745 | Bacteria | 896 |
| 570 | Ga0157379_10000068 | 3300014968 | Bacteria | 65388 |
| 571 | Ga0157379_10100975 | 3300014968 | Bacteria | 2589 |
| 572 | Ga0157379_10103098 | 3300014968 | Bacteria | 2560 |
| 573 | Ga0157379_10121430 | 3300014968 | Bacteria | 2350 |
| 574 | Ga0157379_10740742 | 3300014968 | Bacteria | 925 |
| 575 | Ga0157376_10000743 | 3300014969 | Bacteria | 21197 |
| 576 | Ga0157376_10003830 | 3300014969 | Bacteria | 10401 |
| 577 | Ga0157376_10036543 | 3300014969 | Bacteria | 3980 |
| 578 | Ga0157376_10118858 | 3300014969 | Bacteria | 2339 |
| 579 | Ga0157376_10210757 | 3300014969 | Bacteria | 1794 |
| 580 | Ga0157376_10268264 | 3300014969 | Bacteria | 1602 |
| 581 | Ga0157376_10282613 | 3300014969 | Bacteria | 1563 |
| 582 | Ga0157376_10378867 | 3300014969 | Bacteria | 1362 |
| 583 | Ga0157376_10382771 | 3300014969 | Bacteria | 1356 |
| 584 | Ga0157376_10485072 | 3300014969 | Bacteria | 1212 |
| 585 | Ga0157376_10559517 | 3300014969 | Bacteria | 1133 |
| 586 | Ga0157376_10886761 | 3300014969 | Bacteria | 909 |
| 587 | Ga0157376_11055359 | 3300014969 | Bacteria | 837 |
| 588 | Ga0157376_11287436 | 3300014969 | Bacteria | 761 |
| 589 | Ga0182006_1074727 | 3300015261 | Bacteria | 1248 |
| 590 | Ga0163161_10004591 | 3300017792 | Bacteria | 9611 |
| 591 | Ga0163161_10082195 | 3300017792 | Bacteria | 2373 |
| 592 | Ga0163161_10106832 | 3300017792 | Bacteria | 2089 |
| 593 | Ga0163161_10129337 | 3300017792 | Bacteria | 1903 |
| 594 | Ga0163161_10134377 | 3300017792 | Bacteria | 1868 |
| 595 | Ga0163161_10172690 | 3300017792 | Bacteria | 1653 |
| 596 | Ga0163161_10830251 | 3300017792 | Bacteria | 779 |
| 597 | Ga0163161_11456010 | 3300017792 | Unclassified | 600 |
| 598 | Ga0206356_11546257 | 3300020070 | Bacteria | 1070 |
| 599 | Ga0206352_10812222 | 3300020078 | Bacteria | 2503 |
| 600 | Ga0206350_11250461 | 3300020080 | Bacteria | 1292 |
| 601 | Ga0213876_10005547 | 3300021384 | Bacteria | 6926 |
| 602 | Ga0213876_10057389 | 3300021384 | Bacteria | 2055 |
| 603 | Ga0209646_1000002 | 3300025246 | Bacteria | 1425781 |
| 604 | Ga0209026_1000636 | 3300025250 | Bacteria | 21832 |
| 605 | Ga0209129_1006296 | 3300025258 | Bacteria | 3890 |
| 606 | Ga0209673_1000096 | 3300025273 | Bacteria | 194819 |
| 607 | Ga0209564_1004313 | 3300025295 | Bacteria | 8791 |
| 608 | Ga0209758_1006557 | 3300025297 | Bacteria | 8284 |
| 609 | Ga0209050_1000207 | 3300025298 | Bacteria | 131328 |
| 610 | Ga0207426_1000032 | 3300025302 | Bacteria | 457997 |
| 611 | Ga0207426_1000571 | 3300025302 | Bacteria | 49864 |
| 612 | Ga0207426_1001515 | 3300025302 | Bacteria | 18962 |
| 613 | Ga0207426_1128265 | 3300025302 | Bacteria | 618 |
| 614 | Ga0209051_1036433 | 3300025303 | Bacteria | 1816 |
| 615 | Ga0209257_1002636 | 3300025304 | Bacteria | 17286 |
| 616 | Ga0207697_10082832 | 3300025315 | Bacteria | 1353 |
| 617 | Ga0207697_10111384 | 3300025315 | Bacteria | 1172 |
| 618 | Ga0207656_10001620 | 3300025321 | Bacteria | 7493 |
| 619 | Ga0207656_10185129 | 3300025321 | Bacteria | 1001 |
| 620 | Ga0207682_10003590 | 3300025893 | Bacteria | 6705 |
| 621 | Ga0207682_10005649 | 3300025893 | Bacteria | 5086 |
| 622 | Ga0207682_10020997 | 3300025893 | Bacteria | 2568 |
| 623 | Ga0207682_10035862 | 3300025893 | Bacteria | 2005 |
| 624 | Ga0207642_10147140 | 3300025899 | Bacteria | 1249 |
| 625 | Ga0207642_10368812 | 3300025899 | Unclassified | 852 |
| 626 | Ga0207710_10000660 | 3300025900 | Bacteria | 19517 |
| 627 | Ga0207688_10054638 | 3300025901 | Bacteria | 2241 |
| 628 | Ga0207688_10142761 | 3300025901 | Bacteria | 1410 |
| 629 | Ga0207680_10000358 | 3300025903 | Bacteria | 21841 |
| 630 | Ga0207680_10177361 | 3300025903 | Bacteria | 1439 |
| 631 | Ga0207647_10026855 | 3300025904 | Bacteria | 3761 |
| 632 | Ga0207647_10043529 | 3300025904 | Bacteria | 2809 |
| 633 | Ga0207647_10073901 | 3300025904 | Bacteria | 2054 |
| 634 | Ga0207647_10175810 | 3300025904 | Bacteria | 1245 |
| 635 | Ga0207647_10212752 | 3300025904 | Bacteria | 1116 |
| 636 | Ga0207685_10089665 | 3300025905 | Bacteria | 1291 |
| 637 | Ga0207645_10001770 | 3300025907 | Bacteria | 17477 |
| 638 | Ga0207645_10005531 | 3300025907 | Bacteria | 9152 |
| 639 | Ga0207645_10009423 | 3300025907 | Bacteria | 6754 |
| 640 | Ga0207645_10032558 | 3300025907 | Bacteria | 3351 |
| 641 | Ga0207645_10036823 | 3300025907 | Bacteria | 3141 |
| 642 | Ga0207645_10455260 | 3300025907 | Bacteria | 864 |
| 643 | Ga0207643_10051826 | 3300025908 | Bacteria | 2330 |
| 644 | Ga0207643_10067206 | 3300025908 | Bacteria | 2057 |
| 645 | Ga0207705_10001320 | 3300025909 | Bacteria | 19878 |
| 646 | Ga0207705_10852783 | 3300025909 | Bacteria | 706 |
| 647 | Ga0207654_10004759 | 3300025911 | Bacteria | 6876 |
| 648 | Ga0207654_10010844 | 3300025911 | Bacteria | 4640 |
| 649 | Ga0207654_10420566 | 3300025911 | Bacteria | 932 |
| 650 | Ga0207654_10455608 | 3300025911 | Bacteria | 897 |
| 651 | Ga0207707_10000508 | 3300025912 | Bacteria | 39968 |
| 652 | Ga0207707_10163668 | 3300025912 | Bacteria | 1944 |
| 653 | Ga0207695_10000064 | 3300025913 | Bacteria | 346010 |
| 654 | Ga0207695_10000232 | 3300025913 | Bacteria | 147559 |
| 655 | Ga0207695_10000962 | 3300025913 | Bacteria | 51331 |
| 656 | Ga0207695_10001292 | 3300025913 | Bacteria | 42510 |
| 657 | Ga0207695_10007602 | 3300025913 | Bacteria | 13737 |
| 658 | Ga0207695_10021717 | 3300025913 | Bacteria | 7316 |
| 659 | Ga0207695_10039381 | 3300025913 | Bacteria | 5081 |
| 660 | Ga0207695_10092967 | 3300025913 | Bacteria | 3026 |
| 661 | Ga0207695_10169923 | 3300025913 | Bacteria | 2106 |
| 662 | Ga0207695_10234773 | 3300025913 | Bacteria | 1737 |
| 663 | Ga0207695_10306208 | 3300025913 | Bacteria | 1479 |
| 664 | Ga0207695_10776616 | 3300025913 | Bacteria | 838 |
| 665 | Ga0207671_10011633 | 3300025914 | Bacteria | 7142 |
| 666 | Ga0207671_10045087 | 3300025914 | Bacteria | 3260 |
| 667 | Ga0207671_10053729 | 3300025914 | Bacteria | 2985 |
| 668 | Ga0207671_10120255 | 3300025914 | Bacteria | 2007 |
| 669 | Ga0207671_10127010 | 3300025914 | Bacteria | 1954 |
| 670 | Ga0207671_10232143 | 3300025914 | Bacteria | 1448 |
| 671 | Ga0207663_10735304 | 3300025916 | Bacteria | 783 |
| 672 | Ga0207660_10000325 | 3300025917 | Bacteria | 30850 |
| 673 | Ga0207660_10053302 | 3300025917 | Bacteria | 2882 |
| 674 | Ga0207662_10026414 | 3300025918 | Bacteria | 3349 |
| 675 | Ga0207657_10007324 | 3300025919 | Bacteria | 11321 |
| 676 | Ga0207657_10623355 | 3300025919 | Bacteria | 841 |
| 677 | Ga0207649_10020991 | 3300025920 | Bacteria | 3752 |
| 678 | Ga0207649_10037078 | 3300025920 | Bacteria | 2942 |
| 679 | Ga0207649_10193168 | 3300025920 | Bacteria | 1433 |
| 680 | Ga0207649_10367567 | 3300025920 | Bacteria | 1069 |
| 681 | Ga0207652_10000186 | 3300025921 | Bacteria | 65493 |
| 682 | Ga0207652_10028861 | 3300025921 | Bacteria | 4631 |
| 683 | Ga0207652_10335846 | 3300025921 | Bacteria | 1364 |
| 684 | Ga0207681_10004291 | 3300025923 | Bacteria | 8799 |
| 685 | Ga0207681_10078362 | 3300025923 | Bacteria | 2325 |
| 686 | Ga0207681_10115209 | 3300025923 | Bacteria | 1962 |
| 687 | Ga0207681_10247944 | 3300025923 | Bacteria | 1389 |
| 688 | Ga0207681_10344589 | 3300025923 | Bacteria | 1191 |
| 689 | Ga0207694_10019981 | 3300025924 | Bacteria | 5067 |
| 690 | Ga0207694_10063603 | 3300025924 | Bacteria | 2874 |
| 691 | Ga0207694_10121635 | 3300025924 | Bacteria | 2085 |
| 692 | Ga0207650_10024745 | 3300025925 | Bacteria | 4272 |
| 693 | Ga0207650_10047200 | 3300025925 | Bacteria | 3173 |
| 694 | Ga0207650_10076949 | 3300025925 | Bacteria | 2521 |
| 695 | Ga0207650_10089102 | 3300025925 | Bacteria | 2354 |
| 696 | Ga0207650_10132694 | 3300025925 | Bacteria | 1951 |
| 697 | Ga0207650_10199954 | 3300025925 | Bacteria | 1600 |
| 698 | Ga0207650_10211526 | 3300025925 | Bacteria | 1557 |
| 699 | Ga0207650_10448912 | 3300025925 | Bacteria | 1073 |
| 700 | Ga0207650_10545425 | 3300025925 | Unclassified | 972 |
| 701 | Ga0207650_10599240 | 3300025925 | Bacteria | 926 |
| 702 | Ga0207650_10881349 | 3300025925 | Bacteria | 760 |
| 703 | Ga0207659_10012333 | 3300025926 | Bacteria | 5435 |
| 704 | Ga0207659_10032047 | 3300025926 | Bacteria | 3604 |
| 705 | Ga0207659_10033426 | 3300025926 | Bacteria | 3540 |
| 706 | Ga0207659_10042754 | 3300025926 | Bacteria | 3178 |
| 707 | Ga0207659_10057528 | 3300025926 | Bacteria | 2788 |
| 708 | Ga0207659_10103650 | 3300025926 | Bacteria | 2150 |
| 709 | Ga0207659_10205603 | 3300025926 | Bacteria | 1575 |
| 710 | Ga0207659_10283219 | 3300025926 | Bacteria | 1356 |
| 711 | Ga0207659_10553967 | 3300025926 | Bacteria | 977 |
| 712 | Ga0207659_10571116 | 3300025926 | Bacteria | 962 |
| 713 | Ga0207659_11329623 | 3300025926 | Bacteria | 617 |
| 714 | Ga0207687_10201639 | 3300025927 | Bacteria | 1555 |
| 715 | Ga0207687_10928734 | 3300025927 | Unclassified | 745 |
| 716 | Ga0207700_10752904 | 3300025928 | Bacteria | 870 |
| 717 | Ga0207644_10011186 | 3300025931 | Bacteria | 5931 |
| 718 | Ga0207644_10087334 | 3300025931 | Bacteria | 2318 |
| 719 | Ga0207644_10519265 | 3300025931 | Bacteria | 984 |
| 720 | Ga0207644_10698764 | 3300025931 | Bacteria | 846 |
| 721 | Ga0207644_10700500 | 3300025931 | Bacteria | 844 |
| 722 | Ga0207644_10940290 | 3300025931 | Bacteria | 725 |
| 723 | Ga0207690_10016626 | 3300025932 | Bacteria | 4481 |
| 724 | Ga0207690_10018204 | 3300025932 | Bacteria | 4306 |
| 725 | Ga0207690_10060439 | 3300025932 | Bacteria | 2572 |
| 726 | Ga0207690_10195529 | 3300025932 | Bacteria | 1532 |
| 727 | Ga0207690_10250183 | 3300025932 | Bacteria | 1369 |
| 728 | Ga0207706_10000817 | 3300025933 | Bacteria | 32335 |
| 729 | Ga0207706_10014975 | 3300025933 | Bacteria | 7022 |
| 730 | Ga0207706_10023585 | 3300025933 | Bacteria | 5525 |
| 731 | Ga0207706_10023834 | 3300025933 | Bacteria | 5491 |
| 732 | Ga0207706_10039589 | 3300025933 | Bacteria | 4179 |
| 733 | Ga0207706_10069820 | 3300025933 | Bacteria | 3090 |
| 734 | Ga0207706_10363858 | 3300025933 | Bacteria | 1256 |
| 735 | Ga0207706_10470393 | 3300025933 | Bacteria | 1086 |
| 736 | Ga0207706_10914297 | 3300025933 | Bacteria | 741 |
| 737 | Ga0207686_10013527 | 3300025934 | Bacteria | 4517 |
| 738 | Ga0207686_10037065 | 3300025934 | Bacteria | 2940 |
| 739 | Ga0207686_10058746 | 3300025934 | Bacteria | 2426 |
| 740 | Ga0207686_10339804 | 3300025934 | Bacteria | 1127 |
| 741 | Ga0207686_10387450 | 3300025934 | Bacteria | 1061 |
| 742 | Ga0207686_10941078 | 3300025934 | Bacteria | 699 |
| 743 | Ga0207670_10011420 | 3300025936 | Bacteria | 5156 |
| 744 | Ga0207670_10032249 | 3300025936 | Bacteria | 3367 |
| 745 | Ga0207670_10066017 | 3300025936 | Bacteria | 2485 |
| 746 | Ga0207670_10327013 | 3300025936 | Bacteria | 1208 |
| 747 | Ga0207670_10436479 | 3300025936 | Bacteria | 1053 |
| 748 | Ga0207670_10570414 | 3300025936 | Bacteria | 927 |
| 749 | Ga0207670_11065018 | 3300025936 | Unclassified | 682 |
| 750 | Ga0207669_10011306 | 3300025937 | Bacteria | 4337 |
| 751 | Ga0207704_10059774 | 3300025938 | Bacteria | 2355 |
| 752 | Ga0207704_10060251 | 3300025938 | Bacteria | 2347 |
| 753 | Ga0207704_10331775 | 3300025938 | Bacteria | 1177 |
| 754 | Ga0207704_10594348 | 3300025938 | Bacteria | 905 |
| 755 | Ga0207704_10659050 | 3300025938 | Bacteria | 863 |
| 756 | Ga0207704_11358113 | 3300025938 | Bacteria | 608 |
| 757 | Ga0207691_10000113 | 3300025940 | Bacteria | 72765 |
| 758 | Ga0207691_10026487 | 3300025940 | Bacteria | 5439 |
| 759 | Ga0207691_10040071 | 3300025940 | Bacteria | 4331 |
| 760 | Ga0207691_10061953 | 3300025940 | Bacteria | 3396 |
| 761 | Ga0207691_10108177 | 3300025940 | Bacteria | 2475 |
| 762 | Ga0207691_10133438 | 3300025940 | Bacteria | 2192 |
| 763 | Ga0207691_10137359 | 3300025940 | Bacteria | 2155 |
| 764 | Ga0207691_10241404 | 3300025940 | Bacteria | 1562 |
| 765 | Ga0207691_10255036 | 3300025940 | Bacteria | 1513 |
| 766 | Ga0207691_11010424 | 3300025940 | Bacteria | 694 |
| 767 | Ga0207711_10021040 | 3300025941 | Bacteria | 5448 |
| 768 | Ga0207711_10131935 | 3300025941 | Bacteria | 2241 |
| 769 | Ga0207689_10001136 | 3300025942 | Bacteria | 25671 |
| 770 | Ga0207689_10010264 | 3300025942 | Bacteria | 8067 |
| 771 | Ga0207689_10024823 | 3300025942 | Bacteria | 5025 |
| 772 | Ga0207689_10026316 | 3300025942 | Bacteria | 4871 |
| 773 | Ga0207689_10072661 | 3300025942 | Bacteria | 2826 |
| 774 | Ga0207689_10100304 | 3300025942 | Bacteria | 2379 |
| 775 | Ga0207689_10186232 | 3300025942 | Bacteria | 1712 |
| 776 | Ga0207689_10378777 | 3300025942 | Bacteria | 1178 |
| 777 | Ga0207689_10432450 | 3300025942 | Unclassified | 1099 |
| 778 | Ga0207689_10477186 | 3300025942 | Bacteria | 1044 |
| 779 | Ga0207661_10003908 | 3300025944 | Bacteria | 10400 |
| 780 | Ga0207661_10013720 | 3300025944 | Bacteria | 5917 |
| 781 | Ga0207661_10091142 | 3300025944 | Bacteria | 2539 |
| 782 | Ga0207661_10262038 | 3300025944 | Bacteria | 1540 |
| 783 | Ga0207661_10407822 | 3300025944 | Bacteria | 1233 |
| 784 | Ga0207661_11070118 | 3300025944 | Unclassified | 743 |
| 785 | Ga0207679_10013851 | 3300025945 | Bacteria | 5288 |
| 786 | Ga0207679_10034020 | 3300025945 | Bacteria | 3592 |
| 787 | Ga0207679_10042990 | 3300025945 | Bacteria | 3250 |
| 788 | Ga0207679_10229675 | 3300025945 | Bacteria | 1566 |
| 789 | Ga0207679_10565632 | 3300025945 | Bacteria | 1021 |
| 790 | Ga0207679_10635601 | 3300025945 | Bacteria | 964 |
| 791 | Ga0207679_10827836 | 3300025945 | Bacteria | 845 |
| 792 | Ga0207679_10933429 | 3300025945 | Unclassified | 794 |
| 793 | Ga0207667_10000111 | 3300025949 | Bacteria | 131758 |
| 794 | Ga0207667_10001859 | 3300025949 | Bacteria | 26535 |
| 795 | Ga0207667_10019146 | 3300025949 | Bacteria | 7655 |
| 796 | Ga0207667_10032868 | 3300025949 | Bacteria | 5584 |
| 797 | Ga0207667_10082302 | 3300025949 | Bacteria | 3335 |
| 798 | Ga0207667_10178668 | 3300025949 | Bacteria | 2180 |
| 799 | Ga0207651_10001967 | 3300025960 | Bacteria | 9662 |
| 800 | Ga0207651_10044765 | 3300025960 | Bacteria | 2965 |
| 801 | Ga0207651_10056442 | 3300025960 | Bacteria | 2703 |
| 802 | Ga0207651_10098903 | 3300025960 | Bacteria | 2159 |
| 803 | Ga0207651_10115601 | 3300025960 | Bacteria | 2023 |
| 804 | Ga0207651_10211469 | 3300025960 | Bacteria | 1561 |
| 805 | Ga0207651_10246036 | 3300025960 | Bacteria | 1460 |
| 806 | Ga0207651_10418444 | 3300025960 | Bacteria | 1143 |
| 807 | Ga0207651_10509342 | 3300025960 | Bacteria | 1042 |
| 808 | Ga0207712_10006120 | 3300025961 | Bacteria | 7587 |
| 809 | Ga0207712_10011688 | 3300025961 | Bacteria | 5598 |
| 810 | Ga0207712_10058784 | 3300025961 | Bacteria | 2718 |
| 811 | Ga0207712_10086477 | 3300025961 | Bacteria | 2296 |
| 812 | Ga0207712_10096035 | 3300025961 | Bacteria | 2193 |
| 813 | Ga0207712_10119075 | 3300025961 | Bacteria | 1994 |
| 814 | Ga0207712_10148782 | 3300025961 | Bacteria | 1806 |
| 815 | Ga0207712_10449733 | 3300025961 | Bacteria | 1092 |
| 816 | Ga0207668_10003018 | 3300025972 | Bacteria | 9866 |
| 817 | Ga0207668_10134873 | 3300025972 | Bacteria | 1890 |
| 818 | Ga0207640_10064000 | 3300025981 | Bacteria | 2447 |
| 819 | Ga0207640_10147802 | 3300025981 | Bacteria | 1722 |
| 820 | Ga0207640_10233590 | 3300025981 | Bacteria | 1416 |
| 821 | Ga0207640_10249993 | 3300025981 | Bacteria | 1375 |
| 822 | Ga0207640_10528620 | 3300025981 | Bacteria | 987 |
| 823 | Ga0207640_10640949 | 3300025981 | Bacteria | 904 |
| 824 | Ga0207658_10000759 | 3300025986 | Bacteria | 27690 |
| 825 | Ga0207658_10013459 | 3300025986 | Bacteria | 5589 |
| 826 | Ga0207658_10027901 | 3300025986 | Bacteria | 3971 |
| 827 | Ga0207658_10089800 | 3300025986 | Bacteria | 2380 |
| 828 | Ga0207658_10089965 | 3300025986 | Bacteria | 2378 |
| 829 | Ga0207658_10261211 | 3300025986 | Bacteria | 1476 |
| 830 | Ga0207658_10276433 | 3300025986 | Bacteria | 1438 |
| 831 | Ga0207658_10282066 | 3300025986 | Bacteria | 1424 |
| 832 | Ga0207658_10464408 | 3300025986 | Bacteria | 1122 |
| 833 | Ga0207658_10470979 | 3300025986 | Bacteria | 1115 |
| 834 | Ga0207677_10005254 | 3300026023 | Bacteria | 7013 |
| 835 | Ga0207677_10007331 | 3300026023 | Bacteria | 6092 |
| 836 | Ga0207677_10020140 | 3300026023 | Bacteria | 4045 |
| 837 | Ga0207677_10146203 | 3300026023 | Bacteria | 1817 |
| 838 | Ga0207677_10147283 | 3300026023 | Bacteria | 1811 |
| 839 | Ga0207677_10211811 | 3300026023 | Bacteria | 1548 |
| 840 | Ga0207677_10301311 | 3300026023 | Bacteria | 1324 |
| 841 | Ga0207677_10514140 | 3300026023 | Bacteria | 1038 |
| 842 | Ga0207677_10558142 | 3300026023 | Bacteria | 999 |
| 843 | Ga0207703_10000316 | 3300026035 | Bacteria | 52401 |
| 844 | Ga0207703_10075755 | 3300026035 | Bacteria | 2789 |
| 845 | Ga0207703_10089339 | 3300026035 | Bacteria | 2587 |
| 846 | Ga0207703_10259307 | 3300026035 | Bacteria | 1571 |
| 847 | Ga0207703_10467784 | 3300026035 | Unclassified | 1180 |
| 848 | Ga0207703_10834260 | 3300026035 | Bacteria | 881 |
| 849 | Ga0207703_10947963 | 3300026035 | Bacteria | 825 |
| 850 | Ga0207703_10961762 | 3300026035 | Bacteria | 819 |
| 851 | Ga0207639_10007654 | 3300026041 | Bacteria | 7372 |
| 852 | Ga0207639_10053604 | 3300026041 | Bacteria | 3078 |
| 853 | Ga0207639_10095370 | 3300026041 | Bacteria | 2391 |
| 854 | Ga0207639_10137876 | 3300026041 | Bacteria | 2029 |
| 855 | Ga0207639_10178279 | 3300026041 | Bacteria | 1805 |
| 856 | Ga0207639_10180942 | 3300026041 | Bacteria | 1793 |
| 857 | Ga0207639_10374565 | 3300026041 | Bacteria | 1277 |
| 858 | Ga0207639_10903340 | 3300026041 | Unclassified | 825 |
| 859 | Ga0207639_11685054 | 3300026041 | Unclassified | 594 |
| 860 | Ga0207678_10092984 | 3300026067 | Bacteria | 2577 |
| 861 | Ga0207678_10241065 | 3300026067 | Bacteria | 1548 |
| 862 | Ga0207678_10599780 | 3300026067 | Bacteria | 965 |
| 863 | Ga0207708_10929874 | 3300026075 | Bacteria | 753 |
| 864 | Ga0207702_10681920 | 3300026078 | Bacteria | 1012 |
| 865 | Ga0207641_10001605 | 3300026088 | Bacteria | 22069 |
| 866 | Ga0207641_10094324 | 3300026088 | Bacteria | 2624 |
| 867 | Ga0207641_10218501 | 3300026088 | Bacteria | 1766 |
| 868 | Ga0207641_10313954 | 3300026088 | Bacteria | 1484 |
| 869 | Ga0207641_10443252 | 3300026088 | Bacteria | 1254 |
| 870 | Ga0207641_10844298 | 3300026088 | Bacteria | 907 |
| 871 | Ga0207648_10002305 | 3300026089 | Bacteria | 20617 |
| 872 | Ga0207648_10004992 | 3300026089 | Bacteria | 13485 |
| 873 | Ga0207648_10026128 | 3300026089 | Bacteria | 5192 |
| 874 | Ga0207648_10047900 | 3300026089 | Bacteria | 3745 |
| 875 | Ga0207648_10226031 | 3300026089 | Bacteria | 1664 |
| 876 | Ga0207648_10260108 | 3300026089 | Bacteria | 1548 |
| 877 | Ga0207648_10320590 | 3300026089 | Bacteria | 1393 |
| 878 | Ga0207648_10473225 | 3300026089 | Bacteria | 1143 |
| 879 | Ga0207648_11037937 | 3300026089 | Bacteria | 768 |
| 880 | Ga0207648_11080762 | 3300026089 | Unclassified | 752 |
| 881 | Ga0207676_10001882 | 3300026095 | Bacteria | 15352 |
| 882 | Ga0207676_10018209 | 3300026095 | Bacteria | 5102 |
| 883 | Ga0207676_10036382 | 3300026095 | Bacteria | 3744 |
| 884 | Ga0207676_10076264 | 3300026095 | Bacteria | 2708 |
| 885 | Ga0207676_10285216 | 3300026095 | Bacteria | 1501 |
| 886 | Ga0207676_10421966 | 3300026095 | Bacteria | 1251 |
| 887 | Ga0207676_10502293 | 3300026095 | Bacteria | 1152 |
| 888 | Ga0207676_10653346 | 3300026095 | Bacteria | 1015 |
| 889 | Ga0207676_10757211 | 3300026095 | Bacteria | 945 |
| 890 | Ga0207676_11575664 | 3300026095 | Bacteria | 654 |
| 891 | Ga0207674_10033492 | 3300026116 | Bacteria | 5379 |
| 892 | Ga0207674_10042278 | 3300026116 | Bacteria | 4709 |
| 893 | Ga0207674_10057753 | 3300026116 | Bacteria | 3933 |
| 894 | Ga0207674_10060076 | 3300026116 | Bacteria | 3845 |
| 895 | Ga0207674_10064716 | 3300026116 | Bacteria | 3688 |
| 896 | Ga0207674_10072102 | 3300026116 | Bacteria | 3470 |
| 897 | Ga0207674_10147964 | 3300026116 | Bacteria | 2306 |
| 898 | Ga0207674_10154088 | 3300026116 | Bacteria | 2253 |
| 899 | Ga0207674_10438332 | 3300026116 | Bacteria | 1263 |
| 900 | Ga0207674_10989212 | 3300026116 | Bacteria | 810 |
| 901 | Ga0207675_100027050 | 3300026118 | Bacteria | 5340 |
| 902 | Ga0207675_100067158 | 3300026118 | Bacteria | 3352 |
| 903 | Ga0207675_100082295 | 3300026118 | Bacteria | 3019 |
| 904 | Ga0207675_100098413 | 3300026118 | Bacteria | 2755 |
| 905 | Ga0207675_100204103 | 3300026118 | Bacteria | 1899 |
| 906 | Ga0207675_100773435 | 3300026118 | Bacteria | 972 |
| 907 | Ga0207675_100898518 | 3300026118 | Bacteria | 902 |
| 908 | Ga0207675_101493494 | 3300026118 | Bacteria | 696 |
| 909 | Ga0207683_10002777 | 3300026121 | Bacteria | 15302 |
| 910 | Ga0207683_10013775 | 3300026121 | Bacteria | 6896 |
| 911 | Ga0207683_10063785 | 3300026121 | Bacteria | 3246 |
| 912 | Ga0207683_10103776 | 3300026121 | Bacteria | 2540 |
| 913 | Ga0207683_10134494 | 3300026121 | Bacteria | 2225 |
| 914 | Ga0207683_10234419 | 3300026121 | Bacteria | 1674 |
| 915 | Ga0207683_10268474 | 3300026121 | Bacteria | 1558 |
| 916 | Ga0207683_10303993 | 3300026121 | Bacteria | 1459 |
| 917 | Ga0207683_10514957 | 3300026121 | Bacteria | 1105 |
| 918 | Ga0207683_10638169 | 3300026121 | Bacteria | 986 |
| 919 | Ga0207683_10806538 | 3300026121 | Bacteria | 871 |
| 920 | Ga0207698_10027714 | 3300026142 | Bacteria | 4027 |
| 921 | Ga0207698_10122727 | 3300026142 | Bacteria | 2202 |
| 922 | Ga0207698_10163450 | 3300026142 | Bacteria | 1950 |
| 923 | Ga0207698_10232715 | 3300026142 | Bacteria | 1674 |
| 924 | Ga0207698_10278184 | 3300026142 | Bacteria | 1546 |
| 925 | Ga0207698_10285256 | 3300026142 | Bacteria | 1529 |
| 926 | Ga0207698_10317791 | 3300026142 | Bacteria | 1457 |
| 927 | Ga0207698_10503364 | 3300026142 | Bacteria | 1179 |
| 928 | Ga0207698_11360889 | 3300026142 | Unclassified | 725 |
| 929 | Ga0209999_1032362 | 3300027543 | Bacteria | 972 |
| 930 | Ga0209974_10095085 | 3300027876 | Bacteria | 1036 |
| 931 | Ga0209974_10181214 | 3300027876 | Bacteria | 772 |
| 932 | Ga0268266_10000102 | 3300028379 | Bacteria | 179754 |
| 933 | Ga0268266_10001351 | 3300028379 | Bacteria | 29632 |
| 934 | Ga0268266_10034094 | 3300028379 | Bacteria | 4328 |
| 935 | Ga0268266_10234120 | 3300028379 | Bacteria | 1692 |
| 936 | Ga0268266_10342648 | 3300028379 | Bacteria | 1403 |
| 937 | Ga0268266_10734045 | 3300028379 | Bacteria | 953 |
| 938 | Ga0268266_11290011 | 3300028379 | Bacteria | 706 |
| 939 | Ga0268265_10204126 | 3300028380 | Unclassified | 1717 |
| 940 | Ga0268265_10303711 | 3300028380 | Bacteria | 1438 |
| 941 | Ga0268265_11252394 | 3300028380 | Bacteria | 741 |
| 942 | Ga0268264_10000011 | 3300028381 | Bacteria | 580884 |
| 943 | Ga0268264_10003097 | 3300028381 | Bacteria | 14394 |
| 944 | Ga0268264_10011453 | 3300028381 | Bacteria | 7322 |
| 945 | Ga0268264_10055897 | 3300028381 | Bacteria | 3299 |
| 946 | Ga0268264_10178045 | 3300028381 | Bacteria | 1929 |
| 947 | Ga0268264_11056395 | 3300028381 | Bacteria | 820 |
| 948 | Ga0307517_10050018 | 3300028786 | Bacteria | 4259 |
| 949 | Ga0307517_10116843 | 3300028786 | Bacteria | 1994 |
| 950 | Ga0307517_10269983 | 3300028786 | Bacteria | 979 |
| 951 | Ga0307515_10000010 | 3300028794 | Bacteria | 651586 |
| 952 | Ga0307511_10002902 | 3300030521 | Bacteria | 17761 |
| 953 | Ga0265327_10000084 | 3300031251 | Bacteria | 204433 |
| 954 | Ga0265327_10000366 | 3300031251 | Bacteria | 85818 |
| 955 | Ga0265313_10065844 | 3300031595 | Bacteria | 1681 |
| 956 | Ga0307407_11126864 | 3300031903 | Bacteria | 611 |
| 957 | Ga0307416_101106975 | 3300032002 | Bacteria | 897 |
| 958 | Ga0307414_10320339 | 3300032004 | Bacteria | 1319 |
| 959 | Ga0307507_10414985 | 3300033179 | Bacteria | 759 |
| 960 | Ga0307510_10000119 | 3300033180 | Bacteria | 62835 |
| 961 | Ga0307510_10320608 | 3300033180 | Bacteria | 1007 |
| 962 | Ga0373934_0012385 | 3300035086 | Bacteria | 3220 |
| 963 | Ga0373944_0084007 | 3300035089 | Unclassified | 1056 |
| 964 | Ga0373952_0058148 | 3300035092 | Bacteria | 939 |
| 965 | Ga0373936_0081449 | 3300035113 | Bacteria | 1348 |
| 966 | Ga0373956_0086936 | 3300035119 | Bacteria | 1439 |
| 967 | Ga0373957_0044854 | 3300035120 | Bacteria | 1674 |
| 968 | Ga0373946_0098014 | 3300035171 | Bacteria | 1310 |
| 969 | Ga0373961_0174354 | 3300035241 | Bacteria | 746 |
| 970 | Ga0373935_0351882 | 3300035692 | Bacteria | 1050 |
| 971 | Ga0373927_0314130 | 3300035695 | Bacteria | 1032 |
| 972 | Ga0373933_0045334 | 3300035724 | Bacteria | 2607 |
| 973 | Ga0373947_0159532 | 3300035725 | Bacteria | 1458 |
| 974 | Ga0373937_0061306 | 3300036401 | Bacteria | 3457 |
| 975 | Ga0373937_0356071 | 3300036401 | Bacteria | 1387 |
| 976 | Ga0373937_0869688 | 3300036401 | Bacteria | 850 |
| 977 | Ga0395900_0312296 | 3300037418 | Bacteria | 1555 |
| 978 | Ga0395900_0929139 | 3300037418 | Bacteria | 792 |
| 979 | Ga0395901_0463913 | 3300038443 | Bacteria | 1294 |
| 980 | Ga0436365_0140747 | 3300039437 | Bacteria | 24514 |
| 981 | Ga0436365_1548207 | 3300039437 | Unclassified | 932 |
| 982 | Ga0436365_1929414 | 3300039437 | Bacteria | 3775 |
| 983 | Ga0439436_0082955 | 3300041404 | Bacteria | 892 |
| 984 | Ga0451843_0361727 | 3300041509 | Bacteria | 1226 |
| 985 | Ga0451853_2186715 | 3300041512 | Bacteria | 975 |
| 986 | Ga0439448_0039246 | 3300042005 | Bacteria | 1526 |
| 987 | Ga0439449_0001430 | 3300042007 | Bacteria | 9333 |
| 988 | Ga0439457_028358 | 3300042014 | Bacteria | 1239 |
| 989 | Ga0450922_002800 | 3300042124 | Bacteria | 1618 |
| 990 | Ga0450923_016086 | 3300042125 | Bacteria | 1405 |
| 991 | Ga0439446_0095064 | 3300042156 | Bacteria | 937 |
| 992 | Ga0439435_0075688 | 3300042436 | Bacteria | 1003 |
| 993 | Ga0451577_0671070 | 3300042876 | Bacteria | 939 |
| 994 | Ga0451577_1016883 | 3300042876 | Bacteria | 744 |
| 995 | Ga0466969_0130720 | 3300044656 | Bacteria | 1164 |
| 996 | Ga0466972_0002446 | 3300044658 | Bacteria | 9175 |
| 997 | Ga0466972_0103905 | 3300044658 | Bacteria | 1344 |
| 998 | Ga0466972_0113644 | 3300044658 | Bacteria | 1279 |
| 999 | Ga0453683_0030589 | 3300044673 | Bacteria | 3403 |
| 1000 | Ga0453683_0100341 | 3300044673 | Bacteria | 1817 |
| 1001 | Ga0466965_0027073 | 3300044683 | Bacteria | 2781 |
| 1002 | Ga0466965_0051633 | 3300044683 | Bacteria | 2040 |
| 1003 | Ga0466966_0090599 | 3300044684 | Bacteria | 1899 |
| 1004 | Ga0466966_0329937 | 3300044684 | Bacteria | 917 |
| 1005 | Ga0453684_0238530 | 3300044712 | Bacteria | 2094 |
| 1006 | Ga0453684_0241045 | 3300044712 | Bacteria | 2081 |
| 1007 | Ga0453684_1196284 | 3300044712 | Bacteria | 798 |
| 1008 | Ga0466971_0064131 | 3300044719 | Bacteria | 1663 |
| 1009 | Ga0466968_0061112 | 3300044735 | Bacteria | 1625 |
| 1010 | Ga0466970_0000280 | 3300044765 | Bacteria | 24871 |
| 1011 | Ga0466970_0041827 | 3300044765 | Bacteria | 2436 |
| 1012 | Ga0466970_0139410 | 3300044765 | Bacteria | 1335 |
| 1013 | Ga0466960_0339967 | 3300044901 | Bacteria | 854 |
| 1014 | Ga0466959_0056262 | 3300045049 | Bacteria | 2870 |
| 1015 | Ga0466959_0238188 | 3300045049 | Bacteria | 1258 |
| 1016 | Ga0451576_0257274 | 3300045051 | Bacteria | 1825 |
| 1017 | Ga0466967_0225813 | 3300045976 | Bacteria | 1781 |
| 1018 | Ga0495638_0189260 | 3300046460 | Bacteria | 1168 |
| 1019 | Ga0495580_0465691 | 3300046472 | Bacteria | 847 |
| 1020 | Ga0495664_0296697 | 3300046477 | Bacteria | 976 |
| 1021 | Ga0495594_0075506 | 3300046499 | Bacteria | 1879 |
| 1022 | Ga0495606_0005477 | 3300046507 | Bacteria | 12152 |
| 1023 | Ga0495618_0299897 | 3300046514 | Bacteria | 999 |
| 1024 | Ga0495628_0064246 | 3300046516 | Bacteria | 2874 |
| 1025 | Ga0495630_0131704 | 3300046517 | Bacteria | 1899 |
| 1026 | Ga0495630_0183739 | 3300046517 | Bacteria | 1595 |
| 1027 | Ga0495648_0002633 | 3300046524 | Bacteria | 16312 |
| 1028 | Ga0495586_0059232 | 3300046535 | Bacteria | 2081 |
| 1029 | Ga0495587_0118440 | 3300046536 | Bacteria | 1517 |
| 1030 | Ga0495633_0082064 | 3300046558 | Bacteria | 1500 |
| 1031 | Ga0495668_0000650 | 3300046616 | Bacteria | 41696 |
| 1032 | Ga0495634_0466056 | 3300046642 | Bacteria | 744 |
| 1033 | Ga0495657_0332921 | 3300046675 | Bacteria | 901 |
| 1034 | Ga0495599_0117581 | 3300046678 | Bacteria | 1654 |
| 1035 | Ga0495658_0658293 | 3300046683 | Bacteria | 671 |
| 1036 | Ga0495670_0293978 | 3300046691 | Unclassified | 870 |
| 1037 | Ga0495600_0108701 | 3300046809 | Bacteria | 1806 |
| 1038 | Ga0495636_0000045 | 3300047318 | Bacteria | 53503 |
| 1039 | Ga0495674_0626302 | 3300047319 | Bacteria | 850 |
| 1040 | Ga0495672_0021174 | 3300047320 | Bacteria | 4245 |
| 1041 | Ga0495687_000001 | 3300047443 | Bacteria | 1215582 |
| 1042 | Ga0495684_0073050 | 3300047471 | Bacteria | 2606 |
| 1043 | Ga0495686_0000004 | 3300047472 | Bacteria | 869019 |
| 1044 | Ga0495686_0228891 | 3300047472 | Bacteria | 1054 |
| 1045 | Ga0496100_0010695 | 3300048903 | Bacteria | 5204 |
| 1046 | Ga0496101_0174307 | 3300048904 | Bacteria | 1654 |
| 1047 | Ga0496102_0532146 | 3300048905 | Bacteria | 1098 |
| 1048 | Ga0496104_0392944 | 3300048907 | Bacteria | 1299 |
| 1049 | Ga0496107_0501628 | 3300048910 | Bacteria | 900 |
| 1050 | Ga0496108_0925538 | 3300048911 | Bacteria | 747 |
| 1051 | Ga0496110_0034483 | 3300048913 | Bacteria | 4384 |
| 1052 | Ga0496115_0303524 | 3300048918 | Bacteria | 1308 |
| 1053 | Ga0496115_0545777 | 3300048918 | Bacteria | 927 |
| 1054 | Ga0501306_001423 | 3300049127 | Bacteria | 2251 |
| 1055 | Ga0501306_027935 | 3300049127 | Bacteria | 824 |
| 1056 | Ga0501308_002937 | 3300049128 | Bacteria | 1539 |
| 1057 | Ga0501308_008913 | 3300049128 | Bacteria | 1085 |
| 1058 | Ga0501309_004541 | 3300049129 | Bacteria | 1622 |
| 1059 | Ga0501310_008601 | 3300049130 | Bacteria | 1111 |
| 1060 | Ga0501341_00741 | 3300049131 | Bacteria | 1468 |
| 1061 | Ga0501343_002166 | 3300049132 | Bacteria | 1388 |
| 1062 | Ga0501304_005103 | 3300049160 | Bacteria | 1019 |
| 1063 | Ga0501304_006763 | 3300049160 | Bacteria | 932 |
| 1064 | Ga0501305_001466 | 3300049161 | Bacteria | 2316 |
| 1065 | Ga0501305_011062 | 3300049161 | Bacteria | 1213 |
| 1066 | Ga0501305_014914 | 3300049161 | Bacteria | 1092 |
| 1067 | Ga0501305_025284 | 3300049161 | Bacteria | 899 |
| 1068 | Ga0501307_003819 | 3300049162 | Bacteria | 1502 |
| 1069 | Ga0501307_008465 | 3300049162 | Bacteria | 1156 |
| 1070 | Ga0501298_038960 | 3300049521 | Bacteria | 959 |
| 1071 | Ga0501311_007435 | 3300049527 | Bacteria | 1261 |
| 1072 | Ga0501312_006714 | 3300049528 | Bacteria | 1446 |
| 1073 | Ga0501312_012573 | 3300049528 | Bacteria | 1166 |
| 1074 | Ga0501313_003764 | 3300049529 | Bacteria | 1526 |
| 1075 | Ga0501314_003156 | 3300049530 | Bacteria | 1317 |
| 1076 | Ga0501314_004211 | 3300049530 | Bacteria | 1187 |
| 1077 | Ga0501315_002099 | 3300049531 | Bacteria | 1829 |
| 1078 | Ga0501315_003222 | 3300049531 | Bacteria | 1615 |
| 1079 | Ga0501315_006311 | 3300049531 | Bacteria | 1314 |
| 1080 | Ga0501315_010570 | 3300049531 | Bacteria | 1112 |
| 1081 | Ga0501315_020326 | 3300049531 | Bacteria | 890 |
| 1082 | Ga0501315_034237 | 3300049531 | Bacteria | 745 |
| 1083 | Ga0501315_071676 | 3300049531 | Bacteria | 576 |
| 1084 | Ga0501316_004650 | 3300049532 | Bacteria | 1387 |
| 1085 | Ga0501317_000922 | 3300049533 | Bacteria | 2337 |
| 1086 | Ga0501317_003672 | 3300049533 | Bacteria | 1548 |
| 1087 | Ga0501318_008846 | 3300049534 | Bacteria | 1086 |
| 1088 | Ga0501320_003434 | 3300049536 | Bacteria | 1343 |
| 1089 | Ga0501320_003694 | 3300049536 | Bacteria | 1313 |
| 1090 | Ga0501321_000711 | 3300049537 | Bacteria | 2309 |
| 1091 | Ga0501322_010240 | 3300049538 | Bacteria | 720 |
| 1092 | Ga0501323_004486 | 3300049539 | Bacteria | 1481 |
| 1093 | Ga0501324_001617 | 3300049540 | Bacteria | 1530 |
| 1094 | Ga0501325_002569 | 3300049541 | Bacteria | 1254 |
| 1095 | Ga0501325_005609 | 3300049541 | Bacteria | 1003 |
| 1096 | Ga0501329_01899 | 3300049545 | Bacteria | 962 |
| 1097 | Ga0501330_001281 | 3300049546 | Bacteria | 1278 |
| 1098 | Ga0501332_00970 | 3300049548 | Bacteria | 1412 |
| 1099 | Ga0501332_01863 | 3300049548 | Bacteria | 1145 |
| 1100 | Ga0501334_00963 | 3300049550 | Bacteria | 1501 |
| 1101 | Ga0501334_02415 | 3300049550 | Bacteria | 1108 |
| 1102 | Ga0501335_002286 | 3300049551 | Bacteria | 1544 |
| 1103 | Ga0501335_006219 | 3300049551 | Bacteria | 1083 |
| 1104 | Ga0501335_007004 | 3300049551 | Bacteria | 1035 |
| 1105 | Ga0501335_007190 | 3300049551 | Bacteria | 1025 |
| 1106 | Ga0501335_021289 | 3300049551 | Bacteria | 694 |
| 1107 | Ga0501336_003553 | 3300049552 | Bacteria | 1060 |
| 1108 | Ga0501336_003599 | 3300049552 | Bacteria | 1056 |
| 1109 | Ga0501336_005029 | 3300049552 | Bacteria | 945 |
| 1110 | Ga0501337_001150 | 3300049553 | Bacteria | 1470 |
| 1111 | Ga0501338_00443 | 3300049554 | Bacteria | 1859 |
| 1112 | Ga0501338_02541 | 3300049554 | Bacteria | 1043 |
| 1113 | Ga0501031_0038037 | 3300049568 | Bacteria | 3140 |
| 1114 | Ga0501032_0019262 | 3300049569 | Bacteria | 4775 |
| 1115 | Ga0501032_0055273 | 3300049569 | Unclassified | 2670 |
| 1116 | Ga0501032_0237218 | 3300049569 | Bacteria | 1185 |
| 1117 | Ga0501033_0038999 | 3300049570 | Bacteria | 3549 |
| 1118 | Ga0501033_0363888 | 3300049570 | Bacteria | 1012 |
| 1119 | Ga0501034_0010008 | 3300049571 | Bacteria | 9906 |
| 1120 | Ga0501034_0075740 | 3300049571 | Bacteria | 3371 |
| 1121 | Ga0501034_0142610 | 3300049571 | Bacteria | 2374 |
| 1122 | Ga0501034_0650504 | 3300049571 | Bacteria | 956 |
| 1123 | Ga0501036_0045514 | 3300049572 | Bacteria | 3717 |
| 1124 | Ga0501036_0125079 | 3300049572 | Bacteria | 2171 |
| 1125 | Ga0501037_0009556 | 3300049573 | Bacteria | 7119 |
| 1126 | Ga0501037_0037559 | 3300049573 | Bacteria | 3571 |
| 1127 | Ga0501037_0059629 | 3300049573 | Bacteria | 2783 |
| 1128 | Ga0501037_0092023 | 3300049573 | Bacteria | 2194 |
| 1129 | Ga0501038_0025986 | 3300049574 | Bacteria | 5215 |
| 1130 | Ga0501038_0109514 | 3300049574 | Bacteria | 2288 |
| 1131 | Ga0501039_0050368 | 3300049575 | Bacteria | 3222 |
| 1132 | Ga0501039_0094760 | 3300049575 | Bacteria | 2327 |
| 1133 | Ga0501039_0105234 | 3300049575 | Bacteria | 2203 |
| 1134 | Ga0501043_0004087 | 3300049579 | Bacteria | 11922 |
| 1135 | Ga0501043_0012420 | 3300049579 | Bacteria | 6661 |
| 1136 | Ga0501043_0013840 | 3300049579 | Bacteria | 6314 |
| 1137 | Ga0501043_0044533 | 3300049579 | Bacteria | 3489 |
| 1138 | Ga0501046_0017480 | 3300049580 | Bacteria | 5983 |
| 1139 | Ga0501046_0026251 | 3300049580 | Bacteria | 4758 |
| 1140 | Ga0501047_0003665 | 3300049581 | Bacteria | 14478 |
| 1141 | Ga0501047_0030096 | 3300049581 | Bacteria | 5234 |
| 1142 | Ga0501047_0040101 | 3300049581 | Bacteria | 4529 |
| 1143 | Ga0501048_0050802 | 3300049582 | Bacteria | 2952 |
| 1144 | Ga0501067_0006420 | 3300049583 | Bacteria | 6514 |
| 1145 | Ga0501068_0036447 | 3300049584 | Bacteria | 2941 |
| 1146 | Ga0501068_0101475 | 3300049584 | Bacteria | 1784 |
| 1147 | Ga0501069_0075930 | 3300049585 | Bacteria | 1889 |
| 1148 | Ga0501070_0028792 | 3300049586 | Bacteria | 4657 |
| 1149 | Ga0501072_0073516 | 3300049588 | Bacteria | 2703 |
| 1150 | Ga0501073_0005302 | 3300049589 | Bacteria | 9668 |
| 1151 | Ga0501073_0101797 | 3300049589 | Bacteria | 1995 |
| 1152 | Ga0501073_0162982 | 3300049589 | Bacteria | 1544 |
| 1153 | Ga0501074_0000797 | 3300049590 | Bacteria | 19923 |
| 1154 | Ga0501074_0033875 | 3300049590 | Bacteria | 3703 |
| 1155 | Ga0501198_021401 | 3300049649 | Bacteria | 1031 |
| 1156 | Ga0501207_002993 | 3300049654 | Bacteria | 2214 |
| 1157 | Ga0501217_244982 | 3300049661 | Bacteria | 575 |
| 1158 | Ga0501227_054758 | 3300049665 | Bacteria | 1013 |
| 1159 | Ga0501228_003544 | 3300049666 | Bacteria | 1291 |
| 1160 | Ga0501228_007798 | 3300049666 | Bacteria | 1010 |
| 1161 | Ga0501235_001267 | 3300049669 | Bacteria | 5327 |
| 1162 | Ga0501240_042527 | 3300049673 | Bacteria | 759 |
| 1163 | Ga0501242_005146 | 3300049674 | Bacteria | 1464 |
| 1164 | Ga0501251_028613 | 3300049681 | Unclassified | 783 |
| 1165 | Ga0501261_003348 | 3300049690 | Bacteria | 1966 |
| 1166 | Ga0501221_000112 | 3300049704 | Bacteria | 9948 |
| 1167 | Ga0501221_016364 | 3300049704 | Bacteria | 1403 |
| 1168 | Ga0501225_0002315 | 3300049705 | Bacteria | 5881 |
| 1169 | Ga0501234_008670 | 3300049707 | Bacteria | 1584 |
| 1170 | Ga0501245_005940 | 3300049708 | Bacteria | 1699 |
| 1171 | Ga0501079_0360765 | 3300049741 | Bacteria | 1139 |
| 1172 | Ga0501080_0035757 | 3300049742 | Bacteria | 4637 |
| 1173 | Ga0501080_0052791 | 3300049742 | Bacteria | 3783 |
| 1174 | Ga0501080_0460567 | 3300049742 | Bacteria | 1139 |
| 1175 | Ga0501080_0795674 | 3300049742 | Bacteria | 830 |
| 1176 | Ga0501083_0044352 | 3300049744 | Bacteria | 3010 |
| 1177 | Ga0501272_004633 | 3300049769 | Bacteria | 1433 |
| 1178 | Ga0501279_022600 | 3300049775 | Bacteria | 904 |
| 1179 | Ga0501035_0025721 | 3300049822 | Bacteria | 5395 |
| 1180 | Ga0501035_0067435 | 3300049822 | Bacteria | 3175 |
| 1181 | Ga0501035_0153636 | 3300049822 | Bacteria | 1996 |
| 1182 | Ga0501044_0005733 | 3300049823 | Bacteria | 13754 |
| 1183 | Ga0501044_0015563 | 3300049823 | Bacteria | 8195 |
| 1184 | Ga0501044_0050286 | 3300049823 | Bacteria | 4302 |
| 1185 | Ga0501044_0303588 | 3300049823 | Bacteria | 1525 |
| 1186 | Ga0501044_0405255 | 3300049823 | Bacteria | 1276 |
| 1187 | Ga0501044_0512738 | 3300049823 | Bacteria | 1099 |
| 1188 | Ga0501044_0576844 | 3300049823 | Bacteria | 1020 |
| 1189 | Ga0501045_0165790 | 3300049824 | Bacteria | 1645 |
| 1190 | Ga0501226_031499 | 3300049853 | Unclassified | 603 |
| 1191 | nmdc:mga0k408_446153_c1 | 3300050493 | Bacteria | 768 |
| 1192 | nmdc:mga0k408_47999_c1 | 3300050493 | Bacteria | 2469 |
| 1193 | nmdc:mga07m45_34215_c1 | 3300050496 | Bacteria | 2824 |
| 1194 | nmdc:mga05p37_231260_c1 | 3300050507 | Bacteria | 2227 |
| 1195 | nmdc:mga05p37_281992_c1 | 3300050507 | Bacteria | 1981 |
| 1196 | nmdc:mga09592_45343_c1 | 3300050508 | Bacteria | 3704 |
| 1197 | nmdc:mga09592_49621_c1 | 3300050508 | Bacteria | 3539 |
| 1198 | nmdc:mga09592_682730_c1 | 3300050508 | Unclassified | 875 |
| 1199 | nmdc:mga0qj67_157636_c1 | 3300050509 | Bacteria | 1843 |
| 1200 | nmdc:mga06r32_32850_c2 | 3300050510 | Bacteria | 2887 |
| 1201 | nmdc:mga08y16_1217278_c1 | 3300050511 | Bacteria | 723 |
| 1202 | nmdc:mga08y16_202537_c1 | 3300050511 | Bacteria | 2057 |
| 1203 | nmdc:mga08y16_824739_c1 | 3300050511 | Bacteria | 919 |
| 1204 | nmdc:mga0n895_585434_c1 | 3300050512 | Bacteria | 1119 |
| 1205 | nmdc:mga0a205_1285274_c1 | 3300050515 | Bacteria | 579 |
| 1206 | Ga0495619_0041370 | 3300053085 | Bacteria | 3014 |
| 1207 | Ga0500646_0012093 | 3300053090 | Bacteria | 2226 |
| 1208 | Ga0500583_0005990 | 3300053092 | Bacteria | 4136 |
| 1209 | Ga0500641_0025200 | 3300053096 | Bacteria | 2300 |
| 1210 | Ga0500652_015822 | 3300053131 | Bacteria | 2732 |
| 1211 | Ga0500568_0016248 | 3300053139 | Bacteria | 3315 |
| 1212 | Ga0500622_0000782 | 3300053156 | Bacteria | 27616 |
| 1213 | Ga0500622_0000852 | 3300053156 | Bacteria | 26070 |
| 1214 | Ga0501084_0131031 | 3300054114 | Bacteria | 2110 |
| 1215 | Ga0587073_0060123 | 3300059492 | Bacteria | 889 |
| 1216 | Ga0587077_002325 | 3300059493 | Bacteria | 2235 |
| 1217 | Ga0587090_033183 | 3300059510 | Bacteria | 874 |
| 1218 | Ga0587128_072393 | 3300059630 | Bacteria | 674 |
| 1219 | Ga0501082_0035882 | 3300060353 | Bacteria | 4273 |
| 1220 | Ga0466962_0029755 | 3300061719 | Bacteria | 2615 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046558 | Ga0495633_0082064 | Ga0495633_0082064_356_892 | 153 |
| 2 | 3300046691 | Ga0495670_0293978 | Ga0495670_0293978_321_857 | 153 |
| 3 | 3300047318 | Ga0495636_0000045 | Ga0495636_0000045_45582_46118 | 153 |
| 4 | 3300026121 | Ga0207683_10234419 | Ga0207683_102344193 | 156 |
| 5 | 3300050515 | nmdc:mga0a205_1285274_c1 | nmdc:mga0a205_1285274_c1_14_520 | 159 |
| 6 | 3300003163 | Ga0006759J45824_1097056 | Ga0006759J45824_10970562 | 160 |
| 7 | 3300013307 | Ga0157372_10392189 | Ga0157372_103921892 | 161 |
| 8 | 3300049570 | Ga0501033_0038999 | Ga0501033_0038999_1486_2013 | 161 |
| 9 | 3300049569 | Ga0501032_0237218 | Ga0501032_0237218_130_654 | 162 |
| 10 | 3300049572 | Ga0501036_0045514 | Ga0501036_0045514_2697_3221 | 162 |
| 11 | 3300049573 | Ga0501037_0009556 | Ga0501037_0009556_5792_6316 | 162 |
| 12 | 3300049575 | Ga0501039_0105234 | Ga0501039_0105234_985_1509 | 162 |
| 13 | 3300049581 | Ga0501047_0040101 | Ga0501047_0040101_2230_2754 | 162 |
| 14 | 3300049742 | Ga0501080_0035757 | Ga0501080_0035757_2433_2957 | 162 |
| 15 | 3300049823 | Ga0501044_0015563 | Ga0501044_0015563_6210_6734 | 162 |
| 16 | 3300013307 | Ga0157372_10454228 | Ga0157372_104542281 | 163 |
| 17 | 3300021384 | Ga0213876_10005547 | Ga0213876_100055472 | 164 |
| 18 | 3300039437 | Ga0436365_0140747 | Ga0436365_0140747_14029_14553 | 164 |
| 19 | 3300046616 | Ga0495668_0000650 | Ga0495668_0000650_8879_9481 | 164 |
| 20 | 3300005367 | Ga0070667_100325968 | Ga0070667_1003259682 | 165 |
| 21 | 3300006237 | Ga0097621_100026314 | Ga0097621_1000263144 | 165 |
| 22 | 3300006358 | Ga0068871_100007174 | Ga0068871_1000071744 | 165 |
| 23 | 3300013297 | Ga0157378_10006197 | Ga0157378_100061976 | 165 |
| 24 | 3300013297 | Ga0157378_10029260 | Ga0157378_100292604 | 165 |
| 25 | 3300013306 | Ga0163162_10246087 | Ga0163162_102460873 | 165 |
| 26 | 3300014968 | Ga0157379_10103098 | Ga0157379_101030983 | 165 |
| 27 | 3300017792 | Ga0163161_10134377 | Ga0163161_101343772 | 165 |
| 28 | 3300025986 | Ga0207658_10276433 | Ga0207658_102764332 | 165 |
| 29 | 3300026023 | Ga0207677_10514140 | Ga0207677_105141401 | 165 |
| 30 | 3300026121 | Ga0207683_10514957 | Ga0207683_105149572 | 165 |
| 31 | 3300048918 | Ga0496115_0303524 | Ga0496115_0303524_243_767 | 165 |
| 32 | 3300049533 | Ga0501317_003672 | Ga0501317_003672_406_975 | 165 |
| 33 | iso_pu_bacteria | 2881955468 | 2881955503 | 165 |
| 34 | 3300005293 | Ga0065715_10223950 | Ga0065715_102239502 | 166 |
| 35 | 3300005329 | Ga0070683_100042173 | Ga0070683_1000421734 | 166 |
| 36 | 3300005330 | Ga0070690_100629979 | Ga0070690_1006299791 | 166 |
| 37 | 3300005331 | Ga0070670_100607988 | Ga0070670_1006079881 | 166 |
| 38 | 3300005354 | Ga0070675_100041999 | Ga0070675_1000419996 | 166 |
| 39 | 3300005355 | Ga0070671_100028318 | Ga0070671_1000283181 | 166 |
| 40 | 3300005355 | Ga0070671_100071753 | Ga0070671_1000717534 | 166 |
| 41 | 3300005455 | Ga0070663_100377419 | Ga0070663_1003774191 | 166 |
| 42 | 3300005535 | Ga0070684_100523034 | Ga0070684_1005230341 | 166 |
| 43 | 3300005543 | Ga0070672_100156175 | Ga0070672_1001561754 | 166 |
| 44 | 3300005578 | Ga0068854_100909404 | Ga0068854_1009094041 | 166 |
| 45 | 3300005616 | Ga0068852_100135992 | Ga0068852_1001359923 | 166 |
| 46 | 3300005618 | Ga0068864_100195296 | Ga0068864_1001952961 | 166 |
| 47 | 3300005618 | Ga0068864_100483784 | Ga0068864_1004837842 | 166 |
| 48 | 3300005840 | Ga0068870_10109137 | Ga0068870_101091372 | 166 |
| 49 | 3300006358 | Ga0068871_100905334 | Ga0068871_1009053341 | 166 |
| 50 | 3300013100 | Ga0157373_10215081 | Ga0157373_102150812 | 166 |
| 51 | 3300013102 | Ga0157371_10159985 | Ga0157371_101599852 | 166 |
| 52 | 3300013104 | Ga0157370_10409490 | Ga0157370_104094902 | 166 |
| 53 | 3300013104 | Ga0157370_10765700 | Ga0157370_107657002 | 166 |
| 54 | 3300013296 | Ga0157374_10030157 | Ga0157374_100301572 | 166 |
| 55 | 3300013296 | Ga0157374_11285650 | Ga0157374_112856501 | 166 |
| 56 | 3300013297 | Ga0157378_10053226 | Ga0157378_100532265 | 166 |
| 57 | 3300013307 | Ga0157372_10083781 | Ga0157372_100837812 | 166 |
| 58 | 3300013307 | Ga0157372_11073744 | Ga0157372_110737442 | 166 |
| 59 | 3300013307 | Ga0157372_11975846 | Ga0157372_119758461 | 166 |
| 60 | 3300014325 | Ga0163163_10073545 | Ga0163163_100735452 | 166 |
| 61 | 3300014745 | Ga0157377_10441861 | Ga0157377_104418612 | 166 |
| 62 | 3300025893 | Ga0207682_10005649 | Ga0207682_100056495 | 166 |
| 63 | 3300025925 | Ga0207650_10024745 | Ga0207650_100247453 | 166 |
| 64 | 3300025925 | Ga0207650_10881349 | Ga0207650_108813492 | 166 |
| 65 | 3300025926 | Ga0207659_10032047 | Ga0207659_100320475 | 166 |
| 66 | 3300025926 | Ga0207659_10571116 | Ga0207659_105711162 | 166 |
| 67 | 3300025933 | Ga0207706_10914297 | Ga0207706_109142971 | 166 |
| 68 | 3300025934 | Ga0207686_10941078 | Ga0207686_109410781 | 166 |
| 69 | 3300025940 | Ga0207691_10255036 | Ga0207691_102550362 | 166 |
| 70 | 3300025940 | Ga0207691_11010424 | Ga0207691_110104241 | 166 |
| 71 | 3300025944 | Ga0207661_10262038 | Ga0207661_102620382 | 166 |
| 72 | 3300025944 | Ga0207661_10407822 | Ga0207661_104078222 | 166 |
| 73 | 3300025945 | Ga0207679_10013851 | Ga0207679_100138513 | 166 |
| 74 | 3300025945 | Ga0207679_10565632 | Ga0207679_105656322 | 166 |
| 75 | 3300025945 | Ga0207679_10827836 | Ga0207679_108278361 | 166 |
| 76 | 3300026089 | Ga0207648_11037937 | Ga0207648_110379372 | 166 |
| 77 | 3300026116 | Ga0207674_10042278 | Ga0207674_100422782 | 166 |
| 78 | 3300026121 | Ga0207683_10268474 | Ga0207683_102684741 | 166 |
| 79 | 3300026142 | Ga0207698_10503364 | Ga0207698_105033642 | 166 |
| 80 | 3300033179 | Ga0307507_10414985 | Ga0307507_104149852 | 166 |
| 81 | 3300041404 | Ga0439436_0082955 | Ga0439436_0082955_127_654 | 166 |
| 82 | 3300041512 | Ga0451853_2186715 | Ga0451853_2186715_150_677 | 166 |
| 83 | 3300042007 | Ga0439449_0001430 | Ga0439449_0001430_2666_3193 | 166 |
| 84 | 3300042014 | Ga0439457_028358 | Ga0439457_028358_324_851 | 166 |
| 85 | 3300042876 | Ga0451577_1016883 | Ga0451577_1016883_53_580 | 166 |
| 86 | 3300044712 | Ga0453684_1196284 | Ga0453684_1196284_16_543 | 166 |
| 87 | 3300045049 | Ga0466959_0238188 | Ga0466959_0238188_396_923 | 166 |
| 88 | 3300048911 | Ga0496108_0925538 | Ga0496108_0925538_55_582 | 166 |
| 89 | 3300049128 | Ga0501308_002937 | Ga0501308_002937_461_988 | 166 |
| 90 | 3300049160 | Ga0501304_005103 | Ga0501304_005103_105_632 | 166 |
| 91 | 3300049161 | Ga0501305_014914 | Ga0501305_014914_48_575 | 166 |
| 92 | 3300049161 | Ga0501305_025284 | Ga0501305_025284_284_811 | 166 |
| 93 | 3300049528 | Ga0501312_006714 | Ga0501312_006714_570_1097 | 166 |
| 94 | 3300049531 | Ga0501315_006311 | Ga0501315_006311_529_1056 | 166 |
| 95 | 3300049541 | Ga0501325_002569 | Ga0501325_002569_356_883 | 166 |
| 96 | 3300049551 | Ga0501335_002286 | Ga0501335_002286_406_933 | 166 |
| 97 | 3300049551 | Ga0501335_007190 | Ga0501335_007190_251_778 | 166 |
| 98 | 3300049570 | Ga0501033_0363888 | Ga0501033_0363888_394_921 | 166 |
| 99 | 3300049573 | Ga0501037_0092023 | Ga0501037_0092023_1578_2105 | 166 |
| 100 | 3300049589 | Ga0501073_0101797 | Ga0501073_0101797_1448_1975 | 166 |
| 101 | 3300049742 | Ga0501080_0795674 | Ga0501080_0795674_98_625 | 166 |
| 102 | 3300049823 | Ga0501044_0576844 | Ga0501044_0576844_222_749 | 166 |
| 103 | 3300002459 | JGI24751J29686_10000803 | JGI24751J29686_100008037 | 167 |
| 104 | 3300003203 | JGI25406J46586_10003914 | JGI25406J46586_1000391411 | 167 |
| 105 | 3300003316 | rootH1_10114210 | rootH1_101142102 | 167 |
| 106 | 3300003320 | rootH2_10059898 | rootH2_100598982 | 167 |
| 107 | 3300003320 | rootH2_10204928 | rootH2_102049282 | 167 |
| 108 | 3300003322 | rootL2_10239916 | rootL2_102399162 | 167 |
| 109 | 3300003354 | JGI25160J50197_1000508 | JGI25160J50197_100050814 | 167 |
| 110 | 3300005288 | Ga0065714_10201259 | Ga0065714_102012591 | 167 |
| 111 | 3300005290 | Ga0065712_10206809 | Ga0065712_102068091 | 167 |
| 112 | 3300005295 | Ga0065707_10156493 | Ga0065707_101564932 | 167 |
| 113 | 3300005327 | Ga0070658_10000420 | Ga0070658_100004203 | 167 |
| 114 | 3300005327 | Ga0070658_10013800 | Ga0070658_100138004 | 167 |
| 115 | 3300005327 | Ga0070658_10601651 | Ga0070658_106016512 | 167 |
| 116 | 3300005328 | Ga0070676_10005499 | Ga0070676_100054993 | 167 |
| 117 | 3300005328 | Ga0070676_10036189 | Ga0070676_100361893 | 167 |
| 118 | 3300005328 | Ga0070676_10258521 | Ga0070676_102585212 | 167 |
| 119 | 3300005329 | Ga0070683_100011895 | Ga0070683_1000118954 | 167 |
| 120 | 3300005330 | Ga0070690_100243997 | Ga0070690_1002439971 | 167 |
| 121 | 3300005330 | Ga0070690_100346682 | Ga0070690_1003466822 | 167 |
| 122 | 3300005331 | Ga0070670_100066660 | Ga0070670_1000666602 | 167 |
| 123 | 3300005331 | Ga0070670_100102347 | Ga0070670_1001023472 | 167 |
| 124 | 3300005334 | Ga0068869_100019533 | Ga0068869_1000195335 | 167 |
| 125 | 3300005334 | Ga0068869_100056223 | Ga0068869_1000562232 | 167 |
| 126 | 3300005334 | Ga0068869_100133844 | Ga0068869_1001338442 | 167 |
| 127 | 3300005334 | Ga0068869_100613964 | Ga0068869_1006139641 | 167 |
| 128 | 3300005335 | Ga0070666_10000303 | Ga0070666_1000030313 | 167 |
| 129 | 3300005335 | Ga0070666_10012379 | Ga0070666_100123796 | 167 |
| 130 | 3300005335 | Ga0070666_10251363 | Ga0070666_102513631 | 167 |
| 131 | 3300005336 | Ga0070680_100202632 | Ga0070680_1002026323 | 167 |
| 132 | 3300005336 | Ga0070680_100373394 | Ga0070680_1003733942 | 167 |
| 133 | 3300005337 | Ga0070682_100154126 | Ga0070682_1001541262 | 167 |
| 134 | 3300005338 | Ga0068868_100000177 | Ga0068868_10000017719 | 167 |
| 135 | 3300005338 | Ga0068868_100017469 | Ga0068868_1000174695 | 167 |
| 136 | 3300005338 | Ga0068868_100023646 | Ga0068868_1000236462 | 167 |
| 137 | 3300005338 | Ga0068868_100035202 | Ga0068868_1000352023 | 167 |
| 138 | 3300005339 | Ga0070660_100003304 | Ga0070660_1000033047 | 167 |
| 139 | 3300005340 | Ga0070689_100043517 | Ga0070689_1000435174 | 167 |
| 140 | 3300005340 | Ga0070689_101332879 | Ga0070689_1013328791 | 167 |
| 141 | 3300005344 | Ga0070661_100005063 | Ga0070661_1000050635 | 167 |
| 142 | 3300005344 | Ga0070661_100066001 | Ga0070661_1000660013 | 167 |
| 143 | 3300005344 | Ga0070661_100134540 | Ga0070661_1001345403 | 167 |
| 144 | 3300005347 | Ga0070668_100000022 | Ga0070668_10000002220 | 167 |
| 145 | 3300005347 | Ga0070668_100011383 | Ga0070668_1000113833 | 167 |
| 146 | 3300005347 | Ga0070668_100030037 | Ga0070668_1000300373 | 167 |
| 147 | 3300005353 | Ga0070669_100012393 | Ga0070669_1000123934 | 167 |
| 148 | 3300005353 | Ga0070669_100560973 | Ga0070669_1005609732 | 167 |
| 149 | 3300005354 | Ga0070675_100003907 | Ga0070675_10000390710 | 167 |
| 150 | 3300005354 | Ga0070675_100065083 | Ga0070675_1000650832 | 167 |
| 151 | 3300005354 | Ga0070675_100359411 | Ga0070675_1003594111 | 167 |
| 152 | 3300005354 | Ga0070675_100692711 | Ga0070675_1006927111 | 167 |
| 153 | 3300005355 | Ga0070671_100389713 | Ga0070671_1003897131 | 167 |
| 154 | 3300005355 | Ga0070671_100505169 | Ga0070671_1005051692 | 167 |
| 155 | 3300005355 | Ga0070671_100654251 | Ga0070671_1006542511 | 167 |
| 156 | 3300005356 | Ga0070674_100003780 | Ga0070674_1000037803 | 167 |
| 157 | 3300005356 | Ga0070674_100036667 | Ga0070674_1000366673 | 167 |
| 158 | 3300005356 | Ga0070674_101128809 | Ga0070674_1011288091 | 167 |
| 159 | 3300005364 | Ga0070673_100000090 | Ga0070673_10000009041 | 167 |
| 160 | 3300005364 | Ga0070673_100005548 | Ga0070673_1000055484 | 167 |
| 161 | 3300005364 | Ga0070673_100006318 | Ga0070673_1000063183 | 167 |
| 162 | 3300005364 | Ga0070673_100030181 | Ga0070673_1000301818 | 167 |
| 163 | 3300005364 | Ga0070673_100921135 | Ga0070673_1009211352 | 167 |
| 164 | 3300005365 | Ga0070688_100004674 | Ga0070688_1000046747 | 167 |
| 165 | 3300005365 | Ga0070688_100618541 | Ga0070688_1006185411 | 167 |
| 166 | 3300005366 | Ga0070659_100012440 | Ga0070659_1000124401 | 167 |
| 167 | 3300005366 | Ga0070659_100218796 | Ga0070659_1002187963 | 167 |
| 168 | 3300005367 | Ga0070667_100003830 | Ga0070667_1000038304 | 167 |
| 169 | 3300005367 | Ga0070667_100104894 | Ga0070667_1001048942 | 167 |
| 170 | 3300005367 | Ga0070667_100227413 | Ga0070667_1002274132 | 167 |
| 171 | 3300005438 | Ga0070701_10025221 | Ga0070701_100252212 | 167 |
| 172 | 3300005438 | Ga0070701_10046223 | Ga0070701_100462232 | 167 |
| 173 | 3300005440 | Ga0070705_100587688 | Ga0070705_1005876882 | 167 |
| 174 | 3300005456 | Ga0070678_100086310 | Ga0070678_1000863103 | 167 |
| 175 | 3300005456 | Ga0070678_100222188 | Ga0070678_1002221882 | 167 |
| 176 | 3300005456 | Ga0070678_100993393 | Ga0070678_1009933931 | 167 |
| 177 | 3300005457 | Ga0070662_100009127 | Ga0070662_1000091274 | 167 |
| 178 | 3300005457 | Ga0070662_100012996 | Ga0070662_1000129963 | 167 |
| 179 | 3300005457 | Ga0070662_100036168 | Ga0070662_1000361681 | 167 |
| 180 | 3300005457 | Ga0070662_100038739 | Ga0070662_1000387392 | 167 |
| 181 | 3300005459 | Ga0068867_100014418 | Ga0068867_1000144184 | 167 |
| 182 | 3300005466 | Ga0070685_10266083 | Ga0070685_102660832 | 167 |
| 183 | 3300005466 | Ga0070685_10666046 | Ga0070685_106660461 | 167 |
| 184 | 3300005471 | Ga0070698_100019462 | Ga0070698_10001946211 | 167 |
| 185 | 3300005471 | Ga0070698_100194357 | Ga0070698_1001943573 | 167 |
| 186 | 3300005471 | Ga0070698_100196931 | Ga0070698_1001969313 | 167 |
| 187 | 3300005539 | Ga0068853_100017053 | Ga0068853_1000170537 | 167 |
| 188 | 3300005539 | Ga0068853_100025858 | Ga0068853_1000258588 | 167 |
| 189 | 3300005539 | Ga0068853_100077988 | Ga0068853_1000779884 | 167 |
| 190 | 3300005543 | Ga0070672_100000149 | Ga0070672_10000014937 | 167 |
| 191 | 3300005543 | Ga0070672_100015120 | Ga0070672_1000151204 | 167 |
| 192 | 3300005543 | Ga0070672_100085853 | Ga0070672_1000858535 | 167 |
| 193 | 3300005548 | Ga0070665_100001508 | Ga0070665_10000150827 | 167 |
| 194 | 3300005548 | Ga0070665_100007085 | Ga0070665_1000070855 | 167 |
| 195 | 3300005563 | Ga0068855_100017503 | Ga0068855_1000175035 | 167 |
| 196 | 3300005563 | Ga0068855_100065715 | Ga0068855_1000657153 | 167 |
| 197 | 3300005563 | Ga0068855_100182062 | Ga0068855_1001820623 | 167 |
| 198 | 3300005563 | Ga0068855_100376721 | Ga0068855_1003767214 | 167 |
| 199 | 3300005564 | Ga0070664_100014730 | Ga0070664_1000147304 | 167 |
| 200 | 3300005564 | Ga0070664_100511002 | Ga0070664_1005110021 | 167 |
| 201 | 3300005577 | Ga0068857_100307241 | Ga0068857_1003072412 | 167 |
| 202 | 3300005578 | Ga0068854_100036442 | Ga0068854_1000364422 | 167 |
| 203 | 3300005615 | Ga0070702_100173234 | Ga0070702_1001732342 | 167 |
| 204 | 3300005615 | Ga0070702_100497692 | Ga0070702_1004976921 | 167 |
| 205 | 3300005616 | Ga0068852_100154924 | Ga0068852_1001549242 | 167 |
| 206 | 3300005616 | Ga0068852_100222464 | Ga0068852_1002224643 | 167 |
| 207 | 3300005616 | Ga0068852_100236418 | Ga0068852_1002364183 | 167 |
| 208 | 3300005616 | Ga0068852_100357185 | Ga0068852_1003571852 | 167 |
| 209 | 3300005617 | Ga0068859_100042598 | Ga0068859_1000425983 | 167 |
| 210 | 3300005617 | Ga0068859_100694729 | Ga0068859_1006947292 | 167 |
| 211 | 3300005617 | Ga0068859_101154537 | Ga0068859_1011545371 | 167 |
| 212 | 3300005617 | Ga0068859_101574425 | Ga0068859_1015744251 | 167 |
| 213 | 3300005618 | Ga0068864_100000404 | Ga0068864_1000004043 | 167 |
| 214 | 3300005618 | Ga0068864_100053850 | Ga0068864_1000538503 | 167 |
| 215 | 3300005618 | Ga0068864_100505123 | Ga0068864_1005051232 | 167 |
| 216 | 3300005618 | Ga0068864_100759750 | Ga0068864_1007597502 | 167 |
| 217 | 3300005718 | Ga0068866_10003292 | Ga0068866_100032924 | 167 |
| 218 | 3300005718 | Ga0068866_10165631 | Ga0068866_101656312 | 167 |
| 219 | 3300005719 | Ga0068861_100014937 | Ga0068861_1000149376 | 167 |
| 220 | 3300005719 | Ga0068861_100063618 | Ga0068861_1000636183 | 167 |
| 221 | 3300005719 | Ga0068861_100217217 | Ga0068861_1002172172 | 167 |
| 222 | 3300005834 | Ga0068851_10000712 | Ga0068851_100007125 | 167 |
| 223 | 3300005834 | Ga0068851_10053471 | Ga0068851_100534712 | 167 |
| 224 | 3300005834 | Ga0068851_10143981 | Ga0068851_101439812 | 167 |
| 225 | 3300005834 | Ga0068851_10200429 | Ga0068851_102004291 | 167 |
| 226 | 3300005840 | Ga0068870_10039922 | Ga0068870_100399223 | 167 |
| 227 | 3300005840 | Ga0068870_10131451 | Ga0068870_101314512 | 167 |
| 228 | 3300005841 | Ga0068863_100000216 | Ga0068863_10000021660 | 167 |
| 229 | 3300005841 | Ga0068863_100062485 | Ga0068863_1000624855 | 167 |
| 230 | 3300005841 | Ga0068863_100465408 | Ga0068863_1004654082 | 167 |
| 231 | 3300005842 | Ga0068858_100006030 | Ga0068858_1000060304 | 167 |
| 232 | 3300005842 | Ga0068858_100018008 | Ga0068858_10001800811 | 167 |
| 233 | 3300005842 | Ga0068858_100667249 | Ga0068858_1006672491 | 167 |
| 234 | 3300005842 | Ga0068858_101334152 | Ga0068858_1013341522 | 167 |
| 235 | 3300005843 | Ga0068860_100019189 | Ga0068860_1000191898 | 167 |
| 236 | 3300005843 | Ga0068860_100195522 | Ga0068860_1001955223 | 167 |
| 237 | 3300005843 | Ga0068860_100365657 | Ga0068860_1003656573 | 167 |
| 238 | 3300005843 | Ga0068860_100560611 | Ga0068860_1005606112 | 167 |
| 239 | 3300005844 | Ga0068862_100008729 | Ga0068862_1000087294 | 167 |
| 240 | 3300005844 | Ga0068862_100162459 | Ga0068862_1001624592 | 167 |
| 241 | 3300005985 | Ga0081539_10000925 | Ga0081539_1000092552 | 167 |
| 242 | 3300006195 | Ga0075366_10172410 | Ga0075366_101724101 | 167 |
| 243 | 3300006237 | Ga0097621_100000334 | Ga0097621_10000033418 | 167 |
| 244 | 3300006237 | Ga0097621_100003690 | Ga0097621_1000036905 | 167 |
| 245 | 3300006237 | Ga0097621_100051732 | Ga0097621_1000517321 | 167 |
| 246 | 3300006237 | Ga0097621_100071150 | Ga0097621_1000711504 | 167 |
| 247 | 3300006237 | Ga0097621_100150455 | Ga0097621_1001504554 | 167 |
| 248 | 3300006358 | Ga0068871_100000381 | Ga0068871_10000038133 | 167 |
| 249 | 3300006358 | Ga0068871_100008487 | Ga0068871_1000084873 | 167 |
| 250 | 3300006358 | Ga0068871_100022850 | Ga0068871_1000228504 | 167 |
| 251 | 3300006358 | Ga0068871_100210555 | Ga0068871_1002105552 | 167 |
| 252 | 3300006844 | Ga0075428_100064685 | Ga0075428_1000646853 | 167 |
| 253 | 3300006844 | Ga0075428_100169954 | Ga0075428_1001699544 | 167 |
| 254 | 3300006844 | Ga0075428_100439566 | Ga0075428_1004395662 | 167 |
| 255 | 3300006846 | Ga0075430_100180402 | Ga0075430_1001804021 | 167 |
| 256 | 3300006847 | Ga0075431_100051328 | Ga0075431_1000513283 | 167 |
| 257 | 3300006880 | Ga0075429_100032949 | Ga0075429_1000329492 | 167 |
| 258 | 3300006880 | Ga0075429_100757593 | Ga0075429_1007575932 | 167 |
| 259 | 3300006881 | Ga0068865_100016572 | Ga0068865_1000165724 | 167 |
| 260 | 3300006881 | Ga0068865_100361162 | Ga0068865_1003611622 | 167 |
| 261 | 3300006881 | Ga0068865_100733527 | Ga0068865_1007335272 | 167 |
| 262 | 3300006881 | Ga0068865_100851108 | Ga0068865_1008511082 | 167 |
| 263 | 3300006931 | Ga0097620_100042600 | Ga0097620_1000426003 | 167 |
| 264 | 3300006931 | Ga0097620_100694617 | Ga0097620_1006946172 | 167 |
| 265 | 3300006931 | Ga0097620_101154443 | Ga0097620_1011544431 | 167 |
| 266 | 3300006931 | Ga0097620_101574302 | Ga0097620_1015743021 | 167 |
| 267 | 3300009011 | Ga0105251_10330869 | Ga0105251_103308691 | 167 |
| 268 | 3300009093 | Ga0105240_10027503 | Ga0105240_100275033 | 167 |
| 269 | 3300009093 | Ga0105240_10036655 | Ga0105240_100366553 | 167 |
| 270 | 3300009093 | Ga0105240_10038564 | Ga0105240_100385643 | 167 |
| 271 | 3300009093 | Ga0105240_10099086 | Ga0105240_100990863 | 167 |
| 272 | 3300009093 | Ga0105240_10158659 | Ga0105240_101586593 | 167 |
| 273 | 3300009093 | Ga0105240_10591030 | Ga0105240_105910301 | 167 |
| 274 | 3300009093 | Ga0105240_11260722 | Ga0105240_112607222 | 167 |
| 275 | 3300009094 | Ga0111539_10053820 | Ga0111539_1005382010 | 167 |
| 276 | 3300009094 | Ga0111539_10097257 | Ga0111539_100972572 | 167 |
| 277 | 3300009094 | Ga0111539_11487499 | Ga0111539_114874991 | 167 |
| 278 | 3300009098 | Ga0105245_10344923 | Ga0105245_103449232 | 167 |
| 279 | 3300009098 | Ga0105245_11140814 | Ga0105245_111408141 | 167 |
| 280 | 3300009101 | Ga0105247_10023608 | Ga0105247_100236083 | 167 |
| 281 | 3300009147 | Ga0114129_10149925 | Ga0114129_101499252 | 167 |
| 282 | 3300009147 | Ga0114129_10281430 | Ga0114129_102814303 | 167 |
| 283 | 3300009174 | Ga0105241_10508904 | Ga0105241_105089042 | 167 |
| 284 | 3300009176 | Ga0105242_10032865 | Ga0105242_100328653 | 167 |
| 285 | 3300009176 | Ga0105242_10138406 | Ga0105242_101384062 | 167 |
| 286 | 3300009176 | Ga0105242_10869702 | Ga0105242_108697022 | 167 |
| 287 | 3300009177 | Ga0105248_11136403 | Ga0105248_111364031 | 167 |
| 288 | 3300009545 | Ga0105237_10023667 | Ga0105237_100236673 | 167 |
| 289 | 3300009545 | Ga0105237_10048216 | Ga0105237_100482162 | 167 |
| 290 | 3300009545 | Ga0105237_10101891 | Ga0105237_101018913 | 167 |
| 291 | 3300009545 | Ga0105237_10271562 | Ga0105237_102715622 | 167 |
| 292 | 3300009551 | Ga0105238_10088462 | Ga0105238_100884623 | 167 |
| 293 | 3300009551 | Ga0105238_10338288 | Ga0105238_103382882 | 167 |
| 294 | 3300009553 | Ga0105249_10001776 | Ga0105249_100017764 | 167 |
| 295 | 3300009553 | Ga0105249_10005977 | Ga0105249_100059777 | 167 |
| 296 | 3300009553 | Ga0105249_10011518 | Ga0105249_100115185 | 167 |
| 297 | 3300009553 | Ga0105249_10260342 | Ga0105249_102603423 | 167 |
| 298 | 3300009553 | Ga0105249_10479288 | Ga0105249_104792882 | 167 |
| 299 | 3300009553 | Ga0105249_11590074 | Ga0105249_115900742 | 167 |
| 300 | 3300010375 | Ga0105239_10000169 | Ga0105239_1000016946 | 167 |
| 301 | 3300010375 | Ga0105239_10060010 | Ga0105239_100600103 | 167 |
| 302 | 3300010375 | Ga0105239_10106272 | Ga0105239_101062722 | 167 |
| 303 | 3300011119 | Ga0105246_10019205 | Ga0105246_100192054 | 167 |
| 304 | 3300011119 | Ga0105246_10238300 | Ga0105246_102383002 | 167 |
| 305 | 3300013102 | Ga0157371_10008021 | Ga0157371_100080215 | 167 |
| 306 | 3300013102 | Ga0157371_10130865 | Ga0157371_101308653 | 167 |
| 307 | 3300013104 | Ga0157370_10033102 | Ga0157370_100331022 | 167 |
| 308 | 3300013104 | Ga0157370_10585237 | Ga0157370_105852372 | 167 |
| 309 | 3300013105 | Ga0157369_10053158 | Ga0157369_100531583 | 167 |
| 310 | 3300013105 | Ga0157369_10116206 | Ga0157369_101162062 | 167 |
| 311 | 3300013105 | Ga0157369_10556095 | Ga0157369_105560952 | 167 |
| 312 | 3300013105 | Ga0157369_10733862 | Ga0157369_107338622 | 167 |
| 313 | 3300013105 | Ga0157369_10923213 | Ga0157369_109232132 | 167 |
| 314 | 3300013296 | Ga0157374_10000001 | Ga0157374_10000001522 | 167 |
| 315 | 3300013296 | Ga0157374_10000467 | Ga0157374_1000046719 | 167 |
| 316 | 3300013296 | Ga0157374_10011894 | Ga0157374_100118945 | 167 |
| 317 | 3300013296 | Ga0157374_10013945 | Ga0157374_100139458 | 167 |
| 318 | 3300013296 | Ga0157374_10025397 | Ga0157374_100253972 | 167 |
| 319 | 3300013297 | Ga0157378_10007156 | Ga0157378_100071563 | 167 |
| 320 | 3300013297 | Ga0157378_10018840 | Ga0157378_100188407 | 167 |
| 321 | 3300013297 | Ga0157378_10091216 | Ga0157378_100912164 | 167 |
| 322 | 3300013297 | Ga0157378_10099175 | Ga0157378_100991753 | 167 |
| 323 | 3300013297 | Ga0157378_10809866 | Ga0157378_108098661 | 167 |
| 324 | 3300013297 | Ga0157378_11266256 | Ga0157378_112662562 | 167 |
| 325 | 3300013306 | Ga0163162_10000340 | Ga0163162_1000034014 | 167 |
| 326 | 3300013306 | Ga0163162_10029068 | Ga0163162_100290688 | 167 |
| 327 | 3300013306 | Ga0163162_10085780 | Ga0163162_100857802 | 167 |
| 328 | 3300013306 | Ga0163162_10853390 | Ga0163162_108533902 | 167 |
| 329 | 3300013307 | Ga0157372_10000644 | Ga0157372_1000064425 | 167 |
| 330 | 3300013307 | Ga0157372_10227672 | Ga0157372_102276722 | 167 |
| 331 | 3300013307 | Ga0157372_10375413 | Ga0157372_103754131 | 167 |
| 332 | 3300013307 | Ga0157372_10501245 | Ga0157372_105012453 | 167 |
| 333 | 3300013307 | Ga0157372_10529591 | Ga0157372_105295912 | 167 |
| 334 | 3300013307 | Ga0157372_11708176 | Ga0157372_117081761 | 167 |
| 335 | 3300013308 | Ga0157375_10004239 | Ga0157375_100042395 | 167 |
| 336 | 3300013308 | Ga0157375_10009790 | Ga0157375_100097903 | 167 |
| 337 | 3300013308 | Ga0157375_10040227 | Ga0157375_100402272 | 167 |
| 338 | 3300013308 | Ga0157375_10147483 | Ga0157375_101474832 | 167 |
| 339 | 3300013308 | Ga0157375_10214304 | Ga0157375_102143042 | 167 |
| 340 | 3300013308 | Ga0157375_10240866 | Ga0157375_102408662 | 167 |
| 341 | 3300013308 | Ga0157375_10294176 | Ga0157375_102941763 | 167 |
| 342 | 3300014325 | Ga0163163_10000349 | Ga0163163_1000034928 | 167 |
| 343 | 3300014325 | Ga0163163_10541579 | Ga0163163_105415792 | 167 |
| 344 | 3300014325 | Ga0163163_10831602 | Ga0163163_108316022 | 167 |
| 345 | 3300014326 | Ga0157380_10014224 | Ga0157380_1001422414 | 167 |
| 346 | 3300014326 | Ga0157380_10172983 | Ga0157380_101729833 | 167 |
| 347 | 3300014745 | Ga0157377_10021020 | Ga0157377_100210202 | 167 |
| 348 | 3300014745 | Ga0157377_10030355 | Ga0157377_100303554 | 167 |
| 349 | 3300014745 | Ga0157377_10203908 | Ga0157377_102039082 | 167 |
| 350 | 3300014745 | Ga0157377_10258777 | Ga0157377_102587772 | 167 |
| 351 | 3300014968 | Ga0157379_10000068 | Ga0157379_1000006814 | 167 |
| 352 | 3300014969 | Ga0157376_10000743 | Ga0157376_1000074323 | 167 |
| 353 | 3300014969 | Ga0157376_10003830 | Ga0157376_100038304 | 167 |
| 354 | 3300014969 | Ga0157376_10210757 | Ga0157376_102107572 | 167 |
| 355 | 3300014969 | Ga0157376_10378867 | Ga0157376_103788672 | 167 |
| 356 | 3300014969 | Ga0157376_10382771 | Ga0157376_103827712 | 167 |
| 357 | 3300014969 | Ga0157376_10559517 | Ga0157376_105595172 | 167 |
| 358 | 3300014969 | Ga0157376_10886761 | Ga0157376_108867612 | 167 |
| 359 | 3300015261 | Ga0182006_1074727 | Ga0182006_10747272 | 167 |
| 360 | 3300017792 | Ga0163161_10082195 | Ga0163161_100821952 | 167 |
| 361 | 3300017792 | Ga0163161_10172690 | Ga0163161_101726902 | 167 |
| 362 | 3300017792 | Ga0163161_10830251 | Ga0163161_108302511 | 167 |
| 363 | 3300017792 | Ga0163161_11456010 | Ga0163161_114560101 | 167 |
| 364 | 3300021384 | Ga0213876_10057389 | Ga0213876_100573893 | 167 |
| 365 | 3300025302 | Ga0207426_1000032 | Ga0207426_1000032168 | 167 |
| 366 | 3300025302 | Ga0207426_1128265 | Ga0207426_11282651 | 167 |
| 367 | 3300025315 | Ga0207697_10082832 | Ga0207697_100828322 | 167 |
| 368 | 3300025321 | Ga0207656_10001620 | Ga0207656_100016208 | 167 |
| 369 | 3300025321 | Ga0207656_10185129 | Ga0207656_101851292 | 167 |
| 370 | 3300025893 | Ga0207682_10020997 | Ga0207682_100209973 | 167 |
| 371 | 3300025901 | Ga0207688_10054638 | Ga0207688_100546384 | 167 |
| 372 | 3300025901 | Ga0207688_10142761 | Ga0207688_101427612 | 167 |
| 373 | 3300025903 | Ga0207680_10000358 | Ga0207680_1000035814 | 167 |
| 374 | 3300025904 | Ga0207647_10026855 | Ga0207647_100268553 | 167 |
| 375 | 3300025904 | Ga0207647_10073901 | Ga0207647_100739012 | 167 |
| 376 | 3300025904 | Ga0207647_10175810 | Ga0207647_101758102 | 167 |
| 377 | 3300025907 | Ga0207645_10001770 | Ga0207645_100017706 | 167 |
| 378 | 3300025907 | Ga0207645_10005531 | Ga0207645_100055315 | 167 |
| 379 | 3300025907 | Ga0207645_10009423 | Ga0207645_100094233 | 167 |
| 380 | 3300025907 | Ga0207645_10036823 | Ga0207645_100368231 | 167 |
| 381 | 3300025908 | Ga0207643_10067206 | Ga0207643_100672062 | 167 |
| 382 | 3300025909 | Ga0207705_10001320 | Ga0207705_1000132018 | 167 |
| 383 | 3300025911 | Ga0207654_10455608 | Ga0207654_104556081 | 167 |
| 384 | 3300025912 | Ga0207707_10163668 | Ga0207707_101636683 | 167 |
| 385 | 3300025913 | Ga0207695_10000962 | Ga0207695_1000096231 | 167 |
| 386 | 3300025913 | Ga0207695_10007602 | Ga0207695_100076029 | 167 |
| 387 | 3300025913 | Ga0207695_10092967 | Ga0207695_100929673 | 167 |
| 388 | 3300025913 | Ga0207695_10169923 | Ga0207695_101699232 | 167 |
| 389 | 3300025913 | Ga0207695_10306208 | Ga0207695_103062082 | 167 |
| 390 | 3300025914 | Ga0207671_10045087 | Ga0207671_100450873 | 167 |
| 391 | 3300025914 | Ga0207671_10120255 | Ga0207671_101202552 | 167 |
| 392 | 3300025914 | Ga0207671_10127010 | Ga0207671_101270103 | 167 |
| 393 | 3300025914 | Ga0207671_10232143 | Ga0207671_102321432 | 167 |
| 394 | 3300025916 | Ga0207663_10735304 | Ga0207663_107353042 | 167 |
| 395 | 3300025917 | Ga0207660_10053302 | Ga0207660_100533023 | 167 |
| 396 | 3300025919 | Ga0207657_10007324 | Ga0207657_100073247 | 167 |
| 397 | 3300025920 | Ga0207649_10193168 | Ga0207649_101931682 | 167 |
| 398 | 3300025921 | Ga0207652_10335846 | Ga0207652_103358462 | 167 |
| 399 | 3300025923 | Ga0207681_10004291 | Ga0207681_1000429118 | 167 |
| 400 | 3300025923 | Ga0207681_10078362 | Ga0207681_100783622 | 167 |
| 401 | 3300025924 | Ga0207694_10063603 | Ga0207694_100636032 | 167 |
| 402 | 3300025925 | Ga0207650_10047200 | Ga0207650_100472003 | 167 |
| 403 | 3300025925 | Ga0207650_10545425 | Ga0207650_105454252 | 167 |
| 404 | 3300025926 | Ga0207659_10057528 | Ga0207659_100575283 | 167 |
| 405 | 3300025926 | Ga0207659_10205603 | Ga0207659_102056032 | 167 |
| 406 | 3300025926 | Ga0207659_10283219 | Ga0207659_102832192 | 167 |
| 407 | 3300025926 | Ga0207659_10553967 | Ga0207659_105539671 | 167 |
| 408 | 3300025927 | Ga0207687_10201639 | Ga0207687_102016391 | 167 |
| 409 | 3300025927 | Ga0207687_10928734 | Ga0207687_109287341 | 167 |
| 410 | 3300025931 | Ga0207644_10519265 | Ga0207644_105192652 | 167 |
| 411 | 3300025931 | Ga0207644_10940290 | Ga0207644_109402902 | 167 |
| 412 | 3300025932 | Ga0207690_10016626 | Ga0207690_100166262 | 167 |
| 413 | 3300025933 | Ga0207706_10000817 | Ga0207706_1000081720 | 167 |
| 414 | 3300025933 | Ga0207706_10023585 | Ga0207706_100235853 | 167 |
| 415 | 3300025933 | Ga0207706_10039589 | Ga0207706_100395895 | 167 |
| 416 | 3300025933 | Ga0207706_10470393 | Ga0207706_104703931 | 167 |
| 417 | 3300025934 | Ga0207686_10037065 | Ga0207686_100370653 | 167 |
| 418 | 3300025936 | Ga0207670_10032249 | Ga0207670_100322493 | 167 |
| 419 | 3300025936 | Ga0207670_10327013 | Ga0207670_103270132 | 167 |
| 420 | 3300025936 | Ga0207670_11065018 | Ga0207670_110650181 | 167 |
| 421 | 3300025937 | Ga0207669_10011306 | Ga0207669_100113063 | 167 |
| 422 | 3300025938 | Ga0207704_10060251 | Ga0207704_100602512 | 167 |
| 423 | 3300025938 | Ga0207704_11358113 | Ga0207704_113581131 | 167 |
| 424 | 3300025940 | Ga0207691_10000113 | Ga0207691_1000011325 | 167 |
| 425 | 3300025940 | Ga0207691_10026487 | Ga0207691_100264874 | 167 |
| 426 | 3300025940 | Ga0207691_10133438 | Ga0207691_101334384 | 167 |
| 427 | 3300025940 | Ga0207691_10241404 | Ga0207691_102414042 | 167 |
| 428 | 3300025942 | Ga0207689_10001136 | Ga0207689_100011365 | 167 |
| 429 | 3300025942 | Ga0207689_10024823 | Ga0207689_100248235 | 167 |
| 430 | 3300025942 | Ga0207689_10072661 | Ga0207689_100726612 | 167 |
| 431 | 3300025942 | Ga0207689_10186232 | Ga0207689_101862322 | 167 |
| 432 | 3300025945 | Ga0207679_10635601 | Ga0207679_106356012 | 167 |
| 433 | 3300025949 | Ga0207667_10019146 | Ga0207667_100191462 | 167 |
| 434 | 3300025949 | Ga0207667_10178668 | Ga0207667_101786682 | 167 |
| 435 | 3300025960 | Ga0207651_10001967 | Ga0207651_100019673 | 167 |
| 436 | 3300025960 | Ga0207651_10044765 | Ga0207651_100447653 | 167 |
| 437 | 3300025960 | Ga0207651_10115601 | Ga0207651_101156012 | 167 |
| 438 | 3300025960 | Ga0207651_10418444 | Ga0207651_104184442 | 167 |
| 439 | 3300025961 | Ga0207712_10006120 | Ga0207712_100061202 | 167 |
| 440 | 3300025961 | Ga0207712_10011688 | Ga0207712_100116884 | 167 |
| 441 | 3300025961 | Ga0207712_10096035 | Ga0207712_100960351 | 167 |
| 442 | 3300025961 | Ga0207712_10119075 | Ga0207712_101190752 | 167 |
| 443 | 3300025961 | Ga0207712_10449733 | Ga0207712_104497331 | 167 |
| 444 | 3300025972 | Ga0207668_10003018 | Ga0207668_100030182 | 167 |
| 445 | 3300025972 | Ga0207668_10134873 | Ga0207668_101348732 | 167 |
| 446 | 3300025981 | Ga0207640_10064000 | Ga0207640_100640004 | 167 |
| 447 | 3300025981 | Ga0207640_10233590 | Ga0207640_102335902 | 167 |
| 448 | 3300025981 | Ga0207640_10640949 | Ga0207640_106409492 | 167 |
| 449 | 3300025986 | Ga0207658_10000759 | Ga0207658_1000075915 | 167 |
| 450 | 3300025986 | Ga0207658_10089800 | Ga0207658_100898004 | 167 |
| 451 | 3300025986 | Ga0207658_10089965 | Ga0207658_100899653 | 167 |
| 452 | 3300025986 | Ga0207658_10464408 | Ga0207658_104644082 | 167 |
| 453 | 3300025986 | Ga0207658_10470979 | Ga0207658_104709792 | 167 |
| 454 | 3300026023 | Ga0207677_10005254 | Ga0207677_100052548 | 167 |
| 455 | 3300026023 | Ga0207677_10147283 | Ga0207677_101472832 | 167 |
| 456 | 3300026023 | Ga0207677_10211811 | Ga0207677_102118112 | 167 |
| 457 | 3300026035 | Ga0207703_10000316 | Ga0207703_1000031634 | 167 |
| 458 | 3300026035 | Ga0207703_10259307 | Ga0207703_102593073 | 167 |
| 459 | 3300026035 | Ga0207703_10947963 | Ga0207703_109479631 | 167 |
| 460 | 3300026035 | Ga0207703_10961762 | Ga0207703_109617621 | 167 |
| 461 | 3300026041 | Ga0207639_10007654 | Ga0207639_100076542 | 167 |
| 462 | 3300026041 | Ga0207639_10137876 | Ga0207639_101378763 | 167 |
| 463 | 3300026041 | Ga0207639_10374565 | Ga0207639_103745651 | 167 |
| 464 | 3300026067 | Ga0207678_10599780 | Ga0207678_105997802 | 167 |
| 465 | 3300026075 | Ga0207708_10929874 | Ga0207708_109298741 | 167 |
| 466 | 3300026088 | Ga0207641_10001605 | Ga0207641_100016057 | 167 |
| 467 | 3300026088 | Ga0207641_10094324 | Ga0207641_100943243 | 167 |
| 468 | 3300026088 | Ga0207641_10443252 | Ga0207641_104432521 | 167 |
| 469 | 3300026089 | Ga0207648_10002305 | Ga0207648_1000230511 | 167 |
| 470 | 3300026089 | Ga0207648_10004992 | Ga0207648_100049926 | 167 |
| 471 | 3300026089 | Ga0207648_10226031 | Ga0207648_102260311 | 167 |
| 472 | 3300026089 | Ga0207648_10260108 | Ga0207648_102601082 | 167 |
| 473 | 3300026089 | Ga0207648_10320590 | Ga0207648_103205902 | 167 |
| 474 | 3300026095 | Ga0207676_10001882 | Ga0207676_1000188218 | 167 |
| 475 | 3300026095 | Ga0207676_10036382 | Ga0207676_100363825 | 167 |
| 476 | 3300026095 | Ga0207676_10076264 | Ga0207676_100762644 | 167 |
| 477 | 3300026095 | Ga0207676_10285216 | Ga0207676_102852162 | 167 |
| 478 | 3300026095 | Ga0207676_10421966 | Ga0207676_104219662 | 167 |
| 479 | 3300026095 | Ga0207676_10757211 | Ga0207676_107572111 | 167 |
| 480 | 3300026116 | Ga0207674_10033492 | Ga0207674_100334925 | 167 |
| 481 | 3300026116 | Ga0207674_10147964 | Ga0207674_101479644 | 167 |
| 482 | 3300026116 | Ga0207674_10438332 | Ga0207674_104383322 | 167 |
| 483 | 3300026116 | Ga0207674_10989212 | Ga0207674_109892121 | 167 |
| 484 | 3300026118 | Ga0207675_100027050 | Ga0207675_1000270509 | 167 |
| 485 | 3300026118 | Ga0207675_100067158 | Ga0207675_1000671586 | 167 |
| 486 | 3300026118 | Ga0207675_100098413 | Ga0207675_1000984133 | 167 |
| 487 | 3300026118 | Ga0207675_100204103 | Ga0207675_1002041032 | 167 |
| 488 | 3300026118 | Ga0207675_100773435 | Ga0207675_1007734352 | 167 |
| 489 | 3300026118 | Ga0207675_101493494 | Ga0207675_1014934941 | 167 |
| 490 | 3300026121 | Ga0207683_10002777 | Ga0207683_100027779 | 167 |
| 491 | 3300026121 | Ga0207683_10063785 | Ga0207683_100637855 | 167 |
| 492 | 3300026121 | Ga0207683_10103776 | Ga0207683_101037763 | 167 |
| 493 | 3300026121 | Ga0207683_10303993 | Ga0207683_103039932 | 167 |
| 494 | 3300026121 | Ga0207683_10806538 | Ga0207683_108065381 | 167 |
| 495 | 3300026142 | Ga0207698_10232715 | Ga0207698_102327152 | 167 |
| 496 | 3300026142 | Ga0207698_10278184 | Ga0207698_102781842 | 167 |
| 497 | 3300026142 | Ga0207698_10285256 | Ga0207698_102852561 | 167 |
| 498 | 3300026142 | Ga0207698_10317791 | Ga0207698_103177912 | 167 |
| 499 | 3300026142 | Ga0207698_11360889 | Ga0207698_113608892 | 167 |
| 500 | 3300027543 | Ga0209999_1032362 | Ga0209999_10323622 | 167 |
| 501 | 3300027876 | Ga0209974_10095085 | Ga0209974_100950852 | 167 |
| 502 | 3300027876 | Ga0209974_10181214 | Ga0209974_101812142 | 167 |
| 503 | 3300028379 | Ga0268266_10001351 | Ga0268266_1000135117 | 167 |
| 504 | 3300028379 | Ga0268266_10234120 | Ga0268266_102341203 | 167 |
| 505 | 3300028379 | Ga0268266_11290011 | Ga0268266_112900112 | 167 |
| 506 | 3300028380 | Ga0268265_10303711 | Ga0268265_103037112 | 167 |
| 507 | 3300028380 | Ga0268265_11252394 | Ga0268265_112523941 | 167 |
| 508 | 3300028381 | Ga0268264_10055897 | Ga0268264_100558972 | 167 |
| 509 | 3300028381 | Ga0268264_10178045 | Ga0268264_101780452 | 167 |
| 510 | 3300028381 | Ga0268264_11056395 | Ga0268264_110563952 | 167 |
| 511 | 3300031251 | Ga0265327_10000366 | Ga0265327_1000036637 | 167 |
| 512 | 3300031903 | Ga0307407_11126864 | Ga0307407_111268641 | 167 |
| 513 | 3300032002 | Ga0307416_101106975 | Ga0307416_1011069751 | 167 |
| 514 | 3300035092 | Ga0373952_0058148 | Ga0373952_0058148_320_850 | 167 |
| 515 | 3300035241 | Ga0373961_0174354 | Ga0373961_0174354_190_720 | 167 |
| 516 | 3300036401 | Ga0373937_0356071 | Ga0373937_0356071_726_1256 | 167 |
| 517 | 3300036401 | Ga0373937_0869688 | Ga0373937_0869688_104_619 | 167 |
| 518 | 3300037418 | Ga0395900_0929139 | Ga0395900_0929139_165_695 | 167 |
| 519 | 3300039437 | Ga0436365_1548207 | Ga0436365_1548207_274_804 | 167 |
| 520 | 3300039437 | Ga0436365_1929414 | Ga0436365_1929414_3156_3686 | 167 |
| 521 | 3300042125 | Ga0450923_016086 | Ga0450923_016086_313_828 | 167 |
| 522 | 3300042156 | Ga0439446_0095064 | Ga0439446_0095064_98_613 | 167 |
| 523 | 3300042436 | Ga0439435_0075688 | Ga0439435_0075688_358_876 | 167 |
| 524 | 3300044658 | Ga0466972_0103905 | Ga0466972_0103905_583_1113 | 167 |
| 525 | 3300044673 | Ga0453683_0030589 | Ga0453683_0030589_697_1227 | 167 |
| 526 | 3300044673 | Ga0453683_0100341 | Ga0453683_0100341_492_1007 | 167 |
| 527 | 3300044683 | Ga0466965_0051633 | Ga0466965_0051633_119_649 | 167 |
| 528 | 3300044684 | Ga0466966_0329937 | Ga0466966_0329937_90_620 | 167 |
| 529 | 3300044712 | Ga0453684_0238530 | Ga0453684_0238530_1276_1806 | 167 |
| 530 | 3300044735 | Ga0466968_0061112 | Ga0466968_0061112_1084_1614 | 167 |
| 531 | 3300044765 | Ga0466970_0139410 | Ga0466970_0139410_753_1283 | 167 |
| 532 | 3300045976 | Ga0466967_0225813 | Ga0466967_0225813_222_752 | 167 |
| 533 | 3300046517 | Ga0495630_0183739 | Ga0495630_0183739_60_590 | 167 |
| 534 | 3300046642 | Ga0495634_0466056 | Ga0495634_0466056_12_527 | 167 |
| 535 | 3300048905 | Ga0496102_0532146 | Ga0496102_0532146_182_712 | 167 |
| 536 | 3300048910 | Ga0496107_0501628 | Ga0496107_0501628_26_556 | 167 |
| 537 | 3300049127 | Ga0501306_001423 | Ga0501306_001423_474_1004 | 167 |
| 538 | 3300049127 | Ga0501306_027935 | Ga0501306_027935_260_790 | 167 |
| 539 | 3300049128 | Ga0501308_008913 | Ga0501308_008913_328_858 | 167 |
| 540 | 3300049129 | Ga0501309_004541 | Ga0501309_004541_503_1033 | 167 |
| 541 | 3300049130 | Ga0501310_008601 | Ga0501310_008601_104_634 | 167 |
| 542 | 3300049131 | Ga0501341_00741 | Ga0501341_00741_392_922 | 167 |
| 543 | 3300049132 | Ga0501343_002166 | Ga0501343_002166_333_863 | 167 |
| 544 | 3300049160 | Ga0501304_006763 | Ga0501304_006763_370_900 | 167 |
| 545 | 3300049161 | Ga0501305_001466 | Ga0501305_001466_504_1034 | 167 |
| 546 | 3300049161 | Ga0501305_011062 | Ga0501305_011062_237_767 | 167 |
| 547 | 3300049162 | Ga0501307_003819 | Ga0501307_003819_504_1034 | 167 |
| 548 | 3300049521 | Ga0501298_038960 | Ga0501298_038960_32_562 | 167 |
| 549 | 3300049527 | Ga0501311_007435 | Ga0501311_007435_236_766 | 167 |
| 550 | 3300049529 | Ga0501313_003764 | Ga0501313_003764_493_1023 | 167 |
| 551 | 3300049530 | Ga0501314_003156 | Ga0501314_003156_326_856 | 167 |
| 552 | 3300049531 | Ga0501315_002099 | Ga0501315_002099_840_1370 | 167 |
| 553 | 3300049531 | Ga0501315_003222 | Ga0501315_003222_594_1124 | 167 |
| 554 | 3300049531 | Ga0501315_020326 | Ga0501315_020326_35_565 | 167 |
| 555 | 3300049531 | Ga0501315_034237 | Ga0501315_034237_17_547 | 167 |
| 556 | 3300049531 | Ga0501315_071676 | Ga0501315_071676_35_565 | 167 |
| 557 | 3300049532 | Ga0501316_004650 | Ga0501316_004650_390_920 | 167 |
| 558 | 3300049533 | Ga0501317_000922 | Ga0501317_000922_1301_1831 | 167 |
| 559 | 3300049534 | Ga0501318_008846 | Ga0501318_008846_522_1052 | 167 |
| 560 | 3300049537 | Ga0501321_000711 | Ga0501321_000711_1273_1803 | 167 |
| 561 | 3300049539 | Ga0501323_004486 | Ga0501323_004486_470_1000 | 167 |
| 562 | 3300049540 | Ga0501324_001617 | Ga0501324_001617_514_1044 | 167 |
| 563 | 3300049545 | Ga0501329_01899 | Ga0501329_01899_318_848 | 167 |
| 564 | 3300049546 | Ga0501330_001281 | Ga0501330_001281_392_922 | 167 |
| 565 | 3300049548 | Ga0501332_00970 | Ga0501332_00970_474_1004 | 167 |
| 566 | 3300049548 | Ga0501332_01863 | Ga0501332_01863_228_758 | 167 |
| 567 | 3300049550 | Ga0501334_00963 | Ga0501334_00963_510_1040 | 167 |
| 568 | 3300049550 | Ga0501334_02415 | Ga0501334_02415_101_631 | 167 |
| 569 | 3300049551 | Ga0501335_006219 | Ga0501335_006219_513_1043 | 167 |
| 570 | 3300049551 | Ga0501335_021289 | Ga0501335_021289_41_571 | 167 |
| 571 | 3300049552 | Ga0501336_003553 | Ga0501336_003553_60_590 | 167 |
| 572 | 3300049552 | Ga0501336_005029 | Ga0501336_005029_330_860 | 167 |
| 573 | 3300049553 | Ga0501337_001150 | Ga0501337_001150_441_971 | 167 |
| 574 | 3300049554 | Ga0501338_00443 | Ga0501338_00443_1247_1777 | 167 |
| 575 | 3300049554 | Ga0501338_02541 | Ga0501338_02541_449_979 | 167 |
| 576 | 3300049569 | Ga0501032_0019262 | Ga0501032_0019262_1656_2171 | 167 |
| 577 | 3300049571 | Ga0501034_0010008 | Ga0501034_0010008_3417_3932 | 167 |
| 578 | 3300049572 | Ga0501036_0125079 | Ga0501036_0125079_1275_1790 | 167 |
| 579 | 3300049573 | Ga0501037_0059629 | Ga0501037_0059629_836_1351 | 167 |
| 580 | 3300049574 | Ga0501038_0109514 | Ga0501038_0109514_1371_1886 | 167 |
| 581 | 3300049575 | Ga0501039_0050368 | Ga0501039_0050368_491_1006 | 167 |
| 582 | 3300049579 | Ga0501043_0004087 | Ga0501043_0004087_8008_8523 | 167 |
| 583 | 3300049580 | Ga0501046_0017480 | Ga0501046_0017480_538_1053 | 167 |
| 584 | 3300049581 | Ga0501047_0003665 | Ga0501047_0003665_13858_14373 | 167 |
| 585 | 3300049582 | Ga0501048_0050802 | Ga0501048_0050802_476_991 | 167 |
| 586 | 3300049583 | Ga0501067_0006420 | Ga0501067_0006420_4578_5093 | 167 |
| 587 | 3300049584 | Ga0501068_0101475 | Ga0501068_0101475_44_559 | 167 |
| 588 | 3300049586 | Ga0501070_0028792 | Ga0501070_0028792_1982_2497 | 167 |
| 589 | 3300049589 | Ga0501073_0005302 | Ga0501073_0005302_538_1053 | 167 |
| 590 | 3300049590 | Ga0501074_0000797 | Ga0501074_0000797_15262_15777 | 167 |
| 591 | 3300049649 | Ga0501198_021401 | Ga0501198_021401_96_626 | 167 |
| 592 | 3300049654 | Ga0501207_002993 | Ga0501207_002993_916_1446 | 167 |
| 593 | 3300049661 | Ga0501217_244982 | Ga0501217_244982_35_565 | 167 |
| 594 | 3300049665 | Ga0501227_054758 | Ga0501227_054758_338_868 | 167 |
| 595 | 3300049666 | Ga0501228_003544 | Ga0501228_003544_43_573 | 167 |
| 596 | 3300049666 | Ga0501228_007798 | Ga0501228_007798_44_574 | 167 |
| 597 | 3300049669 | Ga0501235_001267 | Ga0501235_001267_1024_1554 | 167 |
| 598 | 3300049674 | Ga0501242_005146 | Ga0501242_005146_109_639 | 167 |
| 599 | 3300049681 | Ga0501251_028613 | Ga0501251_028613_214_744 | 167 |
| 600 | 3300049690 | Ga0501261_003348 | Ga0501261_003348_584_1114 | 167 |
| 601 | 3300049704 | Ga0501221_000112 | Ga0501221_000112_3175_3705 | 167 |
| 602 | 3300049704 | Ga0501221_016364 | Ga0501221_016364_860_1390 | 167 |
| 603 | 3300049705 | Ga0501225_0002315 | Ga0501225_0002315_98_628 | 167 |
| 604 | 3300049707 | Ga0501234_008670 | Ga0501234_008670_1037_1567 | 167 |
| 605 | 3300049708 | Ga0501245_005940 | Ga0501245_005940_13_543 | 167 |
| 606 | 3300049742 | Ga0501080_0052791 | Ga0501080_0052791_3214_3729 | 167 |
| 607 | 3300049742 | Ga0501080_0460567 | Ga0501080_0460567_135_665 | 167 |
| 608 | 3300049744 | Ga0501083_0044352 | Ga0501083_0044352_725_1240 | 167 |
| 609 | 3300049775 | Ga0501279_022600 | Ga0501279_022600_262_792 | 167 |
| 610 | 3300049822 | Ga0501035_0153636 | Ga0501035_0153636_245_775 | 167 |
| 611 | 3300049824 | Ga0501045_0165790 | Ga0501045_0165790_762_1277 | 167 |
| 612 | 3300049853 | Ga0501226_031499 | Ga0501226_031499_40_570 | 167 |
| 613 | 3300050507 | nmdc:mga05p37_231260_c1 | nmdc:mga05p37_231260_c1_1287_1802 | 167 |
| 614 | 3300050507 | nmdc:mga05p37_281992_c1 | nmdc:mga05p37_281992_c1_149_667 | 167 |
| 615 | 3300050508 | nmdc:mga09592_45343_c1 | nmdc:mga09592_45343_c1_3038_3553 | 167 |
| 616 | 3300050508 | nmdc:mga09592_49621_c1 | nmdc:mga09592_49621_c1_536_1054 | 167 |
| 617 | 3300050508 | nmdc:mga09592_682730_c1 | nmdc:mga09592_682730_c1_45_575 | 167 |
| 618 | 3300050509 | nmdc:mga0qj67_157636_c1 | nmdc:mga0qj67_157636_c1_380_895 | 167 |
| 619 | 3300050510 | nmdc:mga06r32_32850_c2 | nmdc:mga06r32_32850_c2_308_823 | 167 |
| 620 | 3300050511 | nmdc:mga08y16_202537_c1 | nmdc:mga08y16_202537_c1_782_1312 | 167 |
| 621 | 3300053096 | Ga0500641_0025200 | Ga0500641_0025200_298_828 | 167 |
| 622 | 3300059492 | Ga0587073_0060123 | Ga0587073_0060123_189_719 | 167 |
| 623 | 3300059493 | Ga0587077_002325 | Ga0587077_002325_1278_1808 | 167 |
| 624 | 3300059510 | Ga0587090_033183 | Ga0587090_033183_249_779 | 167 |
| 625 | 3300059630 | Ga0587128_072393 | Ga0587128_072393_96_626 | 167 |
| 626 | 3300001989 | JGI24739J22299_10000798 | JGI24739J22299_1000079815 | 168 |
| 627 | 3300001989 | JGI24739J22299_10003052 | JGI24739J22299_100030524 | 168 |
| 628 | 3300002738 | JGI25154J39366_1000001 | JGI25154J39366_1000001382 | 168 |
| 629 | 3300002741 | JGI25157J39369_1003512 | JGI25157J39369_10035123 | 168 |
| 630 | 3300003215 | JGI25153J46596_10001870 | JGI25153J46596_100018704 | 168 |
| 631 | 3300003215 | JGI25153J46596_10005056 | JGI25153J46596_100050561 | 168 |
| 632 | 3300003323 | rootH1_10032943 | rootH1_100329434 | 168 |
| 633 | 3300003354 | JGI25160J50197_1008979 | JGI25160J50197_10089794 | 168 |
| 634 | 3300003354 | JGI25160J50197_1018530 | JGI25160J50197_10185303 | 168 |
| 635 | 3300003771 | Ga0055526_1016300 | Ga0055526_10163001 | 168 |
| 636 | 3300003790 | Ga0055528_1009578 | Ga0055528_10095783 | 168 |
| 637 | 3300003794 | Ga0055531_10020429 | Ga0055531_100204291 | 168 |
| 638 | 3300004625 | Ga0055543_1038139 | Ga0055543_10381391 | 168 |
| 639 | 3300005262 | Ga0065165_1000112 | Ga0065165_10001129 | 168 |
| 640 | 3300005289 | Ga0065704_10414176 | Ga0065704_104141761 | 168 |
| 641 | 3300005290 | Ga0065712_10004615 | Ga0065712_100046158 | 168 |
| 642 | 3300005290 | Ga0065712_10401979 | Ga0065712_104019791 | 168 |
| 643 | 3300005290 | Ga0065712_10561093 | Ga0065712_105610931 | 168 |
| 644 | 3300005293 | Ga0065715_10130180 | Ga0065715_101301802 | 168 |
| 645 | 3300005293 | Ga0065715_10164987 | Ga0065715_101649873 | 168 |
| 646 | 3300005328 | Ga0070676_10235057 | Ga0070676_102350572 | 168 |
| 647 | 3300005328 | Ga0070676_10343053 | Ga0070676_103430532 | 168 |
| 648 | 3300005329 | Ga0070683_100000417 | Ga0070683_1000004173 | 168 |
| 649 | 3300005329 | Ga0070683_100018251 | Ga0070683_1000182513 | 168 |
| 650 | 3300005330 | Ga0070690_100028796 | Ga0070690_1000287963 | 168 |
| 651 | 3300005330 | Ga0070690_100095882 | Ga0070690_1000958823 | 168 |
| 652 | 3300005330 | Ga0070690_100607660 | Ga0070690_1006076602 | 168 |
| 653 | 3300005331 | Ga0070670_100121376 | Ga0070670_1001213762 | 168 |
| 654 | 3300005331 | Ga0070670_100256225 | Ga0070670_1002562252 | 168 |
| 655 | 3300005331 | Ga0070670_100489652 | Ga0070670_1004896522 | 168 |
| 656 | 3300005333 | Ga0070677_10105973 | Ga0070677_101059731 | 168 |
| 657 | 3300005333 | Ga0070677_10122797 | Ga0070677_101227972 | 168 |
| 658 | 3300005334 | Ga0068869_100028140 | Ga0068869_1000281405 | 168 |
| 659 | 3300005334 | Ga0068869_100060658 | Ga0068869_1000606584 | 168 |
| 660 | 3300005334 | Ga0068869_100419337 | Ga0068869_1004193372 | 168 |
| 661 | 3300005334 | Ga0068869_100754069 | Ga0068869_1007540691 | 168 |
| 662 | 3300005335 | Ga0070666_10038579 | Ga0070666_100385792 | 168 |
| 663 | 3300005335 | Ga0070666_10140866 | Ga0070666_101408662 | 168 |
| 664 | 3300005337 | Ga0070682_100000101 | Ga0070682_10000010180 | 168 |
| 665 | 3300005337 | Ga0070682_100172793 | Ga0070682_1001727932 | 168 |
| 666 | 3300005338 | Ga0068868_100001935 | Ga0068868_1000019357 | 168 |
| 667 | 3300005338 | Ga0068868_100041901 | Ga0068868_1000419015 | 168 |
| 668 | 3300005338 | Ga0068868_100146447 | Ga0068868_1001464472 | 168 |
| 669 | 3300005338 | Ga0068868_100250304 | Ga0068868_1002503041 | 168 |
| 670 | 3300005338 | Ga0068868_100391798 | Ga0068868_1003917982 | 168 |
| 671 | 3300005339 | Ga0070660_100097120 | Ga0070660_1000971203 | 168 |
| 672 | 3300005340 | Ga0070689_100067689 | Ga0070689_1000676893 | 168 |
| 673 | 3300005341 | Ga0070691_10187150 | Ga0070691_101871501 | 168 |
| 674 | 3300005343 | Ga0070687_100219001 | Ga0070687_1002190012 | 168 |
| 675 | 3300005344 | Ga0070661_100000686 | Ga0070661_1000006863 | 168 |
| 676 | 3300005344 | Ga0070661_100033517 | Ga0070661_1000335174 | 168 |
| 677 | 3300005353 | Ga0070669_100172763 | Ga0070669_1001727633 | 168 |
| 678 | 3300005353 | Ga0070669_100470126 | Ga0070669_1004701262 | 168 |
| 679 | 3300005353 | Ga0070669_100641183 | Ga0070669_1006411831 | 168 |
| 680 | 3300005354 | Ga0070675_100038447 | Ga0070675_1000384474 | 168 |
| 681 | 3300005354 | Ga0070675_100053739 | Ga0070675_1000537393 | 168 |
| 682 | 3300005354 | Ga0070675_100106195 | Ga0070675_1001061951 | 168 |
| 683 | 3300005354 | Ga0070675_100130430 | Ga0070675_1001304304 | 168 |
| 684 | 3300005355 | Ga0070671_100381457 | Ga0070671_1003814571 | 168 |
| 685 | 3300005355 | Ga0070671_100424095 | Ga0070671_1004240952 | 168 |
| 686 | 3300005355 | Ga0070671_101201239 | Ga0070671_1012012391 | 168 |
| 687 | 3300005355 | Ga0070671_101267937 | Ga0070671_1012679371 | 168 |
| 688 | 3300005364 | Ga0070673_100041325 | Ga0070673_1000413252 | 168 |
| 689 | 3300005364 | Ga0070673_100048741 | Ga0070673_1000487413 | 168 |
| 690 | 3300005365 | Ga0070688_100110409 | Ga0070688_1001104093 | 168 |
| 691 | 3300005365 | Ga0070688_100113200 | Ga0070688_1001132003 | 168 |
| 692 | 3300005365 | Ga0070688_100319010 | Ga0070688_1003190102 | 168 |
| 693 | 3300005366 | Ga0070659_100004989 | Ga0070659_1000049894 | 168 |
| 694 | 3300005367 | Ga0070667_100115377 | Ga0070667_1001153773 | 168 |
| 695 | 3300005367 | Ga0070667_100263519 | Ga0070667_1002635192 | 168 |
| 696 | 3300005367 | Ga0070667_101015626 | Ga0070667_1010156261 | 168 |
| 697 | 3300005440 | Ga0070705_100204328 | Ga0070705_1002043282 | 168 |
| 698 | 3300005440 | Ga0070705_100308405 | Ga0070705_1003084052 | 168 |
| 699 | 3300005455 | Ga0070663_100205300 | Ga0070663_1002053002 | 168 |
| 700 | 3300005456 | Ga0070678_100007545 | Ga0070678_1000075456 | 168 |
| 701 | 3300005457 | Ga0070662_100044153 | Ga0070662_1000441533 | 168 |
| 702 | 3300005457 | Ga0070662_100150293 | Ga0070662_1001502932 | 168 |
| 703 | 3300005457 | Ga0070662_100163457 | Ga0070662_1001634573 | 168 |
| 704 | 3300005458 | Ga0070681_10218197 | Ga0070681_102181972 | 168 |
| 705 | 3300005466 | Ga0070685_10014019 | Ga0070685_100140194 | 168 |
| 706 | 3300005535 | Ga0070684_100000433 | Ga0070684_10000043328 | 168 |
| 707 | 3300005535 | Ga0070684_100053633 | Ga0070684_1000536333 | 168 |
| 708 | 3300005539 | Ga0068853_100034146 | Ga0068853_1000341463 | 168 |
| 709 | 3300005539 | Ga0068853_100308797 | Ga0068853_1003087972 | 168 |
| 710 | 3300005539 | Ga0068853_100652233 | Ga0068853_1006522332 | 168 |
| 711 | 3300005539 | Ga0068853_101444809 | Ga0068853_1014448091 | 168 |
| 712 | 3300005543 | Ga0070672_100130450 | Ga0070672_1001304504 | 168 |
| 713 | 3300005543 | Ga0070672_100603758 | Ga0070672_1006037582 | 168 |
| 714 | 3300005544 | Ga0070686_100059005 | Ga0070686_1000590053 | 168 |
| 715 | 3300005544 | Ga0070686_100084279 | Ga0070686_1000842793 | 168 |
| 716 | 3300005544 | Ga0070686_100458147 | Ga0070686_1004581472 | 168 |
| 717 | 3300005548 | Ga0070665_100000001 | Ga0070665_100000001285 | 168 |
| 718 | 3300005548 | Ga0070665_100111581 | Ga0070665_1001115813 | 168 |
| 719 | 3300005548 | Ga0070665_100226309 | Ga0070665_1002263092 | 168 |
| 720 | 3300005563 | Ga0068855_100088304 | Ga0068855_1000883047 | 168 |
| 721 | 3300005563 | Ga0068855_100194649 | Ga0068855_1001946491 | 168 |
| 722 | 3300005563 | Ga0068855_101082927 | Ga0068855_1010829271 | 168 |
| 723 | 3300005564 | Ga0070664_100004734 | Ga0070664_1000047343 | 168 |
| 724 | 3300005564 | Ga0070664_100060954 | Ga0070664_1000609543 | 168 |
| 725 | 3300005564 | Ga0070664_100707668 | Ga0070664_1007076682 | 168 |
| 726 | 3300005577 | Ga0068857_100019362 | Ga0068857_1000193624 | 168 |
| 727 | 3300005577 | Ga0068857_100027233 | Ga0068857_1000272333 | 168 |
| 728 | 3300005577 | Ga0068857_100030836 | Ga0068857_1000308363 | 168 |
| 729 | 3300005578 | Ga0068854_100035001 | Ga0068854_1000350017 | 168 |
| 730 | 3300005578 | Ga0068854_100117058 | Ga0068854_1001170583 | 168 |
| 731 | 3300005614 | Ga0068856_101207603 | Ga0068856_1012076032 | 168 |
| 732 | 3300005616 | Ga0068852_100025320 | Ga0068852_1000253201 | 168 |
| 733 | 3300005616 | Ga0068852_100099003 | Ga0068852_1000990032 | 168 |
| 734 | 3300005616 | Ga0068852_100136365 | Ga0068852_1001363653 | 168 |
| 735 | 3300005617 | Ga0068859_100012809 | Ga0068859_1000128092 | 168 |
| 736 | 3300005617 | Ga0068859_100018668 | Ga0068859_1000186683 | 168 |
| 737 | 3300005617 | Ga0068859_100018814 | Ga0068859_1000188145 | 168 |
| 738 | 3300005617 | Ga0068859_100022225 | Ga0068859_1000222255 | 168 |
| 739 | 3300005617 | Ga0068859_100156505 | Ga0068859_1001565053 | 168 |
| 740 | 3300005617 | Ga0068859_100496143 | Ga0068859_1004961432 | 168 |
| 741 | 3300005617 | Ga0068859_101089472 | Ga0068859_1010894722 | 168 |
| 742 | 3300005618 | Ga0068864_100006928 | Ga0068864_1000069283 | 168 |
| 743 | 3300005618 | Ga0068864_100013283 | Ga0068864_1000132833 | 168 |
| 744 | 3300005618 | Ga0068864_100806914 | Ga0068864_1008069142 | 168 |
| 745 | 3300005718 | Ga0068866_10065942 | Ga0068866_100659423 | 168 |
| 746 | 3300005719 | Ga0068861_100049974 | Ga0068861_1000499743 | 168 |
| 747 | 3300005840 | Ga0068870_10338430 | Ga0068870_103384301 | 168 |
| 748 | 3300005841 | Ga0068863_100038413 | Ga0068863_1000384133 | 168 |
| 749 | 3300005841 | Ga0068863_100194332 | Ga0068863_1001943322 | 168 |
| 750 | 3300005841 | Ga0068863_100344864 | Ga0068863_1003448642 | 168 |
| 751 | 3300005842 | Ga0068858_100226880 | Ga0068858_1002268803 | 168 |
| 752 | 3300005842 | Ga0068858_100673468 | Ga0068858_1006734681 | 168 |
| 753 | 3300005842 | Ga0068858_100790306 | Ga0068858_1007903062 | 168 |
| 754 | 3300005843 | Ga0068860_100000241 | Ga0068860_10000024136 | 168 |
| 755 | 3300005843 | Ga0068860_100013270 | Ga0068860_1000132701 | 168 |
| 756 | 3300005843 | Ga0068860_100016199 | Ga0068860_10001619913 | 168 |
| 757 | 3300005843 | Ga0068860_100152641 | Ga0068860_1001526412 | 168 |
| 758 | 3300005843 | Ga0068860_101584588 | Ga0068860_1015845881 | 168 |
| 759 | 3300005844 | Ga0068862_100444919 | Ga0068862_1004449192 | 168 |
| 760 | 3300005844 | Ga0068862_100491805 | Ga0068862_1004918052 | 168 |
| 761 | 3300006058 | Ga0075432_10155346 | Ga0075432_101553462 | 168 |
| 762 | 3300006163 | Ga0070715_10184222 | Ga0070715_101842222 | 168 |
| 763 | 3300006195 | Ga0075366_10012601 | Ga0075366_100126014 | 168 |
| 764 | 3300006237 | Ga0097621_100060738 | Ga0097621_1000607384 | 168 |
| 765 | 3300006237 | Ga0097621_100230321 | Ga0097621_1002303211 | 168 |
| 766 | 3300006353 | Ga0075370_10348022 | Ga0075370_103480221 | 168 |
| 767 | 3300006844 | Ga0075428_100374101 | Ga0075428_1003741013 | 168 |
| 768 | 3300006881 | Ga0068865_100095346 | Ga0068865_1000953463 | 168 |
| 769 | 3300006931 | Ga0097620_100012809 | Ga0097620_1000128095 | 168 |
| 770 | 3300006931 | Ga0097620_100018668 | Ga0097620_1000186683 | 168 |
| 771 | 3300006931 | Ga0097620_100018813 | Ga0097620_1000188135 | 168 |
| 772 | 3300006931 | Ga0097620_100022228 | Ga0097620_1000222283 | 168 |
| 773 | 3300006931 | Ga0097620_100156508 | Ga0097620_1001565083 | 168 |
| 774 | 3300006931 | Ga0097620_100496185 | Ga0097620_1004961852 | 168 |
| 775 | 3300006931 | Ga0097620_101089524 | Ga0097620_1010895242 | 168 |
| 776 | 3300009093 | Ga0105240_10262532 | Ga0105240_102625322 | 168 |
| 777 | 3300009093 | Ga0105240_10352502 | Ga0105240_103525023 | 168 |
| 778 | 3300009094 | Ga0111539_10235363 | Ga0111539_102353633 | 168 |
| 779 | 3300009094 | Ga0111539_12082726 | Ga0111539_120827261 | 168 |
| 780 | 3300009101 | Ga0105247_10001018 | Ga0105247_1000101815 | 168 |
| 781 | 3300009101 | Ga0105247_10360463 | Ga0105247_103604632 | 168 |
| 782 | 3300009174 | Ga0105241_10128074 | Ga0105241_101280741 | 168 |
| 783 | 3300009176 | Ga0105242_10153451 | Ga0105242_101534513 | 168 |
| 784 | 3300009176 | Ga0105242_10340756 | Ga0105242_103407562 | 168 |
| 785 | 3300009176 | Ga0105242_10363839 | Ga0105242_103638392 | 168 |
| 786 | 3300009545 | Ga0105237_11773460 | Ga0105237_117734601 | 168 |
| 787 | 3300009551 | Ga0105238_10551558 | Ga0105238_105515582 | 168 |
| 788 | 3300009553 | Ga0105249_10073101 | Ga0105249_100731011 | 168 |
| 789 | 3300009553 | Ga0105249_10233662 | Ga0105249_102336623 | 168 |
| 790 | 3300009553 | Ga0105249_10304678 | Ga0105249_103046781 | 168 |
| 791 | 3300010375 | Ga0105239_10165836 | Ga0105239_101658362 | 168 |
| 792 | 3300010375 | Ga0105239_10836402 | Ga0105239_108364022 | 168 |
| 793 | 3300013100 | Ga0157373_10108073 | Ga0157373_101080733 | 168 |
| 794 | 3300013104 | Ga0157370_10000702 | Ga0157370_1000070213 | 168 |
| 795 | 3300013104 | Ga0157370_11031861 | Ga0157370_110318612 | 168 |
| 796 | 3300013105 | Ga0157369_10431956 | Ga0157369_104319562 | 168 |
| 797 | 3300013296 | Ga0157374_10006039 | Ga0157374_100060393 | 168 |
| 798 | 3300013296 | Ga0157374_10010548 | Ga0157374_100105489 | 168 |
| 799 | 3300013296 | Ga0157374_10191681 | Ga0157374_101916812 | 168 |
| 800 | 3300013297 | Ga0157378_10079954 | Ga0157378_100799544 | 168 |
| 801 | 3300013297 | Ga0157378_10239975 | Ga0157378_102399752 | 168 |
| 802 | 3300013297 | Ga0157378_10306130 | Ga0157378_103061301 | 168 |
| 803 | 3300013297 | Ga0157378_10564528 | Ga0157378_105645282 | 168 |
| 804 | 3300013306 | Ga0163162_10000216 | Ga0163162_1000021655 | 168 |
| 805 | 3300013306 | Ga0163162_10014241 | Ga0163162_100142414 | 168 |
| 806 | 3300013306 | Ga0163162_10016379 | Ga0163162_100163798 | 168 |
| 807 | 3300013306 | Ga0163162_10025721 | Ga0163162_100257213 | 168 |
| 808 | 3300013306 | Ga0163162_10030765 | Ga0163162_100307651 | 168 |
| 809 | 3300013306 | Ga0163162_10179822 | Ga0163162_101798224 | 168 |
| 810 | 3300013306 | Ga0163162_10193340 | Ga0163162_101933403 | 168 |
| 811 | 3300013306 | Ga0163162_10275675 | Ga0163162_102756753 | 168 |
| 812 | 3300013307 | Ga0157372_10008498 | Ga0157372_100084983 | 168 |
| 813 | 3300013307 | Ga0157372_10129397 | Ga0157372_101293972 | 168 |
| 814 | 3300013307 | Ga0157372_11533599 | Ga0157372_115335991 | 168 |
| 815 | 3300013308 | Ga0157375_10024709 | Ga0157375_100247095 | 168 |
| 816 | 3300013308 | Ga0157375_10041079 | Ga0157375_100410792 | 168 |
| 817 | 3300013308 | Ga0157375_10163864 | Ga0157375_101638643 | 168 |
| 818 | 3300013308 | Ga0157375_10461375 | Ga0157375_104613752 | 168 |
| 819 | 3300013308 | Ga0157375_10780719 | Ga0157375_107807192 | 168 |
| 820 | 3300014325 | Ga0163163_10000198 | Ga0163163_1000019864 | 168 |
| 821 | 3300014325 | Ga0163163_10166550 | Ga0163163_101665502 | 168 |
| 822 | 3300014325 | Ga0163163_10345148 | Ga0163163_103451483 | 168 |
| 823 | 3300014326 | Ga0157380_10158134 | Ga0157380_101581342 | 168 |
| 824 | 3300014326 | Ga0157380_10410428 | Ga0157380_104104282 | 168 |
| 825 | 3300014745 | Ga0157377_10005505 | Ga0157377_100055057 | 168 |
| 826 | 3300014745 | Ga0157377_10024497 | Ga0157377_100244973 | 168 |
| 827 | 3300014745 | Ga0157377_10152721 | Ga0157377_101527212 | 168 |
| 828 | 3300014968 | Ga0157379_10100975 | Ga0157379_101009753 | 168 |
| 829 | 3300014968 | Ga0157379_10121430 | Ga0157379_101214302 | 168 |
| 830 | 3300014968 | Ga0157379_10740742 | Ga0157379_107407422 | 168 |
| 831 | 3300014969 | Ga0157376_10118858 | Ga0157376_101188582 | 168 |
| 832 | 3300014969 | Ga0157376_10268264 | Ga0157376_102682642 | 168 |
| 833 | 3300014969 | Ga0157376_10485072 | Ga0157376_104850722 | 168 |
| 834 | 3300014969 | Ga0157376_11055359 | Ga0157376_110553592 | 168 |
| 835 | 3300017792 | Ga0163161_10106832 | Ga0163161_101068323 | 168 |
| 836 | 3300017792 | Ga0163161_10129337 | Ga0163161_101293371 | 168 |
| 837 | 3300025246 | Ga0209646_1000002 | Ga0209646_1000002379 | 168 |
| 838 | 3300025250 | Ga0209026_1000636 | Ga0209026_10006363 | 168 |
| 839 | 3300025258 | Ga0209129_1006296 | Ga0209129_10062963 | 168 |
| 840 | 3300025273 | Ga0209673_1000096 | Ga0209673_1000096104 | 168 |
| 841 | 3300025295 | Ga0209564_1004313 | Ga0209564_10043135 | 168 |
| 842 | 3300025297 | Ga0209758_1006557 | Ga0209758_10065574 | 168 |
| 843 | 3300025298 | Ga0209050_1000207 | Ga0209050_1000207106 | 168 |
| 844 | 3300025302 | Ga0207426_1000571 | Ga0207426_10005714 | 168 |
| 845 | 3300025302 | Ga0207426_1001515 | Ga0207426_10015154 | 168 |
| 846 | 3300025303 | Ga0209051_1036433 | Ga0209051_10364333 | 168 |
| 847 | 3300025304 | Ga0209257_1002636 | Ga0209257_10026363 | 168 |
| 848 | 3300025315 | Ga0207697_10111384 | Ga0207697_101113842 | 168 |
| 849 | 3300025893 | Ga0207682_10003590 | Ga0207682_100035907 | 168 |
| 850 | 3300025899 | Ga0207642_10147140 | Ga0207642_101471402 | 168 |
| 851 | 3300025900 | Ga0207710_10000660 | Ga0207710_1000066015 | 168 |
| 852 | 3300025903 | Ga0207680_10177361 | Ga0207680_101773611 | 168 |
| 853 | 3300025904 | Ga0207647_10043529 | Ga0207647_100435293 | 168 |
| 854 | 3300025905 | Ga0207685_10089665 | Ga0207685_100896652 | 168 |
| 855 | 3300025907 | Ga0207645_10032558 | Ga0207645_100325582 | 168 |
| 856 | 3300025907 | Ga0207645_10455260 | Ga0207645_104552602 | 168 |
| 857 | 3300025908 | Ga0207643_10051826 | Ga0207643_100518264 | 168 |
| 858 | 3300025911 | Ga0207654_10420566 | Ga0207654_104205661 | 168 |
| 859 | 3300025913 | Ga0207695_10039381 | Ga0207695_100393812 | 168 |
| 860 | 3300025913 | Ga0207695_10234773 | Ga0207695_102347732 | 168 |
| 861 | 3300025913 | Ga0207695_10776616 | Ga0207695_107766162 | 168 |
| 862 | 3300025918 | Ga0207662_10026414 | Ga0207662_100264142 | 168 |
| 863 | 3300025919 | Ga0207657_10623355 | Ga0207657_106233551 | 168 |
| 864 | 3300025920 | Ga0207649_10020991 | Ga0207649_100209913 | 168 |
| 865 | 3300025920 | Ga0207649_10037078 | Ga0207649_100370782 | 168 |
| 866 | 3300025920 | Ga0207649_10367567 | Ga0207649_103675671 | 168 |
| 867 | 3300025923 | Ga0207681_10115209 | Ga0207681_101152092 | 168 |
| 868 | 3300025923 | Ga0207681_10247944 | Ga0207681_102479441 | 168 |
| 869 | 3300025923 | Ga0207681_10344589 | Ga0207681_103445892 | 168 |
| 870 | 3300025924 | Ga0207694_10121635 | Ga0207694_101216352 | 168 |
| 871 | 3300025925 | Ga0207650_10076949 | Ga0207650_100769493 | 168 |
| 872 | 3300025925 | Ga0207650_10132694 | Ga0207650_101326942 | 168 |
| 873 | 3300025925 | Ga0207650_10199954 | Ga0207650_101999542 | 168 |
| 874 | 3300025925 | Ga0207650_10448912 | Ga0207650_104489121 | 168 |
| 875 | 3300025925 | Ga0207650_10599240 | Ga0207650_105992402 | 168 |
| 876 | 3300025926 | Ga0207659_10012333 | Ga0207659_100123332 | 168 |
| 877 | 3300025926 | Ga0207659_10033426 | Ga0207659_100334263 | 168 |
| 878 | 3300025926 | Ga0207659_10042754 | Ga0207659_100427544 | 168 |
| 879 | 3300025926 | Ga0207659_10103650 | Ga0207659_101036504 | 168 |
| 880 | 3300025926 | Ga0207659_11329623 | Ga0207659_113296231 | 168 |
| 881 | 3300025931 | Ga0207644_10087334 | Ga0207644_100873341 | 168 |
| 882 | 3300025931 | Ga0207644_10698764 | Ga0207644_106987642 | 168 |
| 883 | 3300025931 | Ga0207644_10700500 | Ga0207644_107005001 | 168 |
| 884 | 3300025932 | Ga0207690_10060439 | Ga0207690_100604393 | 168 |
| 885 | 3300025932 | Ga0207690_10195529 | Ga0207690_101955293 | 168 |
| 886 | 3300025933 | Ga0207706_10014975 | Ga0207706_100149755 | 168 |
| 887 | 3300025933 | Ga0207706_10023834 | Ga0207706_100238343 | 168 |
| 888 | 3300025933 | Ga0207706_10069820 | Ga0207706_100698203 | 168 |
| 889 | 3300025933 | Ga0207706_10363858 | Ga0207706_103638583 | 168 |
| 890 | 3300025934 | Ga0207686_10013527 | Ga0207686_100135274 | 168 |
| 891 | 3300025934 | Ga0207686_10058746 | Ga0207686_100587463 | 168 |
| 892 | 3300025934 | Ga0207686_10339804 | Ga0207686_103398042 | 168 |
| 893 | 3300025936 | Ga0207670_10011420 | Ga0207670_100114203 | 168 |
| 894 | 3300025936 | Ga0207670_10066017 | Ga0207670_100660171 | 168 |
| 895 | 3300025936 | Ga0207670_10436479 | Ga0207670_104364791 | 168 |
| 896 | 3300025936 | Ga0207670_10570414 | Ga0207670_105704141 | 168 |
| 897 | 3300025938 | Ga0207704_10331775 | Ga0207704_103317752 | 168 |
| 898 | 3300025938 | Ga0207704_10594348 | Ga0207704_105943481 | 168 |
| 899 | 3300025938 | Ga0207704_10659050 | Ga0207704_106590501 | 168 |
| 900 | 3300025940 | Ga0207691_10040071 | Ga0207691_100400714 | 168 |
| 901 | 3300025940 | Ga0207691_10108177 | Ga0207691_101081773 | 168 |
| 902 | 3300025941 | Ga0207711_10131935 | Ga0207711_101319352 | 168 |
| 903 | 3300025942 | Ga0207689_10010264 | Ga0207689_100102647 | 168 |
| 904 | 3300025942 | Ga0207689_10026316 | Ga0207689_100263163 | 168 |
| 905 | 3300025942 | Ga0207689_10100304 | Ga0207689_101003043 | 168 |
| 906 | 3300025942 | Ga0207689_10378777 | Ga0207689_103787772 | 168 |
| 907 | 3300025942 | Ga0207689_10432450 | Ga0207689_104324502 | 168 |
| 908 | 3300025942 | Ga0207689_10477186 | Ga0207689_104771861 | 168 |
| 909 | 3300025944 | Ga0207661_10013720 | Ga0207661_100137203 | 168 |
| 910 | 3300025944 | Ga0207661_10091142 | Ga0207661_100911422 | 168 |
| 911 | 3300025945 | Ga0207679_10034020 | Ga0207679_100340203 | 168 |
| 912 | 3300025945 | Ga0207679_10042990 | Ga0207679_100429903 | 168 |
| 913 | 3300025945 | Ga0207679_10933429 | Ga0207679_109334292 | 168 |
| 914 | 3300025949 | Ga0207667_10001859 | Ga0207667_100018593 | 168 |
| 915 | 3300025960 | Ga0207651_10056442 | Ga0207651_100564424 | 168 |
| 916 | 3300025960 | Ga0207651_10098903 | Ga0207651_100989032 | 168 |
| 917 | 3300025960 | Ga0207651_10211469 | Ga0207651_102114693 | 168 |
| 918 | 3300025960 | Ga0207651_10246036 | Ga0207651_102460362 | 168 |
| 919 | 3300025961 | Ga0207712_10058784 | Ga0207712_100587843 | 168 |
| 920 | 3300025961 | Ga0207712_10086477 | Ga0207712_100864773 | 168 |
| 921 | 3300025961 | Ga0207712_10148782 | Ga0207712_101487821 | 168 |
| 922 | 3300025981 | Ga0207640_10147802 | Ga0207640_101478022 | 168 |
| 923 | 3300025981 | Ga0207640_10249993 | Ga0207640_102499932 | 168 |
| 924 | 3300025986 | Ga0207658_10027901 | Ga0207658_100279014 | 168 |
| 925 | 3300025986 | Ga0207658_10261211 | Ga0207658_102612112 | 168 |
| 926 | 3300025986 | Ga0207658_10282066 | Ga0207658_102820662 | 168 |
| 927 | 3300026023 | Ga0207677_10007331 | Ga0207677_100073315 | 168 |
| 928 | 3300026023 | Ga0207677_10020140 | Ga0207677_100201404 | 168 |
| 929 | 3300026023 | Ga0207677_10146203 | Ga0207677_101462032 | 168 |
| 930 | 3300026023 | Ga0207677_10301311 | Ga0207677_103013112 | 168 |
| 931 | 3300026035 | Ga0207703_10075755 | Ga0207703_100757552 | 168 |
| 932 | 3300026035 | Ga0207703_10089339 | Ga0207703_100893392 | 168 |
| 933 | 3300026035 | Ga0207703_10467784 | Ga0207703_104677842 | 168 |
| 934 | 3300026035 | Ga0207703_10834260 | Ga0207703_108342601 | 168 |
| 935 | 3300026041 | Ga0207639_10095370 | Ga0207639_100953703 | 168 |
| 936 | 3300026041 | Ga0207639_10180942 | Ga0207639_101809422 | 168 |
| 937 | 3300026041 | Ga0207639_11685054 | Ga0207639_116850541 | 168 |
| 938 | 3300026067 | Ga0207678_10092984 | Ga0207678_100929843 | 168 |
| 939 | 3300026088 | Ga0207641_10218501 | Ga0207641_102185011 | 168 |
| 940 | 3300026088 | Ga0207641_10844298 | Ga0207641_108442982 | 168 |
| 941 | 3300026089 | Ga0207648_10026128 | Ga0207648_100261283 | 168 |
| 942 | 3300026089 | Ga0207648_10047900 | Ga0207648_100479001 | 168 |
| 943 | 3300026089 | Ga0207648_10473225 | Ga0207648_104732251 | 168 |
| 944 | 3300026095 | Ga0207676_10018209 | Ga0207676_100182092 | 168 |
| 945 | 3300026095 | Ga0207676_10502293 | Ga0207676_105022932 | 168 |
| 946 | 3300026095 | Ga0207676_11575664 | Ga0207676_115756641 | 168 |
| 947 | 3300026116 | Ga0207674_10057753 | Ga0207674_100577532 | 168 |
| 948 | 3300026116 | Ga0207674_10060076 | Ga0207674_100600766 | 168 |
| 949 | 3300026116 | Ga0207674_10064716 | Ga0207674_100647163 | 168 |
| 950 | 3300026116 | Ga0207674_10072102 | Ga0207674_100721023 | 168 |
| 951 | 3300026118 | Ga0207675_100082295 | Ga0207675_1000822954 | 168 |
| 952 | 3300026118 | Ga0207675_100898518 | Ga0207675_1008985182 | 168 |
| 953 | 3300026121 | Ga0207683_10013775 | Ga0207683_100137755 | 168 |
| 954 | 3300026142 | Ga0207698_10027714 | Ga0207698_100277143 | 168 |
| 955 | 3300026142 | Ga0207698_10122727 | Ga0207698_101227272 | 168 |
| 956 | 3300028379 | Ga0268266_10000102 | Ga0268266_1000010281 | 168 |
| 957 | 3300028379 | Ga0268266_10034094 | Ga0268266_100340943 | 168 |
| 958 | 3300028379 | Ga0268266_10342648 | Ga0268266_103426482 | 168 |
| 959 | 3300028380 | Ga0268265_10204126 | Ga0268265_102041263 | 168 |
| 960 | 3300028381 | Ga0268264_10000011 | Ga0268264_10000011396 | 168 |
| 961 | 3300028381 | Ga0268264_10003097 | Ga0268264_1000309720 | 168 |
| 962 | 3300028381 | Ga0268264_10011453 | Ga0268264_100114539 | 168 |
| 963 | 3300028786 | Ga0307517_10116843 | Ga0307517_101168433 | 168 |
| 964 | 3300028794 | Ga0307515_10000010 | Ga0307515_100000109 | 168 |
| 965 | 3300031595 | Ga0265313_10065844 | Ga0265313_100658443 | 168 |
| 966 | 3300035086 | Ga0373934_0012385 | Ga0373934_0012385_530_1063 | 168 |
| 967 | 3300035089 | Ga0373944_0084007 | Ga0373944_0084007_332_865 | 168 |
| 968 | 3300035113 | Ga0373936_0081449 | Ga0373936_0081449_67_600 | 168 |
| 969 | 3300035119 | Ga0373956_0086936 | Ga0373956_0086936_663_1196 | 168 |
| 970 | 3300035120 | Ga0373957_0044854 | Ga0373957_0044854_434_967 | 168 |
| 971 | 3300035171 | Ga0373946_0098014 | Ga0373946_0098014_629_1162 | 168 |
| 972 | 3300035695 | Ga0373927_0314130 | Ga0373927_0314130_126_659 | 168 |
| 973 | 3300035724 | Ga0373933_0045334 | Ga0373933_0045334_1543_2076 | 168 |
| 974 | 3300035725 | Ga0373947_0159532 | Ga0373947_0159532_347_880 | 168 |
| 975 | 3300036401 | Ga0373937_0061306 | Ga0373937_0061306_2308_2841 | 168 |
| 976 | 3300042005 | Ga0439448_0039246 | Ga0439448_0039246_537_1052 | 168 |
| 977 | 3300044656 | Ga0466969_0130720 | Ga0466969_0130720_233_766 | 168 |
| 978 | 3300044658 | Ga0466972_0113644 | Ga0466972_0113644_439_954 | 168 |
| 979 | 3300044683 | Ga0466965_0027073 | Ga0466965_0027073_1210_1725 | 168 |
| 980 | 3300044684 | Ga0466966_0090599 | Ga0466966_0090599_1334_1867 | 168 |
| 981 | 3300044719 | Ga0466971_0064131 | Ga0466971_0064131_818_1351 | 168 |
| 982 | 3300044765 | Ga0466970_0000280 | Ga0466970_0000280_8917_9435 | 168 |
| 983 | 3300044765 | Ga0466970_0041827 | Ga0466970_0041827_1350_1883 | 168 |
| 984 | 3300045049 | Ga0466959_0056262 | Ga0466959_0056262_855_1388 | 168 |
| 985 | 3300046460 | Ga0495638_0189260 | Ga0495638_0189260_196_729 | 168 |
| 986 | 3300046472 | Ga0495580_0465691 | Ga0495580_0465691_203_736 | 168 |
| 987 | 3300046477 | Ga0495664_0296697 | Ga0495664_0296697_297_830 | 168 |
| 988 | 3300046499 | Ga0495594_0075506 | Ga0495594_0075506_703_1224 | 168 |
| 989 | 3300046514 | Ga0495618_0299897 | Ga0495618_0299897_65_598 | 168 |
| 990 | 3300046516 | Ga0495628_0064246 | Ga0495628_0064246_2322_2855 | 168 |
| 991 | 3300046517 | Ga0495630_0131704 | Ga0495630_0131704_805_1338 | 168 |
| 992 | 3300046524 | Ga0495648_0002633 | Ga0495648_0002633_10549_11082 | 168 |
| 993 | 3300046535 | Ga0495586_0059232 | Ga0495586_0059232_662_1195 | 168 |
| 994 | 3300046536 | Ga0495587_0118440 | Ga0495587_0118440_933_1466 | 168 |
| 995 | 3300046675 | Ga0495657_0332921 | Ga0495657_0332921_49_582 | 168 |
| 996 | 3300046678 | Ga0495599_0117581 | Ga0495599_0117581_379_912 | 168 |
| 997 | 3300046683 | Ga0495658_0658293 | Ga0495658_0658293_80_613 | 168 |
| 998 | 3300046809 | Ga0495600_0108701 | Ga0495600_0108701_819_1352 | 168 |
| 999 | 3300047319 | Ga0495674_0626302 | Ga0495674_0626302_239_772 | 168 |
| 1000 | 3300047443 | Ga0495687_000001 | Ga0495687_000001_907336_907869 | 168 |
| 1001 | 3300047471 | Ga0495684_0073050 | Ga0495684_0073050_15_548 | 168 |
| 1002 | 3300048904 | Ga0496101_0174307 | Ga0496101_0174307_751_1284 | 168 |
| 1003 | 3300048913 | Ga0496110_0034483 | Ga0496110_0034483_1269_1802 | 168 |
| 1004 | 3300049162 | Ga0501307_008465 | Ga0501307_008465_286_801 | 168 |
| 1005 | 3300049528 | Ga0501312_012573 | Ga0501312_012573_568_1095 | 168 |
| 1006 | 3300049530 | Ga0501314_004211 | Ga0501314_004211_177_692 | 168 |
| 1007 | 3300049531 | Ga0501315_010570 | Ga0501315_010570_406_930 | 168 |
| 1008 | 3300049536 | Ga0501320_003434 | Ga0501320_003434_162_686 | 168 |
| 1009 | 3300049538 | Ga0501322_010240 | Ga0501322_010240_37_570 | 168 |
| 1010 | 3300049541 | Ga0501325_005609 | Ga0501325_005609_99_623 | 168 |
| 1011 | 3300049551 | Ga0501335_007004 | Ga0501335_007004_336_860 | 168 |
| 1012 | 3300049552 | Ga0501336_003599 | Ga0501336_003599_429_953 | 168 |
| 1013 | 3300049568 | Ga0501031_0038037 | Ga0501031_0038037_1586_2110 | 168 |
| 1014 | 3300049571 | Ga0501034_0075740 | Ga0501034_0075740_985_1509 | 168 |
| 1015 | 3300049579 | Ga0501043_0012420 | Ga0501043_0012420_5629_6153 | 168 |
| 1016 | 3300049673 | Ga0501240_042527 | Ga0501240_042527_154_678 | 168 |
| 1017 | 3300049769 | Ga0501272_004633 | Ga0501272_004633_78_602 | 168 |
| 1018 | 3300049822 | Ga0501035_0025721 | Ga0501035_0025721_4129_4653 | 168 |
| 1019 | 3300049823 | Ga0501044_0050286 | Ga0501044_0050286_819_1346 | 168 |
| 1020 | 3300049823 | Ga0501044_0512738 | Ga0501044_0512738_307_834 | 168 |
| 1021 | 3300050493 | nmdc:mga0k408_446153_c1 | nmdc:mga0k408_446153_c1_67_600 | 168 |
| 1022 | 3300050493 | nmdc:mga0k408_47999_c1 | nmdc:mga0k408_47999_c1_1607_2122 | 168 |
| 1023 | 3300050496 | nmdc:mga07m45_34215_c1 | nmdc:mga07m45_34215_c1_40_555 | 168 |
| 1024 | 3300050511 | nmdc:mga08y16_1217278_c1 | nmdc:mga08y16_1217278_c1_136_657 | 168 |
| 1025 | 3300050511 | nmdc:mga08y16_824739_c1 | nmdc:mga08y16_824739_c1_241_762 | 168 |
| 1026 | 3300053085 | Ga0495619_0041370 | Ga0495619_0041370_1326_1859 | 168 |
| 1027 | 3300053090 | Ga0500646_0012093 | Ga0500646_0012093_1431_1964 | 168 |
| 1028 | 3300053092 | Ga0500583_0005990 | Ga0500583_0005990_3227_3760 | 168 |
| 1029 | 3300053131 | Ga0500652_015822 | Ga0500652_015822_1762_2286 | 168 |
| 1030 | 3300053139 | Ga0500568_0016248 | Ga0500568_0016248_2628_3161 | 168 |
| 1031 | 3300053156 | Ga0500622_0000782 | Ga0500622_0000782_2029_2562 | 168 |
| 1032 | 3300061719 | Ga0466962_0029755 | Ga0466962_0029755_1487_2020 | 168 |
| 1033 | 2162886007 | SwRhRL2b_contig_1663050 | SwRhRL2b_0644.00008760 | 169 |
| 1034 | 3300005289 | Ga0065704_10070140 | Ga0065704_1007014055 | 169 |
| 1035 | 3300005329 | Ga0070683_100010447 | Ga0070683_1000104472 | 169 |
| 1036 | 3300005331 | Ga0070670_100106412 | Ga0070670_1001064123 | 169 |
| 1037 | 3300005334 | Ga0068869_101482645 | Ga0068869_1014826451 | 169 |
| 1038 | 3300005335 | Ga0070666_10040888 | Ga0070666_100408885 | 169 |
| 1039 | 3300005336 | Ga0070680_100000212 | Ga0070680_10000021217 | 169 |
| 1040 | 3300005337 | Ga0070682_100000651 | Ga0070682_10000065113 | 169 |
| 1041 | 3300005339 | Ga0070660_100396663 | Ga0070660_1003966632 | 169 |
| 1042 | 3300005341 | Ga0070691_10005105 | Ga0070691_100051058 | 169 |
| 1043 | 3300005341 | Ga0070691_10038700 | Ga0070691_100387002 | 169 |
| 1044 | 3300005355 | Ga0070671_100037941 | Ga0070671_1000379412 | 169 |
| 1045 | 3300005364 | Ga0070673_100876534 | Ga0070673_1008765342 | 169 |
| 1046 | 3300005366 | Ga0070659_100006423 | Ga0070659_1000064231 | 169 |
| 1047 | 3300005455 | Ga0070663_100264164 | Ga0070663_1002641642 | 169 |
| 1048 | 3300005456 | Ga0070678_100076673 | Ga0070678_1000766733 | 169 |
| 1049 | 3300005458 | Ga0070681_10001590 | Ga0070681_1000159014 | 169 |
| 1050 | 3300005530 | Ga0070679_100000449 | Ga0070679_10000044918 | 169 |
| 1051 | 3300005535 | Ga0070684_100088767 | Ga0070684_1000887674 | 169 |
| 1052 | 3300005539 | Ga0068853_100125496 | Ga0068853_1001254963 | 169 |
| 1053 | 3300005539 | Ga0068853_100135069 | Ga0068853_1001350693 | 169 |
| 1054 | 3300005539 | Ga0068853_100249320 | Ga0068853_1002493202 | 169 |
| 1055 | 3300005543 | Ga0070672_100295707 | Ga0070672_1002957072 | 169 |
| 1056 | 3300005547 | Ga0070693_100019024 | Ga0070693_1000190242 | 169 |
| 1057 | 3300005563 | Ga0068855_100001939 | Ga0068855_10000193928 | 169 |
| 1058 | 3300005563 | Ga0068855_100285669 | Ga0068855_1002856692 | 169 |
| 1059 | 3300005564 | Ga0070664_100043986 | Ga0070664_1000439863 | 169 |
| 1060 | 3300005564 | Ga0070664_100246857 | Ga0070664_1002468571 | 169 |
| 1061 | 3300005564 | Ga0070664_101146843 | Ga0070664_1011468431 | 169 |
| 1062 | 3300005577 | Ga0068857_101512742 | Ga0068857_1015127421 | 169 |
| 1063 | 3300005614 | Ga0068856_100137028 | Ga0068856_1001370283 | 169 |
| 1064 | 3300005614 | Ga0068856_100788325 | Ga0068856_1007883252 | 169 |
| 1065 | 3300005616 | Ga0068852_100186021 | Ga0068852_1001860213 | 169 |
| 1066 | 3300005618 | Ga0068864_100823598 | Ga0068864_1008235982 | 169 |
| 1067 | 3300005841 | Ga0068863_100258872 | Ga0068863_1002588722 | 169 |
| 1068 | 3300005983 | Ga0081540_1022869 | Ga0081540_10228696 | 169 |
| 1069 | 3300006237 | Ga0097621_100000488 | Ga0097621_10000048814 | 169 |
| 1070 | 3300006237 | Ga0097621_101085349 | Ga0097621_1010853492 | 169 |
| 1071 | 3300006881 | Ga0068865_100079282 | Ga0068865_1000792823 | 169 |
| 1072 | 3300009093 | Ga0105240_10000078 | Ga0105240_10000078138 | 169 |
| 1073 | 3300009093 | Ga0105240_10006513 | Ga0105240_1000651320 | 169 |
| 1074 | 3300009093 | Ga0105240_10014605 | Ga0105240_1001460511 | 169 |
| 1075 | 3300009093 | Ga0105240_10038251 | Ga0105240_100382514 | 169 |
| 1076 | 3300009101 | Ga0105247_10274601 | Ga0105247_102746012 | 169 |
| 1077 | 3300009174 | Ga0105241_10000105 | Ga0105241_100001053 | 169 |
| 1078 | 3300009174 | Ga0105241_10000409 | Ga0105241_100004094 | 169 |
| 1079 | 3300009176 | Ga0105242_10015763 | Ga0105242_100157639 | 169 |
| 1080 | 3300009177 | Ga0105248_10017734 | Ga0105248_100177344 | 169 |
| 1081 | 3300009177 | Ga0105248_11814899 | Ga0105248_118148991 | 169 |
| 1082 | 3300009545 | Ga0105237_10004076 | Ga0105237_100040765 | 169 |
| 1083 | 3300009545 | Ga0105237_10076060 | Ga0105237_100760604 | 169 |
| 1084 | 3300009551 | Ga0105238_10095813 | Ga0105238_100958132 | 169 |
| 1085 | 3300010375 | Ga0105239_10092220 | Ga0105239_100922203 | 169 |
| 1086 | 3300010375 | Ga0105239_11196954 | Ga0105239_111969541 | 169 |
| 1087 | 3300011119 | Ga0105246_10665523 | Ga0105246_106655232 | 169 |
| 1088 | 3300013100 | Ga0157373_10160933 | Ga0157373_101609333 | 169 |
| 1089 | 3300013100 | Ga0157373_10483951 | Ga0157373_104839511 | 169 |
| 1090 | 3300013102 | Ga0157371_10092139 | Ga0157371_100921392 | 169 |
| 1091 | 3300013102 | Ga0157371_10686210 | Ga0157371_106862101 | 169 |
| 1092 | 3300013104 | Ga0157370_10003524 | Ga0157370_100035243 | 169 |
| 1093 | 3300013104 | Ga0157370_10583025 | Ga0157370_105830252 | 169 |
| 1094 | 3300013105 | Ga0157369_10030867 | Ga0157369_100308673 | 169 |
| 1095 | 3300013105 | Ga0157369_10111735 | Ga0157369_101117353 | 169 |
| 1096 | 3300013105 | Ga0157369_10209164 | Ga0157369_102091644 | 169 |
| 1097 | 3300013105 | Ga0157369_10424662 | Ga0157369_104246622 | 169 |
| 1098 | 3300013105 | Ga0157369_10760484 | Ga0157369_107604842 | 169 |
| 1099 | 3300013296 | Ga0157374_11222886 | Ga0157374_112228861 | 169 |
| 1100 | 3300013297 | Ga0157378_10004966 | Ga0157378_100049663 | 169 |
| 1101 | 3300013306 | Ga0163162_10015824 | Ga0163162_100158249 | 169 |
| 1102 | 3300013306 | Ga0163162_10151654 | Ga0163162_101516542 | 169 |
| 1103 | 3300013306 | Ga0163162_10356500 | Ga0163162_103565003 | 169 |
| 1104 | 3300013306 | Ga0163162_11059365 | Ga0163162_110593652 | 169 |
| 1105 | 3300013307 | Ga0157372_10008033 | Ga0157372_100080333 | 169 |
| 1106 | 3300013307 | Ga0157372_10020735 | Ga0157372_100207351 | 169 |
| 1107 | 3300013307 | Ga0157372_10037566 | Ga0157372_1003756610 | 169 |
| 1108 | 3300013307 | Ga0157372_10037958 | Ga0157372_100379582 | 169 |
| 1109 | 3300013307 | Ga0157372_10190275 | Ga0157372_101902753 | 169 |
| 1110 | 3300013307 | Ga0157372_10462667 | Ga0157372_104626672 | 169 |
| 1111 | 3300013307 | Ga0157372_10844337 | Ga0157372_108443372 | 169 |
| 1112 | 3300013307 | Ga0157372_11006915 | Ga0157372_110069152 | 169 |
| 1113 | 3300013308 | Ga0157375_10000073 | Ga0157375_1000007399 | 169 |
| 1114 | 3300014325 | Ga0163163_10000317 | Ga0163163_1000031725 | 169 |
| 1115 | 3300014969 | Ga0157376_10036543 | Ga0157376_100365432 | 169 |
| 1116 | 3300014969 | Ga0157376_10282613 | Ga0157376_102826132 | 169 |
| 1117 | 3300014969 | Ga0157376_11287436 | Ga0157376_112874362 | 169 |
| 1118 | 3300017792 | Ga0163161_10004591 | Ga0163161_100045913 | 169 |
| 1119 | 3300020070 | Ga0206356_11546257 | Ga0206356_115462572 | 169 |
| 1120 | 3300020078 | Ga0206352_10812222 | Ga0206352_108122222 | 169 |
| 1121 | 3300020080 | Ga0206350_11250461 | Ga0206350_112504612 | 169 |
| 1122 | 3300025893 | Ga0207682_10035862 | Ga0207682_100358623 | 169 |
| 1123 | 3300025899 | Ga0207642_10368812 | Ga0207642_103688122 | 169 |
| 1124 | 3300025904 | Ga0207647_10212752 | Ga0207647_102127522 | 169 |
| 1125 | 3300025909 | Ga0207705_10852783 | Ga0207705_108527831 | 169 |
| 1126 | 3300025911 | Ga0207654_10004759 | Ga0207654_100047595 | 169 |
| 1127 | 3300025911 | Ga0207654_10010844 | Ga0207654_100108444 | 169 |
| 1128 | 3300025912 | Ga0207707_10000508 | Ga0207707_1000050831 | 169 |
| 1129 | 3300025913 | Ga0207695_10000064 | Ga0207695_1000006465 | 169 |
| 1130 | 3300025913 | Ga0207695_10000232 | Ga0207695_1000023229 | 169 |
| 1131 | 3300025913 | Ga0207695_10001292 | Ga0207695_1000129225 | 169 |
| 1132 | 3300025913 | Ga0207695_10021717 | Ga0207695_100217173 | 169 |
| 1133 | 3300025914 | Ga0207671_10011633 | Ga0207671_100116334 | 169 |
| 1134 | 3300025914 | Ga0207671_10053729 | Ga0207671_100537294 | 169 |
| 1135 | 3300025917 | Ga0207660_10000325 | Ga0207660_1000032518 | 169 |
| 1136 | 3300025921 | Ga0207652_10000186 | Ga0207652_1000018617 | 169 |
| 1137 | 3300025921 | Ga0207652_10028861 | Ga0207652_100288613 | 169 |
| 1138 | 3300025924 | Ga0207694_10019981 | Ga0207694_100199812 | 169 |
| 1139 | 3300025925 | Ga0207650_10089102 | Ga0207650_100891021 | 169 |
| 1140 | 3300025925 | Ga0207650_10211526 | Ga0207650_102115262 | 169 |
| 1141 | 3300025928 | Ga0207700_10752904 | Ga0207700_107529041 | 169 |
| 1142 | 3300025931 | Ga0207644_10011186 | Ga0207644_100111867 | 169 |
| 1143 | 3300025932 | Ga0207690_10018204 | Ga0207690_100182045 | 169 |
| 1144 | 3300025932 | Ga0207690_10250183 | Ga0207690_102501832 | 169 |
| 1145 | 3300025934 | Ga0207686_10387450 | Ga0207686_103874502 | 169 |
| 1146 | 3300025938 | Ga0207704_10059774 | Ga0207704_100597742 | 169 |
| 1147 | 3300025940 | Ga0207691_10061953 | Ga0207691_100619533 | 169 |
| 1148 | 3300025940 | Ga0207691_10137359 | Ga0207691_101373592 | 169 |
| 1149 | 3300025941 | Ga0207711_10021040 | Ga0207711_100210403 | 169 |
| 1150 | 3300025944 | Ga0207661_10003908 | Ga0207661_1000390814 | 169 |
| 1151 | 3300025944 | Ga0207661_11070118 | Ga0207661_110701181 | 169 |
| 1152 | 3300025945 | Ga0207679_10229675 | Ga0207679_102296751 | 169 |
| 1153 | 3300025949 | Ga0207667_10000111 | Ga0207667_1000011130 | 169 |
| 1154 | 3300025949 | Ga0207667_10032868 | Ga0207667_100328682 | 169 |
| 1155 | 3300025949 | Ga0207667_10082302 | Ga0207667_100823025 | 169 |
| 1156 | 3300025960 | Ga0207651_10509342 | Ga0207651_105093421 | 169 |
| 1157 | 3300025981 | Ga0207640_10528620 | Ga0207640_105286201 | 169 |
| 1158 | 3300025986 | Ga0207658_10013459 | Ga0207658_100134593 | 169 |
| 1159 | 3300026023 | Ga0207677_10558142 | Ga0207677_105581421 | 169 |
| 1160 | 3300026041 | Ga0207639_10053604 | Ga0207639_100536043 | 169 |
| 1161 | 3300026041 | Ga0207639_10178279 | Ga0207639_101782793 | 169 |
| 1162 | 3300026041 | Ga0207639_10903340 | Ga0207639_109033402 | 169 |
| 1163 | 3300026067 | Ga0207678_10241065 | Ga0207678_102410653 | 169 |
| 1164 | 3300026078 | Ga0207702_10681920 | Ga0207702_106819202 | 169 |
| 1165 | 3300026088 | Ga0207641_10313954 | Ga0207641_103139542 | 169 |
| 1166 | 3300026089 | Ga0207648_11080762 | Ga0207648_110807621 | 169 |
| 1167 | 3300026095 | Ga0207676_10653346 | Ga0207676_106533462 | 169 |
| 1168 | 3300026116 | Ga0207674_10154088 | Ga0207674_101540883 | 169 |
| 1169 | 3300026121 | Ga0207683_10134494 | Ga0207683_101344942 | 169 |
| 1170 | 3300026121 | Ga0207683_10638169 | Ga0207683_106381692 | 169 |
| 1171 | 3300026142 | Ga0207698_10163450 | Ga0207698_101634501 | 169 |
| 1172 | 3300028379 | Ga0268266_10734045 | Ga0268266_107340451 | 169 |
| 1173 | 3300028786 | Ga0307517_10050018 | Ga0307517_100500185 | 169 |
| 1174 | 3300028786 | Ga0307517_10269983 | Ga0307517_102699832 | 169 |
| 1175 | 3300030521 | Ga0307511_10002902 | Ga0307511_1000290212 | 169 |
| 1176 | 3300031251 | Ga0265327_10000084 | Ga0265327_1000008415 | 169 |
| 1177 | 3300032004 | Ga0307414_10320339 | Ga0307414_103203392 | 169 |
| 1178 | 3300033180 | Ga0307510_10000119 | Ga0307510_1000011948 | 169 |
| 1179 | 3300033180 | Ga0307510_10320608 | Ga0307510_103206081 | 169 |
| 1180 | 3300035692 | Ga0373935_0351882 | Ga0373935_0351882_256_795 | 169 |
| 1181 | 3300037418 | Ga0395900_0312296 | Ga0395900_0312296_272_811 | 169 |
| 1182 | 3300038443 | Ga0395901_0463913 | Ga0395901_0463913_452_979 | 169 |
| 1183 | 3300041509 | Ga0451843_0361727 | Ga0451843_0361727_565_1146 | 169 |
| 1184 | 3300042124 | Ga0450922_002800 | Ga0450922_002800_596_1123 | 169 |
| 1185 | 3300042876 | Ga0451577_0671070 | Ga0451577_0671070_156_788 | 169 |
| 1186 | 3300044658 | Ga0466972_0002446 | Ga0466972_0002446_1628_2167 | 169 |
| 1187 | 3300044712 | Ga0453684_0241045 | Ga0453684_0241045_603_1238 | 169 |
| 1188 | 3300044901 | Ga0466960_0339967 | Ga0466960_0339967_231_770 | 169 |
| 1189 | 3300045051 | Ga0451576_0257274 | Ga0451576_0257274_37_669 | 169 |
| 1190 | 3300046507 | Ga0495606_0005477 | Ga0495606_0005477_2238_2777 | 169 |
| 1191 | 3300047320 | Ga0495672_0021174 | Ga0495672_0021174_388_918 | 169 |
| 1192 | 3300047472 | Ga0495686_0000004 | Ga0495686_0000004_88397_88939 | 169 |
| 1193 | 3300047472 | Ga0495686_0228891 | Ga0495686_0228891_310_870 | 169 |
| 1194 | 3300048903 | Ga0496100_0010695 | Ga0496100_0010695_2880_3404 | 169 |
| 1195 | 3300048907 | Ga0496104_0392944 | Ga0496104_0392944_271_795 | 169 |
| 1196 | 3300048918 | Ga0496115_0545777 | Ga0496115_0545777_339_878 | 169 |
| 1197 | 3300049536 | Ga0501320_003694 | Ga0501320_003694_465_1070 | 169 |
| 1198 | 3300049569 | Ga0501032_0055273 | Ga0501032_0055273_171_707 | 169 |
| 1199 | 3300049571 | Ga0501034_0142610 | Ga0501034_0142610_1006_1542 | 169 |
| 1200 | 3300049571 | Ga0501034_0650504 | Ga0501034_0650504_16_552 | 169 |
| 1201 | 3300049573 | Ga0501037_0037559 | Ga0501037_0037559_57_593 | 169 |
| 1202 | 3300049574 | Ga0501038_0025986 | Ga0501038_0025986_3185_3721 | 169 |
| 1203 | 3300049575 | Ga0501039_0094760 | Ga0501039_0094760_960_1496 | 169 |
| 1204 | 3300049579 | Ga0501043_0013840 | Ga0501043_0013840_1322_1858 | 169 |
| 1205 | 3300049579 | Ga0501043_0044533 | Ga0501043_0044533_301_837 | 169 |
| 1206 | 3300049580 | Ga0501046_0026251 | Ga0501046_0026251_885_1421 | 169 |
| 1207 | 3300049581 | Ga0501047_0030096 | Ga0501047_0030096_849_1385 | 169 |
| 1208 | 3300049584 | Ga0501068_0036447 | Ga0501068_0036447_2382_2918 | 169 |
| 1209 | 3300049585 | Ga0501069_0075930 | Ga0501069_0075930_565_1101 | 169 |
| 1210 | 3300049588 | Ga0501072_0073516 | Ga0501072_0073516_1097_1633 | 169 |
| 1211 | 3300049589 | Ga0501073_0162982 | Ga0501073_0162982_794_1330 | 169 |
| 1212 | 3300049590 | Ga0501074_0033875 | Ga0501074_0033875_2871_3407 | 169 |
| 1213 | 3300049741 | Ga0501079_0360765 | Ga0501079_0360765_106_642 | 169 |
| 1214 | 3300049822 | Ga0501035_0067435 | Ga0501035_0067435_1187_1723 | 169 |
| 1215 | 3300049823 | Ga0501044_0005733 | Ga0501044_0005733_3783_4319 | 169 |
| 1216 | 3300049823 | Ga0501044_0303588 | Ga0501044_0303588_261_953 | 169 |
| 1217 | 3300049823 | Ga0501044_0405255 | Ga0501044_0405255_399_935 | 169 |
| 1218 | 3300050512 | nmdc:mga0n895_585434_c1 | nmdc:mga0n895_585434_c1_373_909 | 169 |
| 1219 | 3300053156 | Ga0500622_0000852 | Ga0500622_0000852_7474_8088 | 169 |
| 1220 | 3300054114 | Ga0501084_0131031 | Ga0501084_0131031_1312_1848 | 169 |
| 1221 | 3300060353 | Ga0501082_0035882 | Ga0501082_0035882_3541_4077 | 169 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7ug7-assembly1.cif.gz_LJ | 70s ribosome complex in an intermediate state of translocation bound to ef-g(gdp) stalled by argyrin b | 0.899 | 2 | 132 |
| 8phj-assembly1.cif.gz_5 | ca4-bound cami1 in complex with 70s ribosome | 0.8964 | 1 | 133 |
| 7as8-assembly1.cif.gz_L | bacillus subtilis ribosome quality control complex state b. ribosomal 50s subunit with p-trna, rqch, and rqcp/yabo | 0.8911 | 4 | 130 |
| 5gad-assembly1.cif.gz_I | rnc-srp-sr complex early state | 0.8879 | 1 | 128 |
| 5zeb-assembly1.cif.gz_I | m. smegmatis p/p state 70s ribosome structure | 0.8862 | 1 | 132 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9VPL3_26_196_3.30.70.1730 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain | 0.8565 | 1 | 132 | 3.30.70.1730 |
| 5oolI00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain | 0.8523 | 3 | 132 | 3.30.70.1730 |
| 1zaxA01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain | 0.8517 | 4 | 132 | 3.30.70.1730 |
| 6dzpI00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain | 0.8473 | 1 | 132 | 3.30.70.1730 |
| af_Q9FY50_43_174_3.30.70.1730 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain | 0.8468 | 1 | 135 | 3.30.70.1730 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3RPJ2-F1-model_v4 | 50S ribosomal protein L10 | 0.9782 | 1 | 121 |
GO:0003735
GO:0006412 GO:0015934 |
| AF-A0A4Q3RPJ2-F1-model_v4 | 50S ribosomal protein L10 | 0.9703 | 1 | 121 |
GO:0003735
GO:0006412 GO:0015934 |
| AF-A0A0R2S5T3-F1-model_v4 | Large ribosomal subunit protein uL10 (50S ribosomal protein L10) | 0.9648 | 1 | 134 |
GO:0005840
GO:1990904 |
| AF-A0A537J6C1-F1-model_v4 | 50S ribosomal protein L10 | 0.9638 | 1 | 138 |
GO:0003735
GO:0006412 GO:0015934 |
| AF-A0A497CSE5-F1-model_v4 | Large ribosomal subunit protein uL10 (50S ribosomal protein L10) | 0.9589 | 1 | 120 |
GO:0005840
GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar