F491841

General Info

Members Datasets Scaffolds Average Seq Length
1220 418 1149 273

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0004648|Ga0395899_0004648_2804_3709
Length 301
Sequence MATDTTPTPQVHVEDRVRAKADPSRIQASLVRNLTRPLAGLDGMGRQLQFYVRSLGWTGRTLRRYKKEVLRLLAEVSLGTGALSVVGGTVGVIAFLAFFTGTEVGLQGYSALNQLGTANFTAFLSAYFNTREIAPLVAGLAMAATVGCGFTAQLGAMRISEEIDALEVMGLPSLPFLVTTRMIAGFVAVIPLYVIGLLSSYVAARTIATFYYGQSTGTYDLYFNQYLPPTDVLWSFGKVIVFAVVIILIHCYYGYTASGGPAGVGVAVGKAVRTSIVAINVVDFFLSLAIWGATTTVRIAG

Samples

Sample ID Description Type Environment
1 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
2 2547132424 Nocardia nova SH22a Isolate Unclassified
3 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
4 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
5 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
6 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
7 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
8 2643221561 Nocardioides sp. Root151 Isolate Unclassified
9 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
10 2643221590 Nocardioides sp. Root682 Isolate Unclassified
11 2643221604 Nocardioides sp. Root190 Isolate Unclassified
12 2643221615 Nocardioides sp. Root224 Isolate Unclassified
13 2643221617 Nocardioides sp. Root79 Isolate Unclassified
14 2643221620 Nocardioides sp. Root240 Isolate Unclassified
15 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
16 2643221647 Streptomyces sp. Root369 Isolate Unclassified
17 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
18 2643221679 Angustibacter sp. Root456 Isolate Unclassified
19 2643221692 Nocardia sp. Root136 Isolate Unclassified
20 2643221696 Nocardioides sp. Root140 Isolate Unclassified
21 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
22 2643221711 Terrabacter sp. Root85 Isolate Unclassified
23 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
24 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
25 2738541305 Nocardioides sp. CF167 Isolate Unclassified
26 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
27 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
28 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
29 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
30 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
31 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
32 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
33 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
34 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
35 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
36 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
37 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
38 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
39 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
40 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
41 2858868258 Micromonospora sp. MH33 Isolate Unclassified
42 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
43 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
44 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
45 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
46 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
47 2902582711 Micromonospora sp. AP08 Isolate Unclassified
48 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
49 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
50 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
51 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
52 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
53 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
54 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
55 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
56 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
57 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
58 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
59 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
60 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
61 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
62 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
63 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
64 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
65 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
66 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
68 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
69 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
70 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
71 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
72 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
73 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
74 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
75 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
76 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
77 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
78 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
79 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
80 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
81 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
82 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
83 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
84 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
85 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
86 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
87 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
88 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
89 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
90 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
91 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
92 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
93 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
94 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
95 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
96 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
97 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
98 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
99 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
100 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
101 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
102 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
103 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
104 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
105 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
106 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
107 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
108 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
109 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
110 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
111 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
112 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
113 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
114 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
115 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
116 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
117 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
118 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
119 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
120 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
121 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
122 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
123 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
124 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
125 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
126 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
127 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
128 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
129 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
130 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
131 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
132 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
133 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
134 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
135 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
136 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
137 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
138 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
139 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
140 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
141 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
142 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
143 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
144 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
145 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
146 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
147 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
148 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
149 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
150 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
151 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
152 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
153 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
154 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
155 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
156 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
157 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
158 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
159 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
160 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
161 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
162 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
163 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
164 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
210 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
211 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
215 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
216 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
217 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
218 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
219 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
220 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
221 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
222 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
223 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
224 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
225 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
226 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
227 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
228 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
229 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
230 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
231 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
232 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
233 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
234 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
235 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
236 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
237 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
238 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
239 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
240 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
241 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
242 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
243 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
244 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
245 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
246 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
247 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
248 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
249 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
250 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
251 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
252 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
253 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
254 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
255 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
256 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
257 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
258 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
259 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
260 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
261 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
262 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
263 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
264 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
265 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
266 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
267 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
268 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
269 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
270 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
271 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
272 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
273 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
274 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
275 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
276 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
277 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
278 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
279 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
280 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
281 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
282 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
283 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
284 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
285 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
286 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
287 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
288 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
289 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
290 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
291 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
292 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
293 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
294 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
295 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
296 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
297 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
298 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
299 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
300 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
301 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
302 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
303 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
304 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
305 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
306 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
307 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
308 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
309 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
310 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
311 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
312 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
313 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
314 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
315 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
316 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
317 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
318 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
319 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
320 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
321 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
322 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
323 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
324 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
325 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
326 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
327 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
328 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
329 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
330 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
331 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
332 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
333 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
334 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
335 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
336 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
337 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
338 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
339 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
340 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
341 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
342 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
343 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
344 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
345 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
346 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
347 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
348 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
349 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
350 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
351 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
352 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
353 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
356 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
369 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
370 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
371 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
372 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
373 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
374 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
375 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
376 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
377 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
378 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
379 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
380 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
381 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
382 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
385 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
386 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
387 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
388 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
389 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
390 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
391 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
392 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
393 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
394 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
395 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
396 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
397 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
398 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
399 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
400 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
401 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
402 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
403 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
404 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
405 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
406 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
407 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
408 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
409 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
410 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
411 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
412 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
413 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
414 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
415 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
416 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
417 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere
418 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.03
Metatranscriptomes 1.15
Isolates 5.82

Biome Distribution

Category Percentage (%)
Aerial Root 0.08
Bulb 0
Endosphere 6.48
Nodule 0.08
Rhizoplane 8.85
Rhizosphere 78.93
Stem 0
Stem Tuber 0
Unclassified 5.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1000406 3300000549 Bacteria 7271
2 JGI24740J21852_10005178 3300001979 Bacteria 5534
3 JGI24740J21852_10011168 3300001979 Bacteria 3428
4 JGI24739J22299_10000895 3300001989 Bacteria 11018
5 JGI24739J22299_10007160 3300001989 Bacteria 4198
6 JGI24737J22298_10002596 3300001990 Bacteria 6396
7 JGI24737J22298_10008355 3300001990 Bacteria 3470
8 JGI24737J22298_10039391 3300001990 Bacteria 1453
9 JGI24735J21928_10004072 3300002067 Bacteria 4936
10 JGI24735J21928_10018306 3300002067 Bacteria 2160
11 JGI24744J21845_10018837 3300002077 Bacteria 1367
12 JGI25406J46586_10010242 3300003203 Bacteria 4166
13 JGI25407J50210_10002085 3300003373 Bacteria 4666
14 Ga0070658_10000814 3300005327 Bacteria 26670
15 Ga0070658_10001258 3300005327 Bacteria 21702
16 Ga0070658_10017927 3300005327 Bacteria 5662
17 Ga0070658_10025618 3300005327 Bacteria 4727
18 Ga0070658_10361292 3300005327 Bacteria 1244
19 Ga0070683_100001781 3300005329 Bacteria 16780
20 Ga0070683_100005269 3300005329 Bacteria 10766
21 Ga0070683_100008215 3300005329 Bacteria 8866
22 Ga0070683_100027904 3300005329 Bacteria 5096
23 Ga0070683_100030081 3300005329 Bacteria 4925
24 Ga0070683_100109888 3300005329 Bacteria 2600
25 Ga0070683_100113895 3300005329 Bacteria 2552
26 Ga0070683_100344814 3300005329 Bacteria 1418
27 Ga0070683_100365384 3300005329 Bacteria 1374
28 Ga0070683_100617509 3300005329 Bacteria 1038
29 Ga0070670_100498867 3300005331 Bacteria 1082
30 Ga0068869_100009607 3300005334 Bacteria 6283
31 Ga0070666_10012071 3300005335 Bacteria 5440
32 Ga0070680_100000061 3300005336 Bacteria 56357
33 Ga0070680_100170910 3300005336 Bacteria 1829
34 Ga0070680_100301242 3300005336 Bacteria 1359
35 Ga0070680_100311642 3300005336 Bacteria 1335
36 Ga0070682_100017470 3300005337 Bacteria 4182
37 Ga0070682_100025445 3300005337 Bacteria 3532
38 Ga0068868_100094838 3300005338 Bacteria 2408
39 Ga0070660_100047049 3300005339 Bacteria 3308
40 Ga0070660_100086161 3300005339 Bacteria 2471
41 Ga0070660_100094063 3300005339 Bacteria 2368
42 Ga0070660_100113770 3300005339 Bacteria 2155
43 Ga0070660_100442539 3300005339 Bacteria 1078
44 Ga0070689_100118455 3300005340 Bacteria 2113
45 Ga0070691_10010021 3300005341 Bacteria 4318
46 Ga0070691_10097460 3300005341 Bacteria 1457
47 Ga0070692_10001341 3300005345 Bacteria 8870
48 Ga0070692_10006255 3300005345 Bacteria 5157
49 Ga0070668_100117602 3300005347 Bacteria 2121
50 Ga0070668_100170216 3300005347 Bacteria 1773
51 Ga0070675_100059192 3300005354 Bacteria 3159
52 Ga0070674_100120333 3300005356 Bacteria 1943
53 Ga0070673_100076323 3300005364 Bacteria 2706
54 Ga0070659_100007547 3300005366 Bacteria 7903
55 Ga0070659_100047430 3300005366 Bacteria 3370
56 Ga0070659_100076146 3300005366 Bacteria 2676
57 Ga0070659_100103332 3300005366 Bacteria 2295
58 Ga0070667_100006291 3300005367 Bacteria 9869
59 Ga0070667_100016409 3300005367 Bacteria 6129
60 Ga0070667_100149673 3300005367 Bacteria 2049
61 Ga0070714_100000011 3300005435 Bacteria 231268
62 Ga0070714_100119293 3300005435 Bacteria 2344
63 Ga0070714_100159970 3300005435 Bacteria 2037
64 Ga0070714_100371222 3300005435 Bacteria 1347
65 Ga0070701_10019203 3300005438 Bacteria 3226
66 Ga0070700_100000046 3300005441 Bacteria 91380
67 Ga0070700_100001955 3300005441 Bacteria 10459
68 Ga0070700_100010715 3300005441 Bacteria 5064
69 Ga0070700_100139733 3300005441 Bacteria 1644
70 Ga0070663_100032528 3300005455 Bacteria 3595
71 Ga0070663_100096511 3300005455 Bacteria 2199
72 Ga0070663_100276395 3300005455 Bacteria 1337
73 Ga0070662_100113751 3300005457 Bacteria 2065
74 Ga0070681_10000471 3300005458 Bacteria 32815
75 Ga0070681_10027056 3300005458 Bacteria 5767
76 Ga0070685_10062685 3300005466 Bacteria 2181
77 Ga0070698_100003098 3300005471 Bacteria 18331
78 Ga0070698_100030285 3300005471 Bacteria 5612
79 Ga0070679_100000720 3300005530 Bacteria 28535
80 Ga0070679_100006982 3300005530 Bacteria 10538
81 Ga0070679_100036126 3300005530 Bacteria 4903
82 Ga0070679_100120071 3300005530 Bacteria 2614
83 Ga0070679_100264201 3300005530 Bacteria 1676
84 Ga0070679_100299195 3300005530 Bacteria 1560
85 Ga0070679_100324446 3300005530 Bacteria 1489
86 Ga0070679_100725761 3300005530 Bacteria 936
87 Ga0070684_100001861 3300005535 Bacteria 15451
88 Ga0070684_100060427 3300005535 Bacteria 3315
89 Ga0070684_100104868 3300005535 Bacteria 2529
90 Ga0070684_100120457 3300005535 Bacteria 2361
91 Ga0070684_100126604 3300005535 Bacteria 2301
92 Ga0070684_100421833 3300005535 Bacteria 1231
93 Ga0070665_100002289 3300005548 Bacteria 21300
94 Ga0070665_100005571 3300005548 Bacteria 12950
95 Ga0070665_100583323 3300005548 Bacteria 1131
96 Ga0068855_100138868 3300005563 Bacteria 2772
97 Ga0068855_100239854 3300005563 Bacteria 2026
98 Ga0068855_100456955 3300005563 Bacteria 1393
99 Ga0070664_100017312 3300005564 Bacteria 5916
100 Ga0070664_100034185 3300005564 Bacteria 4263
101 Ga0070664_100039920 3300005564 Bacteria 3957
102 Ga0070664_100084961 3300005564 Bacteria 2733
103 Ga0070664_100695523 3300005564 Bacteria 947
104 Ga0068857_100064538 3300005577 Bacteria 3256
105 Ga0068857_100067729 3300005577 Bacteria 3177
106 Ga0068857_100096110 3300005577 Bacteria 2655
107 Ga0068857_100118195 3300005577 Bacteria 2386
108 Ga0068854_100096417 3300005578 Bacteria 2210
109 Ga0068856_100028053 3300005614 Bacteria 5494
110 Ga0068856_100116087 3300005614 Bacteria 2677
111 Ga0068856_100300399 3300005614 Bacteria 1623
112 Ga0068852_100017390 3300005616 Bacteria 5641
113 Ga0068852_100065659 3300005616 Bacteria 3167
114 Ga0068859_100001539 3300005617 Bacteria 23536
115 Ga0068864_100021895 3300005618 Bacteria 5359
116 Ga0068864_100050411 3300005618 Bacteria 3583
117 Ga0068864_100304872 3300005618 Bacteria 1492
118 Ga0068866_10165049 3300005718 Bacteria 1295
119 Ga0068861_100015848 3300005719 Bacteria 5322
120 Ga0068851_10224411 3300005834 Bacteria 1057
121 Ga0068870_10003907 3300005840 Bacteria 6360
122 Ga0068863_100002669 3300005841 Bacteria 17631
123 Ga0068863_100008460 3300005841 Bacteria 10050
124 Ga0068863_100025724 3300005841 Bacteria 5614
125 Ga0068858_100049084 3300005842 Bacteria 3909
126 Ga0068858_100117034 3300005842 Bacteria 2491
127 Ga0068858_100155962 3300005842 Bacteria 2148
128 Ga0068860_100000054 3300005843 Bacteria 206114
129 Ga0068860_100002320 3300005843 Bacteria 19985
130 Ga0068860_100003522 3300005843 Bacteria 16105
131 Ga0068860_100040782 3300005843 Bacteria 4436
132 Ga0081455_10000158 3300005937 Bacteria 82249
133 Ga0081455_10002794 3300005937 Bacteria 20547
134 Ga0081455_10005627 3300005937 Bacteria 13690
135 Ga0081455_10019900 3300005937 Bacteria 6337
136 Ga0081455_10026196 3300005937 Bacteria 5371
137 Ga0081538_10000088 3300005981 Bacteria 88922
138 Ga0081540_1006832 3300005983 Bacteria 8238
139 Ga0081539_10000448 3300005985 Bacteria 87723
140 Ga0081539_10046341 3300005985 Bacteria 2492
141 Ga0081539_10164438 3300005985 Bacteria 1055
142 Ga0075365_10019236 3300006038 Bacteria 4212
143 Ga0075365_10019785 3300006038 Bacteria 4162
144 Ga0075365_10021742 3300006038 Bacteria 4007
145 Ga0075365_10028608 3300006038 Bacteria 3555
146 Ga0075365_10072831 3300006038 Bacteria 2314
147 Ga0075365_10087427 3300006038 Bacteria 2119
148 Ga0075365_10286819 3300006038 Bacteria 1158
149 Ga0075365_10295411 3300006038 Bacteria 1140
150 Ga0075365_10299308 3300006038 Bacteria 1132
151 Ga0075368_10011471 3300006042 Bacteria 3225
152 Ga0075368_10054347 3300006042 Bacteria 1595
153 Ga0075368_10062027 3300006042 Bacteria 1498
154 Ga0075363_100011563 3300006048 Bacteria 4231
155 Ga0075363_100017989 3300006048 Bacteria 3514
156 Ga0075363_100020595 3300006048 Bacteria 3309
157 Ga0075363_100055576 3300006048 Bacteria 2121
158 Ga0075363_100056566 3300006048 Bacteria 2103
159 Ga0075363_100097036 3300006048 Bacteria 1628
160 Ga0075363_100111933 3300006048 Bacteria 1518
161 Ga0075364_10040219 3300006051 Bacteria 3032
162 Ga0075364_10045224 3300006051 Bacteria 2865
163 Ga0075364_10116985 3300006051 Bacteria 1782
164 Ga0075362_10001503 3300006177 Bacteria 7495
165 Ga0075367_10002838 3300006178 Bacteria 8046
166 Ga0075367_10027486 3300006178 Bacteria 3237
167 Ga0075367_10039576 3300006178 Bacteria 2749
168 Ga0075367_10058334 3300006178 Bacteria 2297
169 Ga0075367_10081540 3300006178 Bacteria 1957
170 Ga0075367_10095824 3300006178 Bacteria 1810
171 Ga0075370_10001514 3300006353 Bacteria 10155
172 Ga0075370_10051205 3300006353 Bacteria 2342
173 Ga0075370_10051729 3300006353 Bacteria 2330
174 Ga0075428_100011687 3300006844 Bacteria 9770
175 Ga0075428_100025318 3300006844 Bacteria 6567
176 Ga0075428_100118616 3300006844 Bacteria 2881
177 Ga0075428_100301708 3300006844 Bacteria 1722
178 Ga0075430_100002641 3300006846 Bacteria 14969
179 Ga0075430_100017685 3300006846 Bacteria 6070
180 Ga0075430_100116731 3300006846 Bacteria 2224
181 Ga0075430_100487729 3300006846 Bacteria 1017
182 Ga0075431_100005930 3300006847 Bacteria 12088
183 Ga0075431_100011587 3300006847 Bacteria 8892
184 Ga0075431_100021426 3300006847 Bacteria 6610
185 Ga0075431_100032015 3300006847 Bacteria 5419
186 Ga0075431_100071369 3300006847 Bacteria 3583
187 Ga0075431_100114258 3300006847 Bacteria 2787
188 Ga0075431_100114651 3300006847 Bacteria 2782
189 Ga0075431_100527122 3300006847 Bacteria 1170
190 Ga0075429_100020719 3300006880 Bacteria 5707
191 Ga0075429_100039984 3300006880 Bacteria 4081
192 Ga0075429_100155817 3300006880 Bacteria 2000
193 Ga0097620_100001539 3300006931 Bacteria 23536
194 Ga0105250_10177731 3300009092 Bacteria 892
195 Ga0111539_10002374 3300009094 Bacteria 25010
196 Ga0111539_10244275 3300009094 Bacteria 2090
197 Ga0105245_10002330 3300009098 Bacteria 17171
198 Ga0105245_10017613 3300009098 Bacteria 6236
199 Ga0105245_10019306 3300009098 Bacteria 5967
200 Ga0105245_10152411 3300009098 Bacteria 2187
201 Ga0105247_10016015 3300009101 Bacteria 4492
202 Ga0105247_10249354 3300009101 Bacteria 1213
203 Ga0114129_10000701 3300009147 Bacteria 42196
204 Ga0114129_10006635 3300009147 Bacteria 16432
205 Ga0114129_10039526 3300009147 Bacteria 6651
206 Ga0114129_10050112 3300009147 Bacteria 5866
207 Ga0114129_10094413 3300009147 Bacteria 4142
208 Ga0114129_10289303 3300009147 Bacteria 2187
209 Ga0114129_10609888 3300009147 Bacteria 1413
210 Ga0105243_10007239 3300009148 Bacteria 8527
211 Ga0105243_10094788 3300009148 Bacteria 2465
212 Ga0105241_10532403 3300009174 Bacteria 1052
213 Ga0105242_10052187 3300009176 Bacteria 3336
214 Ga0105248_10008579 3300009177 Bacteria 11223
215 Ga0105248_10014315 3300009177 Bacteria 8730
216 Ga0105248_10022716 3300009177 Bacteria 6961
217 Ga0105248_10059801 3300009177 Bacteria 4280
218 Ga0105248_10109181 3300009177 Bacteria 3119
219 Ga0105248_10813623 3300009177 Bacteria 1054
220 Ga0105237_10143583 3300009545 Bacteria 2381
221 Ga0105237_10417118 3300009545 Bacteria 1348
222 Ga0105238_10110120 3300009551 Bacteria 2735
223 Ga0105238_10131312 3300009551 Bacteria 2483
224 Ga0105249_10006360 3300009553 Bacteria 10271
225 Ga0105239_10015655 3300010375 Bacteria 8396
226 Ga0105239_10087352 3300010375 Bacteria 3437
227 Ga0105239_10104299 3300010375 Bacteria 3139
228 Ga0105239_10219330 3300010375 Bacteria 2133
229 Ga0105239_10677503 3300010375 Bacteria 1178
230 Ga0105246_10006909 3300011119 Bacteria 6944
231 Ga0105246_10084460 3300011119 Bacteria 2271
232 Ga0105246_10174148 3300011119 Bacteria 1651
233 Ga0105246_10414964 3300011119 Bacteria 1122
234 Ga0157371_10021486 3300013102 Bacteria 4737
235 Ga0157370_10261408 3300013104 Bacteria 1600
236 Ga0157369_10017434 3300013105 Bacteria 8069
237 Ga0157369_10026619 3300013105 Bacteria 6414
238 Ga0157369_10110374 3300013105 Bacteria 2924
239 Ga0157369_10141737 3300013105 Bacteria 2543
240 Ga0157369_10685263 3300013105 Bacteria 1056
241 Ga0157374_10291649 3300013296 Bacteria 1613
242 Ga0157374_10439647 3300013296 Bacteria 1305
243 Ga0157378_10814315 3300013297 Bacteria 960
244 Ga0163162_10234485 3300013306 Bacteria 1966
245 Ga0163162_10250272 3300013306 Bacteria 1904
246 Ga0163162_10570323 3300013306 Bacteria 1259
247 Ga0157372_10000069 3300013307 Bacteria 110621
248 Ga0157372_10023195 3300013307 Bacteria 6726
249 Ga0157372_10056905 3300013307 Bacteria 4370
250 Ga0157372_10082665 3300013307 Bacteria 3636
251 Ga0157372_10144137 3300013307 Bacteria 2747
252 Ga0157372_10177196 3300013307 Bacteria 2468
253 Ga0157372_10275067 3300013307 Bacteria 1957
254 Ga0157372_10408720 3300013307 Bacteria 1582
255 Ga0157372_10417394 3300013307 Bacteria 1564
256 Ga0157372_10694298 3300013307 Bacteria 1184
257 Ga0157375_10167615 3300013308 Bacteria 2342
258 Ga0157375_10178567 3300013308 Bacteria 2274
259 Ga0157375_10249164 3300013308 Bacteria 1937
260 Ga0157375_10826900 3300013308 Bacteria 1074
261 Ga0163163_10010605 3300014325 Bacteria 8298
262 Ga0163163_10051861 3300014325 Bacteria 4045
263 Ga0163163_10195169 3300014325 Bacteria 2072
264 Ga0163163_10238106 3300014325 Bacteria 1870
265 Ga0157377_10008109 3300014745 Bacteria 5109
266 Ga0157377_10016277 3300014745 Bacteria 3821
267 Ga0157379_10016161 3300014968 Bacteria 6565
268 Ga0157379_10053286 3300014968 Bacteria 3614
269 Ga0157379_10105884 3300014968 Bacteria 2524
270 Ga0157379_10183386 3300014968 Bacteria 1891
271 Ga0163161_10114048 3300017792 Bacteria 2024
272 Ga0163161_10303207 3300017792 Bacteria 1258
273 Ga0163161_10392471 3300017792 Bacteria 1111
274 Ga0163161_10545996 3300017792 Bacteria 949
275 Ga0206356_10758618 3300020070 Bacteria 2448
276 Ga0206349_1219296 3300020075 Bacteria 1481
277 Ga0206351_10570905 3300020077 Bacteria 1102
278 Ga0206351_10590854 3300020077 Bacteria 3068
279 Ga0206350_11539497 3300020080 Bacteria 1242
280 Ga0206354_11210162 3300020081 Bacteria 2207
281 Ga0206353_10671446 3300020082 Bacteria 2613
282 Ga0206353_10991039 3300020082 Bacteria 1086
283 Ga0206353_11552232 3300020082 Bacteria 4097
284 Ga0206353_11812951 3300020082 Bacteria 15253
285 Ga0206353_11887563 3300020082 Bacteria 3722
286 Ga0213876_10002578 3300021384 Bacteria 10594
287 Ga0213875_10011930 3300021388 Bacteria 4308
288 Ga0224712_10011753 3300022467 Bacteria 2728
289 Ga0224712_10039299 3300022467 Bacteria 1773
290 Ga0224712_10058843 3300022467 Bacteria 1524
291 Ga0209758_1005429 3300025297 Bacteria 9828
292 Ga0207710_10008328 3300025900 Bacteria 4374
293 Ga0207688_10103924 3300025901 Bacteria 1643
294 Ga0207688_10173266 3300025901 Bacteria 1284
295 Ga0207688_10259035 3300025901 Bacteria 1055
296 Ga0207647_10002919 3300025904 Bacteria 12873
297 Ga0207647_10007225 3300025904 Bacteria 8042
298 Ga0207647_10009203 3300025904 Bacteria 7028
299 Ga0207647_10019070 3300025904 Bacteria 4620
300 Ga0207647_10037182 3300025904 Bacteria 3089
301 Ga0207647_10071089 3300025904 Bacteria 2100
302 Ga0207643_10001247 3300025908 Bacteria 14945
303 Ga0207705_10001488 3300025909 Bacteria 18644
304 Ga0207705_10059407 3300025909 Bacteria 2759
305 Ga0207705_10063669 3300025909 Bacteria 2664
306 Ga0207705_10082085 3300025909 Bacteria 2350
307 Ga0207705_10261144 3300025909 Bacteria 1322
308 Ga0207705_10319251 3300025909 Bacteria 1193
309 Ga0207707_10000277 3300025912 Bacteria 55264
310 Ga0207707_10011997 3300025912 Bacteria 7532
311 Ga0207707_10020504 3300025912 Bacteria 5772
312 Ga0207671_10235272 3300025914 Bacteria 1438
313 Ga0207671_10373166 3300025914 Bacteria 1133
314 Ga0207660_10000909 3300025917 Bacteria 19475
315 Ga0207660_10051337 3300025917 Bacteria 2932
316 Ga0207660_10483004 3300025917 Bacteria 1004
317 Ga0207662_10024650 3300025918 Bacteria 3462
318 Ga0207657_10006999 3300025919 Bacteria 11611
319 Ga0207657_10082177 3300025919 Bacteria 2705
320 Ga0207657_10088697 3300025919 Bacteria 2585
321 Ga0207657_10098643 3300025919 Bacteria 2427
322 Ga0207649_10195839 3300025920 Bacteria 1424
323 Ga0207652_10000333 3300025921 Bacteria 48970
324 Ga0207652_10005131 3300025921 Bacteria 10630
325 Ga0207652_10011178 3300025921 Bacteria 7235
326 Ga0207652_10180076 3300025921 Bacteria 1899
327 Ga0207652_10273099 3300025921 Bacteria 1525
328 Ga0207652_10362618 3300025921 Bacteria 1308
329 Ga0207646_10379282 3300025922 Bacteria 1277
330 Ga0207659_10023152 3300025926 Bacteria 4142
331 Ga0207659_10175068 3300025926 Bacteria 1695
332 Ga0207687_10052541 3300025927 Bacteria 2844
333 Ga0207687_10061079 3300025927 Bacteria 2660
334 Ga0207687_10064937 3300025927 Bacteria 2590
335 Ga0207687_10116121 3300025927 Bacteria 1994
336 Ga0207687_10160693 3300025927 Bacteria 1724
337 Ga0207664_10000001 3300025929 Bacteria 724213
338 Ga0207664_10063108 3300025929 Bacteria 2960
339 Ga0207664_10191302 3300025929 Bacteria 1762
340 Ga0207664_10317575 3300025929 Bacteria 1374
341 Ga0207644_10068688 3300025931 Bacteria 2586
342 Ga0207644_10320643 3300025931 Bacteria 1253
343 Ga0207690_10009500 3300025932 Bacteria 5776
344 Ga0207690_10106295 3300025932 Bacteria 2014
345 Ga0207690_10288906 3300025932 Bacteria 1279
346 Ga0207706_10070059 3300025933 Bacteria 3084
347 Ga0207706_10070727 3300025933 Bacteria 3069
348 Ga0207686_10197639 3300025934 Bacteria 1438
349 Ga0207709_10097521 3300025935 Bacteria 1936
350 Ga0207669_10180299 3300025937 Bacteria 1513
351 Ga0207704_10030583 3300025938 Bacteria 3020
352 Ga0207691_10020374 3300025940 Bacteria 6269
353 Ga0207691_10261968 3300025940 Bacteria 1490
354 Ga0207691_10263052 3300025940 Bacteria 1487
355 Ga0207711_10014894 3300025941 Bacteria 6459
356 Ga0207711_10088073 3300025941 Bacteria 2725
357 Ga0207711_10214457 3300025941 Bacteria 1759
358 Ga0207711_10343102 3300025941 Bacteria 1382
359 Ga0207661_10001990 3300025944 Bacteria 14063
360 Ga0207661_10038045 3300025944 Bacteria 3768
361 Ga0207661_10046146 3300025944 Bacteria 3454
362 Ga0207661_10052202 3300025944 Bacteria 3265
363 Ga0207661_10122401 3300025944 Bacteria 2217
364 Ga0207661_10157256 3300025944 Bacteria 1970
365 Ga0207661_10195862 3300025944 Bacteria 1774
366 Ga0207661_10197223 3300025944 Bacteria 1768
367 Ga0207661_10225639 3300025944 Bacteria 1657
368 Ga0207679_10008536 3300025945 Bacteria 6527
369 Ga0207679_10011135 3300025945 Bacteria 5809
370 Ga0207679_10021837 3300025945 Bacteria 4347
371 Ga0207679_10189434 3300025945 Bacteria 1709
372 Ga0207679_10213605 3300025945 Bacteria 1619
373 Ga0207679_10378908 3300025945 Bacteria 1240
374 Ga0207667_10009869 3300025949 Bacteria 11205
375 Ga0207667_10082723 3300025949 Bacteria 3325
376 Ga0207667_10260009 3300025949 Bacteria 1775
377 Ga0207712_10184114 3300025961 Bacteria 1643
378 Ga0207668_10009452 3300025972 Bacteria 5845
379 Ga0207668_10041693 3300025972 Bacteria 3105
380 Ga0207640_10420905 3300025981 Bacteria 1093
381 Ga0207658_10006035 3300025986 Bacteria 8273
382 Ga0207658_10011134 3300025986 Bacteria 6125
383 Ga0207658_10050600 3300025986 Bacteria 3058
384 Ga0207658_10183621 3300025986 Bacteria 1733
385 Ga0207677_10072123 3300026023 Bacteria 2440
386 Ga0207677_10118612 3300026023 Bacteria 1986
387 Ga0207703_10036258 3300026035 Bacteria 3924
388 Ga0207703_10057661 3300026035 Bacteria 3168
389 Ga0207703_10348652 3300026035 Bacteria 1362
390 Ga0207639_10249673 3300026041 Bacteria 1547
391 Ga0207678_10035120 3300026067 Bacteria 4366
392 Ga0207678_10149146 3300026067 Bacteria 1996
393 Ga0207678_10166753 3300026067 Bacteria 1881
394 Ga0207708_10000002 3300026075 Bacteria 411071
395 Ga0207708_10000970 3300026075 Bacteria 21503
396 Ga0207708_10047138 3300026075 Bacteria 3282
397 Ga0207708_10070799 3300026075 Bacteria 2670
398 Ga0207702_10245261 3300026078 Bacteria 1680
399 Ga0207702_10500232 3300026078 Bacteria 1185
400 Ga0207702_10567743 3300026078 Bacteria 1111
401 Ga0207641_10073804 3300026088 Bacteria 2941
402 Ga0207641_10092980 3300026088 Bacteria 2642
403 Ga0207641_10249061 3300026088 Bacteria 1658
404 Ga0207641_10591313 3300026088 Bacteria 1086
405 Ga0207648_10007917 3300026089 Bacteria 10362
406 Ga0207676_10008982 3300026095 Bacteria 7110
407 Ga0207676_10294371 3300026095 Bacteria 1479
408 Ga0207676_10306483 3300026095 Bacteria 1452
409 Ga0207676_10457296 3300026095 Bacteria 1205
410 Ga0207676_10471435 3300026095 Bacteria 1187
411 Ga0207674_10084881 3300026116 Bacteria 3163
412 Ga0207674_10133371 3300026116 Bacteria 2446
413 Ga0207674_10140766 3300026116 Bacteria 2372
414 Ga0207674_10148082 3300026116 Bacteria 2305
415 Ga0207674_10267712 3300026116 Bacteria 1656
416 Ga0207675_100013178 3300026118 Bacteria 7717
417 Ga0207675_100248083 3300026118 Bacteria 1722
418 Ga0207675_100793542 3300026118 Bacteria 960
419 Ga0207683_10215134 3300026121 Bacteria 1750
420 Ga0207698_10005597 3300026142 Bacteria 7775
421 Ga0207698_10034753 3300026142 Bacteria 3679
422 Ga0209813_10001554 3300027866 Bacteria 5149
423 Ga0209813_10024648 3300027866 Bacteria 1723
424 Ga0209813_10050921 3300027866 Bacteria 1294
425 Ga0209813_10089925 3300027866 Bacteria 1029
426 Ga0207428_10010606 3300027907 Bacteria 8222
427 Ga0207428_10066640 3300027907 Bacteria 2836
428 Ga0207428_10104342 3300027907 Bacteria 2188
429 Ga0268266_10000921 3300028379 Bacteria 37821
430 Ga0268266_10002828 3300028379 Bacteria 18100
431 Ga0268266_10137164 3300028379 Bacteria 2192
432 Ga0268266_10526916 3300028379 Bacteria 1130
433 Ga0268265_10026801 3300028380 Bacteria 4104
434 Ga0268264_10000097 3300028381 Bacteria 229722
435 Ga0268264_10000417 3300028381 Bacteria 60164
436 Ga0268264_10000437 3300028381 Bacteria 57431
437 Ga0268264_10100196 3300028381 Bacteria 2516
438 Ga0268264_10125449 3300028381 Bacteria 2268
439 Ga0307515_10044084 3300028794 Bacteria 6906
440 Ga0307512_10030926 3300030522 Bacteria 4648
441 Ga0265327_10000004 3300031251 Bacteria 803973
442 Ga0307513_10003949 3300031456 Bacteria 19925
443 Ga0307408_100195554 3300031548 Bacteria 1633
444 Ga0307408_100437427 3300031548 Bacteria 1132
445 Ga0307508_10022174 3300031616 Bacteria 5771
446 Ga0307405_10002296 3300031731 Bacteria 8380
447 Ga0307405_10021835 3300031731 Bacteria 3606
448 Ga0307405_10086415 3300031731 Bacteria 2064
449 Ga0307405_10222334 3300031731 Bacteria 1386
450 Ga0307405_10239010 3300031731 Bacteria 1344
451 Ga0307405_10279226 3300031731 Bacteria 1256
452 Ga0307413_10464937 3300031824 Bacteria 1007
453 Ga0307518_10070328 3300031838 Bacteria 2535
454 Ga0307518_10217230 3300031838 Bacteria 1252
455 Ga0307410_10012734 3300031852 Bacteria 4877
456 Ga0307410_10027544 3300031852 Bacteria 3592
457 Ga0307410_10029204 3300031852 Bacteria 3509
458 Ga0307410_10042080 3300031852 Bacteria 3017
459 Ga0307410_10052303 3300031852 Bacteria 2758
460 Ga0307410_10058829 3300031852 Bacteria 2622
461 Ga0307410_10100192 3300031852 Bacteria 2075
462 Ga0307410_10102539 3300031852 Bacteria 2053
463 Ga0307410_10140734 3300031852 Bacteria 1785
464 Ga0307410_10251467 3300031852 Bacteria 1374
465 Ga0307406_10055428 3300031901 Bacteria 2534
466 Ga0307406_10057322 3300031901 Bacteria 2498
467 Ga0307406_10069930 3300031901 Bacteria 2297
468 Ga0307406_10117777 3300031901 Bacteria 1840
469 Ga0307406_10298592 3300031901 Bacteria 1236
470 Ga0307406_10372929 3300031901 Bacteria 1123
471 Ga0307407_10063199 3300031903 Bacteria 2171
472 Ga0307407_10079172 3300031903 Bacteria 1982
473 Ga0307407_10115338 3300031903 Bacteria 1693
474 Ga0307407_10445622 3300031903 Bacteria 938
475 Ga0307412_10072015 3300031911 Bacteria 2361
476 Ga0307412_10115738 3300031911 Bacteria 1922
477 Ga0307412_10564220 3300031911 Bacteria 958
478 Ga0307409_100002935 3300031995 Bacteria 9065
479 Ga0307409_100003522 3300031995 Bacteria 8531
480 Ga0307409_100042993 3300031995 Bacteria 3388
481 Ga0307409_100044415 3300031995 Bacteria 3347
482 Ga0307409_100060594 3300031995 Bacteria 2952
483 Ga0307409_100062779 3300031995 Bacteria 2910
484 Ga0307409_100070856 3300031995 Bacteria 2769
485 Ga0307409_100109822 3300031995 Bacteria 2310
486 Ga0307409_100162542 3300031995 Bacteria 1955
487 Ga0307409_100307371 3300031995 Bacteria 1478
488 Ga0307409_100354186 3300031995 Bacteria 1386
489 Ga0307409_100533803 3300031995 Bacteria 1148
490 Ga0307409_100644955 3300031995 Bacteria 1052
491 Ga0307416_100010155 3300032002 Bacteria 6205
492 Ga0307416_100011648 3300032002 Bacteria 5880
493 Ga0307416_100012393 3300032002 Bacteria 5742
494 Ga0307416_100039587 3300032002 Bacteria 3652
495 Ga0307416_100059184 3300032002 Bacteria 3111
496 Ga0307416_100062962 3300032002 Bacteria 3035
497 Ga0307416_100063868 3300032002 Bacteria 3017
498 Ga0307416_100104394 3300032002 Bacteria 2477
499 Ga0307416_100108292 3300032002 Bacteria 2441
500 Ga0307416_100905121 3300032002 Bacteria 982
501 Ga0307414_10116251 3300032004 Bacteria 2047
502 Ga0307414_10269099 3300032004 Bacteria 1426
503 Ga0307414_10295860 3300032004 Bacteria 1367
504 Ga0307414_10459715 3300032004 Bacteria 1118
505 Ga0307414_10515540 3300032004 Bacteria 1060
506 Ga0307411_10061789 3300032005 Bacteria 2496
507 Ga0307411_10126923 3300032005 Bacteria 1857
508 Ga0307411_10193387 3300032005 Bacteria 1555
509 Ga0307411_10283594 3300032005 Bacteria 1319
510 Ga0307415_100000185 3300032126 Bacteria 27611
511 Ga0307415_100000940 3300032126 Bacteria 13381
512 Ga0307415_100010414 3300032126 Bacteria 5267
513 Ga0307415_100013501 3300032126 Bacteria 4770
514 Ga0307415_100013553 3300032126 Bacteria 4762
515 Ga0307415_100040583 3300032126 Bacteria 3084
516 Ga0307415_100052929 3300032126 Bacteria 2763
517 Ga0307415_100071461 3300032126 Bacteria 2441
518 Ga0307415_100089834 3300032126 Bacteria 2220
519 Ga0307415_100112716 3300032126 Bacteria 2021
520 Ga0307415_100373509 3300032126 Bacteria 1208
521 Ga0307415_100422545 3300032126 Bacteria 1144
522 Ga0373928_0037050 3300035084 Bacteria 1105
523 Ga0373956_0004841 3300035119 Bacteria 5390
524 Ga0395899_0004648 3300037312 Bacteria 10711
525 Ga0395900_0043573 3300037418 Bacteria 4625
526 Ga0395900_0052534 3300037418 Bacteria 4195
527 Ga0395900_0134671 3300037418 Bacteria 2531
528 Ga0395900_0160873 3300037418 Bacteria 2290
529 Ga0395900_0329141 3300037418 Bacteria 1506
530 Ga0395898_0009234 3300037466 Bacteria 10375
531 Ga0395898_0017331 3300037466 Bacteria 7358
532 Ga0395898_0084943 3300037466 Bacteria 3051
533 Ga0395898_0094097 3300037466 Bacteria 2880
534 Ga0395898_0177579 3300037466 Bacteria 2035
535 Ga0395898_0187513 3300037466 Bacteria 1976
536 Ga0395898_0279201 3300037466 Bacteria 1593
537 Ga0395898_0479344 3300037466 Bacteria 1184
538 Ga0395905_0023370 3300037471 Bacteria 5843
539 Ga0395905_0312267 3300037471 Bacteria 1461
540 Ga0395905_0572833 3300037471 Bacteria 1030
541 Ga0395905_0690840 3300037471 Bacteria 923
542 Ga0436364_1557918 3300037853 Bacteria 10476
543 Ga0395901_0006829 3300038443 Bacteria 11525
544 Ga0395901_0012737 3300038443 Bacteria 8531
545 Ga0395901_0018885 3300038443 Bacteria 7048
546 Ga0395901_0046225 3300038443 Bacteria 4521
547 Ga0395901_0072557 3300038443 Bacteria 3589
548 Ga0395901_0138427 3300038443 Bacteria 2559
549 Ga0395901_0142114 3300038443 Bacteria 2522
550 Ga0395901_0157189 3300038443 Bacteria 2388
551 Ga0395901_0202418 3300038443 Bacteria 2081
552 Ga0395901_0237350 3300038443 Bacteria 1902
553 Ga0395901_0257879 3300038443 Bacteria 1815
554 Ga0395901_0380946 3300038443 Bacteria 1452
555 Ga0395901_0532477 3300038443 Bacteria 1192
556 Ga0436365_0754694 3300039437 Bacteria 1790
557 Ga0436365_1489938 3300039437 Bacteria 11589
558 Ga0439436_0017044 3300041404 Bacteria 2174
559 Ga0439436_0020928 3300041404 Bacteria 1947
560 Ga0439438_011809 3300041405 Bacteria 2702
561 Ga0439438_022418 3300041405 Bacteria 1751
562 Ga0439439_0002785 3300041406 Bacteria 3771
563 Ga0439447_027600 3300041407 Bacteria 1448
564 Ga0439465_0046689 3300041413 Bacteria 1410
565 Ga0451837_0174851 3300041494 Bacteria 832
566 Ga0451837_0507184 3300041494 Bacteria 3640
567 Ga0451841_0998218 3300041498 Bacteria 1359
568 Ga0451853_0891367 3300041512 Bacteria 1987
569 Ga0451853_0938007 3300041512 Bacteria 12888
570 Ga0439431_0002045 3300041997 Bacteria 4465
571 Ga0439431_0005016 3300041997 Bacteria 2916
572 Ga0439433_0001969 3300041999 Bacteria 4305
573 Ga0439433_0023380 3300041999 Bacteria 1390
574 Ga0439442_011637 3300042002 Bacteria 1794
575 Ga0439442_032915 3300042002 Bacteria 1083
576 Ga0439445_0010157 3300042004 Bacteria 2224
577 Ga0439448_0030794 3300042005 Bacteria 1703
578 Ga0439432_065105 3300042006 Bacteria 1118
579 Ga0439449_0023750 3300042007 Bacteria 2293
580 Ga0439457_000320 3300042014 Bacteria 13245
581 Ga0439457_025456 3300042014 Bacteria 1309
582 Ga0439446_0002795 3300042156 Bacteria 4238
583 Ga0439458_0029773 3300042157 Bacteria 1297
584 Ga0466969_0006204 3300044656 Bacteria 6361
585 Ga0466969_0072790 3300044656 Bacteria 1650
586 Ga0466969_0118664 3300044656 Bacteria 1233
587 Ga0466972_0003523 3300044658 Bacteria 7770
588 Ga0466972_0009003 3300044658 Bacteria 5011
589 Ga0466972_0012265 3300044658 Bacteria 4308
590 Ga0466972_0017930 3300044658 Bacteria 3541
591 Ga0466972_0032237 3300044658 Bacteria 2574
592 Ga0466972_0036552 3300044658 Bacteria 2402
593 Ga0466972_0061415 3300044658 Bacteria 1802
594 Ga0466972_0102846 3300044658 Bacteria 1351
595 Ga0466972_0131447 3300044658 Bacteria 1179
596 Ga0466965_0001050 3300044683 Bacteria 10727
597 Ga0466965_0001140 3300044683 Bacteria 10427
598 Ga0466965_0002133 3300044683 Bacteria 8313
599 Ga0466965_0008211 3300044683 Bacteria 4823
600 Ga0466965_0015890 3300044683 Bacteria 3576
601 Ga0466965_0022572 3300044683 Bacteria 3034
602 Ga0466965_0025314 3300044683 Bacteria 2873
603 Ga0466965_0027816 3300044683 Bacteria 2745
604 Ga0466965_0207548 3300044683 Bacteria 1041
605 Ga0466966_0000312 3300044684 Bacteria 31314
606 Ga0466966_0003667 3300044684 Bacteria 10136
607 Ga0466966_0004977 3300044684 Bacteria 8733
608 Ga0466966_0006032 3300044684 Bacteria 8001
609 Ga0466966_0013542 3300044684 Bacteria 5398
610 Ga0466966_0031931 3300044684 Bacteria 3415
611 Ga0466966_0075407 3300044684 Bacteria 2107
612 Ga0466966_0232447 3300044684 Bacteria 1112
613 Ga0466966_0367606 3300044684 Bacteria 864
614 Ga0466961_0001784 3300044693 Bacteria 13324
615 Ga0466961_0005475 3300044693 Bacteria 8006
616 Ga0466961_0007256 3300044693 Bacteria 7053
617 Ga0466961_0008731 3300044693 Bacteria 6461
618 Ga0466961_0013140 3300044693 Bacteria 5297
619 Ga0466961_0023713 3300044693 Bacteria 3948
620 Ga0466961_0042433 3300044693 Bacteria 2915
621 Ga0466961_0080796 3300044693 Bacteria 2057
622 Ga0466961_0186839 3300044693 Bacteria 1285
623 Ga0466961_0249263 3300044693 Bacteria 1091
624 Ga0466963_0002192 3300044694 Bacteria 10803
625 Ga0466963_0003072 3300044694 Bacteria 9457
626 Ga0466963_0005300 3300044694 Bacteria 7537
627 Ga0466963_0030073 3300044694 Bacteria 3501
628 Ga0466963_0034793 3300044694 Bacteria 3279
629 Ga0466963_0041272 3300044694 Bacteria 3026
630 Ga0466963_0050295 3300044694 Bacteria 2759
631 Ga0466963_0101072 3300044694 Bacteria 1974
632 Ga0466963_0164540 3300044694 Bacteria 1545
633 Ga0466963_0183993 3300044694 Bacteria 1459
634 Ga0466963_0214710 3300044694 Bacteria 1347
635 Ga0466963_0299375 3300044694 Bacteria 1131
636 Ga0466964_0002321 3300044706 Bacteria 6753
637 Ga0466964_0006703 3300044706 Bacteria 4294
638 Ga0466964_0008724 3300044706 Bacteria 3811
639 Ga0466964_0011057 3300044706 Bacteria 3410
640 Ga0466964_0017672 3300044706 Bacteria 2731
641 Ga0466964_0018035 3300044706 Bacteria 2705
642 Ga0466971_0000174 3300044719 Bacteria 24176
643 Ga0466971_0001114 3300044719 Bacteria 11153
644 Ga0466971_0007769 3300044719 Bacteria 4675
645 Ga0466971_0019980 3300044719 Bacteria 2977
646 Ga0466971_0026523 3300044719 Bacteria 2590
647 Ga0466971_0041918 3300044719 Bacteria 2056
648 Ga0466968_0055853 3300044735 Bacteria 1695
649 Ga0466970_0004600 3300044765 Bacteria 6808
650 Ga0466970_0008811 3300044765 Bacteria 5083
651 Ga0466970_0013457 3300044765 Bacteria 4193
652 Ga0466970_0029621 3300044765 Bacteria 2883
653 Ga0466970_0043731 3300044765 Bacteria 2384
654 Ga0466970_0058236 3300044765 Bacteria 2068
655 Ga0466970_0070641 3300044765 Bacteria 1877
656 Ga0466970_0093227 3300044765 Bacteria 1636
657 Ga0466970_0096663 3300044765 Bacteria 1606
658 Ga0466970_0129608 3300044765 Bacteria 1385
659 Ga0466970_0147130 3300044765 Bacteria 1300
660 Ga0466970_0157035 3300044765 Bacteria 1257
661 Ga0466970_0201372 3300044765 Bacteria 1108
662 Ga0466957_0000556 3300044842 Bacteria 18815
663 Ga0466957_0002349 3300044842 Bacteria 10139
664 Ga0466957_0006840 3300044842 Bacteria 6444
665 Ga0466957_0011694 3300044842 Bacteria 5073
666 Ga0466957_0013850 3300044842 Bacteria 4687
667 Ga0466957_0024957 3300044842 Bacteria 3541
668 Ga0466957_0027493 3300044842 Bacteria 3381
669 Ga0466957_0088785 3300044842 Bacteria 1934
670 Ga0466957_0217483 3300044842 Bacteria 1260
671 Ga0466960_0000786 3300044901 Bacteria 11141
672 Ga0466960_0001800 3300044901 Bacteria 7868
673 Ga0466960_0006193 3300044901 Bacteria 4791
674 Ga0466960_0008988 3300044901 Bacteria 4107
675 Ga0466960_0019338 3300044901 Bacteria 3000
676 Ga0466960_0076153 3300044901 Bacteria 1680
677 Ga0466960_0090361 3300044901 Bacteria 1560
678 Ga0466960_0095269 3300044901 Bacteria 1524
679 Ga0466960_0123716 3300044901 Bacteria 1357
680 Ga0466960_0172058 3300044901 Bacteria 1169
681 Ga0466959_0001149 3300045049 Bacteria 15958
682 Ga0466959_0006909 3300045049 Bacteria 7924
683 Ga0466959_0032516 3300045049 Bacteria 3862
684 Ga0466959_0115172 3300045049 Bacteria 1915
685 Ga0466959_0280236 3300045049 Bacteria 1144
686 Ga0451576_0121267 3300045051 Bacteria 2722
687 Ga0466958_0000298 3300045836 Bacteria 19456
688 Ga0466958_0014202 3300045836 Bacteria 4546
689 Ga0466958_0016820 3300045836 Bacteria 4218
690 Ga0466958_0017847 3300045836 Bacteria 4110
691 Ga0466958_0020765 3300045836 Bacteria 3833
692 Ga0466958_0097302 3300045836 Bacteria 1826
693 Ga0466958_0098165 3300045836 Bacteria 1818
694 Ga0466967_0001336 3300045976 Bacteria 14138
695 Ga0466967_0004013 3300045976 Bacteria 9814
696 Ga0466967_0007727 3300045976 Bacteria 7795
697 Ga0466967_0010100 3300045976 Bacteria 7055
698 Ga0466967_0013766 3300045976 Bacteria 6269
699 Ga0466967_0033451 3300045976 Bacteria 4352
700 Ga0466967_0049511 3300045976 Bacteria 3675
701 Ga0466967_0075576 3300045976 Bacteria 3028
702 Ga0466967_0081691 3300045976 Bacteria 2919
703 Ga0466967_0107214 3300045976 Bacteria 2562
704 Ga0466967_0116273 3300045976 Bacteria 2464
705 Ga0466967_0119872 3300045976 Bacteria 2429
706 Ga0466967_0123345 3300045976 Bacteria 2397
707 Ga0466967_0179493 3300045976 Bacteria 1996
708 Ga0466967_0232776 3300045976 Bacteria 1755
709 Ga0466967_0243023 3300045976 Bacteria 1718
710 Ga0466967_0267844 3300045976 Bacteria 1636
711 Ga0466967_0275732 3300045976 Bacteria 1612
712 Ga0466967_0355714 3300045976 Bacteria 1418
713 Ga0466967_0413791 3300045976 Bacteria 1313
714 Ga0466967_0724037 3300045976 Bacteria 986
715 Ga0466967_1158180 3300045976 Bacteria 770
716 Ga0495617_009013 3300046452 Bacteria 3432
717 Ga0495627_017372 3300046453 Bacteria 2446
718 Ga0495627_043882 3300046453 Bacteria 1366
719 Ga0495592_0039421 3300046454 Bacteria 3548
720 Ga0495603_0002573 3300046455 Bacteria 10703
721 Ga0495603_0085514 3300046455 Bacteria 1846
722 Ga0495638_0274132 3300046460 Bacteria 919
723 Ga0495651_0050627 3300046462 Bacteria 3204
724 Ga0495582_0082016 3300046473 Bacteria 1792
725 Ga0495605_0012721 3300046474 Bacteria 4660
726 Ga0495664_0055576 3300046477 Bacteria 2355
727 Ga0495585_0094322 3300046492 Bacteria 1608
728 Ga0495594_0003966 3300046499 Bacteria 7613
729 Ga0495594_0045190 3300046499 Bacteria 2417
730 Ga0495596_0028776 3300046500 Bacteria 2229
731 Ga0495583_0073175 3300046506 Bacteria 1502
732 Ga0495606_0003890 3300046507 Bacteria 15397
733 Ga0495606_0061900 3300046507 Bacteria 2391
734 Ga0495608_0276261 3300046511 Bacteria 1044
735 Ga0495618_0279016 3300046514 Bacteria 1042
736 Ga0495620_0084842 3300046515 Bacteria 1277
737 Ga0495628_0522814 3300046516 Bacteria 854
738 Ga0495632_0168214 3300046519 Bacteria 1008
739 Ga0495637_0037191 3300046520 Bacteria 2115
740 Ga0495648_0052934 3300046524 Bacteria 2462
741 Ga0495663_0006886 3300046525 Bacteria 3137
742 Ga0495666_0109556 3300046526 Bacteria 1297
743 Ga0495652_0086551 3300046529 Bacteria 2572
744 Ga0495640_0001133 3300046533 Bacteria 20805
745 Ga0495640_0016311 3300046533 Bacteria 5560
746 Ga0495622_0010493 3300046557 Bacteria 4277
747 Ga0495633_0079759 3300046558 Bacteria 1524
748 Ga0495656_0021950 3300046615 Bacteria 2493
749 Ga0495668_0000604 3300046616 Bacteria 43491
750 Ga0495668_0175880 3300046616 Bacteria 1173
751 Ga0495634_0074015 3300046642 Bacteria 2239
752 Ga0495611_0097819 3300046648 Bacteria 1360
753 Ga0495625_0000792 3300046660 Bacteria 43853
754 Ga0495635_0036077 3300046663 Bacteria 3428
755 Ga0495635_0136485 3300046663 Bacteria 1672
756 Ga0495635_0220060 3300046663 Bacteria 1284
757 Ga0495635_0261225 3300046663 Bacteria 1166
758 Ga0495657_0036806 3300046675 Bacteria 3379
759 Ga0495658_0077576 3300046683 Bacteria 1943
760 Ga0495658_0088750 3300046683 Bacteria 1828
761 Ga0495658_0091824 3300046683 Bacteria 1799
762 Ga0495669_0141418 3300046684 Bacteria 1136
763 Ga0495613_0004782 3300046689 Bacteria 10159
764 Ga0495624_0040285 3300046690 Bacteria 2992
765 Ga0495670_0141729 3300046691 Bacteria 1257
766 Ga0495671_0061377 3300046692 Bacteria 1854
767 Ga0495589_0001508 3300046794 Bacteria 13394
768 Ga0495589_0009835 3300046794 Bacteria 4966
769 Ga0495589_0024143 3300046794 Bacteria 3090
770 Ga0495600_0012512 3300046809 Bacteria 5310
771 Ga0495600_0149263 3300046809 Bacteria 1514
772 Ga0495581_0030078 3300047315 Bacteria 3148
773 Ga0495581_0059591 3300047315 Bacteria 2206
774 Ga0495581_0194043 3300047315 Bacteria 1188
775 Ga0495604_0007446 3300047317 Bacteria 8669
776 Ga0495604_0075104 3300047317 Bacteria 2546
777 Ga0495636_0001722 3300047318 Bacteria 8352
778 Ga0495636_0076952 3300047318 Bacteria 1431
779 Ga0495672_0043736 3300047320 Bacteria 2691
780 Ga0495676_0005332 3300047321 Bacteria 11774
781 Ga0495676_0018843 3300047321 Bacteria 6083
782 Ga0495676_0022178 3300047321 Bacteria 5530
783 Ga0495676_0072178 3300047321 Bacteria 2651
784 Ga0495683_0005400 3300047323 Bacteria 7093
785 Ga0495683_0076247 3300047323 Bacteria 1641
786 Ga0495687_030404 3300047443 Bacteria 2486
787 Ga0495675_0040552 3300047444 Bacteria 2967
788 Ga0495685_039977 3300047447 Bacteria 1604
789 Ga0495684_0246944 3300047471 Bacteria 1300
790 Ga0495614_0106339 3300048089 Bacteria 1230
791 Ga0495615_0028435 3300048090 Bacteria 1320
792 Ga0495626_0000952 3300048091 Bacteria 25154
793 Ga0496100_0055893 3300048903 Bacteria 2580
794 Ga0496100_0340621 3300048903 Bacteria 1130
795 Ga0496100_0341397 3300048903 Bacteria 1129
796 Ga0496101_0017790 3300048904 Bacteria 4823
797 Ga0496101_0048577 3300048904 Bacteria 3050
798 Ga0496101_0137291 3300048904 Bacteria 1862
799 Ga0496101_0138648 3300048904 Bacteria 1852
800 Ga0496101_0344468 3300048904 Bacteria 1171
801 Ga0496102_0000023 3300048905 Bacteria 237015
802 Ga0496102_0001368 3300048905 Bacteria 21794
803 Ga0496102_0002562 3300048905 Bacteria 15491
804 Ga0496102_0032571 3300048905 Bacteria 4682
805 Ga0496102_0061256 3300048905 Bacteria 3443
806 Ga0496102_0068124 3300048905 Bacteria 3265
807 Ga0496102_0081406 3300048905 Bacteria 2985
808 Ga0496102_0182992 3300048905 Bacteria 1974
809 Ga0496102_0226982 3300048905 Bacteria 1761
810 Ga0496102_0416513 3300048905 Bacteria 1262
811 Ga0496103_0000039 3300048906 Bacteria 174284
812 Ga0496103_0001868 3300048906 Bacteria 13682
813 Ga0496103_0004297 3300048906 Bacteria 8659
814 Ga0496103_0009368 3300048906 Bacteria 5801
815 Ga0496103_0033995 3300048906 Bacteria 3117
816 Ga0496103_0036271 3300048906 Bacteria 3019
817 Ga0496103_0038978 3300048906 Bacteria 2919
818 Ga0496103_0047929 3300048906 Bacteria 2640
819 Ga0496104_0008950 3300048907 Bacteria 8899
820 Ga0496104_0012903 3300048907 Bacteria 7526
821 Ga0496104_0120380 3300048907 Bacteria 2520
822 Ga0496104_0124453 3300048907 Bacteria 2475
823 Ga0496104_0150178 3300048907 Bacteria 2237
824 Ga0496104_0364854 3300048907 Bacteria 1357
825 Ga0496105_0005192 3300048908 Bacteria 9865
826 Ga0496105_0020845 3300048908 Bacteria 5300
827 Ga0496105_0184620 3300048908 Bacteria 1707
828 Ga0496106_0003036 3300048909 Bacteria 12499
829 Ga0496106_0134727 3300048909 Bacteria 1939
830 Ga0496106_0188236 3300048909 Bacteria 1640
831 Ga0496106_0224619 3300048909 Bacteria 1498
832 Ga0496106_0287512 3300048909 Bacteria 1318
833 Ga0496106_0416808 3300048909 Bacteria 1079
834 Ga0496106_0511942 3300048909 Bacteria 964
835 Ga0496106_0522827 3300048909 Bacteria 953
836 Ga0496107_0023844 3300048910 Bacteria 4324
837 Ga0496107_0031829 3300048910 Bacteria 3766
838 Ga0496107_0267148 3300048910 Bacteria 1273
839 Ga0496108_0003317 3300048911 Bacteria 12930
840 Ga0496108_0021620 3300048911 Bacteria 5287
841 Ga0496108_0042046 3300048911 Bacteria 3814
842 Ga0496108_0048716 3300048911 Bacteria 3543
843 Ga0496108_0083144 3300048911 Bacteria 2715
844 Ga0496108_0091556 3300048911 Bacteria 2585
845 Ga0496108_0106822 3300048911 Bacteria 2390
846 Ga0496108_0108974 3300048911 Bacteria 2366
847 Ga0496108_0119741 3300048911 Bacteria 2257
848 Ga0496108_0207961 3300048911 Bacteria 1698
849 Ga0496108_0250630 3300048911 Bacteria 1540
850 Ga0496108_0483497 3300048911 Bacteria 1082
851 Ga0496109_0010252 3300048912 Bacteria 8002
852 Ga0496109_0051091 3300048912 Bacteria 3765
853 Ga0496109_0066613 3300048912 Bacteria 3298
854 Ga0496109_0068607 3300048912 Bacteria 3250
855 Ga0496109_0088402 3300048912 Bacteria 2863
856 Ga0496109_0109648 3300048912 Bacteria 2566
857 Ga0496109_0227915 3300048912 Bacteria 1752
858 Ga0496109_0253538 3300048912 Bacteria 1657
859 Ga0496109_0257698 3300048912 Bacteria 1643
860 Ga0496109_0473604 3300048912 Bacteria 1182
861 Ga0496110_0046594 3300048913 Bacteria 3793
862 Ga0496110_0050068 3300048913 Bacteria 3668
863 Ga0496110_0060539 3300048913 Bacteria 3339
864 Ga0496110_0073917 3300048913 Bacteria 3025
865 Ga0496110_0086854 3300048913 Bacteria 2793
866 Ga0496110_0100624 3300048913 Bacteria 2591
867 Ga0496110_0346753 3300048913 Bacteria 1353
868 Ga0496111_0001576 3300048914 Bacteria 13164
869 Ga0496111_0049098 3300048914 Bacteria 3042
870 Ga0496111_0197411 3300048914 Bacteria 1496
871 Ga0496111_0307361 3300048914 Bacteria 1175
872 Ga0496112_0033916 3300048915 Bacteria 4965
873 Ga0496112_0072241 3300048915 Bacteria 3410
874 Ga0496112_0075488 3300048915 Bacteria 3333
875 Ga0496112_0100661 3300048915 Bacteria 2859
876 Ga0496112_0121060 3300048915 Bacteria 2586
877 Ga0496112_0164462 3300048915 Bacteria 2185
878 Ga0496112_0443976 3300048915 Bacteria 1235
879 Ga0496112_0484289 3300048915 Bacteria 1173
880 Ga0496112_0601079 3300048915 Bacteria 1032
881 Ga0496112_0814788 3300048915 Bacteria 858
882 Ga0496113_0004733 3300048916 Bacteria 8402
883 Ga0496113_0010367 3300048916 Bacteria 6158
884 Ga0496113_0081210 3300048916 Bacteria 2484
885 Ga0496113_0232954 3300048916 Bacteria 1469
886 Ga0496113_0375935 3300048916 Bacteria 1140
887 Ga0496114_0005510 3300048917 Bacteria 9912
888 Ga0496114_0012430 3300048917 Bacteria 6814
889 Ga0496114_0029996 3300048917 Bacteria 4472
890 Ga0496114_0034065 3300048917 Bacteria 4199
891 Ga0496114_0055012 3300048917 Bacteria 3318
892 Ga0496114_0062102 3300048917 Bacteria 3126
893 Ga0496114_0083393 3300048917 Bacteria 2704
894 Ga0496114_0251456 3300048917 Bacteria 1555
895 Ga0496114_0260371 3300048917 Bacteria 1527
896 Ga0496114_0339342 3300048917 Bacteria 1328
897 Ga0496114_0485339 3300048917 Bacteria 1093
898 Ga0496115_0110709 3300048918 Bacteria 2256
899 Ga0496115_0127160 3300048918 Bacteria 2100
900 Ga0496115_0178725 3300048918 Bacteria 1755
901 Ga0496118_0026452 3300048921 Bacteria 4943
902 Ga0496119_0057580 3300048922 Bacteria 2348
903 Ga0496121_0188261 3300048924 Bacteria 1482
904 Ga0496122_0110882 3300048925 Bacteria 1801
905 Ga0496123_0016240 3300048926 Bacteria 6057
906 Ga0496125_0062951 3300048928 Bacteria 2961
907 Ga0496126_0000039 3300048929 Bacteria 347353
908 Ga0496126_0013779 3300048929 Bacteria 8199
909 Ga0496126_0125254 3300048929 Bacteria 2225
910 Ga0501031_0007062 3300049568 Bacteria 7328
911 Ga0501031_0059908 3300049568 Bacteria 2481
912 Ga0501031_0096478 3300049568 Bacteria 1930
913 Ga0501031_0121655 3300049568 Bacteria 1705
914 Ga0501031_0173507 3300049568 Bacteria 1409
915 Ga0501031_0206669 3300049568 Bacteria 1280
916 Ga0501032_0011546 3300049569 Bacteria 6341
917 Ga0501032_0029706 3300049569 Bacteria 3749
918 Ga0501032_0081624 3300049569 Bacteria 2151
919 Ga0501033_0003015 3300049570 Bacteria 14051
920 Ga0501033_0003043 3300049570 Bacteria 13944
921 Ga0501033_0043093 3300049570 Bacteria 3362
922 Ga0501034_0247525 3300049571 Bacteria 1727
923 Ga0501034_0350419 3300049571 Bacteria 1405
924 Ga0501034_0379743 3300049571 Bacteria 1338
925 Ga0501034_0616361 3300049571 Bacteria 989
926 Ga0501036_0007516 3300049572 Bacteria 8891
927 Ga0501036_0068378 3300049572 Bacteria 3006
928 Ga0501036_0098243 3300049572 Bacteria 2475
929 Ga0501036_0253072 3300049572 Bacteria 1476
930 Ga0501036_0257405 3300049572 Bacteria 1462
931 Ga0501036_0301608 3300049572 Bacteria 1340
932 Ga0501036_0320430 3300049572 Bacteria 1295
933 Ga0501037_0016485 3300049573 Bacteria 5439
934 Ga0501037_0062611 3300049573 Bacteria 2712
935 Ga0501037_0102218 3300049573 Bacteria 2067
936 Ga0501037_0151515 3300049573 Bacteria 1657
937 Ga0501037_0152198 3300049573 Bacteria 1653
938 Ga0501038_0008275 3300049574 Bacteria 9573
939 Ga0501038_0017909 3300049574 Bacteria 6400
940 Ga0501038_0020357 3300049574 Bacteria 5965
941 Ga0501038_0172101 3300049574 Bacteria 1752
942 Ga0501038_0192306 3300049574 Bacteria 1641
943 Ga0501039_0007597 3300049575 Bacteria 8280
944 Ga0501039_0013152 3300049575 Bacteria 6325
945 Ga0501039_0061912 3300049575 Bacteria 2899
946 Ga0501039_0072691 3300049575 Bacteria 2672
947 Ga0501039_0224569 3300049575 Bacteria 1476
948 Ga0501040_0010206 3300049576 Bacteria 6141
949 Ga0501040_0021687 3300049576 Bacteria 4293
950 Ga0501040_0041849 3300049576 Bacteria 3121
951 Ga0501040_0195198 3300049576 Bacteria 1437
952 Ga0501040_0240290 3300049576 Bacteria 1291
953 Ga0501041_0224322 3300049577 Bacteria 1179
954 Ga0501042_0092943 3300049578 Bacteria 2166
955 Ga0501042_0162335 3300049578 Bacteria 1612
956 Ga0501042_0471291 3300049578 Bacteria 911
957 Ga0501043_0015765 3300049579 Bacteria 5925
958 Ga0501043_0135203 3300049579 Bacteria 1931
959 Ga0501043_0163041 3300049579 Bacteria 1741
960 Ga0501043_0324584 3300049579 Bacteria 1173
961 Ga0501046_0008758 3300049580 Bacteria 8791
962 Ga0501046_0021851 3300049580 Bacteria 5275
963 Ga0501046_0055366 3300049580 Bacteria 3117
964 Ga0501046_0065124 3300049580 Bacteria 2844
965 Ga0501046_0327536 3300049580 Bacteria 1115
966 Ga0501046_0471217 3300049580 Bacteria 902
967 Ga0501047_0000811 3300049581 Bacteria 32563
968 Ga0501047_0029534 3300049581 Bacteria 5285
969 Ga0501047_0124206 3300049581 Bacteria 2461
970 Ga0501047_0135348 3300049581 Bacteria 2344
971 Ga0501048_0000630 3300049582 Bacteria 25188
972 Ga0501048_0005904 3300049582 Bacteria 9323
973 Ga0501048_0010990 3300049582 Bacteria 6754
974 Ga0501048_0011892 3300049582 Bacteria 6491
975 Ga0501048_0176851 3300049582 Bacteria 1512
976 Ga0501048_0227008 3300049582 Bacteria 1325
977 Ga0501048_0433439 3300049582 Bacteria 941
978 Ga0501067_0001090 3300049583 Bacteria 14631
979 Ga0501067_0001788 3300049583 Bacteria 11805
980 Ga0501067_0021546 3300049583 Bacteria 3567
981 Ga0501067_0023273 3300049583 Bacteria 3433
982 Ga0501067_0052242 3300049583 Bacteria 2264
983 Ga0501067_0072042 3300049583 Bacteria 1914
984 Ga0501067_0086619 3300049583 Bacteria 1738
985 Ga0501067_0216241 3300049583 Bacteria 1067
986 Ga0501068_0017891 3300049584 Bacteria 4103
987 Ga0501069_0000908 3300049585 Bacteria 14128
988 Ga0501069_0050958 3300049585 Bacteria 2303
989 Ga0501069_0051122 3300049585 Bacteria 2300
990 Ga0501069_0085329 3300049585 Bacteria 1782
991 Ga0501069_0090818 3300049585 Bacteria 1727
992 Ga0501069_0092661 3300049585 Bacteria 1709
993 Ga0501069_0117268 3300049585 Bacteria 1519
994 Ga0501069_0138918 3300049585 Bacteria 1393
995 Ga0501070_0000918 3300049586 Bacteria 26690
996 Ga0501070_0012605 3300049586 Bacteria 7131
997 Ga0501070_0013510 3300049586 Bacteria 6883
998 Ga0501070_0028176 3300049586 Bacteria 4710
999 Ga0501070_0043160 3300049586 Bacteria 3753
1000 Ga0501070_0077743 3300049586 Bacteria 2746
1001 Ga0501070_0079337 3300049586 Bacteria 2716
1002 Ga0501070_0091700 3300049586 Bacteria 2514
1003 Ga0501070_0105535 3300049586 Bacteria 2329
1004 Ga0501070_0244859 3300049586 Bacteria 1467
1005 Ga0501070_0346104 3300049586 Bacteria 1207
1006 Ga0501071_0015549 3300049587 Bacteria 5225
1007 Ga0501071_0123760 3300049587 Bacteria 1918
1008 Ga0501071_0196861 3300049587 Bacteria 1513
1009 Ga0501072_0011905 3300049588 Bacteria 6643
1010 Ga0501072_0012575 3300049588 Bacteria 6470
1011 Ga0501072_0052300 3300049588 Bacteria 3216
1012 Ga0501072_0069844 3300049588 Bacteria 2773
1013 Ga0501072_0205407 3300049588 Bacteria 1570
1014 Ga0501072_0327189 3300049588 Bacteria 1218
1015 Ga0501073_0004454 3300049589 Bacteria 10522
1016 Ga0501073_0008076 3300049589 Bacteria 7808
1017 Ga0501073_0009952 3300049589 Bacteria 6996
1018 Ga0501073_0023714 3300049589 Bacteria 4405
1019 Ga0501073_0238230 3300049589 Bacteria 1257
1020 Ga0501073_0238320 3300049589 Bacteria 1256
1021 Ga0501074_0007714 3300049590 Bacteria 7795
1022 Ga0501074_0013689 3300049590 Bacteria 5896
1023 Ga0501074_0039356 3300049590 Bacteria 3425
1024 Ga0501074_0063442 3300049590 Bacteria 2661
1025 Ga0501074_0192584 3300049590 Bacteria 1454
1026 Ga0501074_0365917 3300049590 Bacteria 1023
1027 Ga0501075_0012487 3300049591 Bacteria 6038
1028 Ga0501075_0455947 3300049591 Bacteria 975
1029 Ga0501076_0003371 3300049592 Bacteria 11214
1030 Ga0501079_0000248 3300049741 Bacteria 32709
1031 Ga0501079_0043902 3300049741 Bacteria 3450
1032 Ga0501079_0114655 3300049741 Bacteria 2095
1033 Ga0501079_0235299 3300049741 Bacteria 1431
1034 Ga0501080_0002288 3300049742 Bacteria 16681
1035 Ga0501080_0003333 3300049742 Bacteria 14175
1036 Ga0501080_0004763 3300049742 Bacteria 12103
1037 Ga0501080_0005815 3300049742 Bacteria 11039
1038 Ga0501080_0093870 3300049742 Bacteria 2786
1039 Ga0501080_0123452 3300049742 Bacteria 2399
1040 Ga0501080_0136975 3300049742 Bacteria 2265
1041 Ga0501080_0241389 3300049742 Bacteria 1649
1042 Ga0501080_0537742 3300049742 Bacteria 1042
1043 Ga0501081_0027841 3300049743 Bacteria 3811
1044 Ga0501081_0062297 3300049743 Bacteria 2587
1045 Ga0501081_0170987 3300049743 Bacteria 1569
1046 Ga0501081_0334957 3300049743 Bacteria 1114
1047 Ga0501083_0023410 3300049744 Bacteria 4284
1048 Ga0501035_0022469 3300049822 Bacteria 5793
1049 Ga0501035_0037792 3300049822 Bacteria 4370
1050 Ga0501035_0195124 3300049822 Bacteria 1739
1051 Ga0501035_0562550 3300049822 Bacteria 933
1052 Ga0501044_0008214 3300049823 Bacteria 11453
1053 Ga0501044_0042726 3300049823 Bacteria 4713
1054 Ga0501044_0084993 3300049823 Bacteria 3197
1055 Ga0501044_0181422 3300049823 Bacteria 2072
1056 Ga0501044_0216688 3300049823 Bacteria 1866
1057 Ga0501044_0555366 3300049823 Bacteria 1045
1058 Ga0501045_0009297 3300049824 Bacteria 6876
1059 Ga0501045_0025826 3300049824 Bacteria 4223
1060 Ga0501045_0340758 3300049824 Bacteria 1116
1061 nmdc:mga03n38_1705_c1 3300050490 Bacteria 6472
1062 nmdc:mga03n38_27789_c1 3300050490 Bacteria 2351
1063 nmdc:mga03n38_28983_c1 3300050490 Bacteria 2312
1064 nmdc:mga03n38_43035_c1 3300050490 Bacteria 1977
1065 nmdc:mga03n38_48645_c1 3300050490 Bacteria 1882
1066 nmdc:mga03n38_92968_c1 3300050490 Bacteria 1440
1067 nmdc:mga00v17_10300_c1 3300050491 Bacteria 5099
1068 nmdc:mga00v17_127094_c1 3300050491 Bacteria 1627
1069 nmdc:mga00v17_21847_c1 3300050491 Bacteria 3685
1070 nmdc:mga00v17_22538_c1 3300050491 Bacteria 3634
1071 nmdc:mga00v17_25580_c1 3300050491 Bacteria 3432
1072 nmdc:mga00v17_290421_c1 3300050491 Bacteria 1062
1073 nmdc:mga0yw44_14826_c1 3300050492 Bacteria 4153
1074 nmdc:mga0yw44_165911_c1 3300050492 Bacteria 1448
1075 nmdc:mga0yw44_168869_c1 3300050492 Bacteria 1436
1076 nmdc:mga0yw44_2006_c2 3300050492 Bacteria 2327
1077 nmdc:mga0yw44_210968_c1 3300050492 Bacteria 1285
1078 nmdc:mga0yw44_245025_c1 3300050492 Bacteria 1192
1079 nmdc:mga0yw44_347721_c1 3300050492 Bacteria 998
1080 nmdc:mga0yw44_46667_c1 3300050492 Bacteria 2603
1081 nmdc:mga0yw44_69008_c1 3300050492 Bacteria 2188
1082 nmdc:mga06z11_21169_c1 3300050494 Bacteria 3018
1083 nmdc:mga06z11_3351_c1 3300050494 Bacteria 6201
1084 nmdc:mga06z11_39132_c1 3300050494 Bacteria 2358
1085 nmdc:mga06z11_51099_c1 3300050494 Bacteria 2115
1086 nmdc:mga04h51_105079_c1 3300050495 Bacteria 1034
1087 nmdc:mga04h51_13608_c1 3300050495 Bacteria 2307
1088 nmdc:mga04h51_43591_c1 3300050495 Bacteria 1476
1089 nmdc:mga04h51_77092_c1 3300050495 Bacteria 1176
1090 nmdc:mga07m45_12979_c1 3300050496 Bacteria 4407
1091 nmdc:mga07m45_36850_c1 3300050496 Bacteria 2726
1092 nmdc:mga07m45_49355_c1 3300050496 Bacteria 1433
1093 nmdc:mga07m45_9308_c1 3300050496 Bacteria 5090
1094 nmdc:mga05p37_12762_c1 3300050507 Bacteria 10043
1095 nmdc:mga05p37_16805_c1 3300050507 Bacteria 8821
1096 nmdc:mga05p37_18567_c1 3300050507 Bacteria 8404
1097 nmdc:mga05p37_252281_c1 3300050507 Bacteria 2116
1098 nmdc:mga05p37_316495_c1 3300050507 Bacteria 1848
1099 nmdc:mga05p37_64330_c1 3300050507 Bacteria 4514
1100 nmdc:mga09592_25228_c1 3300050508 Bacteria 4919
1101 nmdc:mga09592_8873_c1 3300050508 Bacteria 8177
1102 nmdc:mga0qj67_39873_c1 3300050509 Bacteria 3690
1103 nmdc:mga0qj67_5949_c1 3300050509 Bacteria 8939
1104 nmdc:mga06r32_136_c5 3300050510 Bacteria 10167
1105 nmdc:mga06r32_148141_c1 3300050510 Bacteria 2325
1106 nmdc:mga06r32_15394_c1 3300050510 Bacteria 6946
1107 nmdc:mga06r32_162200_c1 3300050510 Bacteria 2218
1108 nmdc:mga06r32_2767_c1 3300050510 Bacteria 15692
1109 nmdc:mga06r32_283515_c1 3300050510 Bacteria 1643
1110 nmdc:mga06r32_376_c1 3300050510 Bacteria 37709
1111 nmdc:mga08y16_141283_c1 3300050511 Bacteria 2503
1112 nmdc:mga08y16_15681_c1 3300050511 Bacteria 7969
1113 nmdc:mga0a205_46570_c1 3300050515 Bacteria 4182
1114 Ga0495601_0159668 3300053077 Bacteria 1473
1115 Ga0495595_0195748 3300053084 Bacteria 1005
1116 Ga0495619_0008085 3300053085 Bacteria 6657
1117 Ga0495619_0018583 3300053085 Bacteria 4411
1118 Ga0495619_0157710 3300053085 Bacteria 1566
1119 Ga0495619_0157887 3300053085 Bacteria 1566
1120 Ga0495619_0190927 3300053085 Bacteria 1418
1121 Ga0495619_0258318 3300053085 Bacteria 1207
1122 Ga0500644_0000003 3300053088 Bacteria 199121
1123 Ga0500644_0018585 3300053088 Bacteria 2039
1124 Ga0500646_0001695 3300053090 Bacteria 5820
1125 Ga0500583_0011164 3300053092 Bacteria 3374
1126 Ga0500641_0017688 3300053096 Bacteria 2671
1127 Ga0500554_037542 3300053102 Bacteria 1469
1128 Ga0500556_0001669 3300053104 Bacteria 8612
1129 Ga0500593_000037 3300053117 Bacteria 47188
1130 Ga0500588_0001575 3300053146 Bacteria 4393
1131 Ga0501084_0069521 3300054114 Bacteria 2948
1132 Ga0501084_0158378 3300054114 Bacteria 1910
1133 Ga0501084_0186516 3300054114 Bacteria 1750
1134 Ga0590071_018147 3300059421 Bacteria 1655
1135 Ga0590074_027277 3300059423 Bacteria 1000
1136 Ga0590077_036674 3300059426 Bacteria 1082
1137 Ga0501082_0006546 3300060353 Bacteria 10094
1138 Ga0501082_0028741 3300060353 Bacteria 4789
1139 Ga0501082_0342946 3300060353 Bacteria 1302
1140 Ga0501082_0406966 3300060353 Bacteria 1187
1141 Ga0466962_0002130 3300061719 Bacteria 9349
1142 Ga0466962_0015122 3300061719 Bacteria 3721
1143 Ga0466962_0015415 3300061719 Bacteria 3685
1144 Ga0466962_0034921 3300061719 Bacteria 2407
1145 Ga0466962_0058568 3300061719 Bacteria 1838
1146 Ga0466962_0122656 3300061719 Bacteria 1254
1147 Ga0530510_0004800 3300061734 Bacteria 9359
1148 Ga0530510_0108006 3300061734 Bacteria 2037
1149 Ga0530510_0121314 3300061734 Bacteria 1919

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031251 Ga0265327_10000004 Ga0265327_10000004503 229
2 3300041512 Ga0451853_0891367 Ga0451853_0891367_1059_1907 229
3 3300048911 Ga0496108_0048716 Ga0496108_0048716_557_1429 240
4 3300048928 Ga0496125_0062951 Ga0496125_0062951_1268_2140 240
5 3300047323 Ga0495683_0005400 Ga0495683_0005400_2754_3605 241
6 3300044658 Ga0466972_0003523 Ga0466972_0003523_2107_2940 242
7 3300044683 Ga0466965_0001050 Ga0466965_0001050_7148_7981 242
8 3300044684 Ga0466966_0004977 Ga0466966_0004977_6723_7556 242
9 3300044693 Ga0466961_0008731 Ga0466961_0008731_5243_6076 242
10 3300044694 Ga0466963_0002192 Ga0466963_0002192_9730_10563 242
11 3300044706 Ga0466964_0002321 Ga0466964_0002321_3950_4783 242
12 3300044719 Ga0466971_0000174 Ga0466971_0000174_15872_16705 242
13 3300044765 Ga0466970_0029621 Ga0466970_0029621_1664_2497 242
14 3300044842 Ga0466957_0000556 Ga0466957_0000556_15883_16716 242
15 3300045049 Ga0466959_0001149 Ga0466959_0001149_8795_9628 242
16 3300045836 Ga0466958_0000298 Ga0466958_0000298_10619_11452 242
17 3300061719 Ga0466962_0034921 Ga0466962_0034921_1178_2011 242
18 3300001989 JGI24739J22299_10007160 JGI24739J22299_100071604 243
19 3300001990 JGI24737J22298_10008355 JGI24737J22298_100083552 243
20 3300005563 Ga0068855_100456955 Ga0068855_1004569552 243
21 3300011119 Ga0105246_10084460 Ga0105246_100844602 243
22 3300026116 Ga0207674_10084881 Ga0207674_100848813 243
23 3300049823 Ga0501044_0555366 Ga0501044_0555366_287_1021 244
24 3300050490 nmdc:mga03n38_28983_c1 nmdc:mga03n38_28983_c1_1009_1815 244
25 3300061734 Ga0530510_0108006 Ga0530510_0108006_382_1188 244
26 3300021388 Ga0213875_10011930 Ga0213875_100119303 246
27 3300045976 Ga0466967_1158180 Ga0466967_1158180_11_754 247
28 3300048908 Ga0496105_0020845 Ga0496105_0020845_4519_5283 247
29 3300005618 Ga0068864_100304872 Ga0068864_1003048721 249
30 3300026095 Ga0207676_10471435 Ga0207676_104714352 249
31 3300006048 Ga0075363_100055576 Ga0075363_1000555763 250
32 3300045976 Ga0466967_0123345 Ga0466967_0123345_1425_2297 250
33 3300050496 nmdc:mga07m45_49355_c1 nmdc:mga07m45_49355_c1_492_1346 250
34 3300005985 Ga0081539_10164438 Ga0081539_101644381 251
35 3300037466 Ga0395898_0279201 Ga0395898_0279201_437_1252 251
36 3300048090 Ga0495615_0028435 Ga0495615_0028435_399_1199 252
37 3300049586 Ga0501070_0000918 Ga0501070_0000918_19163_20035 252
38 3300046533 Ga0495640_0001133 Ga0495640_0001133_12227_13090 253
39 3300046642 Ga0495634_0074015 Ga0495634_0074015_860_1723 253
40 3300046675 Ga0495657_0036806 Ga0495657_0036806_2155_3018 253
41 3300046689 Ga0495613_0004782 Ga0495613_0004782_526_1389 253
42 3300046690 Ga0495624_0040285 Ga0495624_0040285_1713_2576 253
43 3300046809 Ga0495600_0012512 Ga0495600_0012512_3273_4136 253
44 3300047315 Ga0495581_0059591 Ga0495581_0059591_885_1748 253
45 3300047317 Ga0495604_0007446 Ga0495604_0007446_2055_2918 253
46 3300047321 Ga0495676_0005332 Ga0495676_0005332_6037_6900 253
47 3300044684 Ga0466966_0232447 Ga0466966_0232447_327_1091 254
48 3300044684 Ga0466966_0367606 Ga0466966_0367606_59_823 254
49 3300044765 Ga0466970_0043731 Ga0466970_0043731_1318_2082 254
50 3300048907 Ga0496104_0012903 Ga0496104_0012903_4248_5033 254
51 3300048911 Ga0496108_0042046 Ga0496108_0042046_2920_3705 254
52 3300048915 Ga0496112_0033916 Ga0496112_0033916_3528_4313 254
53 3300049570 Ga0501033_0003043 Ga0501033_0003043_10110_10934 254
54 3300050491 nmdc:mga00v17_10300_c1 nmdc:mga00v17_10300_c1_2319_3146 254
55 3300053085 Ga0495619_0258318 Ga0495619_0258318_12_776 254
56 3300041404 Ga0439436_0017044 Ga0439436_0017044_155_958 255
57 3300041406 Ga0439439_0002785 Ga0439439_0002785_251_1054 255
58 3300041999 Ga0439433_0001969 Ga0439433_0001969_3086_3889 255
59 3300042002 Ga0439442_011637 Ga0439442_011637_903_1706 255
60 3300042014 Ga0439457_000320 Ga0439457_000320_9022_9825 255
61 3300044658 Ga0466972_0017930 Ga0466972_0017930_1195_2010 255
62 3300044683 Ga0466965_0027816 Ga0466965_0027816_134_949 255
63 3300044693 Ga0466961_0013140 Ga0466961_0013140_2814_3629 255
64 3300046526 Ga0495666_0109556 Ga0495666_0109556_53_856 255
65 3300047315 Ga0495581_0030078 Ga0495581_0030078_458_1261 255
66 3300047321 Ga0495676_0072178 Ga0495676_0072178_62_865 255
67 3300013308 Ga0157375_10826900 Ga0157375_108269002 256
68 3300037418 Ga0395900_0134671 Ga0395900_0134671_1024_1839 256
69 3300037466 Ga0395898_0017331 Ga0395898_0017331_4423_5238 256
70 3300025904 Ga0207647_10007225 Ga0207647_100072257 257
71 3300031838 Ga0307518_10217230 Ga0307518_102172302 257
72 3300046794 Ga0495589_0001508 Ga0495589_0001508_10712_11515 257
73 3300047318 Ga0495636_0001722 Ga0495636_0001722_1837_2664 257
74 3300047443 Ga0495687_030404 Ga0495687_030404_438_1265 257
75 iso_pu_bacteria 2547132424 2548692818 257
76 iso_pu_bacteria 2551306166 2552105448 257
77 3300005577 Ga0068857_100064538 Ga0068857_1000645384 258
78 3300006038 Ga0075365_10295411 Ga0075365_102954112 258
79 3300006038 Ga0075365_10299308 Ga0075365_102993082 258
80 3300006353 Ga0075370_10051729 Ga0075370_100517292 258
81 3300042005 Ga0439448_0030794 Ga0439448_0030794_380_1183 258
82 3300046455 Ga0495603_0085514 Ga0495603_0085514_903_1706 258
83 3300047321 Ga0495676_0018843 Ga0495676_0018843_3634_4437 258
84 3300050492 nmdc:mga0yw44_347721_c1 nmdc:mga0yw44_347721_c1_126_965 258
85 3300050507 nmdc:mga05p37_316495_c1 nmdc:mga05p37_316495_c1_816_1592 258
86 iso_pu_bacteria 8057568493 8057570144 258
87 3300006042 Ga0075368_10011471 Ga0075368_100114713 259
88 3300006051 Ga0075364_10116985 Ga0075364_101169852 259
89 3300031995 Ga0307409_100162542 Ga0307409_1001625422 259
90 3300032126 Ga0307415_100373509 Ga0307415_1003735092 259
91 3300049585 Ga0501069_0085329 Ga0501069_0085329_903_1733 259
92 3300050491 nmdc:mga00v17_21847_c1 nmdc:mga00v17_21847_c1_2571_3398 259
93 3300001979 JGI24740J21852_10011168 JGI24740J21852_100111682 260
94 3300001989 JGI24739J22299_10000895 JGI24739J22299_100008959 260
95 3300001990 JGI24737J22298_10002596 JGI24737J22298_100025965 260
96 3300002067 JGI24735J21928_10018306 JGI24735J21928_100183062 260
97 3300005367 Ga0070667_100149673 Ga0070667_1001496731 260
98 3300005618 Ga0068864_100050411 Ga0068864_1000504114 260
99 3300005841 Ga0068863_100025724 Ga0068863_1000257246 260
100 3300005842 Ga0068858_100155962 Ga0068858_1001559622 260
101 3300006038 Ga0075365_10028608 Ga0075365_100286082 260
102 3300006844 Ga0075428_100118616 Ga0075428_1001186163 260
103 3300006846 Ga0075430_100116731 Ga0075430_1001167312 260
104 3300006847 Ga0075431_100011587 Ga0075431_1000115876 260
105 3300006880 Ga0075429_100020719 Ga0075429_1000207193 260
106 3300009147 Ga0114129_10006635 Ga0114129_1000663511 260
107 3300009177 Ga0105248_10059801 Ga0105248_100598011 260
108 3300013307 Ga0157372_10144137 Ga0157372_101441372 260
109 3300014325 Ga0163163_10010605 Ga0163163_100106055 260
110 3300025901 Ga0207688_10259035 Ga0207688_102590352 260
111 3300025945 Ga0207679_10189434 Ga0207679_101894342 260
112 3300025986 Ga0207658_10183621 Ga0207658_101836212 260
113 3300026035 Ga0207703_10057661 Ga0207703_100576612 260
114 3300026088 Ga0207641_10073804 Ga0207641_100738043 260
115 3300026088 Ga0207641_10591313 Ga0207641_105913132 260
116 3300026095 Ga0207676_10294371 Ga0207676_102943712 260
117 3300026116 Ga0207674_10148082 Ga0207674_101480822 260
118 3300026121 Ga0207683_10215134 Ga0207683_102151342 260
119 3300027866 Ga0209813_10089925 Ga0209813_100899251 260
120 3300045976 Ga0466967_0004013 Ga0466967_0004013_18_833 260
121 3300048913 Ga0496110_0046594 Ga0496110_0046594_122_925 260
122 3300048916 Ga0496113_0010367 Ga0496113_0010367_4685_5488 260
123 3300050507 nmdc:mga05p37_16805_c1 nmdc:mga05p37_16805_c1_6795_7625 260
124 iso_pu_bacteria 2861520306 2861525620 260
125 3300005367 Ga0070667_100016409 Ga0070667_1000164091 261
126 3300005614 Ga0068856_100300399 Ga0068856_1003003992 261
127 3300006048 Ga0075363_100056566 Ga0075363_1000565662 261
128 3300006178 Ga0075367_10095824 Ga0075367_100958242 261
129 3300025940 Ga0207691_10263052 Ga0207691_102630521 261
130 3300025981 Ga0207640_10420905 Ga0207640_104209052 261
131 3300025986 Ga0207658_10011134 Ga0207658_100111342 261
132 3300041494 Ga0451837_0174851 Ga0451837_0174851_16_801 261
133 3300046453 Ga0495627_043882 Ga0495627_043882_299_1117 261
134 3300047315 Ga0495581_0194043 Ga0495581_0194043_315_1133 261
135 3300048929 Ga0496126_0013779 Ga0496126_0013779_3956_4804 261
136 3300053085 Ga0495619_0157887 Ga0495619_0157887_504_1343 261
137 iso_pu_bacteria 2887478801 2887484187 261
138 iso_pu_bacteria 8001781756 8001786498 261
139 3300003203 JGI25406J46586_10010242 JGI25406J46586_100102425 262
140 3300005719 Ga0068861_100015848 Ga0068861_1000158482 262
141 3300005843 Ga0068860_100002320 Ga0068860_10000232019 262
142 3300005843 Ga0068860_100003522 Ga0068860_1000035228 262
143 3300005985 Ga0081539_10000448 Ga0081539_1000044864 262
144 3300006038 Ga0075365_10087427 Ga0075365_100874272 262
145 3300006038 Ga0075365_10286819 Ga0075365_102868192 262
146 3300006051 Ga0075364_10045224 Ga0075364_100452243 262
147 3300006178 Ga0075367_10058334 Ga0075367_100583342 262
148 3300006846 Ga0075430_100487729 Ga0075430_1004877291 262
149 3300025986 Ga0207658_10006035 Ga0207658_100060356 262
150 3300026075 Ga0207708_10047138 Ga0207708_100471383 262
151 3300026118 Ga0207675_100248083 Ga0207675_1002480832 262
152 3300028381 Ga0268264_10000417 Ga0268264_100004174 262
153 3300028381 Ga0268264_10000437 Ga0268264_1000043751 262
154 3300031456 Ga0307513_10003949 Ga0307513_1000394920 262
155 3300031852 Ga0307410_10100192 Ga0307410_101001922 262
156 3300031995 Ga0307409_100060594 Ga0307409_1000605943 262
157 3300032004 Ga0307414_10295860 Ga0307414_102958602 262
158 3300032126 Ga0307415_100013553 Ga0307415_1000135535 262
159 3300032126 Ga0307415_100071461 Ga0307415_1000714612 262
160 3300032126 Ga0307415_100422545 Ga0307415_1004225452 262
161 3300038443 Ga0395901_0138427 Ga0395901_0138427_1364_2203 262
162 3300044901 Ga0466960_0001800 Ga0466960_0001800_2469_3308 262
163 3300045976 Ga0466967_0355714 Ga0466967_0355714_404_1243 262
164 3300046515 Ga0495620_0084842 Ga0495620_0084842_274_1113 262
165 3300049568 Ga0501031_0096478 Ga0501031_0096478_863_1702 262
166 3300049583 Ga0501067_0072042 Ga0501067_0072042_40_879 262
167 3300050490 nmdc:mga03n38_48645_c1 nmdc:mga03n38_48645_c1_979_1833 262
168 3300050492 nmdc:mga0yw44_165911_c1 nmdc:mga0yw44_165911_c1_433_1260 262
169 3300050492 nmdc:mga0yw44_168869_c1 nmdc:mga0yw44_168869_c1_412_1251 262
170 3300050492 nmdc:mga0yw44_210968_c1 nmdc:mga0yw44_210968_c1_399_1226 262
171 3300050494 nmdc:mga06z11_39132_c1 nmdc:mga06z11_39132_c1_1052_1906 262
172 3300005327 Ga0070658_10025618 Ga0070658_100256185 263
173 3300005336 Ga0070680_100301242 Ga0070680_1003012422 263
174 3300005337 Ga0070682_100025445 Ga0070682_1000254453 263
175 3300005366 Ga0070659_100103332 Ga0070659_1001033322 263
176 3300005435 Ga0070714_100119293 Ga0070714_1001192933 263
177 3300005435 Ga0070714_100371222 Ga0070714_1003712222 263
178 3300005458 Ga0070681_10027056 Ga0070681_100270562 263
179 3300005530 Ga0070679_100725761 Ga0070679_1007257611 263
180 3300005535 Ga0070684_100060427 Ga0070684_1000604271 263
181 3300005563 Ga0068855_100138868 Ga0068855_1001388683 263
182 3300005564 Ga0070664_100034185 Ga0070664_1000341852 263
183 3300005577 Ga0068857_100067729 Ga0068857_1000677292 263
184 3300005614 Ga0068856_100116087 Ga0068856_1001160871 263
185 3300005618 Ga0068864_100021895 Ga0068864_1000218955 263
186 3300005841 Ga0068863_100008460 Ga0068863_1000084606 263
187 3300006048 Ga0075363_100111933 Ga0075363_1001119332 263
188 3300006847 Ga0075431_100114651 Ga0075431_1001146513 263
189 3300009177 Ga0105248_10022716 Ga0105248_100227167 263
190 3300010375 Ga0105239_10087352 Ga0105239_100873523 263
191 3300013105 Ga0157369_10017434 Ga0157369_100174347 263
192 3300013307 Ga0157372_10177196 Ga0157372_101771962 263
193 3300014968 Ga0157379_10053286 Ga0157379_100532862 263
194 3300014968 Ga0157379_10183386 Ga0157379_101833862 263
195 3300020070 Ga0206356_10758618 Ga0206356_107586182 263
196 3300020075 Ga0206349_1219296 Ga0206349_12192962 263
197 3300020080 Ga0206350_11539497 Ga0206350_115394972 263
198 3300022467 Ga0224712_10039299 Ga0224712_100392992 263
199 3300025909 Ga0207705_10063669 Ga0207705_100636693 263
200 3300025912 Ga0207707_10011997 Ga0207707_100119972 263
201 3300025914 Ga0207671_10373166 Ga0207671_103731661 263
202 3300025921 Ga0207652_10011178 Ga0207652_100111782 263
203 3300025929 Ga0207664_10191302 Ga0207664_101913022 263
204 3300025941 Ga0207711_10014894 Ga0207711_100148947 263
205 3300025944 Ga0207661_10052202 Ga0207661_100522023 263
206 3300025949 Ga0207667_10082723 Ga0207667_100827232 263
207 3300026095 Ga0207676_10008982 Ga0207676_100089828 263
208 3300026116 Ga0207674_10267712 Ga0207674_102677122 263
209 3300047447 Ga0495685_039977 Ga0495685_039977_561_1394 263
210 3300048907 Ga0496104_0124453 Ga0496104_0124453_1611_2402 263
211 3300048911 Ga0496108_0003317 Ga0496108_0003317_8219_9010 263
212 3300048912 Ga0496109_0010252 Ga0496109_0010252_5167_5958 263
213 3300048915 Ga0496112_0121060 Ga0496112_0121060_1496_2287 263
214 3300048916 Ga0496113_0004733 Ga0496113_0004733_4495_5286 263
215 3300048916 Ga0496113_0232954 Ga0496113_0232954_511_1302 263
216 3300049581 Ga0501047_0124206 Ga0501047_0124206_528_1319 263
217 3300049822 Ga0501035_0562550 Ga0501035_0562550_117_923 263
218 3300050510 nmdc:mga06r32_162200_c1 nmdc:mga06r32_162200_c1_364_1155 263
219 3300050510 nmdc:mga06r32_283515_c1 nmdc:mga06r32_283515_c1_386_1177 263
220 3300053085 Ga0495619_0018583 Ga0495619_0018583_114_905 263
221 iso_pu_bacteria 2616644814 2616694475 263
222 iso_pu_bacteria 2622736626 2623589100 263
223 iso_pu_bacteria 2643221647 2644268583 263
224 iso_pu_bacteria 2643221697 2644536664 263
225 iso_pu_bacteria 2808606375 2808916272 263
226 iso_pu_bacteria 2808606982 2811843657 263
227 iso_pu_bacteria 2852635781 2852640652 263
228 iso_pu_bacteria 2858868258 2858872214 263
229 iso_pu_bacteria 2867302475 2867308270 263
230 iso_pu_bacteria 2902582711 2902583358 263
231 iso_pu_bacteria 2929219909 2929223861 263
232 iso_pu_bacteria 2954701450 2954703837 263
233 iso_pu_bacteria 2996221748 2996228441 263
234 iso_pu_bacteria 8055412473 8055414748 263
235 3300009147 Ga0114129_10000701 Ga0114129_1000070118 264
236 3300013105 Ga0157369_10685263 Ga0157369_106852632 264
237 3300028794 Ga0307515_10044084 Ga0307515_100440843 264
238 3300031901 Ga0307406_10298592 Ga0307406_102985922 264
239 3300031995 Ga0307409_100307371 Ga0307409_1003073712 264
240 3300044658 Ga0466972_0131447 Ga0466972_0131447_315_1109 264
241 3300044683 Ga0466965_0025314 Ga0466965_0025314_509_1303 264
242 3300044765 Ga0466970_0008811 Ga0466970_0008811_4046_4840 264
243 3300044901 Ga0466960_0123716 Ga0466960_0123716_545_1339 264
244 3300050507 nmdc:mga05p37_64330_c1 nmdc:mga05p37_64330_c1_588_1382 264
245 iso_pu_bacteria 2675903058 2676476408 264
246 iso_pu_bacteria 2827628540 2827632216 264
247 iso_pu_bacteria 2919713450 2919717946 264
248 3300005983 Ga0081540_1006832 Ga0081540_10068326 265
249 3300009147 Ga0114129_10050112 Ga0114129_100501122 265
250 3300013297 Ga0157378_10814315 Ga0157378_108143151 265
251 3300013306 Ga0163162_10250272 Ga0163162_102502722 265
252 3300031901 Ga0307406_10372929 Ga0307406_103729292 265
253 3300046507 Ga0495606_0003890 Ga0495606_0003890_2199_2996 265
254 3300046616 Ga0495668_0000604 Ga0495668_0000604_17275_18072 265
255 3300046660 Ga0495625_0000792 Ga0495625_0000792_6875_7672 265
256 3300047323 Ga0495683_0076247 Ga0495683_0076247_186_983 265
257 3300048091 Ga0495626_0000952 Ga0495626_0000952_17476_18273 265
258 3300048905 Ga0496102_0032571 Ga0496102_0032571_3089_3952 265
259 3300048906 Ga0496103_0001868 Ga0496103_0001868_5687_6550 265
260 3300048907 Ga0496104_0008950 Ga0496104_0008950_5608_6471 265
261 3300048908 Ga0496105_0005192 Ga0496105_0005192_6618_7481 265
262 3300048911 Ga0496108_0250630 Ga0496108_0250630_26_883 265
263 3300048913 Ga0496110_0073917 Ga0496110_0073917_1391_2248 265
264 3300048915 Ga0496112_0164462 Ga0496112_0164462_896_1762 265
265 3300048916 Ga0496113_0375935 Ga0496113_0375935_246_1112 265
266 3300048917 Ga0496114_0005510 Ga0496114_0005510_2549_3412 265
267 3300048918 Ga0496115_0178725 Ga0496115_0178725_579_1436 265
268 3300048922 Ga0496119_0057580 Ga0496119_0057580_459_1316 265
269 3300049578 Ga0501042_0471291 Ga0501042_0471291_101_898 265
270 3300006038 Ga0075365_10021742 Ga0075365_100217422 266
271 3300006844 Ga0075428_100011687 Ga0075428_1000116876 266
272 3300006846 Ga0075430_100002641 Ga0075430_1000026416 266
273 3300006847 Ga0075431_100021426 Ga0075431_1000214263 266
274 3300031731 Ga0307405_10222334 Ga0307405_102223342 266
275 3300032126 Ga0307415_100052929 Ga0307415_1000529292 266
276 3300041413 Ga0439465_0046689 Ga0439465_0046689_520_1359 266
277 3300042006 Ga0439432_065105 Ga0439432_065105_203_1042 266
278 3300048903 Ga0496100_0340621 Ga0496100_0340621_155_1021 266
279 3300050507 nmdc:mga05p37_12762_c1 nmdc:mga05p37_12762_c1_2119_2919 266
280 3300050508 nmdc:mga09592_25228_c1 nmdc:mga09592_25228_c1_104_904 266
281 3300050509 nmdc:mga0qj67_39873_c1 nmdc:mga0qj67_39873_c1_329_1129 266
282 3300050510 nmdc:mga06r32_15394_c1 nmdc:mga06r32_15394_c1_3187_3987 266
283 3300005329 Ga0070683_100005269 Ga0070683_1000052693 267
284 3300005329 Ga0070683_100030081 Ga0070683_1000300814 267
285 3300005334 Ga0068869_100009607 Ga0068869_1000096076 267
286 3300005341 Ga0070691_10097460 Ga0070691_100974602 267
287 3300005347 Ga0070668_100170216 Ga0070668_1001702162 267
288 3300005441 Ga0070700_100010715 Ga0070700_1000107155 267
289 3300005457 Ga0070662_100113751 Ga0070662_1001137511 267
290 3300005577 Ga0068857_100096110 Ga0068857_1000961102 267
291 3300006042 Ga0075368_10062027 Ga0075368_100620272 267
292 3300006178 Ga0075367_10039576 Ga0075367_100395762 267
293 3300006880 Ga0075429_100039984 Ga0075429_1000399842 267
294 3300009094 Ga0111539_10002374 Ga0111539_1000237414 267
295 3300009098 Ga0105245_10002330 Ga0105245_100023306 267
296 3300009147 Ga0114129_10094413 Ga0114129_100944135 267
297 3300013306 Ga0163162_10570323 Ga0163162_105703232 267
298 3300014745 Ga0157377_10008109 Ga0157377_100081094 267
299 3300025901 Ga0207688_10103924 Ga0207688_101039241 267
300 3300025909 Ga0207705_10261144 Ga0207705_102611442 267
301 3300025920 Ga0207649_10195839 Ga0207649_101958392 267
302 3300025926 Ga0207659_10023152 Ga0207659_100231523 267
303 3300025927 Ga0207687_10052541 Ga0207687_100525412 267
304 3300025933 Ga0207706_10070727 Ga0207706_100707273 267
305 3300025940 Ga0207691_10261968 Ga0207691_102619682 267
306 3300025945 Ga0207679_10008536 Ga0207679_100085365 267
307 3300025972 Ga0207668_10041693 Ga0207668_100416931 267
308 3300026023 Ga0207677_10072123 Ga0207677_100721231 267
309 3300026116 Ga0207674_10140766 Ga0207674_101407662 267
310 3300026142 Ga0207698_10034753 Ga0207698_100347533 267
311 3300028380 Ga0268265_10026801 Ga0268265_100268012 267
312 3300028381 Ga0268264_10125449 Ga0268264_101254492 267
313 3300030522 Ga0307512_10030926 Ga0307512_100309264 267
314 3300031616 Ga0307508_10022174 Ga0307508_100221744 267
315 3300031852 Ga0307410_10052303 Ga0307410_100523033 267
316 3300032002 Ga0307416_100039587 Ga0307416_1000395873 267
317 3300037418 Ga0395900_0052534 Ga0395900_0052534_3028_3831 267
318 3300037466 Ga0395898_0094097 Ga0395898_0094097_1002_1805 267
319 3300037471 Ga0395905_0572833 Ga0395905_0572833_115_918 267
320 3300038443 Ga0395901_0018885 Ga0395901_0018885_2501_3304 267
321 3300042007 Ga0439449_0023750 Ga0439449_0023750_425_1240 267
322 3300046452 Ga0495617_009013 Ga0495617_009013_563_1366 267
323 3300046453 Ga0495627_017372 Ga0495627_017372_495_1298 267
324 3300046454 Ga0495592_0039421 Ga0495592_0039421_2120_2923 267
325 3300046455 Ga0495603_0002573 Ga0495603_0002573_3242_4045 267
326 3300046460 Ga0495638_0274132 Ga0495638_0274132_102_905 267
327 3300046462 Ga0495651_0050627 Ga0495651_0050627_1809_2612 267
328 3300046474 Ga0495605_0012721 Ga0495605_0012721_1935_2738 267
329 3300046477 Ga0495664_0055576 Ga0495664_0055576_1438_2241 267
330 3300046492 Ga0495585_0094322 Ga0495585_0094322_496_1299 267
331 3300046499 Ga0495594_0045190 Ga0495594_0045190_467_1270 267
332 3300046500 Ga0495596_0028776 Ga0495596_0028776_966_1769 267
333 3300046506 Ga0495583_0073175 Ga0495583_0073175_114_917 267
334 3300046507 Ga0495606_0061900 Ga0495606_0061900_1046_1849 267
335 3300046514 Ga0495618_0279016 Ga0495618_0279016_145_948 267
336 3300046516 Ga0495628_0522814 Ga0495628_0522814_37_840 267
337 3300046519 Ga0495632_0168214 Ga0495632_0168214_88_891 267
338 3300046520 Ga0495637_0037191 Ga0495637_0037191_1193_1996 267
339 3300046524 Ga0495648_0052934 Ga0495648_0052934_525_1328 267
340 3300046529 Ga0495652_0086551 Ga0495652_0086551_888_1691 267
341 3300046533 Ga0495640_0016311 Ga0495640_0016311_2404_3207 267
342 3300046557 Ga0495622_0010493 Ga0495622_0010493_2327_3130 267
343 3300046558 Ga0495633_0079759 Ga0495633_0079759_509_1312 267
344 3300046648 Ga0495611_0097819 Ga0495611_0097819_133_936 267
345 3300046663 Ga0495635_0036077 Ga0495635_0036077_130_933 267
346 3300046691 Ga0495670_0141729 Ga0495670_0141729_155_958 267
347 3300046692 Ga0495671_0061377 Ga0495671_0061377_864_1667 267
348 3300046794 Ga0495589_0009835 Ga0495589_0009835_249_1052 267
349 3300046794 Ga0495589_0024143 Ga0495589_0024143_904_1707 267
350 3300046809 Ga0495600_0149263 Ga0495600_0149263_596_1399 267
351 3300047317 Ga0495604_0075104 Ga0495604_0075104_1580_2383 267
352 3300047318 Ga0495636_0076952 Ga0495636_0076952_506_1309 267
353 3300047320 Ga0495672_0043736 Ga0495672_0043736_987_1790 267
354 3300047321 Ga0495676_0022178 Ga0495676_0022178_3280_4083 267
355 3300047444 Ga0495675_0040552 Ga0495675_0040552_833_1636 267
356 3300050494 nmdc:mga06z11_21169_c1 nmdc:mga06z11_21169_c1_2034_2837 267
357 3300050495 nmdc:mga04h51_77092_c1 nmdc:mga04h51_77092_c1_258_1061 267
358 3300050507 nmdc:mga05p37_252281_c1 nmdc:mga05p37_252281_c1_1203_2006 267
359 iso_pu_bacteria 2811994879 2812355036 267
360 iso_pu_bacteria 2863404153 2863407709 267
361 iso_pu_bacteria 2912715099 2912716647 267
362 iso_pu_bacteria 2946064051 2946070862 267
363 iso_pu_bacteria 2947224130 2947225936 267
364 iso_pu_bacteria 2954380949 2954384670 267
365 iso_pu_bacteria 2997451912 2997455525 267
366 iso_pu_bacteria 8056829672 8056829711 267
367 3300005455 Ga0070663_100096511 Ga0070663_1000965112 268
368 3300006844 Ga0075428_100301708 Ga0075428_1003017082 268
369 3300006847 Ga0075431_100032015 Ga0075431_1000320153 268
370 3300006847 Ga0075431_100527122 Ga0075431_1005271222 268
371 3300009147 Ga0114129_10289303 Ga0114129_102893031 268
372 3300009147 Ga0114129_10609888 Ga0114129_106098882 268
373 3300025297 Ga0209758_1005429 Ga0209758_10054295 268
374 3300031731 Ga0307405_10002296 Ga0307405_100022964 268
375 3300031852 Ga0307410_10058829 Ga0307410_100588293 268
376 3300031911 Ga0307412_10115738 Ga0307412_101157381 268
377 3300031995 Ga0307409_100002935 Ga0307409_1000029353 268
378 3300032002 Ga0307416_100012393 Ga0307416_1000123934 268
379 3300032126 Ga0307415_100000185 Ga0307415_10000018514 268
380 3300032126 Ga0307415_100013501 Ga0307415_1000135012 268
381 3300032126 Ga0307415_100089834 Ga0307415_1000898342 268
382 3300045976 Ga0466967_0119872 Ga0466967_0119872_1106_1912 268
383 3300050510 nmdc:mga06r32_148141_c1 nmdc:mga06r32_148141_c1_431_1237 268
384 3300053090 Ga0500646_0001695 Ga0500646_0001695_2268_3074 268
385 3300053092 Ga0500583_0011164 Ga0500583_0011164_734_1540 268
386 3300053096 Ga0500641_0017688 Ga0500641_0017688_1037_1843 268
387 3300053146 Ga0500588_0001575 Ga0500588_0001575_3040_3846 268
388 iso_pu_bacteria 2582581314 2585318006 268
389 iso_pu_bacteria 2954691527 2954698386 268
390 3300005329 Ga0070683_100344814 Ga0070683_1003448142 269
391 3300005338 Ga0068868_100094838 Ga0068868_1000948383 269
392 3300005530 Ga0070679_100264201 Ga0070679_1002642012 269
393 3300005535 Ga0070684_100421833 Ga0070684_1004218332 269
394 3300005564 Ga0070664_100695523 Ga0070664_1006955231 269
395 3300005616 Ga0068852_100065659 Ga0068852_1000656593 269
396 3300005937 Ga0081455_10026196 Ga0081455_100261965 269
397 3300009148 Ga0105243_10094788 Ga0105243_100947882 269
398 3300009176 Ga0105242_10052187 Ga0105242_100521872 269
399 3300009177 Ga0105248_10813623 Ga0105248_108136231 269
400 3300013306 Ga0163162_10234485 Ga0163162_102344853 269
401 3300014325 Ga0163163_10051861 Ga0163163_100518613 269
402 3300014968 Ga0157379_10105884 Ga0157379_101058842 269
403 3300017792 Ga0163161_10392471 Ga0163161_103924711 269
404 3300025921 Ga0207652_10180076 Ga0207652_101800762 269
405 3300025941 Ga0207711_10343102 Ga0207711_103431022 269
406 3300025944 Ga0207661_10225639 Ga0207661_102256392 269
407 3300026023 Ga0207677_10118612 Ga0207677_101186122 269
408 3300031995 Ga0307409_100644955 Ga0307409_1006449552 269
409 3300037312 Ga0395899_0004648 Ga0395899_0004648_2804_3709 269
410 3300038443 Ga0395901_0237350 Ga0395901_0237350_560_1396 269
411 3300041512 Ga0451853_0938007 Ga0451853_0938007_10844_11653 269
412 3300044656 Ga0466969_0006204 Ga0466969_0006204_588_1418 269
413 3300044684 Ga0466966_0000312 Ga0466966_0000312_28231_29061 269
414 3300044693 Ga0466961_0042433 Ga0466961_0042433_830_1660 269
415 3300044842 Ga0466957_0024957 Ga0466957_0024957_912_1733 269
416 3300045049 Ga0466959_0006909 Ga0466959_0006909_402_1232 269
417 3300048904 Ga0496101_0137291 Ga0496101_0137291_833_1657 269
418 3300048905 Ga0496102_0182992 Ga0496102_0182992_417_1241 269
419 3300048907 Ga0496104_0120380 Ga0496104_0120380_1368_2192 269
420 3300048909 Ga0496106_0134727 Ga0496106_0134727_966_1790 269
421 3300048911 Ga0496108_0083144 Ga0496108_0083144_1172_1996 269
422 3300048913 Ga0496110_0050068 Ga0496110_0050068_1327_2151 269
423 3300048913 Ga0496110_0086854 Ga0496110_0086854_387_1196 269
424 3300048916 Ga0496113_0081210 Ga0496113_0081210_711_1535 269
425 3300048917 Ga0496114_0034065 Ga0496114_0034065_1536_2360 269
426 3300049572 Ga0501036_0068378 Ga0501036_0068378_81_917 269
427 3300049574 Ga0501038_0172101 Ga0501038_0172101_731_1567 269
428 3300049576 Ga0501040_0021687 Ga0501040_0021687_880_1716 269
429 3300049580 Ga0501046_0065124 Ga0501046_0065124_671_1507 269
430 3300049582 Ga0501048_0176851 Ga0501048_0176851_372_1208 269
431 3300049586 Ga0501070_0079337 Ga0501070_0079337_1640_2449 269
432 3300049587 Ga0501071_0015549 Ga0501071_0015549_1558_2394 269
433 3300049588 Ga0501072_0052300 Ga0501072_0052300_1609_2445 269
434 3300049590 Ga0501074_0039356 Ga0501074_0039356_2141_2977 269
435 3300049591 Ga0501075_0012487 Ga0501075_0012487_2484_3320 269
436 3300049591 Ga0501075_0455947 Ga0501075_0455947_77_913 269
437 3300049741 Ga0501079_0114655 Ga0501079_0114655_998_1834 269
438 3300049742 Ga0501080_0537742 Ga0501080_0537742_40_876 269
439 3300049822 Ga0501035_0195124 Ga0501035_0195124_443_1279 269
440 3300054114 Ga0501084_0069521 Ga0501084_0069521_283_1119 269
441 3300059421 Ga0590071_018147 Ga0590071_018147_315_1142 269
442 3300060353 Ga0501082_0406966 Ga0501082_0406966_226_1062 269
443 3300061719 Ga0466962_0122656 Ga0466962_0122656_434_1243 269
444 3300011119 Ga0105246_10414964 Ga0105246_104149642 270
445 3300025945 Ga0207679_10213605 Ga0207679_102136052 270
446 3300031901 Ga0307406_10069930 Ga0307406_100699303 270
447 3300039437 Ga0436365_0754694 Ga0436365_0754694_200_1015 270
448 3300044656 Ga0466969_0118664 Ga0466969_0118664_134_976 270
449 3300044683 Ga0466965_0207548 Ga0466965_0207548_139_969 270
450 3300044684 Ga0466966_0003667 Ga0466966_0003667_9020_9862 270
451 3300044693 Ga0466961_0001784 Ga0466961_0001784_4316_5158 270
452 3300044693 Ga0466961_0249263 Ga0466961_0249263_61_900 270
453 3300048905 Ga0496102_0081406 Ga0496102_0081406_247_1071 270
454 3300048906 Ga0496103_0038978 Ga0496103_0038978_726_1550 270
455 3300048909 Ga0496106_0522827 Ga0496106_0522827_57_881 270
456 3300048917 Ga0496114_0012430 Ga0496114_0012430_264_1088 270
457 3300050490 nmdc:mga03n38_43035_c1 nmdc:mga03n38_43035_c1_345_1193 270
458 iso_pu_bacteria 2643221567 2643851207 270
459 iso_pu_bacteria 2643221624 2644138078 270
460 iso_pu_bacteria 2808606365 2808872956 270
461 iso_pu_bacteria 2811994874 2812330458 270
462 iso_pu_bacteria 2919446982 2919449300 270
463 3300001990 JGI24737J22298_10039391 JGI24737J22298_100393912 271
464 3300005530 Ga0070679_100299195 Ga0070679_1002991952 271
465 3300005535 Ga0070684_100120457 Ga0070684_1001204573 271
466 3300005577 Ga0068857_100118195 Ga0068857_1001181952 271
467 3300009092 Ga0105250_10177731 Ga0105250_101777311 271
468 3300009101 Ga0105247_10249354 Ga0105247_102493542 271
469 3300009177 Ga0105248_10109181 Ga0105248_101091812 271
470 3300013307 Ga0157372_10000069 Ga0157372_1000006963 271
471 3300013307 Ga0157372_10694298 Ga0157372_106942982 271
472 3300014325 Ga0163163_10195169 Ga0163163_101951692 271
473 3300020082 Ga0206353_11887563 Ga0206353_118875633 271
474 3300025941 Ga0207711_10214457 Ga0207711_102144572 271
475 3300025944 Ga0207661_10157256 Ga0207661_101572562 271
476 3300026088 Ga0207641_10092980 Ga0207641_100929802 271
477 3300026095 Ga0207676_10306483 Ga0207676_103064832 271
478 3300028379 Ga0268266_10137164 Ga0268266_101371642 271
479 3300031548 Ga0307408_100195554 Ga0307408_1001955542 271
480 3300031731 Ga0307405_10239010 Ga0307405_102390102 271
481 3300031838 Ga0307518_10070328 Ga0307518_100703282 271
482 3300031852 Ga0307410_10012734 Ga0307410_100127342 271
483 3300031995 Ga0307409_100003522 Ga0307409_1000035222 271
484 3300037418 Ga0395900_0329141 Ga0395900_0329141_517_1344 271
485 3300037466 Ga0395898_0009234 Ga0395898_0009234_7507_8334 271
486 3300037466 Ga0395898_0084943 Ga0395898_0084943_2056_2910 271
487 3300038443 Ga0395901_0006829 Ga0395901_0006829_7177_8031 271
488 3300038443 Ga0395901_0142114 Ga0395901_0142114_1055_1882 271
489 3300038443 Ga0395901_0257879 Ga0395901_0257879_460_1287 271
490 3300041999 Ga0439433_0023380 Ga0439433_0023380_190_1017 271
491 3300042014 Ga0439457_025456 Ga0439457_025456_130_957 271
492 3300046473 Ga0495582_0082016 Ga0495582_0082016_178_1005 271
493 3300046499 Ga0495594_0003966 Ga0495594_0003966_3426_4250 271
494 3300046663 Ga0495635_0220060 Ga0495635_0220060_393_1220 271
495 3300048089 Ga0495614_0106339 Ga0495614_0106339_41_868 271
496 3300048905 Ga0496102_0001368 Ga0496102_0001368_15751_16578 271
497 3300048906 Ga0496103_0009368 Ga0496103_0009368_1817_2644 271
498 3300048915 Ga0496112_0072241 Ga0496112_0072241_2252_3076 271
499 3300048915 Ga0496112_0075488 Ga0496112_0075488_203_1027 271
500 3300048915 Ga0496112_0100661 Ga0496112_0100661_746_1660 271
501 3300048917 Ga0496114_0062102 Ga0496114_0062102_1371_2198 271
502 3300048918 Ga0496115_0110709 Ga0496115_0110709_760_1587 271
503 3300049568 Ga0501031_0007062 Ga0501031_0007062_1792_2619 271
504 3300049571 Ga0501034_0350419 Ga0501034_0350419_485_1312 271
505 3300049572 Ga0501036_0007516 Ga0501036_0007516_8016_8843 271
506 3300049572 Ga0501036_0253072 Ga0501036_0253072_467_1294 271
507 3300049573 Ga0501037_0016485 Ga0501037_0016485_4582_5409 271
508 3300049573 Ga0501037_0152198 Ga0501037_0152198_565_1392 271
509 3300049574 Ga0501038_0017909 Ga0501038_0017909_992_1819 271
510 3300049575 Ga0501039_0072691 Ga0501039_0072691_951_1778 271
511 3300049575 Ga0501039_0224569 Ga0501039_0224569_533_1360 271
512 3300049576 Ga0501040_0010206 Ga0501040_0010206_5188_6015 271
513 3300049580 Ga0501046_0327536 Ga0501046_0327536_263_1090 271
514 3300049582 Ga0501048_0010990 Ga0501048_0010990_4768_5595 271
515 3300049585 Ga0501069_0138918 Ga0501069_0138918_386_1213 271
516 3300049586 Ga0501070_0105535 Ga0501070_0105535_836_1663 271
517 3300049588 Ga0501072_0012575 Ga0501072_0012575_4459_5286 271
518 3300049588 Ga0501072_0327189 Ga0501072_0327189_135_953 271
519 3300049590 Ga0501074_0013689 Ga0501074_0013689_3768_4595 271
520 3300049590 Ga0501074_0365917 Ga0501074_0365917_28_855 271
521 3300049592 Ga0501076_0003371 Ga0501076_0003371_8383_9210 271
522 3300049741 Ga0501079_0043902 Ga0501079_0043902_729_1556 271
523 3300049742 Ga0501080_0136975 Ga0501080_0136975_1313_2140 271
524 3300049743 Ga0501081_0027841 Ga0501081_0027841_783_1610 271
525 3300049823 Ga0501044_0084993 Ga0501044_0084993_500_1327 271
526 3300049824 Ga0501045_0009297 Ga0501045_0009297_1533_2360 271
527 3300049824 Ga0501045_0340758 Ga0501045_0340758_137_964 271
528 3300053085 Ga0495619_0157710 Ga0495619_0157710_79_906 271
529 3300060353 Ga0501082_0006546 Ga0501082_0006546_8383_9210 271
530 3300061734 Ga0530510_0004800 Ga0530510_0004800_68_895 271
531 iso_pu_bacteria 2643221561 2643825756 271
532 iso_pu_bacteria 2643221561 2643827397 271
533 iso_pu_bacteria 2643221590 2643957882 271
534 iso_pu_bacteria 2643221604 2644034389 271
535 iso_pu_bacteria 2643221615 2644093007 271
536 iso_pu_bacteria 2643221617 2644100390 271
537 iso_pu_bacteria 2643221620 2644116797 271
538 iso_pu_bacteria 2643221657 2644322618 271
539 iso_pu_bacteria 2643221692 2644515652 271
540 iso_pu_bacteria 2643221696 2644531748 271
541 iso_pu_bacteria 2643221696 2644533776 271
542 iso_pu_bacteria 2643221711 2644607556 271
543 iso_pu_bacteria 2643221962 2645724237 271
544 iso_pu_bacteria 2738541305 2738870883 271
545 iso_pu_bacteria 2773857762 2774394853 271
546 iso_pu_bacteria 2808606439 2809194295 271
547 iso_pu_bacteria 2811994878 2812349046 271
548 iso_pu_bacteria 2891968417 2891973198 271
549 3300009545 Ga0105237_10417118 Ga0105237_104171182 272
550 3300025904 Ga0207647_10071089 Ga0207647_100710892 272
551 3300038443 Ga0395901_0072557 Ga0395901_0072557_2030_2863 272
552 3300041494 Ga0451837_0507184 Ga0451837_0507184_1671_2495 272
553 3300041498 Ga0451841_0998218 Ga0451841_0998218_69_893 272
554 3300044683 Ga0466965_0002133 Ga0466965_0002133_3103_3930 272
555 3300046684 Ga0495669_0141418 Ga0495669_0141418_190_1044 272
556 3300048912 Ga0496109_0068607 Ga0496109_0068607_806_1624 272
557 3300048925 Ga0496122_0110882 Ga0496122_0110882_874_1701 272
558 3300048926 Ga0496123_0016240 Ga0496123_0016240_5198_6025 272
559 3300049569 Ga0501032_0011546 Ga0501032_0011546_4956_5774 272
560 3300049570 Ga0501033_0003015 Ga0501033_0003015_11318_12136 272
561 3300049571 Ga0501034_0379743 Ga0501034_0379743_97_915 272
562 3300049571 Ga0501034_0616361 Ga0501034_0616361_137_955 272
563 3300049572 Ga0501036_0320430 Ga0501036_0320430_429_1247 272
564 3300049573 Ga0501037_0102218 Ga0501037_0102218_387_1205 272
565 3300049574 Ga0501038_0192306 Ga0501038_0192306_703_1521 272
566 3300049575 Ga0501039_0007597 Ga0501039_0007597_1396_2214 272
567 3300049579 Ga0501043_0135203 Ga0501043_0135203_897_1715 272
568 3300049579 Ga0501043_0163041 Ga0501043_0163041_265_1083 272
569 3300049580 Ga0501046_0008758 Ga0501046_0008758_5592_6410 272
570 3300049580 Ga0501046_0055366 Ga0501046_0055366_1691_2509 272
571 3300049581 Ga0501047_0135348 Ga0501047_0135348_1405_2223 272
572 3300049582 Ga0501048_0005904 Ga0501048_0005904_7181_7999 272
573 3300049583 Ga0501067_0001090 Ga0501067_0001090_7743_8561 272
574 3300049585 Ga0501069_0050958 Ga0501069_0050958_1377_2195 272
575 3300049586 Ga0501070_0077743 Ga0501070_0077743_18_836 272
576 3300049586 Ga0501070_0091700 Ga0501070_0091700_1632_2450 272
577 3300049588 Ga0501072_0011905 Ga0501072_0011905_4166_4984 272
578 3300049589 Ga0501073_0008076 Ga0501073_0008076_1660_2478 272
579 3300049590 Ga0501074_0007714 Ga0501074_0007714_5633_6451 272
580 3300049742 Ga0501080_0004763 Ga0501080_0004763_6256_7074 272
581 3300049742 Ga0501080_0241389 Ga0501080_0241389_532_1350 272
582 3300054114 Ga0501084_0186516 Ga0501084_0186516_618_1436 272
583 3300060353 Ga0501082_0028741 Ga0501082_0028741_3780_4598 272
584 iso_pu_bacteria 2515154155 2515851597 272
585 iso_pu_bacteria 2643221697 2644538549 272
586 iso_pu_bacteria 2643221962 2645723860 272
587 iso_pu_bacteria 2773857762 2774392469 272
588 iso_pu_bacteria 2808606439 2809196253 272
589 iso_pu_bacteria 2811994878 2812351585 272
590 iso_pu_bacteria 2811994882 2812373685 272
591 iso_pu_bacteria 2816332119 2816421185 272
592 iso_pu_bacteria 2818991458 2819665333 272
593 iso_pu_bacteria 2818991462 2819691455 272
594 iso_pu_bacteria 2818991469 2819727508 272
595 iso_pu_bacteria 2891968417 2891970808 272
596 iso_pu_bacteria 2984592036 2984593886 272
597 3300002067 JGI24735J21928_10004072 JGI24735J21928_100040722 273
598 3300005331 Ga0070670_100498867 Ga0070670_1004988671 273
599 3300005335 Ga0070666_10012071 Ga0070666_100120715 273
600 3300005347 Ga0070668_100117602 Ga0070668_1001176022 273
601 3300005367 Ga0070667_100006291 Ga0070667_1000062918 273
602 3300005435 Ga0070714_100000011 Ga0070714_10000001111 273
603 3300005441 Ga0070700_100000046 Ga0070700_10000004685 273
604 3300005548 Ga0070665_100002289 Ga0070665_1000022898 273
605 3300005841 Ga0068863_100002669 Ga0068863_1000026693 273
606 3300005842 Ga0068858_100049084 Ga0068858_1000490842 273
607 3300005843 Ga0068860_100000054 Ga0068860_100000054135 273
608 3300006847 Ga0075431_100071369 Ga0075431_1000713693 273
609 3300009098 Ga0105245_10017613 Ga0105245_100176133 273
610 3300022467 Ga0224712_10011753 Ga0224712_100117532 273
611 3300022467 Ga0224712_10058843 Ga0224712_100588432 273
612 3300025929 Ga0207664_10000001 Ga0207664_10000001498 273
613 3300025931 Ga0207644_10068688 Ga0207644_100686883 273
614 3300025972 Ga0207668_10009452 Ga0207668_100094526 273
615 3300025986 Ga0207658_10050600 Ga0207658_100506003 273
616 3300026035 Ga0207703_10036258 Ga0207703_100362584 273
617 3300026075 Ga0207708_10000002 Ga0207708_1000000211 273
618 3300026088 Ga0207641_10249061 Ga0207641_102490612 273
619 3300028379 Ga0268266_10000921 Ga0268266_1000092117 273
620 3300028381 Ga0268264_10000097 Ga0268264_1000009792 273
621 3300031995 Ga0307409_100354186 Ga0307409_1003541862 273
622 3300037853 Ga0436364_1557918 Ga0436364_1557918_4414_5256 273
623 3300044684 Ga0466966_0006032 Ga0466966_0006032_5571_6407 273
624 3300044765 Ga0466970_0058236 Ga0466970_0058236_1179_2021 273
625 3300044765 Ga0466970_0096663 Ga0466970_0096663_31_867 273
626 3300045976 Ga0466967_0001336 Ga0466967_0001336_3114_3950 273
627 3300045976 Ga0466967_0243023 Ga0466967_0243023_397_1260 273
628 3300048912 Ga0496109_0257698 Ga0496109_0257698_279_1115 273
629 3300048915 Ga0496112_0484289 Ga0496112_0484289_238_1071 273
630 3300048929 Ga0496126_0000039 Ga0496126_0000039_335561_336424 273
631 3300048929 Ga0496126_0125254 Ga0496126_0125254_1309_2145 273
632 3300049580 Ga0501046_0021851 Ga0501046_0021851_2286_3107 273
633 3300050510 nmdc:mga06r32_136_c5 nmdc:mga06r32_136_c5_6231_7070 273
634 iso_pu_bacteria 2622736605 2623497678 273
635 iso_pu_bacteria 2643221679 2644445586 273
636 3300005339 Ga0070660_100113770 Ga0070660_1001137702 274
637 3300005614 Ga0068856_100028053 Ga0068856_1000280535 274
638 3300009545 Ga0105237_10143583 Ga0105237_101435833 274
639 3300009551 Ga0105238_10110120 Ga0105238_101101203 274
640 3300013105 Ga0157369_10141737 Ga0157369_101417372 274
641 3300021384 Ga0213876_10002578 Ga0213876_100025782 274
642 3300025904 Ga0207647_10009203 Ga0207647_100092036 274
643 3300025949 Ga0207667_10009869 Ga0207667_100098695 274
644 3300037418 Ga0395900_0160873 Ga0395900_0160873_1270_2094 274
645 3300037466 Ga0395898_0479344 Ga0395898_0479344_199_1026 274
646 3300037471 Ga0395905_0690840 Ga0395905_0690840_63_893 274
647 3300038443 Ga0395901_0532477 Ga0395901_0532477_14_841 274
648 3300039437 Ga0436365_1489938 Ga0436365_1489938_284_1147 274
649 3300049569 Ga0501032_0029706 Ga0501032_0029706_950_1789 274
650 3300049572 Ga0501036_0257405 Ga0501036_0257405_474_1313 274
651 3300049573 Ga0501037_0062611 Ga0501037_0062611_1791_2630 274
652 3300049574 Ga0501038_0020357 Ga0501038_0020357_1754_2593 274
653 3300049579 Ga0501043_0015765 Ga0501043_0015765_34_873 274
654 3300049581 Ga0501047_0000811 Ga0501047_0000811_3105_3944 274
655 3300049582 Ga0501048_0000630 Ga0501048_0000630_11298_12137 274
656 3300049582 Ga0501048_0433439 Ga0501048_0433439_63_890 274
657 3300049586 Ga0501070_0043160 Ga0501070_0043160_190_1029 274
658 3300049590 Ga0501074_0192584 Ga0501074_0192584_115_954 274
659 3300049822 Ga0501035_0037792 Ga0501035_0037792_2535_3374 274
660 3300049823 Ga0501044_0216688 Ga0501044_0216688_766_1605 274
661 3300000549 LJQas_1000406 LJQas_10004068 275
662 3300001979 JGI24740J21852_10005178 JGI24740J21852_100051785 275
663 3300002077 JGI24744J21845_10018837 JGI24744J21845_100188372 275
664 3300003373 JGI25407J50210_10002085 JGI25407J50210_100020854 275
665 3300005327 Ga0070658_10000814 Ga0070658_1000081423 275
666 3300005327 Ga0070658_10001258 Ga0070658_1000125810 275
667 3300005327 Ga0070658_10017927 Ga0070658_100179273 275
668 3300005327 Ga0070658_10361292 Ga0070658_103612922 275
669 3300005329 Ga0070683_100001781 Ga0070683_1000017819 275
670 3300005329 Ga0070683_100008215 Ga0070683_1000082152 275
671 3300005329 Ga0070683_100027904 Ga0070683_1000279043 275
672 3300005329 Ga0070683_100109888 Ga0070683_1001098882 275
673 3300005329 Ga0070683_100113895 Ga0070683_1001138951 275
674 3300005329 Ga0070683_100365384 Ga0070683_1003653842 275
675 3300005329 Ga0070683_100617509 Ga0070683_1006175092 275
676 3300005336 Ga0070680_100000061 Ga0070680_10000006149 275
677 3300005336 Ga0070680_100170910 Ga0070680_1001709102 275
678 3300005336 Ga0070680_100311642 Ga0070680_1003116421 275
679 3300005337 Ga0070682_100017470 Ga0070682_1000174703 275
680 3300005339 Ga0070660_100047049 Ga0070660_1000470493 275
681 3300005339 Ga0070660_100086161 Ga0070660_1000861612 275
682 3300005339 Ga0070660_100094063 Ga0070660_1000940632 275
683 3300005339 Ga0070660_100442539 Ga0070660_1004425392 275
684 3300005340 Ga0070689_100118455 Ga0070689_1001184552 275
685 3300005341 Ga0070691_10010021 Ga0070691_100100213 275
686 3300005345 Ga0070692_10001341 Ga0070692_1000134111 275
687 3300005345 Ga0070692_10006255 Ga0070692_100062554 275
688 3300005354 Ga0070675_100059192 Ga0070675_1000591922 275
689 3300005356 Ga0070674_100120333 Ga0070674_1001203332 275
690 3300005364 Ga0070673_100076323 Ga0070673_1000763233 275
691 3300005366 Ga0070659_100007547 Ga0070659_1000075473 275
692 3300005366 Ga0070659_100047430 Ga0070659_1000474302 275
693 3300005366 Ga0070659_100076146 Ga0070659_1000761462 275
694 3300005435 Ga0070714_100159970 Ga0070714_1001599702 275
695 3300005438 Ga0070701_10019203 Ga0070701_100192033 275
696 3300005441 Ga0070700_100001955 Ga0070700_1000019553 275
697 3300005441 Ga0070700_100139733 Ga0070700_1001397332 275
698 3300005455 Ga0070663_100032528 Ga0070663_1000325282 275
699 3300005455 Ga0070663_100276395 Ga0070663_1002763952 275
700 3300005458 Ga0070681_10000471 Ga0070681_1000047111 275
701 3300005466 Ga0070685_10062685 Ga0070685_100626852 275
702 3300005471 Ga0070698_100003098 Ga0070698_1000030982 275
703 3300005471 Ga0070698_100030285 Ga0070698_1000302853 275
704 3300005530 Ga0070679_100000720 Ga0070679_10000072030 275
705 3300005530 Ga0070679_100006982 Ga0070679_1000069821 275
706 3300005530 Ga0070679_100036126 Ga0070679_1000361263 275
707 3300005530 Ga0070679_100120071 Ga0070679_1001200712 275
708 3300005530 Ga0070679_100324446 Ga0070679_1003244462 275
709 3300005535 Ga0070684_100001861 Ga0070684_1000018616 275
710 3300005535 Ga0070684_100104868 Ga0070684_1001048683 275
711 3300005535 Ga0070684_100126604 Ga0070684_1001266042 275
712 3300005548 Ga0070665_100005571 Ga0070665_10000557110 275
713 3300005548 Ga0070665_100583323 Ga0070665_1005833232 275
714 3300005563 Ga0068855_100239854 Ga0068855_1002398542 275
715 3300005564 Ga0070664_100017312 Ga0070664_1000173122 275
716 3300005564 Ga0070664_100039920 Ga0070664_1000399203 275
717 3300005564 Ga0070664_100084961 Ga0070664_1000849613 275
718 3300005578 Ga0068854_100096417 Ga0068854_1000964172 275
719 3300005616 Ga0068852_100017390 Ga0068852_1000173906 275
720 3300005617 Ga0068859_100001539 Ga0068859_10000153925 275
721 3300005718 Ga0068866_10165049 Ga0068866_101650492 275
722 3300005834 Ga0068851_10224411 Ga0068851_102244111 275
723 3300005840 Ga0068870_10003907 Ga0068870_100039071 275
724 3300005842 Ga0068858_100117034 Ga0068858_1001170342 275
725 3300005843 Ga0068860_100040782 Ga0068860_1000407822 275
726 3300005937 Ga0081455_10000158 Ga0081455_1000015878 275
727 3300005937 Ga0081455_10002794 Ga0081455_1000279411 275
728 3300005937 Ga0081455_10005627 Ga0081455_100056272 275
729 3300005937 Ga0081455_10019900 Ga0081455_100199002 275
730 3300005981 Ga0081538_10000088 Ga0081538_1000008887 275
731 3300005985 Ga0081539_10046341 Ga0081539_100463412 275
732 3300006038 Ga0075365_10019236 Ga0075365_100192364 275
733 3300006038 Ga0075365_10019785 Ga0075365_100197853 275
734 3300006038 Ga0075365_10072831 Ga0075365_100728313 275
735 3300006042 Ga0075368_10054347 Ga0075368_100543472 275
736 3300006048 Ga0075363_100011563 Ga0075363_1000115633 275
737 3300006048 Ga0075363_100017989 Ga0075363_1000179893 275
738 3300006048 Ga0075363_100020595 Ga0075363_1000205952 275
739 3300006048 Ga0075363_100097036 Ga0075363_1000970362 275
740 3300006051 Ga0075364_10040219 Ga0075364_100402192 275
741 3300006177 Ga0075362_10001503 Ga0075362_100015035 275
742 3300006178 Ga0075367_10002838 Ga0075367_100028386 275
743 3300006178 Ga0075367_10027486 Ga0075367_100274863 275
744 3300006178 Ga0075367_10081540 Ga0075367_100815402 275
745 3300006353 Ga0075370_10001514 Ga0075370_100015147 275
746 3300006353 Ga0075370_10051205 Ga0075370_100512052 275
747 3300006844 Ga0075428_100025318 Ga0075428_1000253183 275
748 3300006846 Ga0075430_100017685 Ga0075430_1000176852 275
749 3300006847 Ga0075431_100005930 Ga0075431_1000059303 275
750 3300006847 Ga0075431_100114258 Ga0075431_1001142581 275
751 3300006880 Ga0075429_100155817 Ga0075429_1001558172 275
752 3300006931 Ga0097620_100001539 Ga0097620_10000153925 275
753 3300009094 Ga0111539_10244275 Ga0111539_102442752 275
754 3300009098 Ga0105245_10019306 Ga0105245_100193063 275
755 3300009098 Ga0105245_10152411 Ga0105245_101524112 275
756 3300009101 Ga0105247_10016015 Ga0105247_100160154 275
757 3300009147 Ga0114129_10039526 Ga0114129_100395266 275
758 3300009148 Ga0105243_10007239 Ga0105243_100072394 275
759 3300009174 Ga0105241_10532403 Ga0105241_105324032 275
760 3300009177 Ga0105248_10008579 Ga0105248_1000857911 275
761 3300009177 Ga0105248_10014315 Ga0105248_100143154 275
762 3300009551 Ga0105238_10131312 Ga0105238_101313123 275
763 3300009553 Ga0105249_10006360 Ga0105249_1000636010 275
764 3300010375 Ga0105239_10015655 Ga0105239_100156554 275
765 3300010375 Ga0105239_10104299 Ga0105239_101042993 275
766 3300010375 Ga0105239_10219330 Ga0105239_102193303 275
767 3300010375 Ga0105239_10677503 Ga0105239_106775032 275
768 3300011119 Ga0105246_10006909 Ga0105246_100069093 275
769 3300011119 Ga0105246_10174148 Ga0105246_101741482 275
770 3300013102 Ga0157371_10021486 Ga0157371_100214862 275
771 3300013104 Ga0157370_10261408 Ga0157370_102614082 275
772 3300013105 Ga0157369_10026619 Ga0157369_100266194 275
773 3300013105 Ga0157369_10110374 Ga0157369_101103743 275
774 3300013296 Ga0157374_10291649 Ga0157374_102916492 275
775 3300013296 Ga0157374_10439647 Ga0157374_104396472 275
776 3300013307 Ga0157372_10023195 Ga0157372_100231955 275
777 3300013307 Ga0157372_10056905 Ga0157372_100569054 275
778 3300013307 Ga0157372_10082665 Ga0157372_100826653 275
779 3300013307 Ga0157372_10275067 Ga0157372_102750672 275
780 3300013307 Ga0157372_10408720 Ga0157372_104087202 275
781 3300013307 Ga0157372_10417394 Ga0157372_104173942 275
782 3300013308 Ga0157375_10167615 Ga0157375_101676152 275
783 3300013308 Ga0157375_10178567 Ga0157375_101785673 275
784 3300013308 Ga0157375_10249164 Ga0157375_102491644 275
785 3300014325 Ga0163163_10238106 Ga0163163_102381062 275
786 3300014745 Ga0157377_10016277 Ga0157377_100162773 275
787 3300014968 Ga0157379_10016161 Ga0157379_100161613 275
788 3300017792 Ga0163161_10114048 Ga0163161_101140482 275
789 3300017792 Ga0163161_10303207 Ga0163161_103032072 275
790 3300017792 Ga0163161_10545996 Ga0163161_105459961 275
791 3300020077 Ga0206351_10570905 Ga0206351_105709052 275
792 3300020077 Ga0206351_10590854 Ga0206351_105908542 275
793 3300020081 Ga0206354_11210162 Ga0206354_112101622 275
794 3300020082 Ga0206353_10671446 Ga0206353_106714462 275
795 3300020082 Ga0206353_10991039 Ga0206353_109910392 275
796 3300020082 Ga0206353_11552232 Ga0206353_115522324 275
797 3300020082 Ga0206353_11812951 Ga0206353_118129517 275
798 3300025900 Ga0207710_10008328 Ga0207710_100083284 275
799 3300025901 Ga0207688_10173266 Ga0207688_101732662 275
800 3300025904 Ga0207647_10002919 Ga0207647_100029194 275
801 3300025904 Ga0207647_10019070 Ga0207647_100190704 275
802 3300025904 Ga0207647_10037182 Ga0207647_100371822 275
803 3300025908 Ga0207643_10001247 Ga0207643_100012475 275
804 3300025909 Ga0207705_10001488 Ga0207705_100014888 275
805 3300025909 Ga0207705_10059407 Ga0207705_100594073 275
806 3300025909 Ga0207705_10082085 Ga0207705_100820852 275
807 3300025909 Ga0207705_10319251 Ga0207705_103192511 275
808 3300025912 Ga0207707_10000277 Ga0207707_1000027712 275
809 3300025912 Ga0207707_10020504 Ga0207707_100205043 275
810 3300025914 Ga0207671_10235272 Ga0207671_102352722 275
811 3300025917 Ga0207660_10000909 Ga0207660_1000090910 275
812 3300025917 Ga0207660_10051337 Ga0207660_100513373 275
813 3300025917 Ga0207660_10483004 Ga0207660_104830042 275
814 3300025918 Ga0207662_10024650 Ga0207662_100246503 275
815 3300025919 Ga0207657_10006999 Ga0207657_100069993 275
816 3300025919 Ga0207657_10082177 Ga0207657_100821773 275
817 3300025919 Ga0207657_10088697 Ga0207657_100886973 275
818 3300025919 Ga0207657_10098643 Ga0207657_100986432 275
819 3300025921 Ga0207652_10000333 Ga0207652_1000033340 275
820 3300025921 Ga0207652_10005131 Ga0207652_1000513110 275
821 3300025921 Ga0207652_10273099 Ga0207652_102730992 275
822 3300025921 Ga0207652_10362618 Ga0207652_103626182 275
823 3300025922 Ga0207646_10379282 Ga0207646_103792822 275
824 3300025926 Ga0207659_10175068 Ga0207659_101750682 275
825 3300025927 Ga0207687_10061079 Ga0207687_100610792 275
826 3300025927 Ga0207687_10064937 Ga0207687_100649372 275
827 3300025927 Ga0207687_10116121 Ga0207687_101161212 275
828 3300025927 Ga0207687_10160693 Ga0207687_101606932 275
829 3300025929 Ga0207664_10063108 Ga0207664_100631082 275
830 3300025929 Ga0207664_10317575 Ga0207664_103175752 275
831 3300025931 Ga0207644_10320643 Ga0207644_103206432 275
832 3300025932 Ga0207690_10009500 Ga0207690_100095004 275
833 3300025932 Ga0207690_10106295 Ga0207690_101062953 275
834 3300025932 Ga0207690_10288906 Ga0207690_102889062 275
835 3300025933 Ga0207706_10070059 Ga0207706_100700593 275
836 3300025934 Ga0207686_10197639 Ga0207686_101976392 275
837 3300025935 Ga0207709_10097521 Ga0207709_100975212 275
838 3300025937 Ga0207669_10180299 Ga0207669_101802992 275
839 3300025938 Ga0207704_10030583 Ga0207704_100305832 275
840 3300025940 Ga0207691_10020374 Ga0207691_100203743 275
841 3300025941 Ga0207711_10088073 Ga0207711_100880733 275
842 3300025944 Ga0207661_10001990 Ga0207661_100019909 275
843 3300025944 Ga0207661_10038045 Ga0207661_100380452 275
844 3300025944 Ga0207661_10046146 Ga0207661_100461463 275
845 3300025944 Ga0207661_10122401 Ga0207661_101224012 275
846 3300025944 Ga0207661_10195862 Ga0207661_101958622 275
847 3300025944 Ga0207661_10197223 Ga0207661_101972232 275
848 3300025945 Ga0207679_10011135 Ga0207679_1001113510 275
849 3300025945 Ga0207679_10021837 Ga0207679_100218373 275
850 3300025945 Ga0207679_10378908 Ga0207679_103789082 275
851 3300025949 Ga0207667_10260009 Ga0207667_102600092 275
852 3300025961 Ga0207712_10184114 Ga0207712_101841142 275
853 3300026035 Ga0207703_10348652 Ga0207703_103486522 275
854 3300026041 Ga0207639_10249673 Ga0207639_102496732 275
855 3300026067 Ga0207678_10035120 Ga0207678_100351205 275
856 3300026067 Ga0207678_10149146 Ga0207678_101491462 275
857 3300026067 Ga0207678_10166753 Ga0207678_101667532 275
858 3300026075 Ga0207708_10000970 Ga0207708_1000097012 275
859 3300026075 Ga0207708_10070799 Ga0207708_100707992 275
860 3300026078 Ga0207702_10245261 Ga0207702_102452611 275
861 3300026078 Ga0207702_10500232 Ga0207702_105002322 275
862 3300026078 Ga0207702_10567743 Ga0207702_105677431 275
863 3300026089 Ga0207648_10007917 Ga0207648_1000791712 275
864 3300026095 Ga0207676_10457296 Ga0207676_104572962 275
865 3300026116 Ga0207674_10133371 Ga0207674_101333712 275
866 3300026118 Ga0207675_100013178 Ga0207675_1000131787 275
867 3300026118 Ga0207675_100793542 Ga0207675_1007935421 275
868 3300026142 Ga0207698_10005597 Ga0207698_100055973 275
869 3300027866 Ga0209813_10001554 Ga0209813_100015544 275
870 3300027866 Ga0209813_10024648 Ga0209813_100246482 275
871 3300027866 Ga0209813_10050921 Ga0209813_100509212 275
872 3300027907 Ga0207428_10010606 Ga0207428_100106063 275
873 3300027907 Ga0207428_10066640 Ga0207428_100666403 275
874 3300027907 Ga0207428_10104342 Ga0207428_101043422 275
875 3300028379 Ga0268266_10002828 Ga0268266_1000282810 275
876 3300028379 Ga0268266_10526916 Ga0268266_105269162 275
877 3300028381 Ga0268264_10100196 Ga0268264_101001963 275
878 3300031548 Ga0307408_100437427 Ga0307408_1004374272 275
879 3300031731 Ga0307405_10021835 Ga0307405_100218353 275
880 3300031731 Ga0307405_10086415 Ga0307405_100864152 275
881 3300031731 Ga0307405_10279226 Ga0307405_102792262 275
882 3300031824 Ga0307413_10464937 Ga0307413_104649371 275
883 3300031852 Ga0307410_10027544 Ga0307410_100275442 275
884 3300031852 Ga0307410_10029204 Ga0307410_100292043 275
885 3300031852 Ga0307410_10042080 Ga0307410_100420802 275
886 3300031852 Ga0307410_10102539 Ga0307410_101025392 275
887 3300031852 Ga0307410_10140734 Ga0307410_101407343 275
888 3300031852 Ga0307410_10251467 Ga0307410_102514672 275
889 3300031901 Ga0307406_10055428 Ga0307406_100554283 275
890 3300031901 Ga0307406_10057322 Ga0307406_100573222 275
891 3300031901 Ga0307406_10117777 Ga0307406_101177772 275
892 3300031903 Ga0307407_10063199 Ga0307407_100631992 275
893 3300031903 Ga0307407_10079172 Ga0307407_100791722 275
894 3300031903 Ga0307407_10115338 Ga0307407_101153382 275
895 3300031903 Ga0307407_10445622 Ga0307407_104456221 275
896 3300031911 Ga0307412_10072015 Ga0307412_100720152 275
897 3300031911 Ga0307412_10564220 Ga0307412_105642201 275
898 3300031995 Ga0307409_100042993 Ga0307409_1000429932 275
899 3300031995 Ga0307409_100044415 Ga0307409_1000444152 275
900 3300031995 Ga0307409_100062779 Ga0307409_1000627793 275
901 3300031995 Ga0307409_100070856 Ga0307409_1000708563 275
902 3300031995 Ga0307409_100109822 Ga0307409_1001098222 275
903 3300031995 Ga0307409_100533803 Ga0307409_1005338032 275
904 3300032002 Ga0307416_100010155 Ga0307416_1000101554 275
905 3300032002 Ga0307416_100011648 Ga0307416_1000116484 275
906 3300032002 Ga0307416_100059184 Ga0307416_1000591842 275
907 3300032002 Ga0307416_100062962 Ga0307416_1000629622 275
908 3300032002 Ga0307416_100063868 Ga0307416_1000638682 275
909 3300032002 Ga0307416_100104394 Ga0307416_1001043943 275
910 3300032002 Ga0307416_100108292 Ga0307416_1001082923 275
911 3300032002 Ga0307416_100905121 Ga0307416_1009051212 275
912 3300032004 Ga0307414_10116251 Ga0307414_101162512 275
913 3300032004 Ga0307414_10269099 Ga0307414_102690992 275
914 3300032004 Ga0307414_10459715 Ga0307414_104597151 275
915 3300032004 Ga0307414_10515540 Ga0307414_105155401 275
916 3300032005 Ga0307411_10061789 Ga0307411_100617892 275
917 3300032005 Ga0307411_10126923 Ga0307411_101269232 275
918 3300032005 Ga0307411_10193387 Ga0307411_101933872 275
919 3300032005 Ga0307411_10283594 Ga0307411_102835942 275
920 3300032126 Ga0307415_100000940 Ga0307415_1000009404 275
921 3300032126 Ga0307415_100010414 Ga0307415_1000104142 275
922 3300032126 Ga0307415_100040583 Ga0307415_1000405832 275
923 3300032126 Ga0307415_100112716 Ga0307415_1001127162 275
924 3300035084 Ga0373928_0037050 Ga0373928_0037050_240_1067 275
925 3300035119 Ga0373956_0004841 Ga0373956_0004841_3385_4239 275
926 3300037418 Ga0395900_0043573 Ga0395900_0043573_1123_1992 275
927 3300037466 Ga0395898_0177579 Ga0395898_0177579_983_1852 275
928 3300037466 Ga0395898_0187513 Ga0395898_0187513_188_1057 275
929 3300037471 Ga0395905_0023370 Ga0395905_0023370_1439_2266 275
930 3300037471 Ga0395905_0312267 Ga0395905_0312267_469_1338 275
931 3300038443 Ga0395901_0012737 Ga0395901_0012737_5476_6345 275
932 3300038443 Ga0395901_0046225 Ga0395901_0046225_1496_2365 275
933 3300038443 Ga0395901_0157189 Ga0395901_0157189_466_1338 275
934 3300038443 Ga0395901_0202418 Ga0395901_0202418_867_1694 275
935 3300038443 Ga0395901_0380946 Ga0395901_0380946_429_1268 275
936 3300041404 Ga0439436_0020928 Ga0439436_0020928_1079_1912 275
937 3300041405 Ga0439438_011809 Ga0439438_011809_213_1046 275
938 3300041405 Ga0439438_022418 Ga0439438_022418_340_1179 275
939 3300041407 Ga0439447_027600 Ga0439447_027600_115_948 275
940 3300041997 Ga0439431_0002045 Ga0439431_0002045_1432_2265 275
941 3300041997 Ga0439431_0005016 Ga0439431_0005016_125_964 275
942 3300042002 Ga0439442_032915 Ga0439442_032915_147_980 275
943 3300042004 Ga0439445_0010157 Ga0439445_0010157_909_1742 275
944 3300042156 Ga0439446_0002795 Ga0439446_0002795_2444_3277 275
945 3300042157 Ga0439458_0029773 Ga0439458_0029773_440_1273 275
946 3300044656 Ga0466969_0072790 Ga0466969_0072790_204_1046 275
947 3300044658 Ga0466972_0009003 Ga0466972_0009003_2621_3463 275
948 3300044658 Ga0466972_0012265 Ga0466972_0012265_165_1001 275
949 3300044658 Ga0466972_0032237 Ga0466972_0032237_131_973 275
950 3300044658 Ga0466972_0036552 Ga0466972_0036552_367_1194 275
951 3300044658 Ga0466972_0061415 Ga0466972_0061415_847_1722 275
952 3300044658 Ga0466972_0102846 Ga0466972_0102846_299_1141 275
953 3300044683 Ga0466965_0001140 Ga0466965_0001140_8115_8942 275
954 3300044683 Ga0466965_0008211 Ga0466965_0008211_309_1136 275
955 3300044683 Ga0466965_0015890 Ga0466965_0015890_1546_2388 275
956 3300044683 Ga0466965_0022572 Ga0466965_0022572_1990_2817 275
957 3300044684 Ga0466966_0013542 Ga0466966_0013542_756_1598 275
958 3300044684 Ga0466966_0031931 Ga0466966_0031931_2123_2992 275
959 3300044684 Ga0466966_0075407 Ga0466966_0075407_1183_2025 275
960 3300044693 Ga0466961_0005475 Ga0466961_0005475_1967_2809 275
961 3300044693 Ga0466961_0007256 Ga0466961_0007256_3103_3945 275
962 3300044693 Ga0466961_0023713 Ga0466961_0023713_1640_2482 275
963 3300044693 Ga0466961_0080796 Ga0466961_0080796_1083_1952 275
964 3300044693 Ga0466961_0186839 Ga0466961_0186839_241_1083 275
965 3300044694 Ga0466963_0003072 Ga0466963_0003072_2598_3440 275
966 3300044694 Ga0466963_0005300 Ga0466963_0005300_5951_6793 275
967 3300044694 Ga0466963_0030073 Ga0466963_0030073_430_1299 275
968 3300044694 Ga0466963_0034793 Ga0466963_0034793_906_1748 275
969 3300044694 Ga0466963_0041272 Ga0466963_0041272_650_1477 275
970 3300044694 Ga0466963_0050295 Ga0466963_0050295_1854_2681 275
971 3300044694 Ga0466963_0101072 Ga0466963_0101072_509_1378 275
972 3300044694 Ga0466963_0164540 Ga0466963_0164540_392_1219 275
973 3300044694 Ga0466963_0183993 Ga0466963_0183993_596_1438 275
974 3300044694 Ga0466963_0214710 Ga0466963_0214710_168_1037 275
975 3300044694 Ga0466963_0299375 Ga0466963_0299375_265_1092 275
976 3300044706 Ga0466964_0006703 Ga0466964_0006703_1900_2742 275
977 3300044706 Ga0466964_0008724 Ga0466964_0008724_1157_1993 275
978 3300044706 Ga0466964_0011057 Ga0466964_0011057_2023_2850 275
979 3300044706 Ga0466964_0017672 Ga0466964_0017672_480_1307 275
980 3300044706 Ga0466964_0018035 Ga0466964_0018035_190_1017 275
981 3300044719 Ga0466971_0001114 Ga0466971_0001114_2278_3147 275
982 3300044719 Ga0466971_0007769 Ga0466971_0007769_3648_4490 275
983 3300044719 Ga0466971_0019980 Ga0466971_0019980_1621_2457 275
984 3300044719 Ga0466971_0026523 Ga0466971_0026523_1711_2553 275
985 3300044719 Ga0466971_0041918 Ga0466971_0041918_364_1233 275
986 3300044735 Ga0466968_0055853 Ga0466968_0055853_699_1541 275
987 3300044765 Ga0466970_0004600 Ga0466970_0004600_3700_4527 275
988 3300044765 Ga0466970_0013457 Ga0466970_0013457_1360_2187 275
989 3300044765 Ga0466970_0070641 Ga0466970_0070641_255_1097 275
990 3300044765 Ga0466970_0093227 Ga0466970_0093227_577_1446 275
991 3300044765 Ga0466970_0129608 Ga0466970_0129608_362_1231 275
992 3300044765 Ga0466970_0147130 Ga0466970_0147130_326_1153 275
993 3300044765 Ga0466970_0157035 Ga0466970_0157035_211_1038 275
994 3300044765 Ga0466970_0201372 Ga0466970_0201372_151_978 275
995 3300044842 Ga0466957_0002349 Ga0466957_0002349_984_1853 275
996 3300044842 Ga0466957_0006840 Ga0466957_0006840_5363_6199 275
997 3300044842 Ga0466957_0011694 Ga0466957_0011694_2053_2895 275
998 3300044842 Ga0466957_0013850 Ga0466957_0013850_2652_3494 275
999 3300044842 Ga0466957_0027493 Ga0466957_0027493_2430_3299 275
1000 3300044842 Ga0466957_0088785 Ga0466957_0088785_48_884 275
1001 3300044842 Ga0466957_0217483 Ga0466957_0217483_137_964 275
1002 3300044901 Ga0466960_0000786 Ga0466960_0000786_7879_8706 275
1003 3300044901 Ga0466960_0006193 Ga0466960_0006193_2435_3262 275
1004 3300044901 Ga0466960_0008988 Ga0466960_0008988_2936_3763 275
1005 3300044901 Ga0466960_0019338 Ga0466960_0019338_779_1606 275
1006 3300044901 Ga0466960_0076153 Ga0466960_0076153_783_1610 275
1007 3300044901 Ga0466960_0090361 Ga0466960_0090361_505_1347 275
1008 3300044901 Ga0466960_0095269 Ga0466960_0095269_499_1383 275
1009 3300044901 Ga0466960_0172058 Ga0466960_0172058_111_962 275
1010 3300045049 Ga0466959_0032516 Ga0466959_0032516_2709_3551 275
1011 3300045049 Ga0466959_0115172 Ga0466959_0115172_950_1819 275
1012 3300045049 Ga0466959_0280236 Ga0466959_0280236_42_884 275
1013 3300045051 Ga0451576_0121267 Ga0451576_0121267_528_1355 275
1014 3300045836 Ga0466958_0014202 Ga0466958_0014202_3230_4072 275
1015 3300045836 Ga0466958_0016820 Ga0466958_0016820_3216_4058 275
1016 3300045836 Ga0466958_0017847 Ga0466958_0017847_998_1825 275
1017 3300045836 Ga0466958_0020765 Ga0466958_0020765_198_1067 275
1018 3300045836 Ga0466958_0097302 Ga0466958_0097302_101_937 275
1019 3300045836 Ga0466958_0098165 Ga0466958_0098165_608_1450 275
1020 3300045976 Ga0466967_0007727 Ga0466967_0007727_2798_3640 275
1021 3300045976 Ga0466967_0010100 Ga0466967_0010100_3852_4694 275
1022 3300045976 Ga0466967_0013766 Ga0466967_0013766_1529_2398 275
1023 3300045976 Ga0466967_0033451 Ga0466967_0033451_3253_4122 275
1024 3300045976 Ga0466967_0049511 Ga0466967_0049511_1282_2124 275
1025 3300045976 Ga0466967_0075576 Ga0466967_0075576_1887_2729 275
1026 3300045976 Ga0466967_0081691 Ga0466967_0081691_847_1683 275
1027 3300045976 Ga0466967_0107214 Ga0466967_0107214_1358_2227 275
1028 3300045976 Ga0466967_0116273 Ga0466967_0116273_377_1204 275
1029 3300045976 Ga0466967_0179493 Ga0466967_0179493_642_1484 275
1030 3300045976 Ga0466967_0232776 Ga0466967_0232776_86_937 275
1031 3300045976 Ga0466967_0267844 Ga0466967_0267844_349_1200 275
1032 3300045976 Ga0466967_0275732 Ga0466967_0275732_433_1260 275
1033 3300045976 Ga0466967_0413791 Ga0466967_0413791_268_1095 275
1034 3300045976 Ga0466967_0724037 Ga0466967_0724037_127_963 275
1035 3300046511 Ga0495608_0276261 Ga0495608_0276261_178_1005 275
1036 3300046525 Ga0495663_0006886 Ga0495663_0006886_144_1013 275
1037 3300046615 Ga0495656_0021950 Ga0495656_0021950_1368_2237 275
1038 3300046616 Ga0495668_0175880 Ga0495668_0175880_16_885 275
1039 3300046663 Ga0495635_0136485 Ga0495635_0136485_426_1268 275
1040 3300046663 Ga0495635_0261225 Ga0495635_0261225_99_926 275
1041 3300046683 Ga0495658_0077576 Ga0495658_0077576_654_1481 275
1042 3300046683 Ga0495658_0088750 Ga0495658_0088750_916_1743 275
1043 3300046683 Ga0495658_0091824 Ga0495658_0091824_174_1001 275
1044 3300047471 Ga0495684_0246944 Ga0495684_0246944_10_876 275
1045 3300048903 Ga0496100_0055893 Ga0496100_0055893_414_1241 275
1046 3300048903 Ga0496100_0341397 Ga0496100_0341397_266_1093 275
1047 3300048904 Ga0496101_0017790 Ga0496101_0017790_371_1198 275
1048 3300048904 Ga0496101_0048577 Ga0496101_0048577_1769_2620 275
1049 3300048904 Ga0496101_0138648 Ga0496101_0138648_640_1467 275
1050 3300048904 Ga0496101_0344468 Ga0496101_0344468_97_924 275
1051 3300048905 Ga0496102_0000023 Ga0496102_0000023_234409_235260 275
1052 3300048905 Ga0496102_0002562 Ga0496102_0002562_8384_9229 275
1053 3300048905 Ga0496102_0061256 Ga0496102_0061256_370_1197 275
1054 3300048905 Ga0496102_0068124 Ga0496102_0068124_920_1747 275
1055 3300048905 Ga0496102_0226982 Ga0496102_0226982_491_1318 275
1056 3300048905 Ga0496102_0416513 Ga0496102_0416513_199_1026 275
1057 3300048906 Ga0496103_0000039 Ga0496103_0000039_136293_137144 275
1058 3300048906 Ga0496103_0004297 Ga0496103_0004297_6741_7568 275
1059 3300048906 Ga0496103_0033995 Ga0496103_0033995_1927_2772 275
1060 3300048906 Ga0496103_0036271 Ga0496103_0036271_1193_2020 275
1061 3300048906 Ga0496103_0047929 Ga0496103_0047929_138_965 275
1062 3300048907 Ga0496104_0150178 Ga0496104_0150178_324_1151 275
1063 3300048907 Ga0496104_0364854 Ga0496104_0364854_281_1108 275
1064 3300048908 Ga0496105_0184620 Ga0496105_0184620_504_1331 275
1065 3300048909 Ga0496106_0003036 Ga0496106_0003036_10011_10838 275
1066 3300048909 Ga0496106_0188236 Ga0496106_0188236_528_1355 275
1067 3300048909 Ga0496106_0224619 Ga0496106_0224619_439_1290 275
1068 3300048909 Ga0496106_0287512 Ga0496106_0287512_138_965 275
1069 3300048909 Ga0496106_0416808 Ga0496106_0416808_187_1014 275
1070 3300048909 Ga0496106_0511942 Ga0496106_0511942_94_933 275
1071 3300048910 Ga0496107_0023844 Ga0496107_0023844_1334_2161 275
1072 3300048910 Ga0496107_0031829 Ga0496107_0031829_2362_3189 275
1073 3300048910 Ga0496107_0267148 Ga0496107_0267148_78_905 275
1074 3300048911 Ga0496108_0021620 Ga0496108_0021620_2794_3621 275
1075 3300048911 Ga0496108_0091556 Ga0496108_0091556_146_985 275
1076 3300048911 Ga0496108_0106822 Ga0496108_0106822_1248_2075 275
1077 3300048911 Ga0496108_0108974 Ga0496108_0108974_330_1157 275
1078 3300048911 Ga0496108_0119741 Ga0496108_0119741_288_1115 275
1079 3300048911 Ga0496108_0207961 Ga0496108_0207961_443_1270 275
1080 3300048911 Ga0496108_0483497 Ga0496108_0483497_189_1058 275
1081 3300048912 Ga0496109_0051091 Ga0496109_0051091_562_1389 275
1082 3300048912 Ga0496109_0066613 Ga0496109_0066613_2260_3087 275
1083 3300048912 Ga0496109_0088402 Ga0496109_0088402_1915_2742 275
1084 3300048912 Ga0496109_0109648 Ga0496109_0109648_150_977 275
1085 3300048912 Ga0496109_0227915 Ga0496109_0227915_324_1151 275
1086 3300048912 Ga0496109_0253538 Ga0496109_0253538_756_1583 275
1087 3300048912 Ga0496109_0473604 Ga0496109_0473604_323_1150 275
1088 3300048913 Ga0496110_0060539 Ga0496110_0060539_2116_2943 275
1089 3300048913 Ga0496110_0100624 Ga0496110_0100624_308_1147 275
1090 3300048913 Ga0496110_0346753 Ga0496110_0346753_216_1043 275
1091 3300048914 Ga0496111_0001576 Ga0496111_0001576_4889_5716 275
1092 3300048914 Ga0496111_0049098 Ga0496111_0049098_1842_2669 275
1093 3300048914 Ga0496111_0197411 Ga0496111_0197411_359_1231 275
1094 3300048914 Ga0496111_0307361 Ga0496111_0307361_326_1153 275
1095 3300048915 Ga0496112_0443976 Ga0496112_0443976_307_1134 275
1096 3300048915 Ga0496112_0601079 Ga0496112_0601079_19_846 275
1097 3300048915 Ga0496112_0814788 Ga0496112_0814788_14_841 275
1098 3300048917 Ga0496114_0029996 Ga0496114_0029996_1390_2217 275
1099 3300048917 Ga0496114_0055012 Ga0496114_0055012_1424_2251 275
1100 3300048917 Ga0496114_0083393 Ga0496114_0083393_1148_1975 275
1101 3300048917 Ga0496114_0251456 Ga0496114_0251456_468_1295 275
1102 3300048917 Ga0496114_0260371 Ga0496114_0260371_199_1038 275
1103 3300048917 Ga0496114_0339342 Ga0496114_0339342_393_1220 275
1104 3300048917 Ga0496114_0485339 Ga0496114_0485339_238_1065 275
1105 3300048918 Ga0496115_0127160 Ga0496115_0127160_521_1360 275
1106 3300048921 Ga0496118_0026452 Ga0496118_0026452_3092_3943 275
1107 3300048924 Ga0496121_0188261 Ga0496121_0188261_51_902 275
1108 3300049568 Ga0501031_0059908 Ga0501031_0059908_188_1027 275
1109 3300049568 Ga0501031_0121655 Ga0501031_0121655_507_1346 275
1110 3300049568 Ga0501031_0173507 Ga0501031_0173507_124_951 275
1111 3300049568 Ga0501031_0206669 Ga0501031_0206669_44_880 275
1112 3300049569 Ga0501032_0081624 Ga0501032_0081624_434_1261 275
1113 3300049570 Ga0501033_0043093 Ga0501033_0043093_58_885 275
1114 3300049571 Ga0501034_0247525 Ga0501034_0247525_369_1196 275
1115 3300049572 Ga0501036_0098243 Ga0501036_0098243_1071_1898 275
1116 3300049572 Ga0501036_0301608 Ga0501036_0301608_102_971 275
1117 3300049573 Ga0501037_0151515 Ga0501037_0151515_75_944 275
1118 3300049574 Ga0501038_0008275 Ga0501038_0008275_3683_4510 275
1119 3300049575 Ga0501039_0013152 Ga0501039_0013152_444_1280 275
1120 3300049575 Ga0501039_0061912 Ga0501039_0061912_123_950 275
1121 3300049576 Ga0501040_0041849 Ga0501040_0041849_765_1601 275
1122 3300049576 Ga0501040_0195198 Ga0501040_0195198_220_1059 275
1123 3300049576 Ga0501040_0240290 Ga0501040_0240290_62_898 275
1124 3300049577 Ga0501041_0224322 Ga0501041_0224322_264_1100 275
1125 3300049578 Ga0501042_0092943 Ga0501042_0092943_1167_2003 275
1126 3300049578 Ga0501042_0162335 Ga0501042_0162335_746_1573 275
1127 3300049579 Ga0501043_0324584 Ga0501043_0324584_77_949 275
1128 3300049580 Ga0501046_0471217 Ga0501046_0471217_27_854 275
1129 3300049581 Ga0501047_0029534 Ga0501047_0029534_1575_2402 275
1130 3300049582 Ga0501048_0011892 Ga0501048_0011892_2110_2946 275
1131 3300049582 Ga0501048_0227008 Ga0501048_0227008_123_950 275
1132 3300049583 Ga0501067_0001788 Ga0501067_0001788_9504_10331 275
1133 3300049583 Ga0501067_0021546 Ga0501067_0021546_395_1222 275
1134 3300049583 Ga0501067_0023273 Ga0501067_0023273_2453_3280 275
1135 3300049583 Ga0501067_0052242 Ga0501067_0052242_773_1600 275
1136 3300049583 Ga0501067_0086619 Ga0501067_0086619_695_1522 275
1137 3300049583 Ga0501067_0216241 Ga0501067_0216241_46_873 275
1138 3300049584 Ga0501068_0017891 Ga0501068_0017891_1573_2400 275
1139 3300049585 Ga0501069_0000908 Ga0501069_0000908_5855_6727 275
1140 3300049585 Ga0501069_0051122 Ga0501069_0051122_24_851 275
1141 3300049585 Ga0501069_0090818 Ga0501069_0090818_422_1249 275
1142 3300049585 Ga0501069_0092661 Ga0501069_0092661_400_1227 275
1143 3300049585 Ga0501069_0117268 Ga0501069_0117268_397_1224 275
1144 3300049586 Ga0501070_0012605 Ga0501070_0012605_38_865 275
1145 3300049586 Ga0501070_0013510 Ga0501070_0013510_214_1086 275
1146 3300049586 Ga0501070_0028176 Ga0501070_0028176_2086_2958 275
1147 3300049586 Ga0501070_0244859 Ga0501070_0244859_552_1379 275
1148 3300049586 Ga0501070_0346104 Ga0501070_0346104_335_1186 275
1149 3300049587 Ga0501071_0123760 Ga0501071_0123760_470_1306 275
1150 3300049587 Ga0501071_0196861 Ga0501071_0196861_559_1386 275
1151 3300049588 Ga0501072_0069844 Ga0501072_0069844_1643_2470 275
1152 3300049588 Ga0501072_0205407 Ga0501072_0205407_240_1067 275
1153 3300049589 Ga0501073_0004454 Ga0501073_0004454_8205_9032 275
1154 3300049589 Ga0501073_0009952 Ga0501073_0009952_559_1431 275
1155 3300049589 Ga0501073_0023714 Ga0501073_0023714_2028_2855 275
1156 3300049589 Ga0501073_0238230 Ga0501073_0238230_104_931 275
1157 3300049589 Ga0501073_0238320 Ga0501073_0238320_79_906 275
1158 3300049590 Ga0501074_0063442 Ga0501074_0063442_1139_2011 275
1159 3300049741 Ga0501079_0000248 Ga0501079_0000248_5353_6225 275
1160 3300049741 Ga0501079_0235299 Ga0501079_0235299_541_1368 275
1161 3300049742 Ga0501080_0002288 Ga0501080_0002288_2252_3124 275
1162 3300049742 Ga0501080_0003333 Ga0501080_0003333_8193_9065 275
1163 3300049742 Ga0501080_0005815 Ga0501080_0005815_8878_9705 275
1164 3300049742 Ga0501080_0093870 Ga0501080_0093870_1142_1969 275
1165 3300049742 Ga0501080_0123452 Ga0501080_0123452_359_1186 275
1166 3300049743 Ga0501081_0062297 Ga0501081_0062297_691_1566 275
1167 3300049743 Ga0501081_0170987 Ga0501081_0170987_626_1453 275
1168 3300049743 Ga0501081_0334957 Ga0501081_0334957_141_980 275
1169 3300049744 Ga0501083_0023410 Ga0501083_0023410_535_1362 275
1170 3300049822 Ga0501035_0022469 Ga0501035_0022469_2845_3672 275
1171 3300049823 Ga0501044_0008214 Ga0501044_0008214_9232_10104 275
1172 3300049823 Ga0501044_0042726 Ga0501044_0042726_3142_3969 275
1173 3300049823 Ga0501044_0181422 Ga0501044_0181422_685_1512 275
1174 3300049824 Ga0501045_0025826 Ga0501045_0025826_1226_2062 275
1175 3300050490 nmdc:mga03n38_1705_c1 nmdc:mga03n38_1705_c1_1781_2608 275
1176 3300050490 nmdc:mga03n38_27789_c1 nmdc:mga03n38_27789_c1_598_1425 275
1177 3300050490 nmdc:mga03n38_92968_c1 nmdc:mga03n38_92968_c1_158_985 275
1178 3300050491 nmdc:mga00v17_127094_c1 nmdc:mga00v17_127094_c1_432_1259 275
1179 3300050491 nmdc:mga00v17_22538_c1 nmdc:mga00v17_22538_c1_791_1630 275
1180 3300050491 nmdc:mga00v17_25580_c1 nmdc:mga00v17_25580_c1_1523_2350 275
1181 3300050491 nmdc:mga00v17_290421_c1 nmdc:mga00v17_290421_c1_160_999 275
1182 3300050492 nmdc:mga0yw44_14826_c1 nmdc:mga0yw44_14826_c1_2266_3093 275
1183 3300050492 nmdc:mga0yw44_2006_c2 nmdc:mga0yw44_2006_c2_36_875 275
1184 3300050492 nmdc:mga0yw44_245025_c1 nmdc:mga0yw44_245025_c1_297_1124 275
1185 3300050492 nmdc:mga0yw44_46667_c1 nmdc:mga0yw44_46667_c1_1462_2289 275
1186 3300050492 nmdc:mga0yw44_69008_c1 nmdc:mga0yw44_69008_c1_44_883 275
1187 3300050494 nmdc:mga06z11_3351_c1 nmdc:mga06z11_3351_c1_2477_3304 275
1188 3300050494 nmdc:mga06z11_51099_c1 nmdc:mga06z11_51099_c1_703_1530 275
1189 3300050495 nmdc:mga04h51_105079_c1 nmdc:mga04h51_105079_c1_133_972 275
1190 3300050495 nmdc:mga04h51_13608_c1 nmdc:mga04h51_13608_c1_312_1139 275
1191 3300050495 nmdc:mga04h51_43591_c1 nmdc:mga04h51_43591_c1_312_1139 275
1192 3300050496 nmdc:mga07m45_12979_c1 nmdc:mga07m45_12979_c1_3110_3937 275
1193 3300050496 nmdc:mga07m45_36850_c1 nmdc:mga07m45_36850_c1_814_1653 275
1194 3300050496 nmdc:mga07m45_9308_c1 nmdc:mga07m45_9308_c1_602_1429 275
1195 3300050507 nmdc:mga05p37_18567_c1 nmdc:mga05p37_18567_c1_5268_6107 275
1196 3300050508 nmdc:mga09592_8873_c1 nmdc:mga09592_8873_c1_5090_5929 275
1197 3300050509 nmdc:mga0qj67_5949_c1 nmdc:mga0qj67_5949_c1_1223_2062 275
1198 3300050510 nmdc:mga06r32_2767_c1 nmdc:mga06r32_2767_c1_5168_6007 275
1199 3300050510 nmdc:mga06r32_376_c1 nmdc:mga06r32_376_c1_16327_17166 275
1200 3300050511 nmdc:mga08y16_141283_c1 nmdc:mga08y16_141283_c1_335_1171 275
1201 3300050511 nmdc:mga08y16_15681_c1 nmdc:mga08y16_15681_c1_138_977 275
1202 3300050515 nmdc:mga0a205_46570_c1 nmdc:mga0a205_46570_c1_1932_2771 275
1203 3300053077 Ga0495601_0159668 Ga0495601_0159668_79_906 275
1204 3300053084 Ga0495595_0195748 Ga0495595_0195748_34_861 275
1205 3300053085 Ga0495619_0008085 Ga0495619_0008085_1151_1978 275
1206 3300053085 Ga0495619_0190927 Ga0495619_0190927_153_980 275
1207 3300053088 Ga0500644_0000003 Ga0500644_0000003_43369_44196 275
1208 3300053088 Ga0500644_0018585 Ga0500644_0018585_79_906 275
1209 3300053102 Ga0500554_037542 Ga0500554_037542_476_1303 275
1210 3300053104 Ga0500556_0001669 Ga0500556_0001669_5786_6613 275
1211 3300053117 Ga0500593_000037 Ga0500593_000037_4612_5439 275
1212 3300054114 Ga0501084_0158378 Ga0501084_0158378_485_1312 275
1213 3300059423 Ga0590074_027277 Ga0590074_027277_78_905 275
1214 3300059426 Ga0590077_036674 Ga0590077_036674_26_853 275
1215 3300060353 Ga0501082_0342946 Ga0501082_0342946_31_858 275
1216 3300061719 Ga0466962_0002130 Ga0466962_0002130_2075_2917 275
1217 3300061719 Ga0466962_0015122 Ga0466962_0015122_1324_2151 275
1218 3300061719 Ga0466962_0015415 Ga0466962_0015415_2333_3175 275
1219 3300061719 Ga0466962_0058568 Ga0466962_0058568_630_1472 275
1220 3300061734 Ga0530510_0121314 Ga0530510_0121314_1064_1891 275

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02405

MlaE

Permease MlaE

79

289

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fef-assembly1.cif.gz_J structure of mce1 transporter from mycobacterium smegmatis (map0) 0.8817 14 271
8fef-assembly1.cif.gz_J structure of mce1 transporter from mycobacterium smegmatis (map0) 0.8631 14 271
6z5u-assembly1.cif.gz_B cryo-em structure of the a. baumannii mlabdef complex bound to appnhp 0.848 4 266
6z5u-assembly1.cif.gz_B cryo-em structure of the a. baumannii mlabdef complex bound to appnhp 0.842 4 266
6zy9-assembly1.cif.gz_H cryo-em structure of mlafedb in complex with amp-pnp 0.8393 3 266
ID Description Score Start End Superfamily
af_A4IBQ2_333_497_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.4432 70 254 1.10.1760.20
af_Q9V3Y4_23_306_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.4353 122 270 1.50.40.10
af_A4IBQ2_333_497_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.435 70 254 1.10.1760.20
af_Q96JW4_154_338_1.10.357.20 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain 0.4121 64 264 1.10.357.20
af_A0A0R0KD43_41_201_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.4108 65 257 1.10.1760.20
ID Description Score Start End GO Terms
AF-A0A2S8BML2-F1-model_v4 Putative phospholipid ABC transporter permease protein MlaE 0.9562 64 268 GO:0005548
GO:0043190
AF-A0A2S8MH05-F1-model_v4 deleted 0.9534 66 253
AF-A0A2S8MH05-F1-model_v4 deleted 0.9389 66 253
AF-A0A1Z4L2A9-F1-model_v4 deleted 0.9385 61 264
AF-A0A1F3XW93-F1-model_v4 ABC transporter permease 0.9344 59 261 GO:0005548
GO:0043190

Feature Viewer

pLDDT pTM Quality
87.69 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map