F491756
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1213 | 460 | 1211 | 71 |
Family's Representative Sequence
| Representative Sequence | 3300044658|Ga0466972_0000303|Ga0466972_0000303_18099_18353 |
| Length | 84 |
| Sequence | MADQGLIGFDQRIMSDTPKRAATVEVVAADLQGPGVVFCPNPKMPLWSNHPRVFIDVATTGEGWCPYCSTVYKLKAGEKLPAHH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 2 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 3 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 4 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 5 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 16 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 78 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 79 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 80 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 81 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 82 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 84 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 85 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 86 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 94 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 95 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 96 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 111 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 112 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 113 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 114 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 129 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 131 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 132 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 133 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 203 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 204 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 206 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 207 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 211 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 212 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 213 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 214 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 215 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 216 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 217 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 218 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 219 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 220 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 221 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 222 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 223 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 224 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 225 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 226 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 227 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 228 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 229 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 230 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 231 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 232 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 233 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 234 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 235 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 236 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 237 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 238 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 239 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 240 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 241 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 242 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 243 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 244 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 245 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 246 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 247 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 248 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 249 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 250 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 251 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 252 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 254 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 255 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 256 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 257 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 258 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 259 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 260 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 261 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 262 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 263 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 264 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 265 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 266 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 267 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 268 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 269 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 270 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 271 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 272 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 273 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 274 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 275 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 276 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 277 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 278 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 279 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 280 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 281 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 282 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 283 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 284 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 285 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 286 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 287 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 288 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 289 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 290 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 291 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 292 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 293 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 294 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 295 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 296 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 297 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 298 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 299 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 300 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 301 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 302 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 303 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 304 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 305 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 306 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 307 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 308 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 309 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 310 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 311 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 312 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 313 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 314 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 315 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 316 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 317 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 318 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 319 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 320 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 321 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 322 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 323 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 365 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 366 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 367 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 368 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 369 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 370 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 371 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 372 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 373 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 374 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 375 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 376 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 377 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 378 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 379 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 380 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 381 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 382 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 383 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 384 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 392 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 393 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 394 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 395 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 396 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 397 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 398 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 399 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 400 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 401 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 402 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 403 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 404 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 405 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 406 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 407 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 408 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 409 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 410 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 411 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 413 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 414 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 415 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 416 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 417 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 418 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 419 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 420 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 421 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 422 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 423 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 424 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 425 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 426 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 427 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 428 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 429 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 430 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 431 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 432 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 433 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 434 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 435 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 436 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 437 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 438 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 439 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 440 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 442 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 443 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 444 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 445 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 446 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 447 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 448 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 449 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 452 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 453 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 454 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 455 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 456 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 457 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 458 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 459 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 460 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.35 |
| Metatranscriptomes | 1.48 |
| Isolates | 0.16 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.56 |
| Nodule | 0.49 |
| Rhizoplane | 4.53 |
| Rhizosphere | 81.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.79 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24744J21845_10021994 | 3300002077 | Bacteria | 1253 |
| 2 | JGI24742J22300_10081240 | 3300002244 | Bacteria | 613 |
| 3 | rootH1_10003598 | 3300003316 | Bacteria | 4171 |
| 4 | rootH2_10029593 | 3300003320 | Bacteria | 2113 |
| 5 | rootL2_10001906 | 3300003322 | Bacteria | 13343 |
| 6 | rootL2_10027947 | 3300003322 | Bacteria | 28083 |
| 7 | rootH1_10003292 | 3300003323 | Bacteria | 2196 |
| 8 | rootH1_10003293 | 3300003323 | Bacteria | 15628 |
| 9 | Ga0055526_1024551 | 3300003771 | Bacteria | 1967 |
| 10 | Ga0055524_1000162 | 3300003775 | Bacteria | 77486 |
| 11 | Ga0055528_1075278 | 3300003790 | Bacteria | 602 |
| 12 | Ga0055530_10005149 | 3300003791 | Bacteria | 6376 |
| 13 | Ga0055530_10024256 | 3300003791 | Bacteria | 1725 |
| 14 | Ga0055540_1000007 | 3300003792 | Bacteria | 318178 |
| 15 | Ga0055540_1048691 | 3300003792 | Bacteria | 882 |
| 16 | Ga0055531_10002886 | 3300003794 | Bacteria | 11193 |
| 17 | Ga0055531_10013558 | 3300003794 | Bacteria | 3748 |
| 18 | Ga0055531_10013883 | 3300003794 | Bacteria | 3677 |
| 19 | Ga0055531_10119979 | 3300003794 | Bacteria | 514 |
| 20 | Ga0065165_1000086 | 3300005262 | Bacteria | 154235 |
| 21 | Ga0065165_1003210 | 3300005262 | Bacteria | 11915 |
| 22 | Ga0065715_10150019 | 3300005293 | Bacteria | 1740 |
| 23 | Ga0065707_10107246 | 3300005295 | Bacteria | 2562 |
| 24 | Ga0065707_10218566 | 3300005295 | Bacteria | 1217 |
| 25 | Ga0070658_10037488 | 3300005327 | Bacteria | 3908 |
| 26 | Ga0070658_10532818 | 3300005327 | Bacteria | 1016 |
| 27 | Ga0070658_10712175 | 3300005327 | Bacteria | 871 |
| 28 | Ga0070658_11431759 | 3300005327 | Bacteria | 599 |
| 29 | Ga0070676_10000461 | 3300005328 | Bacteria | 19451 |
| 30 | Ga0070676_10188357 | 3300005328 | Bacteria | 1345 |
| 31 | Ga0070676_10568668 | 3300005328 | Bacteria | 814 |
| 32 | Ga0070676_10749959 | 3300005328 | Bacteria | 716 |
| 33 | Ga0070676_10916169 | 3300005328 | Bacteria | 654 |
| 34 | Ga0070683_100002657 | 3300005329 | Bacteria | 14284 |
| 35 | Ga0070683_100756950 | 3300005329 | Bacteria | 931 |
| 36 | Ga0070683_101712464 | 3300005329 | Bacteria | 604 |
| 37 | Ga0070683_102167617 | 3300005329 | Bacteria | 534 |
| 38 | Ga0070690_100061053 | 3300005330 | Bacteria | 2427 |
| 39 | Ga0070690_100128639 | 3300005330 | Bacteria | 1708 |
| 40 | Ga0070690_100953649 | 3300005330 | Bacteria | 674 |
| 41 | Ga0070670_100082742 | 3300005331 | Bacteria | 2758 |
| 42 | Ga0070670_100121665 | 3300005331 | Bacteria | 2251 |
| 43 | Ga0070670_100157279 | 3300005331 | Bacteria | 1969 |
| 44 | Ga0070670_100163031 | 3300005331 | Bacteria | 1932 |
| 45 | Ga0070670_100277458 | 3300005331 | Bacteria | 1463 |
| 46 | Ga0070670_100321255 | 3300005331 | Bacteria | 1356 |
| 47 | Ga0070670_100740322 | 3300005331 | Bacteria | 885 |
| 48 | Ga0070670_100767372 | 3300005331 | Bacteria | 869 |
| 49 | Ga0070670_100788634 | 3300005331 | Bacteria | 857 |
| 50 | Ga0070670_100894621 | 3300005331 | Bacteria | 805 |
| 51 | Ga0070670_101209809 | 3300005331 | Bacteria | 690 |
| 52 | Ga0070677_10007562 | 3300005333 | Bacteria | 3632 |
| 53 | Ga0070677_10013313 | 3300005333 | Bacteria | 2875 |
| 54 | Ga0070677_10088375 | 3300005333 | Bacteria | 1342 |
| 55 | Ga0070677_10161518 | 3300005333 | Bacteria | 1052 |
| 56 | Ga0070677_10379619 | 3300005333 | Bacteria | 739 |
| 57 | Ga0070677_10404198 | 3300005333 | Bacteria | 720 |
| 58 | Ga0070677_10496518 | 3300005333 | Bacteria | 661 |
| 59 | Ga0070677_10623503 | 3300005333 | Bacteria | 600 |
| 60 | Ga0068869_100005237 | 3300005334 | Bacteria | 8145 |
| 61 | Ga0068869_100056006 | 3300005334 | Bacteria | 2874 |
| 62 | Ga0068869_100214971 | 3300005334 | Bacteria | 1521 |
| 63 | Ga0068869_100385446 | 3300005334 | Bacteria | 1149 |
| 64 | Ga0068869_100978383 | 3300005334 | Bacteria | 736 |
| 65 | Ga0068869_101444504 | 3300005334 | Bacteria | 610 |
| 66 | Ga0068869_101614653 | 3300005334 | Bacteria | 578 |
| 67 | Ga0070666_10172127 | 3300005335 | Bacteria | 1516 |
| 68 | Ga0070666_10205065 | 3300005335 | Bacteria | 1387 |
| 69 | Ga0070666_10336329 | 3300005335 | Bacteria | 1079 |
| 70 | Ga0070666_10495351 | 3300005335 | Bacteria | 885 |
| 71 | Ga0070666_10986349 | 3300005335 | Bacteria | 625 |
| 72 | Ga0070680_100033672 | 3300005336 | Bacteria | 4131 |
| 73 | Ga0070682_100729376 | 3300005337 | Bacteria | 798 |
| 74 | Ga0070682_100803104 | 3300005337 | Bacteria | 764 |
| 75 | Ga0068868_100003772 | 3300005338 | Bacteria | 10579 |
| 76 | Ga0068868_100038470 | 3300005338 | Bacteria | 3713 |
| 77 | Ga0068868_100098048 | 3300005338 | Bacteria | 2369 |
| 78 | Ga0068868_100222516 | 3300005338 | Bacteria | 1581 |
| 79 | Ga0070660_100038847 | 3300005339 | Bacteria | 3615 |
| 80 | Ga0070660_100292667 | 3300005339 | Bacteria | 1334 |
| 81 | Ga0070660_100573144 | 3300005339 | Bacteria | 942 |
| 82 | Ga0070660_100645233 | 3300005339 | Bacteria | 886 |
| 83 | Ga0070660_101892275 | 3300005339 | Bacteria | 508 |
| 84 | Ga0070689_100126876 | 3300005340 | Bacteria | 2043 |
| 85 | Ga0070689_100615911 | 3300005340 | Bacteria | 941 |
| 86 | Ga0070687_100070250 | 3300005343 | Bacteria | 1878 |
| 87 | Ga0070687_100318600 | 3300005343 | Bacteria | 993 |
| 88 | Ga0070661_100033916 | 3300005344 | Bacteria | 3700 |
| 89 | Ga0070661_100503360 | 3300005344 | Bacteria | 970 |
| 90 | Ga0070692_10125892 | 3300005345 | Bacteria | 1435 |
| 91 | Ga0070692_11218408 | 3300005345 | Bacteria | 537 |
| 92 | Ga0070668_100072024 | 3300005347 | Bacteria | 2692 |
| 93 | Ga0070668_100117952 | 3300005347 | Bacteria | 2118 |
| 94 | Ga0070668_100321570 | 3300005347 | Bacteria | 1303 |
| 95 | Ga0070668_100682415 | 3300005347 | Bacteria | 905 |
| 96 | Ga0070668_100731276 | 3300005347 | Bacteria | 875 |
| 97 | Ga0070668_101044436 | 3300005347 | Bacteria | 736 |
| 98 | Ga0070668_102270204 | 3300005347 | Bacteria | 502 |
| 99 | Ga0070669_100012530 | 3300005353 | Bacteria | 6014 |
| 100 | Ga0070669_100059940 | 3300005353 | Bacteria | 2794 |
| 101 | Ga0070669_100125241 | 3300005353 | Bacteria | 1965 |
| 102 | Ga0070669_100187143 | 3300005353 | Bacteria | 1622 |
| 103 | Ga0070669_100364633 | 3300005353 | Bacteria | 1175 |
| 104 | Ga0070669_100415872 | 3300005353 | Bacteria | 1103 |
| 105 | Ga0070675_100036510 | 3300005354 | Bacteria | 3999 |
| 106 | Ga0070675_100081897 | 3300005354 | Bacteria | 2692 |
| 107 | Ga0070675_100150278 | 3300005354 | Bacteria | 1996 |
| 108 | Ga0070675_100390177 | 3300005354 | Bacteria | 1240 |
| 109 | Ga0070675_100995825 | 3300005354 | Bacteria | 769 |
| 110 | Ga0070675_101291210 | 3300005354 | Bacteria | 672 |
| 111 | Ga0070671_100000158 | 3300005355 | Bacteria | 44456 |
| 112 | Ga0070671_100001245 | 3300005355 | Bacteria | 19079 |
| 113 | Ga0070671_100030059 | 3300005355 | Bacteria | 4483 |
| 114 | Ga0070671_100050580 | 3300005355 | Bacteria | 3456 |
| 115 | Ga0070671_100150995 | 3300005355 | Bacteria | 1962 |
| 116 | Ga0070671_100214533 | 3300005355 | Bacteria | 1633 |
| 117 | Ga0070671_100251765 | 3300005355 | Bacteria | 1500 |
| 118 | Ga0070671_100487619 | 3300005355 | Bacteria | 1059 |
| 119 | Ga0070671_100551903 | 3300005355 | Bacteria | 993 |
| 120 | Ga0070671_100615511 | 3300005355 | Bacteria | 939 |
| 121 | Ga0070671_100770803 | 3300005355 | Bacteria | 837 |
| 122 | Ga0070671_101927230 | 3300005355 | Bacteria | 526 |
| 123 | Ga0070674_100053422 | 3300005356 | Bacteria | 2789 |
| 124 | Ga0070674_100401175 | 3300005356 | Bacteria | 1120 |
| 125 | Ga0070674_100545946 | 3300005356 | Bacteria | 972 |
| 126 | Ga0070674_101538775 | 3300005356 | Bacteria | 598 |
| 127 | Ga0070674_101954598 | 3300005356 | Bacteria | 533 |
| 128 | Ga0070673_100003957 | 3300005364 | Bacteria | 9311 |
| 129 | Ga0070673_100110117 | 3300005364 | Bacteria | 2283 |
| 130 | Ga0070673_100148749 | 3300005364 | Bacteria | 1982 |
| 131 | Ga0070673_100150067 | 3300005364 | Bacteria | 1973 |
| 132 | Ga0070673_100199811 | 3300005364 | Bacteria | 1721 |
| 133 | Ga0070673_100485714 | 3300005364 | Bacteria | 1115 |
| 134 | Ga0070673_100609217 | 3300005364 | Bacteria | 997 |
| 135 | Ga0070673_100741796 | 3300005364 | Bacteria | 904 |
| 136 | Ga0070673_100781873 | 3300005364 | Bacteria | 880 |
| 137 | Ga0070673_101500526 | 3300005364 | Bacteria | 636 |
| 138 | Ga0070673_102203326 | 3300005364 | Bacteria | 524 |
| 139 | Ga0070659_100003957 | 3300005366 | Bacteria | 10542 |
| 140 | Ga0070659_100536357 | 3300005366 | Bacteria | 1000 |
| 141 | Ga0070667_100046188 | 3300005367 | Bacteria | 3663 |
| 142 | Ga0070667_100054743 | 3300005367 | Bacteria | 3369 |
| 143 | Ga0070667_100210364 | 3300005367 | Bacteria | 1728 |
| 144 | Ga0070667_100332487 | 3300005367 | Bacteria | 1373 |
| 145 | Ga0070667_100445002 | 3300005367 | Bacteria | 1183 |
| 146 | Ga0070667_100531703 | 3300005367 | Bacteria | 1079 |
| 147 | Ga0070667_101014174 | 3300005367 | Bacteria | 775 |
| 148 | Ga0070667_101092396 | 3300005367 | Bacteria | 745 |
| 149 | Ga0070703_10493164 | 3300005406 | Bacteria | 550 |
| 150 | Ga0070701_10128634 | 3300005438 | Bacteria | 1436 |
| 151 | Ga0070700_100152310 | 3300005441 | Bacteria | 1583 |
| 152 | Ga0070663_100013605 | 3300005455 | Bacteria | 5193 |
| 153 | Ga0070663_100052271 | 3300005455 | Bacteria | 2914 |
| 154 | Ga0070663_100822722 | 3300005455 | Bacteria | 798 |
| 155 | Ga0070663_100956393 | 3300005455 | Bacteria | 743 |
| 156 | Ga0070663_101635755 | 3300005455 | Bacteria | 575 |
| 157 | Ga0070678_100003077 | 3300005456 | Bacteria | 9249 |
| 158 | Ga0070678_100019501 | 3300005456 | Bacteria | 4424 |
| 159 | Ga0070678_100025454 | 3300005456 | Bacteria | 3981 |
| 160 | Ga0070678_100075598 | 3300005456 | Bacteria | 2534 |
| 161 | Ga0070678_100339332 | 3300005456 | Bacteria | 1288 |
| 162 | Ga0070678_100394619 | 3300005456 | Bacteria | 1200 |
| 163 | Ga0070678_100412546 | 3300005456 | Bacteria | 1176 |
| 164 | Ga0070678_100448670 | 3300005456 | Bacteria | 1129 |
| 165 | Ga0070678_100559072 | 3300005456 | Bacteria | 1017 |
| 166 | Ga0070678_100830827 | 3300005456 | Bacteria | 840 |
| 167 | Ga0070678_102089001 | 3300005456 | Bacteria | 536 |
| 168 | Ga0070662_100001692 | 3300005457 | Bacteria | 13562 |
| 169 | Ga0070662_100002939 | 3300005457 | Bacteria | 10601 |
| 170 | Ga0070662_100014752 | 3300005457 | Bacteria | 5223 |
| 171 | Ga0070662_100106521 | 3300005457 | Bacteria | 2130 |
| 172 | Ga0070662_100178967 | 3300005457 | Bacteria | 1670 |
| 173 | Ga0070662_100188941 | 3300005457 | Bacteria | 1628 |
| 174 | Ga0070662_100288194 | 3300005457 | Bacteria | 1330 |
| 175 | Ga0070662_101202280 | 3300005457 | Bacteria | 652 |
| 176 | Ga0070662_101684507 | 3300005457 | Bacteria | 548 |
| 177 | Ga0070681_10099309 | 3300005458 | Bacteria | 2857 |
| 178 | Ga0068867_100009697 | 3300005459 | Bacteria | 6789 |
| 179 | Ga0068867_100099529 | 3300005459 | Bacteria | 2218 |
| 180 | Ga0068867_100123681 | 3300005459 | Bacteria | 2002 |
| 181 | Ga0068867_100136026 | 3300005459 | Bacteria | 1915 |
| 182 | Ga0068867_100167727 | 3300005459 | Bacteria | 1736 |
| 183 | Ga0068867_100414451 | 3300005459 | Bacteria | 1139 |
| 184 | Ga0068867_100684096 | 3300005459 | Bacteria | 903 |
| 185 | Ga0068867_100870639 | 3300005459 | Bacteria | 808 |
| 186 | Ga0068867_100982266 | 3300005459 | Bacteria | 764 |
| 187 | Ga0068867_101558170 | 3300005459 | Bacteria | 617 |
| 188 | Ga0068867_101855947 | 3300005459 | Bacteria | 568 |
| 189 | Ga0070685_10090539 | 3300005466 | Bacteria | 1851 |
| 190 | Ga0070685_10687883 | 3300005466 | Bacteria | 745 |
| 191 | Ga0070685_11562629 | 3300005466 | Bacteria | 510 |
| 192 | Ga0070707_100145184 | 3300005468 | Bacteria | 2309 |
| 193 | Ga0070698_100396623 | 3300005471 | Bacteria | 1313 |
| 194 | Ga0070699_100475545 | 3300005518 | Bacteria | 1134 |
| 195 | Ga0070699_101251718 | 3300005518 | Bacteria | 681 |
| 196 | Ga0070679_100001707 | 3300005530 | Bacteria | 19792 |
| 197 | Ga0070679_101606854 | 3300005530 | Bacteria | 598 |
| 198 | Ga0070679_101718106 | 3300005530 | Bacteria | 576 |
| 199 | Ga0070684_100031437 | 3300005535 | Bacteria | 4519 |
| 200 | Ga0068853_100059642 | 3300005539 | Bacteria | 3297 |
| 201 | Ga0068853_100108265 | 3300005539 | Bacteria | 2465 |
| 202 | Ga0068853_100261617 | 3300005539 | Bacteria | 1591 |
| 203 | Ga0068853_100285282 | 3300005539 | Bacteria | 1523 |
| 204 | Ga0068853_100331799 | 3300005539 | Bacteria | 1412 |
| 205 | Ga0068853_102079339 | 3300005539 | Bacteria | 551 |
| 206 | Ga0070672_100020047 | 3300005543 | Bacteria | 4870 |
| 207 | Ga0070672_100036467 | 3300005543 | Bacteria | 3746 |
| 208 | Ga0070672_100078038 | 3300005543 | Bacteria | 2649 |
| 209 | Ga0070672_100167529 | 3300005543 | Bacteria | 1825 |
| 210 | Ga0070672_100182863 | 3300005543 | Bacteria | 1747 |
| 211 | Ga0070672_100206087 | 3300005543 | Bacteria | 1646 |
| 212 | Ga0070672_100273181 | 3300005543 | Bacteria | 1428 |
| 213 | Ga0070672_100617109 | 3300005543 | Bacteria | 945 |
| 214 | Ga0070672_100678166 | 3300005543 | Bacteria | 901 |
| 215 | Ga0070672_101163559 | 3300005543 | Bacteria | 686 |
| 216 | Ga0070672_101237582 | 3300005543 | Bacteria | 665 |
| 217 | Ga0070672_101655846 | 3300005543 | Bacteria | 574 |
| 218 | Ga0070672_101695320 | 3300005543 | Bacteria | 568 |
| 219 | Ga0070686_100189355 | 3300005544 | Bacteria | 1467 |
| 220 | Ga0070686_100807700 | 3300005544 | Bacteria | 756 |
| 221 | Ga0070693_100025694 | 3300005547 | Bacteria | 3171 |
| 222 | Ga0070693_100026782 | 3300005547 | Bacteria | 3115 |
| 223 | Ga0070693_100027109 | 3300005547 | Bacteria | 3100 |
| 224 | Ga0070665_100158936 | 3300005548 | Bacteria | 2261 |
| 225 | Ga0070665_100415534 | 3300005548 | Bacteria | 1354 |
| 226 | Ga0070665_100680788 | 3300005548 | Bacteria | 1041 |
| 227 | Ga0070665_101563223 | 3300005548 | Bacteria | 668 |
| 228 | Ga0068855_100007939 | 3300005563 | Bacteria | 12823 |
| 229 | Ga0068855_101240944 | 3300005563 | Bacteria | 774 |
| 230 | Ga0070664_100145676 | 3300005564 | Bacteria | 2088 |
| 231 | Ga0070664_100181364 | 3300005564 | Bacteria | 1871 |
| 232 | Ga0070664_100277123 | 3300005564 | Bacteria | 1512 |
| 233 | Ga0070664_100279810 | 3300005564 | Bacteria | 1504 |
| 234 | Ga0070664_100849782 | 3300005564 | Bacteria | 855 |
| 235 | Ga0070664_101018464 | 3300005564 | Bacteria | 779 |
| 236 | Ga0070664_101147251 | 3300005564 | Bacteria | 732 |
| 237 | Ga0070664_102088786 | 3300005564 | Bacteria | 538 |
| 238 | Ga0070664_102089009 | 3300005564 | Bacteria | 538 |
| 239 | Ga0070664_102189124 | 3300005564 | Bacteria | 525 |
| 240 | Ga0068857_100055768 | 3300005577 | Bacteria | 3506 |
| 241 | Ga0068857_100069270 | 3300005577 | Bacteria | 3141 |
| 242 | Ga0068857_100575627 | 3300005577 | Bacteria | 1062 |
| 243 | Ga0068857_101143615 | 3300005577 | Bacteria | 753 |
| 244 | Ga0068854_100152030 | 3300005578 | Bacteria | 1786 |
| 245 | Ga0068854_100268962 | 3300005578 | Bacteria | 1368 |
| 246 | Ga0068854_100279967 | 3300005578 | Bacteria | 1342 |
| 247 | Ga0068854_100520375 | 3300005578 | Bacteria | 1005 |
| 248 | Ga0068854_101016874 | 3300005578 | Bacteria | 735 |
| 249 | Ga0068854_101189659 | 3300005578 | Bacteria | 682 |
| 250 | Ga0068854_101934454 | 3300005578 | Bacteria | 543 |
| 251 | Ga0068856_100024547 | 3300005614 | Bacteria | 5869 |
| 252 | Ga0068856_100065004 | 3300005614 | Bacteria | 3604 |
| 253 | Ga0068856_100107970 | 3300005614 | Bacteria | 2779 |
| 254 | Ga0068856_100405615 | 3300005614 | Bacteria | 1383 |
| 255 | Ga0068852_100012164 | 3300005616 | Bacteria | 6518 |
| 256 | Ga0068852_100064917 | 3300005616 | Bacteria | 3183 |
| 257 | Ga0068852_100158582 | 3300005616 | Bacteria | 2110 |
| 258 | Ga0068852_100200369 | 3300005616 | Bacteria | 1889 |
| 259 | Ga0068852_100493379 | 3300005616 | Bacteria | 1218 |
| 260 | Ga0068852_100925162 | 3300005616 | Bacteria | 889 |
| 261 | Ga0068852_100960817 | 3300005616 | Bacteria | 872 |
| 262 | Ga0068852_101194951 | 3300005616 | Bacteria | 781 |
| 263 | Ga0068852_101993887 | 3300005616 | Bacteria | 602 |
| 264 | Ga0068852_102574464 | 3300005616 | Bacteria | 528 |
| 265 | Ga0068859_100100711 | 3300005617 | Bacteria | 2945 |
| 266 | Ga0068859_100151854 | 3300005617 | Bacteria | 2391 |
| 267 | Ga0068859_100658925 | 3300005617 | Bacteria | 1139 |
| 268 | Ga0068859_102193399 | 3300005617 | Bacteria | 609 |
| 269 | Ga0068864_100005884 | 3300005618 | Bacteria | 10049 |
| 270 | Ga0068864_100018827 | 3300005618 | Bacteria | 5772 |
| 271 | Ga0068864_100025050 | 3300005618 | Bacteria | 5022 |
| 272 | Ga0068864_100062621 | 3300005618 | Bacteria | 3223 |
| 273 | Ga0068864_100303311 | 3300005618 | Bacteria | 1496 |
| 274 | Ga0068864_100320948 | 3300005618 | Bacteria | 1455 |
| 275 | Ga0068864_100490563 | 3300005618 | Bacteria | 1180 |
| 276 | Ga0068864_100763044 | 3300005618 | Bacteria | 948 |
| 277 | Ga0068864_101766259 | 3300005618 | Bacteria | 623 |
| 278 | Ga0068864_101777824 | 3300005618 | Bacteria | 621 |
| 279 | Ga0068866_10013545 | 3300005718 | Bacteria | 3581 |
| 280 | Ga0068866_10119182 | 3300005718 | Bacteria | 1484 |
| 281 | Ga0068866_10191098 | 3300005718 | Bacteria | 1216 |
| 282 | Ga0068861_100006706 | 3300005719 | Bacteria | 7868 |
| 283 | Ga0068861_100011826 | 3300005719 | Bacteria | 6074 |
| 284 | Ga0068861_100065336 | 3300005719 | Bacteria | 2802 |
| 285 | Ga0068861_101294117 | 3300005719 | Bacteria | 709 |
| 286 | Ga0068851_10045937 | 3300005834 | Bacteria | 2208 |
| 287 | Ga0068851_10077405 | 3300005834 | Bacteria | 1731 |
| 288 | Ga0068851_10132817 | 3300005834 | Bacteria | 1347 |
| 289 | Ga0068851_10160215 | 3300005834 | Bacteria | 1236 |
| 290 | Ga0068851_10678497 | 3300005834 | Bacteria | 633 |
| 291 | Ga0068851_11107248 | 3300005834 | Bacteria | 503 |
| 292 | Ga0068870_10156643 | 3300005840 | Bacteria | 1347 |
| 293 | Ga0068870_10317538 | 3300005840 | Bacteria | 989 |
| 294 | Ga0068870_10645284 | 3300005840 | Bacteria | 724 |
| 295 | Ga0068870_10879111 | 3300005840 | Bacteria | 632 |
| 296 | Ga0068870_11017869 | 3300005840 | Bacteria | 592 |
| 297 | Ga0068863_100001141 | 3300005841 | Bacteria | 26504 |
| 298 | Ga0068863_100010494 | 3300005841 | Bacteria | 9002 |
| 299 | Ga0068863_100207098 | 3300005841 | Bacteria | 1888 |
| 300 | Ga0068863_100271550 | 3300005841 | Bacteria | 1641 |
| 301 | Ga0068863_100288882 | 3300005841 | Bacteria | 1589 |
| 302 | Ga0068863_100491709 | 3300005841 | Bacteria | 1207 |
| 303 | Ga0068863_100507872 | 3300005841 | Bacteria | 1187 |
| 304 | Ga0068863_101332759 | 3300005841 | Bacteria | 725 |
| 305 | Ga0068863_101716211 | 3300005841 | Bacteria | 638 |
| 306 | Ga0068863_102285774 | 3300005841 | Bacteria | 550 |
| 307 | Ga0068858_100000259 | 3300005842 | Bacteria | 56570 |
| 308 | Ga0068858_100056525 | 3300005842 | Bacteria | 3626 |
| 309 | Ga0068858_100435158 | 3300005842 | Bacteria | 1263 |
| 310 | Ga0068858_100472602 | 3300005842 | Bacteria | 1209 |
| 311 | Ga0068858_100619547 | 3300005842 | Bacteria | 1050 |
| 312 | Ga0068858_101583262 | 3300005842 | Bacteria | 646 |
| 313 | Ga0068860_100031504 | 3300005843 | Bacteria | 5097 |
| 314 | Ga0068860_100048517 | 3300005843 | Bacteria | 4047 |
| 315 | Ga0068860_100120719 | 3300005843 | Bacteria | 2510 |
| 316 | Ga0068860_100446547 | 3300005843 | Bacteria | 1285 |
| 317 | Ga0068860_100620520 | 3300005843 | Bacteria | 1088 |
| 318 | Ga0068860_100647217 | 3300005843 | Bacteria | 1065 |
| 319 | Ga0068860_101431122 | 3300005843 | Bacteria | 713 |
| 320 | Ga0068862_100060510 | 3300005844 | Bacteria | 3253 |
| 321 | Ga0068862_100065510 | 3300005844 | Bacteria | 3129 |
| 322 | Ga0068862_100281501 | 3300005844 | Bacteria | 1524 |
| 323 | Ga0068862_100807123 | 3300005844 | Bacteria | 917 |
| 324 | Ga0068862_100913861 | 3300005844 | Bacteria | 863 |
| 325 | Ga0068862_101123099 | 3300005844 | Bacteria | 782 |
| 326 | Ga0075365_10096479 | 3300006038 | Bacteria | 2020 |
| 327 | Ga0075365_10753128 | 3300006038 | Bacteria | 688 |
| 328 | Ga0075368_10032256 | 3300006042 | Bacteria | 2034 |
| 329 | Ga0075368_10040488 | 3300006042 | Bacteria | 1830 |
| 330 | Ga0075363_100151243 | 3300006048 | Bacteria | 1310 |
| 331 | Ga0075363_100234652 | 3300006048 | Bacteria | 1054 |
| 332 | Ga0075364_10093210 | 3300006051 | Bacteria | 2000 |
| 333 | Ga0075432_10085198 | 3300006058 | Bacteria | 1150 |
| 334 | Ga0070715_10484768 | 3300006163 | Bacteria | 705 |
| 335 | Ga0075362_10109550 | 3300006177 | Bacteria | 1299 |
| 336 | Ga0075362_10112124 | 3300006177 | Bacteria | 1284 |
| 337 | Ga0075362_10377743 | 3300006177 | Bacteria | 712 |
| 338 | Ga0075362_10680226 | 3300006177 | Bacteria | 536 |
| 339 | Ga0075362_10711960 | 3300006177 | Bacteria | 524 |
| 340 | Ga0075367_10030819 | 3300006178 | Bacteria | 3077 |
| 341 | Ga0075367_10070169 | 3300006178 | Bacteria | 2105 |
| 342 | Ga0075367_10101024 | 3300006178 | Bacteria | 1763 |
| 343 | Ga0075367_10295551 | 3300006178 | Bacteria | 1019 |
| 344 | Ga0075369_10035715 | 3300006186 | Bacteria | 2113 |
| 345 | Ga0075369_10053081 | 3300006186 | Bacteria | 1758 |
| 346 | Ga0075369_10443126 | 3300006186 | Bacteria | 614 |
| 347 | Ga0075366_10001728 | 3300006195 | Bacteria | 10989 |
| 348 | Ga0075366_10029122 | 3300006195 | Bacteria | 3243 |
| 349 | Ga0075366_10052841 | 3300006195 | Bacteria | 2414 |
| 350 | Ga0075366_10155127 | 3300006195 | Bacteria | 1387 |
| 351 | Ga0075366_10163695 | 3300006195 | Bacteria | 1348 |
| 352 | Ga0075366_10184230 | 3300006195 | Bacteria | 1268 |
| 353 | Ga0075366_10200269 | 3300006195 | Bacteria | 1214 |
| 354 | Ga0075366_10386666 | 3300006195 | Bacteria | 861 |
| 355 | Ga0075366_10461532 | 3300006195 | Bacteria | 784 |
| 356 | Ga0075366_10631272 | 3300006195 | Bacteria | 664 |
| 357 | Ga0097621_100004806 | 3300006237 | Bacteria | 9459 |
| 358 | Ga0097621_100012924 | 3300006237 | Bacteria | 6204 |
| 359 | Ga0097621_100018962 | 3300006237 | Bacteria | 5272 |
| 360 | Ga0097621_100074567 | 3300006237 | Bacteria | 2810 |
| 361 | Ga0097621_100458396 | 3300006237 | Bacteria | 1149 |
| 362 | Ga0097621_100834024 | 3300006237 | Bacteria | 856 |
| 363 | Ga0097621_100881830 | 3300006237 | Bacteria | 832 |
| 364 | Ga0097621_100940208 | 3300006237 | Bacteria | 806 |
| 365 | Ga0075370_10006917 | 3300006353 | Bacteria | 5745 |
| 366 | Ga0075370_10011994 | 3300006353 | Bacteria | 4568 |
| 367 | Ga0075370_10029181 | 3300006353 | Bacteria | 3071 |
| 368 | Ga0075370_10029651 | 3300006353 | Bacteria | 3048 |
| 369 | Ga0075370_10032930 | 3300006353 | Bacteria | 2900 |
| 370 | Ga0075370_10057682 | 3300006353 | Bacteria | 2207 |
| 371 | Ga0075370_10233950 | 3300006353 | Bacteria | 1087 |
| 372 | Ga0075370_10381496 | 3300006353 | Bacteria | 844 |
| 373 | Ga0075370_10843060 | 3300006353 | Bacteria | 559 |
| 374 | Ga0068871_100005787 | 3300006358 | Bacteria | 8684 |
| 375 | Ga0068871_100013396 | 3300006358 | Bacteria | 6084 |
| 376 | Ga0068871_100180950 | 3300006358 | Bacteria | 1811 |
| 377 | Ga0068871_100335857 | 3300006358 | Bacteria | 1333 |
| 378 | Ga0068871_101348847 | 3300006358 | Bacteria | 671 |
| 379 | Ga0068871_101474077 | 3300006358 | Bacteria | 642 |
| 380 | Ga0075430_101699021 | 3300006846 | Bacteria | 518 |
| 381 | Ga0068865_100054762 | 3300006881 | Bacteria | 2773 |
| 382 | Ga0068865_100217594 | 3300006881 | Bacteria | 1492 |
| 383 | Ga0068865_100259807 | 3300006881 | Bacteria | 1374 |
| 384 | Ga0068865_100340111 | 3300006881 | Bacteria | 1213 |
| 385 | Ga0068865_100581052 | 3300006881 | Bacteria | 944 |
| 386 | Ga0097620_100100703 | 3300006931 | Bacteria | 2945 |
| 387 | Ga0097620_100151853 | 3300006931 | Bacteria | 2391 |
| 388 | Ga0097620_100658915 | 3300006931 | Bacteria | 1139 |
| 389 | Ga0097620_102193390 | 3300006931 | Bacteria | 609 |
| 390 | Ga0099824_1052367 | 3300006942 | Bacteria | 737 |
| 391 | Ga0099823_1000003 | 3300006944 | Bacteria | 189058 |
| 392 | Ga0079104_1000009 | 3300006946 | Bacteria | 367015 |
| 393 | Ga0105244_10316941 | 3300009036 | Bacteria | 720 |
| 394 | Ga0105250_10520863 | 3300009092 | Bacteria | 542 |
| 395 | Ga0105240_11260290 | 3300009093 | Bacteria | 781 |
| 396 | Ga0105240_11408338 | 3300009093 | Bacteria | 733 |
| 397 | Ga0111539_11836921 | 3300009094 | Bacteria | 703 |
| 398 | Ga0111539_12240810 | 3300009094 | Bacteria | 634 |
| 399 | Ga0105245_10554247 | 3300009098 | Bacteria | 1172 |
| 400 | Ga0105243_10364805 | 3300009148 | Bacteria | 1331 |
| 401 | Ga0105243_11509329 | 3300009148 | Bacteria | 696 |
| 402 | Ga0105243_11798883 | 3300009148 | Bacteria | 644 |
| 403 | Ga0105243_12962686 | 3300009148 | Bacteria | 515 |
| 404 | Ga0105243_13125384 | 3300009148 | Bacteria | 501 |
| 405 | Ga0105241_10272826 | 3300009174 | Bacteria | 1442 |
| 406 | Ga0105241_11217970 | 3300009174 | Bacteria | 714 |
| 407 | Ga0105242_10013753 | 3300009176 | Bacteria | 6263 |
| 408 | Ga0105242_11641046 | 3300009176 | Bacteria | 678 |
| 409 | Ga0105242_12479464 | 3300009176 | Bacteria | 567 |
| 410 | Ga0105248_10028131 | 3300009177 | Bacteria | 6261 |
| 411 | Ga0105248_10042274 | 3300009177 | Bacteria | 5111 |
| 412 | Ga0105248_10206255 | 3300009177 | Bacteria | 2215 |
| 413 | Ga0105248_10286139 | 3300009177 | Bacteria | 1856 |
| 414 | Ga0105248_10563000 | 3300009177 | Bacteria | 1286 |
| 415 | Ga0105248_10880348 | 3300009177 | Bacteria | 1011 |
| 416 | Ga0105248_11098229 | 3300009177 | Bacteria | 899 |
| 417 | Ga0105248_11414358 | 3300009177 | Bacteria | 787 |
| 418 | Ga0105237_10041408 | 3300009545 | Bacteria | 4645 |
| 419 | Ga0105237_11637547 | 3300009545 | Bacteria | 651 |
| 420 | Ga0105238_10058508 | 3300009551 | Bacteria | 3863 |
| 421 | Ga0105238_10623624 | 3300009551 | Bacteria | 1087 |
| 422 | Ga0105238_11658774 | 3300009551 | Bacteria | 670 |
| 423 | Ga0105238_11841186 | 3300009551 | Bacteria | 638 |
| 424 | Ga0105238_11890695 | 3300009551 | Bacteria | 630 |
| 425 | Ga0105249_10008180 | 3300009553 | Bacteria | 9116 |
| 426 | Ga0105249_10016884 | 3300009553 | Bacteria | 6478 |
| 427 | Ga0105249_11120382 | 3300009553 | Bacteria | 857 |
| 428 | Ga0105249_11585481 | 3300009553 | Bacteria | 727 |
| 429 | Ga0105239_10085568 | 3300010375 | Bacteria | 3475 |
| 430 | Ga0105239_10277231 | 3300010375 | Bacteria | 1887 |
| 431 | Ga0105246_10682207 | 3300011119 | Bacteria | 898 |
| 432 | Ga0157317_1000186 | 3300012475 | Bacteria | 2176 |
| 433 | Ga0157319_1000002 | 3300012497 | Bacteria | 410803 |
| 434 | Ga0157314_1008272 | 3300012500 | Bacteria | 856 |
| 435 | Ga0157338_1018411 | 3300012515 | Bacteria | 791 |
| 436 | Ga0157373_10124484 | 3300013100 | Bacteria | 1813 |
| 437 | Ga0157371_10042098 | 3300013102 | Bacteria | 3256 |
| 438 | Ga0157371_10229125 | 3300013102 | Bacteria | 1335 |
| 439 | Ga0157371_11542036 | 3300013102 | Bacteria | 519 |
| 440 | Ga0157370_11307137 | 3300013104 | Bacteria | 653 |
| 441 | Ga0157370_11798996 | 3300013104 | Bacteria | 550 |
| 442 | Ga0157370_12071504 | 3300013104 | Bacteria | 510 |
| 443 | Ga0157369_10002529 | 3300013105 | Bacteria | 21858 |
| 444 | Ga0157369_11424531 | 3300013105 | Bacteria | 705 |
| 445 | Ga0157374_10015370 | 3300013296 | Bacteria | 6713 |
| 446 | Ga0157374_10037388 | 3300013296 | Bacteria | 4455 |
| 447 | Ga0157374_10346616 | 3300013296 | Bacteria | 1475 |
| 448 | Ga0157374_10477754 | 3300013296 | Bacteria | 1249 |
| 449 | Ga0157378_10402459 | 3300013297 | Bacteria | 1349 |
| 450 | Ga0163162_10019201 | 3300013306 | Bacteria | 6702 |
| 451 | Ga0163162_10118418 | 3300013306 | Bacteria | 2750 |
| 452 | Ga0163162_10181851 | 3300013306 | Bacteria | 2229 |
| 453 | Ga0163162_10384122 | 3300013306 | Bacteria | 1537 |
| 454 | Ga0163162_10794400 | 3300013306 | Bacteria | 1064 |
| 455 | Ga0163162_10897855 | 3300013306 | Bacteria | 999 |
| 456 | Ga0163162_12311543 | 3300013306 | Bacteria | 618 |
| 457 | Ga0157372_10008954 | 3300013307 | Bacteria | 10636 |
| 458 | Ga0157372_10095594 | 3300013307 | Bacteria | 3385 |
| 459 | Ga0157372_11348096 | 3300013307 | Bacteria | 823 |
| 460 | Ga0157372_11559918 | 3300013307 | Bacteria | 760 |
| 461 | Ga0157375_10003085 | 3300013308 | Bacteria | 14462 |
| 462 | Ga0157375_10054149 | 3300013308 | Bacteria | 3951 |
| 463 | Ga0157375_10115460 | 3300013308 | Bacteria | 2787 |
| 464 | Ga0157375_10772242 | 3300013308 | Bacteria | 1111 |
| 465 | Ga0157375_10919768 | 3300013308 | Bacteria | 1018 |
| 466 | Ga0157375_11153051 | 3300013308 | Bacteria | 908 |
| 467 | Ga0157375_13758463 | 3300013308 | Bacteria | 504 |
| 468 | Ga0163163_10129271 | 3300014325 | Bacteria | 2566 |
| 469 | Ga0163163_10443619 | 3300014325 | Bacteria | 1358 |
| 470 | Ga0163163_10663707 | 3300014325 | Bacteria | 1106 |
| 471 | Ga0163163_12002836 | 3300014325 | Bacteria | 639 |
| 472 | Ga0163163_12632753 | 3300014325 | Bacteria | 560 |
| 473 | Ga0163163_13048771 | 3300014325 | Bacteria | 522 |
| 474 | Ga0157380_10079211 | 3300014326 | Bacteria | 2683 |
| 475 | Ga0157380_10092961 | 3300014326 | Bacteria | 2493 |
| 476 | Ga0157380_10675391 | 3300014326 | Bacteria | 1034 |
| 477 | Ga0157380_10868749 | 3300014326 | Bacteria | 925 |
| 478 | Ga0157380_13534103 | 3300014326 | Bacteria | 501 |
| 479 | Ga0157377_10401551 | 3300014745 | Bacteria | 933 |
| 480 | Ga0157379_10017047 | 3300014968 | Bacteria | 6395 |
| 481 | Ga0157379_10041700 | 3300014968 | Bacteria | 4097 |
| 482 | Ga0157379_10042358 | 3300014968 | Bacteria | 4065 |
| 483 | Ga0157379_10133470 | 3300014968 | Bacteria | 2236 |
| 484 | Ga0157379_10527442 | 3300014968 | Bacteria | 1097 |
| 485 | Ga0157376_10014509 | 3300014969 | Bacteria | 5917 |
| 486 | Ga0157376_10062388 | 3300014969 | Bacteria | 3136 |
| 487 | Ga0157376_10073392 | 3300014969 | Bacteria | 2913 |
| 488 | Ga0157376_10272779 | 3300014969 | Bacteria | 1590 |
| 489 | Ga0182006_1205986 | 3300015261 | Bacteria | 651 |
| 490 | Ga0163161_10016875 | 3300017792 | Bacteria | 5103 |
| 491 | Ga0163161_10075187 | 3300017792 | Bacteria | 2478 |
| 492 | Ga0163161_10181529 | 3300017792 | Bacteria | 1614 |
| 493 | Ga0163161_10260221 | 3300017792 | Bacteria | 1355 |
| 494 | Ga0163161_11754518 | 3300017792 | Bacteria | 551 |
| 495 | Ga0213872_10000211 | 3300021361 | Bacteria | 51730 |
| 496 | Ga0213874_10023839 | 3300021377 | Bacteria | 1711 |
| 497 | Ga0213876_10046569 | 3300021384 | Bacteria | 2293 |
| 498 | Ga0209258_106366 | 3300025242 | Bacteria | 1860 |
| 499 | Ga0209565_1012512 | 3300025263 | Bacteria | 2021 |
| 500 | Ga0209673_1003399 | 3300025273 | Bacteria | 9436 |
| 501 | Ga0209673_1051533 | 3300025273 | Bacteria | 1085 |
| 502 | Ga0209675_1009399 | 3300025291 | Bacteria | 3460 |
| 503 | Ga0209564_1000229 | 3300025295 | Bacteria | 125047 |
| 504 | Ga0209050_1000246 | 3300025298 | Bacteria | 116721 |
| 505 | Ga0209050_1016802 | 3300025298 | Bacteria | 2966 |
| 506 | Ga0209050_1060364 | 3300025298 | Bacteria | 899 |
| 507 | Ga0209256_1000019 | 3300025299 | Bacteria | 558627 |
| 508 | Ga0209256_1000072 | 3300025299 | Bacteria | 239812 |
| 509 | Ga0209256_1004519 | 3300025299 | Bacteria | 8681 |
| 510 | Ga0209051_1000004 | 3300025303 | Bacteria | 1155596 |
| 511 | Ga0209051_1001942 | 3300025303 | Bacteria | 15920 |
| 512 | Ga0209051_1136781 | 3300025303 | Bacteria | 596 |
| 513 | Ga0209257_1000038 | 3300025304 | Bacteria | 609032 |
| 514 | Ga0209257_1000044 | 3300025304 | Bacteria | 486709 |
| 515 | Ga0209257_1000385 | 3300025304 | Bacteria | 88117 |
| 516 | Ga0209257_1001796 | 3300025304 | Bacteria | 23562 |
| 517 | Ga0209257_1008778 | 3300025304 | Bacteria | 5617 |
| 518 | Ga0207656_10095821 | 3300025321 | Bacteria | 1354 |
| 519 | Ga0207656_10261619 | 3300025321 | Bacteria | 850 |
| 520 | Ga0207656_10568260 | 3300025321 | Bacteria | 578 |
| 521 | Ga0207653_10421378 | 3300025885 | Bacteria | 524 |
| 522 | Ga0207682_10012060 | 3300025893 | Bacteria | 3375 |
| 523 | Ga0207682_10186938 | 3300025893 | Bacteria | 948 |
| 524 | Ga0207682_10275583 | 3300025893 | Bacteria | 786 |
| 525 | Ga0207682_10314062 | 3300025893 | Bacteria | 736 |
| 526 | Ga0207682_10555219 | 3300025893 | Bacteria | 543 |
| 527 | Ga0207642_10121417 | 3300025899 | Bacteria | 1348 |
| 528 | Ga0207642_10638210 | 3300025899 | Bacteria | 666 |
| 529 | Ga0207688_10030759 | 3300025901 | Bacteria | 2961 |
| 530 | Ga0207688_10582553 | 3300025901 | Bacteria | 704 |
| 531 | Ga0207688_10716116 | 3300025901 | Bacteria | 633 |
| 532 | Ga0207680_10263175 | 3300025903 | Bacteria | 1194 |
| 533 | Ga0207680_10280727 | 3300025903 | Bacteria | 1157 |
| 534 | Ga0207680_11175949 | 3300025903 | Bacteria | 547 |
| 535 | Ga0207647_10454839 | 3300025904 | Bacteria | 717 |
| 536 | Ga0207685_10196175 | 3300025905 | Bacteria | 945 |
| 537 | Ga0207645_10035303 | 3300025907 | Bacteria | 3210 |
| 538 | Ga0207645_10042617 | 3300025907 | Bacteria | 2904 |
| 539 | Ga0207645_10283491 | 3300025907 | Bacteria | 1100 |
| 540 | Ga0207645_10317180 | 3300025907 | Bacteria | 1039 |
| 541 | Ga0207645_10576488 | 3300025907 | Bacteria | 764 |
| 542 | Ga0207643_10026655 | 3300025908 | Bacteria | 3200 |
| 543 | Ga0207643_10637350 | 3300025908 | Bacteria | 687 |
| 544 | Ga0207643_10639793 | 3300025908 | Bacteria | 686 |
| 545 | Ga0207643_11150028 | 3300025908 | Bacteria | 500 |
| 546 | Ga0207705_10061289 | 3300025909 | Bacteria | 2717 |
| 547 | Ga0207705_10311029 | 3300025909 | Bacteria | 1209 |
| 548 | Ga0207705_11288080 | 3300025909 | Bacteria | 558 |
| 549 | Ga0207684_10004630 | 3300025910 | Bacteria | 12912 |
| 550 | Ga0207654_10161056 | 3300025911 | Bacteria | 1450 |
| 551 | Ga0207707_10073153 | 3300025912 | Bacteria | 2988 |
| 552 | Ga0207695_10250268 | 3300025913 | Bacteria | 1671 |
| 553 | Ga0207695_11149153 | 3300025913 | Bacteria | 656 |
| 554 | Ga0207671_10017203 | 3300025914 | Bacteria | 5585 |
| 555 | Ga0207660_10060825 | 3300025917 | Bacteria | 2717 |
| 556 | Ga0207662_10113501 | 3300025918 | Bacteria | 1692 |
| 557 | Ga0207662_10181173 | 3300025918 | Bacteria | 1356 |
| 558 | Ga0207657_10092016 | 3300025919 | Bacteria | 2528 |
| 559 | Ga0207657_10300745 | 3300025919 | Bacteria | 1271 |
| 560 | Ga0207657_10502183 | 3300025919 | Bacteria | 950 |
| 561 | Ga0207657_11004917 | 3300025919 | Bacteria | 640 |
| 562 | Ga0207649_10002033 | 3300025920 | Bacteria | 11512 |
| 563 | Ga0207649_10511011 | 3300025920 | Bacteria | 915 |
| 564 | Ga0207649_10552236 | 3300025920 | Bacteria | 881 |
| 565 | Ga0207649_10581904 | 3300025920 | Bacteria | 859 |
| 566 | Ga0207649_11385791 | 3300025920 | Bacteria | 556 |
| 567 | Ga0207652_10006365 | 3300025921 | Bacteria | 9535 |
| 568 | Ga0207652_10567489 | 3300025921 | Bacteria | 1019 |
| 569 | Ga0207652_11006912 | 3300025921 | Bacteria | 732 |
| 570 | Ga0207646_10133400 | 3300025922 | Bacteria | 2236 |
| 571 | Ga0207681_10001527 | 3300025923 | Bacteria | 14917 |
| 572 | Ga0207681_10039148 | 3300025923 | Bacteria | 3145 |
| 573 | Ga0207681_10286602 | 3300025923 | Bacteria | 1298 |
| 574 | Ga0207681_11033633 | 3300025923 | Bacteria | 690 |
| 575 | Ga0207681_11367583 | 3300025923 | Bacteria | 594 |
| 576 | Ga0207694_10015626 | 3300025924 | Bacteria | 5726 |
| 577 | Ga0207694_11151574 | 3300025924 | Bacteria | 656 |
| 578 | Ga0207694_11516164 | 3300025924 | Bacteria | 566 |
| 579 | Ga0207694_11526959 | 3300025924 | Bacteria | 563 |
| 580 | Ga0207650_10012223 | 3300025925 | Bacteria | 5924 |
| 581 | Ga0207650_10075854 | 3300025925 | Bacteria | 2539 |
| 582 | Ga0207650_10121643 | 3300025925 | Bacteria | 2033 |
| 583 | Ga0207650_10176777 | 3300025925 | Bacteria | 1699 |
| 584 | Ga0207650_10244739 | 3300025925 | Bacteria | 1450 |
| 585 | Ga0207650_10996471 | 3300025925 | Bacteria | 713 |
| 586 | Ga0207650_11008863 | 3300025925 | Bacteria | 708 |
| 587 | Ga0207650_11334132 | 3300025925 | Bacteria | 610 |
| 588 | Ga0207659_10001630 | 3300025926 | Bacteria | 13323 |
| 589 | Ga0207659_10010794 | 3300025926 | Bacteria | 5749 |
| 590 | Ga0207659_10105131 | 3300025926 | Bacteria | 2136 |
| 591 | Ga0207659_10158022 | 3300025926 | Bacteria | 1777 |
| 592 | Ga0207659_10261462 | 3300025926 | Bacteria | 1408 |
| 593 | Ga0207687_10008433 | 3300025927 | Bacteria | 6739 |
| 594 | Ga0207687_10077309 | 3300025927 | Bacteria | 2393 |
| 595 | Ga0207687_11701710 | 3300025927 | Bacteria | 541 |
| 596 | Ga0207687_11707794 | 3300025927 | Bacteria | 540 |
| 597 | Ga0207644_10000042 | 3300025931 | Bacteria | 112685 |
| 598 | Ga0207644_10054871 | 3300025931 | Bacteria | 2870 |
| 599 | Ga0207644_10163644 | 3300025931 | Bacteria | 1731 |
| 600 | Ga0207644_10246026 | 3300025931 | Bacteria | 1425 |
| 601 | Ga0207644_10976995 | 3300025931 | Bacteria | 710 |
| 602 | Ga0207644_11749109 | 3300025931 | Bacteria | 520 |
| 603 | Ga0207690_10008281 | 3300025932 | Bacteria | 6167 |
| 604 | Ga0207690_10509942 | 3300025932 | Bacteria | 974 |
| 605 | Ga0207690_10745156 | 3300025932 | Bacteria | 807 |
| 606 | Ga0207690_11652560 | 3300025932 | Bacteria | 535 |
| 607 | Ga0207706_10005001 | 3300025933 | Bacteria | 12380 |
| 608 | Ga0207706_10005687 | 3300025933 | Bacteria | 11610 |
| 609 | Ga0207706_10026753 | 3300025933 | Bacteria | 5164 |
| 610 | Ga0207706_10067926 | 3300025933 | Bacteria | 3137 |
| 611 | Ga0207706_10138168 | 3300025933 | Bacteria | 2144 |
| 612 | Ga0207706_10379379 | 3300025933 | Bacteria | 1227 |
| 613 | Ga0207706_11369876 | 3300025933 | Bacteria | 582 |
| 614 | Ga0207686_10325134 | 3300025934 | Bacteria | 1150 |
| 615 | Ga0207686_10330696 | 3300025934 | Bacteria | 1141 |
| 616 | Ga0207686_10408659 | 3300025934 | Bacteria | 1036 |
| 617 | Ga0207709_10386814 | 3300025935 | Bacteria | 1066 |
| 618 | Ga0207709_10646511 | 3300025935 | Bacteria | 842 |
| 619 | Ga0207709_10680611 | 3300025935 | Bacteria | 822 |
| 620 | Ga0207709_10689438 | 3300025935 | Bacteria | 817 |
| 621 | Ga0207709_11578893 | 3300025935 | Bacteria | 545 |
| 622 | Ga0207670_10727338 | 3300025936 | Bacteria | 823 |
| 623 | Ga0207669_10974537 | 3300025937 | Bacteria | 711 |
| 624 | Ga0207669_11693468 | 3300025937 | Bacteria | 540 |
| 625 | Ga0207704_10180766 | 3300025938 | Bacteria | 1524 |
| 626 | Ga0207704_10353622 | 3300025938 | Bacteria | 1145 |
| 627 | Ga0207704_11218645 | 3300025938 | Bacteria | 642 |
| 628 | Ga0207665_10096334 | 3300025939 | Bacteria | 2058 |
| 629 | Ga0207691_10013989 | 3300025940 | Bacteria | 7656 |
| 630 | Ga0207691_10086275 | 3300025940 | Bacteria | 2816 |
| 631 | Ga0207691_10087701 | 3300025940 | Bacteria | 2792 |
| 632 | Ga0207691_10093639 | 3300025940 | Bacteria | 2689 |
| 633 | Ga0207691_10112255 | 3300025940 | Bacteria | 2423 |
| 634 | Ga0207691_10113757 | 3300025940 | Bacteria | 2405 |
| 635 | Ga0207691_10148946 | 3300025940 | Bacteria | 2058 |
| 636 | Ga0207691_10208529 | 3300025940 | Bacteria | 1698 |
| 637 | Ga0207691_10507322 | 3300025940 | Bacteria | 1024 |
| 638 | Ga0207691_10511258 | 3300025940 | Bacteria | 1020 |
| 639 | Ga0207711_10003933 | 3300025941 | Bacteria | 12779 |
| 640 | Ga0207711_10033806 | 3300025941 | Bacteria | 4328 |
| 641 | Ga0207711_10156494 | 3300025941 | Bacteria | 2060 |
| 642 | Ga0207711_10196560 | 3300025941 | Bacteria | 1839 |
| 643 | Ga0207711_10263223 | 3300025941 | Bacteria | 1585 |
| 644 | Ga0207711_10290088 | 3300025941 | Bacteria | 1508 |
| 645 | Ga0207711_10410320 | 3300025941 | Bacteria | 1259 |
| 646 | Ga0207711_10482421 | 3300025941 | Bacteria | 1155 |
| 647 | Ga0207711_10642204 | 3300025941 | Bacteria | 990 |
| 648 | Ga0207689_10002895 | 3300025942 | Bacteria | 15837 |
| 649 | Ga0207689_10034592 | 3300025942 | Bacteria | 4196 |
| 650 | Ga0207689_10182281 | 3300025942 | Bacteria | 1731 |
| 651 | Ga0207689_10185674 | 3300025942 | Bacteria | 1715 |
| 652 | Ga0207689_10573459 | 3300025942 | Bacteria | 948 |
| 653 | Ga0207661_10919929 | 3300025944 | Bacteria | 805 |
| 654 | Ga0207679_10071379 | 3300025945 | Bacteria | 2619 |
| 655 | Ga0207679_10307546 | 3300025945 | Bacteria | 1368 |
| 656 | Ga0207679_10364340 | 3300025945 | Bacteria | 1263 |
| 657 | Ga0207679_10379413 | 3300025945 | Bacteria | 1239 |
| 658 | Ga0207679_10432498 | 3300025945 | Bacteria | 1164 |
| 659 | Ga0207679_10450536 | 3300025945 | Bacteria | 1141 |
| 660 | Ga0207679_10629805 | 3300025945 | Bacteria | 969 |
| 661 | Ga0207679_10999529 | 3300025945 | Bacteria | 767 |
| 662 | Ga0207667_10902073 | 3300025949 | Bacteria | 876 |
| 663 | Ga0207651_10170129 | 3300025960 | Bacteria | 1717 |
| 664 | Ga0207651_10209051 | 3300025960 | Bacteria | 1569 |
| 665 | Ga0207651_10354218 | 3300025960 | Bacteria | 1237 |
| 666 | Ga0207651_10436994 | 3300025960 | Bacteria | 1120 |
| 667 | Ga0207651_10514551 | 3300025960 | Bacteria | 1036 |
| 668 | Ga0207651_10666144 | 3300025960 | Bacteria | 914 |
| 669 | Ga0207651_10775515 | 3300025960 | Bacteria | 849 |
| 670 | Ga0207651_11396709 | 3300025960 | Bacteria | 630 |
| 671 | Ga0207651_11757787 | 3300025960 | Bacteria | 558 |
| 672 | Ga0207712_10082265 | 3300025961 | Bacteria | 2347 |
| 673 | Ga0207712_10434957 | 3300025961 | Bacteria | 1110 |
| 674 | Ga0207712_11143249 | 3300025961 | Bacteria | 694 |
| 675 | Ga0207712_11276954 | 3300025961 | Bacteria | 656 |
| 676 | Ga0207668_10100445 | 3300025972 | Bacteria | 2148 |
| 677 | Ga0207668_10101101 | 3300025972 | Bacteria | 2142 |
| 678 | Ga0207668_10474314 | 3300025972 | Bacteria | 1072 |
| 679 | Ga0207668_11976703 | 3300025972 | Bacteria | 525 |
| 680 | Ga0207640_10020844 | 3300025981 | Bacteria | 3896 |
| 681 | Ga0207640_10296935 | 3300025981 | Bacteria | 1276 |
| 682 | Ga0207640_10368080 | 3300025981 | Bacteria | 1160 |
| 683 | Ga0207640_10495554 | 3300025981 | Bacteria | 1016 |
| 684 | Ga0207658_10005557 | 3300025986 | Bacteria | 8628 |
| 685 | Ga0207658_10013827 | 3300025986 | Bacteria | 5522 |
| 686 | Ga0207658_10041532 | 3300025986 | Bacteria | 3331 |
| 687 | Ga0207658_10844757 | 3300025986 | Bacteria | 832 |
| 688 | Ga0207658_10927550 | 3300025986 | Bacteria | 793 |
| 689 | Ga0207658_11274281 | 3300025986 | Bacteria | 672 |
| 690 | Ga0207677_10028291 | 3300026023 | Bacteria | 3542 |
| 691 | Ga0207677_10030155 | 3300026023 | Bacteria | 3458 |
| 692 | Ga0207677_10104794 | 3300026023 | Bacteria | 2091 |
| 693 | Ga0207677_10164116 | 3300026023 | Bacteria | 1729 |
| 694 | Ga0207677_11622288 | 3300026023 | Bacteria | 599 |
| 695 | Ga0207677_12103329 | 3300026023 | Bacteria | 525 |
| 696 | Ga0207703_10001748 | 3300026035 | Bacteria | 19439 |
| 697 | Ga0207703_10007108 | 3300026035 | Bacteria | 8907 |
| 698 | Ga0207703_10020187 | 3300026035 | Bacteria | 5210 |
| 699 | Ga0207703_10124604 | 3300026035 | Bacteria | 2216 |
| 700 | Ga0207703_10488216 | 3300026035 | Bacteria | 1155 |
| 701 | Ga0207703_11007532 | 3300026035 | Bacteria | 799 |
| 702 | Ga0207703_12034965 | 3300026035 | Bacteria | 550 |
| 703 | Ga0207639_10030055 | 3300026041 | Bacteria | 3982 |
| 704 | Ga0207639_10183239 | 3300026041 | Bacteria | 1783 |
| 705 | Ga0207639_10199709 | 3300026041 | Bacteria | 1714 |
| 706 | Ga0207639_11242500 | 3300026041 | Bacteria | 699 |
| 707 | Ga0207639_11597682 | 3300026041 | Bacteria | 612 |
| 708 | Ga0207678_10003767 | 3300026067 | Bacteria | 13637 |
| 709 | Ga0207678_10018029 | 3300026067 | Bacteria | 6202 |
| 710 | Ga0207678_10420686 | 3300026067 | Bacteria | 1159 |
| 711 | Ga0207678_11075367 | 3300026067 | Bacteria | 712 |
| 712 | Ga0207678_11816775 | 3300026067 | Bacteria | 533 |
| 713 | Ga0207708_10238106 | 3300026075 | Bacteria | 1463 |
| 714 | Ga0207708_10545729 | 3300026075 | Bacteria | 977 |
| 715 | Ga0207702_10004875 | 3300026078 | Bacteria | 11814 |
| 716 | Ga0207702_10162793 | 3300026078 | Bacteria | 2039 |
| 717 | Ga0207702_10619397 | 3300026078 | Bacteria | 1063 |
| 718 | Ga0207702_10973022 | 3300026078 | Bacteria | 842 |
| 719 | Ga0207702_11899300 | 3300026078 | Bacteria | 587 |
| 720 | Ga0207641_10016191 | 3300026088 | Bacteria | 6106 |
| 721 | Ga0207641_10020236 | 3300026088 | Bacteria | 5464 |
| 722 | Ga0207641_10027686 | 3300026088 | Bacteria | 4682 |
| 723 | Ga0207641_10043194 | 3300026088 | Bacteria | 3784 |
| 724 | Ga0207641_10244794 | 3300026088 | Bacteria | 1672 |
| 725 | Ga0207641_10249076 | 3300026088 | Bacteria | 1658 |
| 726 | Ga0207641_10289757 | 3300026088 | Bacteria | 1543 |
| 727 | Ga0207641_10447897 | 3300026088 | Bacteria | 1247 |
| 728 | Ga0207641_11799220 | 3300026088 | Bacteria | 614 |
| 729 | Ga0207648_10019721 | 3300026089 | Bacteria | 6083 |
| 730 | Ga0207648_10029021 | 3300026089 | Bacteria | 4905 |
| 731 | Ga0207648_10053971 | 3300026089 | Bacteria | 3511 |
| 732 | Ga0207648_10146863 | 3300026089 | Bacteria | 2080 |
| 733 | Ga0207648_10158812 | 3300026089 | Bacteria | 1996 |
| 734 | Ga0207648_10336740 | 3300026089 | Bacteria | 1358 |
| 735 | Ga0207648_10781787 | 3300026089 | Bacteria | 888 |
| 736 | Ga0207648_11699060 | 3300026089 | Bacteria | 593 |
| 737 | Ga0207676_10000660 | 3300026095 | Bacteria | 27633 |
| 738 | Ga0207676_10023252 | 3300026095 | Bacteria | 4569 |
| 739 | Ga0207676_10028649 | 3300026095 | Bacteria | 4162 |
| 740 | Ga0207676_10121175 | 3300026095 | Bacteria | 2206 |
| 741 | Ga0207676_10231393 | 3300026095 | Bacteria | 1652 |
| 742 | Ga0207676_10287685 | 3300026095 | Bacteria | 1495 |
| 743 | Ga0207676_10313279 | 3300026095 | Bacteria | 1437 |
| 744 | Ga0207676_11684430 | 3300026095 | Bacteria | 632 |
| 745 | Ga0207674_10014711 | 3300026116 | Bacteria | 8629 |
| 746 | Ga0207674_10018509 | 3300026116 | Bacteria | 7570 |
| 747 | Ga0207674_10037010 | 3300026116 | Bacteria | 5079 |
| 748 | Ga0207674_10825990 | 3300026116 | Bacteria | 894 |
| 749 | Ga0207675_100003221 | 3300026118 | Bacteria | 16017 |
| 750 | Ga0207675_100019157 | 3300026118 | Bacteria | 6387 |
| 751 | Ga0207675_100104404 | 3300026118 | Bacteria | 2671 |
| 752 | Ga0207683_10047843 | 3300026121 | Bacteria | 3745 |
| 753 | Ga0207683_10070308 | 3300026121 | Bacteria | 3092 |
| 754 | Ga0207683_10178407 | 3300026121 | Bacteria | 1926 |
| 755 | Ga0207683_10407713 | 3300026121 | Bacteria | 1251 |
| 756 | Ga0207683_10447901 | 3300026121 | Bacteria | 1190 |
| 757 | Ga0207683_11032758 | 3300026121 | Bacteria | 763 |
| 758 | Ga0207683_11887413 | 3300026121 | Bacteria | 546 |
| 759 | Ga0207698_10002589 | 3300026142 | Bacteria | 10755 |
| 760 | Ga0207698_10030656 | 3300026142 | Bacteria | 3871 |
| 761 | Ga0207698_10048051 | 3300026142 | Bacteria | 3237 |
| 762 | Ga0207698_10275652 | 3300026142 | Bacteria | 1553 |
| 763 | Ga0207698_11414492 | 3300026142 | Bacteria | 711 |
| 764 | Ga0207698_11533569 | 3300026142 | Bacteria | 682 |
| 765 | Ga0207698_11646563 | 3300026142 | Bacteria | 657 |
| 766 | Ga0207698_11676086 | 3300026142 | Bacteria | 651 |
| 767 | Ga0207698_11863146 | 3300026142 | Bacteria | 616 |
| 768 | Ga0207698_12199648 | 3300026142 | Bacteria | 564 |
| 769 | Ga0209281_1000023 | 3300027111 | Bacteria | 519955 |
| 770 | Ga0209389_1033766 | 3300027296 | Bacteria | 4208 |
| 771 | Ga0209371_1036352 | 3300027312 | Bacteria | 1030 |
| 772 | Ga0209813_10009482 | 3300027866 | Bacteria | 2491 |
| 773 | Ga0209813_10073825 | 3300027866 | Bacteria | 1114 |
| 774 | Ga0207428_11165531 | 3300027907 | Bacteria | 537 |
| 775 | Ga0268266_11978636 | 3300028379 | Bacteria | 556 |
| 776 | Ga0268265_10077470 | 3300028380 | Bacteria | 2611 |
| 777 | Ga0268265_10109496 | 3300028380 | Bacteria | 2251 |
| 778 | Ga0268265_10600875 | 3300028380 | Bacteria | 1051 |
| 779 | Ga0268265_10743641 | 3300028380 | Bacteria | 951 |
| 780 | Ga0268265_11307156 | 3300028380 | Bacteria | 725 |
| 781 | Ga0268264_10006446 | 3300028381 | Bacteria | 9879 |
| 782 | Ga0268264_10067766 | 3300028381 | Bacteria | 3013 |
| 783 | Ga0268264_10363049 | 3300028381 | Bacteria | 1382 |
| 784 | Ga0268264_10564191 | 3300028381 | Bacteria | 1118 |
| 785 | Ga0268264_10680355 | 3300028381 | Bacteria | 1020 |
| 786 | Ga0268264_11997984 | 3300028381 | Bacteria | 589 |
| 787 | Ga0307517_10074242 | 3300028786 | Bacteria | 3002 |
| 788 | Ga0307517_10173931 | 3300028786 | Bacteria | 1408 |
| 789 | Ga0307517_10267130 | 3300028786 | Bacteria | 987 |
| 790 | Ga0307515_10000013 | 3300028794 | Bacteria | 568456 |
| 791 | Ga0307515_10000037 | 3300028794 | Bacteria | 331970 |
| 792 | Ga0307515_10105571 | 3300028794 | Bacteria | 3352 |
| 793 | Ga0307515_10105752 | 3300028794 | Bacteria | 3347 |
| 794 | Ga0307515_10409874 | 3300028794 | Bacteria | 978 |
| 795 | Ga0307515_10591478 | 3300028794 | Bacteria | 720 |
| 796 | Ga0268256_1044252 | 3300030500 | Bacteria | 977 |
| 797 | Ga0307512_10175569 | 3300030522 | Bacteria | 1217 |
| 798 | Ga0265316_10000180 | 3300031344 | Bacteria | 71764 |
| 799 | Ga0307513_10754781 | 3300031456 | Bacteria | 678 |
| 800 | Ga0307513_10762378 | 3300031456 | Bacteria | 673 |
| 801 | Ga0307509_10861347 | 3300031507 | Bacteria | 571 |
| 802 | Ga0307408_100014492 | 3300031548 | Bacteria | 5238 |
| 803 | Ga0307408_100059178 | 3300031548 | Bacteria | 2788 |
| 804 | Ga0307408_100430249 | 3300031548 | Bacteria | 1140 |
| 805 | Ga0307408_100724192 | 3300031548 | Bacteria | 896 |
| 806 | Ga0307508_10517386 | 3300031616 | Bacteria | 789 |
| 807 | Ga0307514_10000533 | 3300031649 | Bacteria | 74078 |
| 808 | Ga0307516_10004112 | 3300031730 | Bacteria | 18151 |
| 809 | Ga0307516_10847704 | 3300031730 | Bacteria | 577 |
| 810 | Ga0307405_10026040 | 3300031731 | Bacteria | 3368 |
| 811 | Ga0307405_10041390 | 3300031731 | Bacteria | 2796 |
| 812 | Ga0307405_11477972 | 3300031731 | Bacteria | 596 |
| 813 | Ga0307413_10030250 | 3300031824 | Bacteria | 3040 |
| 814 | Ga0307413_10324676 | 3300031824 | Bacteria | 1177 |
| 815 | Ga0307410_10005676 | 3300031852 | Bacteria | 6639 |
| 816 | Ga0307410_10484526 | 3300031852 | Bacteria | 1015 |
| 817 | Ga0307406_10002787 | 3300031901 | Bacteria | 9539 |
| 818 | Ga0307406_10236256 | 3300031901 | Bacteria | 1368 |
| 819 | Ga0307407_10095579 | 3300031903 | Bacteria | 1832 |
| 820 | Ga0307407_10422176 | 3300031903 | Bacteria | 961 |
| 821 | Ga0307407_11078698 | 3300031903 | Bacteria | 623 |
| 822 | Ga0307412_10053728 | 3300031911 | Bacteria | 2671 |
| 823 | Ga0307412_10105704 | 3300031911 | Bacteria | 2000 |
| 824 | Ga0307412_11063416 | 3300031911 | Bacteria | 718 |
| 825 | Ga0307409_100036556 | 3300031995 | Bacteria | 3611 |
| 826 | Ga0307409_100561838 | 3300031995 | Bacteria | 1122 |
| 827 | Ga0307409_101671358 | 3300031995 | Bacteria | 665 |
| 828 | Ga0307416_100231616 | 3300032002 | Bacteria | 1781 |
| 829 | Ga0307416_101029015 | 3300032002 | Bacteria | 927 |
| 830 | Ga0307416_101076444 | 3300032002 | Bacteria | 908 |
| 831 | Ga0307416_101546051 | 3300032002 | Bacteria | 769 |
| 832 | Ga0307416_103051478 | 3300032002 | Bacteria | 560 |
| 833 | Ga0307414_10888069 | 3300032004 | Bacteria | 817 |
| 834 | Ga0307411_10004113 | 3300032005 | Bacteria | 6903 |
| 835 | Ga0307411_10008760 | 3300032005 | Bacteria | 5264 |
| 836 | Ga0307411_10125064 | 3300032005 | Bacteria | 1868 |
| 837 | Ga0307411_10743827 | 3300032005 | Bacteria | 858 |
| 838 | Ga0307411_11304475 | 3300032005 | Bacteria | 661 |
| 839 | Ga0307415_100001187 | 3300032126 | Bacteria | 12187 |
| 840 | Ga0307510_10256422 | 3300033180 | Bacteria | 1233 |
| 841 | Ga0373948_0017056 | 3300034817 | Bacteria | 1349 |
| 842 | Ga0373950_0010239 | 3300034818 | Bacteria | 1511 |
| 843 | Ga0373940_0000136 | 3300035088 | Bacteria | 9391 |
| 844 | Ga0373944_0040391 | 3300035089 | Bacteria | 1440 |
| 845 | Ga0373944_0183056 | 3300035089 | Bacteria | 752 |
| 846 | Ga0373949_0095761 | 3300035090 | Bacteria | 808 |
| 847 | Ga0373939_0000059 | 3300035114 | Bacteria | 38006 |
| 848 | Ga0373941_0041699 | 3300035115 | Bacteria | 1422 |
| 849 | Ga0373945_0131295 | 3300035116 | Bacteria | 1004 |
| 850 | Ga0373945_0311832 | 3300035116 | Bacteria | 676 |
| 851 | Ga0373956_0432069 | 3300035119 | Bacteria | 629 |
| 852 | Ga0373957_0062678 | 3300035120 | Bacteria | 1443 |
| 853 | Ga0373960_0001178 | 3300035121 | Bacteria | 5698 |
| 854 | Ga0373960_0234561 | 3300035121 | Bacteria | 661 |
| 855 | Ga0373955_0688087 | 3300035172 | Bacteria | 627 |
| 856 | Ga0373962_0018166 | 3300035242 | Bacteria | 1828 |
| 857 | Ga0373924_0038467 | 3300035410 | Bacteria | 1952 |
| 858 | Ga0373931_0000334 | 3300035691 | Bacteria | 19574 |
| 859 | Ga0373931_0001033 | 3300035691 | Bacteria | 11770 |
| 860 | Ga0373935_0259327 | 3300035692 | Bacteria | 1219 |
| 861 | Ga0373935_0330311 | 3300035692 | Bacteria | 1084 |
| 862 | Ga0373935_1141289 | 3300035692 | Bacteria | 580 |
| 863 | Ga0373927_0075418 | 3300035695 | Bacteria | 2184 |
| 864 | Ga0373927_0496591 | 3300035695 | Bacteria | 806 |
| 865 | Ga0373933_0169041 | 3300035724 | Bacteria | 1391 |
| 866 | Ga0373947_0045257 | 3300035725 | Bacteria | 2633 |
| 867 | Ga0373947_0171299 | 3300035725 | Bacteria | 1409 |
| 868 | Ga0373937_0459011 | 3300036401 | Bacteria | 1210 |
| 869 | Ga0373937_0769336 | 3300036401 | Bacteria | 910 |
| 870 | Ga0373925_0004378 | 3300037068 | Bacteria | 10673 |
| 871 | Ga0373925_0079048 | 3300037068 | Bacteria | 2498 |
| 872 | Ga0373925_0271315 | 3300037068 | Bacteria | 1365 |
| 873 | Ga0395900_0000387 | 3300037418 | Bacteria | 63605 |
| 874 | Ga0395898_0000958 | 3300037466 | Bacteria | 45958 |
| 875 | Ga0395898_0729126 | 3300037466 | Bacteria | 933 |
| 876 | Ga0395905_0017509 | 3300037471 | Bacteria | 6803 |
| 877 | Ga0395905_0043266 | 3300037471 | Bacteria | 4225 |
| 878 | Ga0395905_0082870 | 3300037471 | Bacteria | 3005 |
| 879 | Ga0395905_0212641 | 3300037471 | Bacteria | 1811 |
| 880 | Ga0395905_0630520 | 3300037471 | Bacteria | 974 |
| 881 | Ga0395905_0888196 | 3300037471 | Bacteria | 794 |
| 882 | Ga0395905_1415934 | 3300037471 | Bacteria | 599 |
| 883 | Ga0436364_0410954 | 3300037853 | Bacteria | 785 |
| 884 | Ga0436364_0677523 | 3300037853 | Bacteria | 682 |
| 885 | Ga0436365_0312685 | 3300039437 | Bacteria | 4619 |
| 886 | Ga0436360_1262653 | 3300039438 | Bacteria | 1764 |
| 887 | Ga0436361_0019501 | 3300039447 | Bacteria | 28508 |
| 888 | Ga0436361_1031544 | 3300039447 | Bacteria | 8114 |
| 889 | Ga0436361_1220274 | 3300039447 | Bacteria | 48509 |
| 890 | Ga0436363_0126290 | 3300039450 | Bacteria | 503 |
| 891 | Ga0436363_1209952 | 3300039450 | Bacteria | 2781 |
| 892 | Ga0436362_0064679 | 3300039453 | Bacteria | 657 |
| 893 | Ga0439453_0092932 | 3300041408 | Bacteria | 664 |
| 894 | Ga0439461_0066004 | 3300041410 | Bacteria | 830 |
| 895 | Ga0439465_0042070 | 3300041413 | Bacteria | 1480 |
| 896 | Ga0451789_0529892 | 3300041443 | Bacteria | 609 |
| 897 | Ga0451791_0898320 | 3300041451 | Bacteria | 695 |
| 898 | Ga0451793_1409532 | 3300041452 | Bacteria | 924 |
| 899 | Ga0451795_1063439 | 3300041456 | Bacteria | 520 |
| 900 | Ga0451798_0749136 | 3300041458 | Bacteria | 558 |
| 901 | Ga0451802_0239083 | 3300041460 | Bacteria | 521 |
| 902 | Ga0451802_1320011 | 3300041460 | Bacteria | 638 |
| 903 | Ga0451804_0191505 | 3300041463 | Bacteria | 888 |
| 904 | Ga0451804_0632507 | 3300041463 | Bacteria | 508 |
| 905 | Ga0451804_0639527 | 3300041463 | Bacteria | 529 |
| 906 | Ga0451841_1083417 | 3300041498 | Bacteria | 619 |
| 907 | Ga0451845_0298283 | 3300041501 | Bacteria | 569 |
| 908 | Ga0451849_1244220 | 3300041505 | Bacteria | 710 |
| 909 | Ga0451851_1153008 | 3300041507 | Bacteria | 578 |
| 910 | Ga0451853_1131216 | 3300041512 | Bacteria | 791 |
| 911 | Ga0451853_3130241 | 3300041512 | Bacteria | 512 |
| 912 | Ga0439433_0032858 | 3300041999 | Bacteria | 1191 |
| 913 | Ga0439441_170853 | 3300042001 | Bacteria | 519 |
| 914 | Ga0439441_185558 | 3300042001 | Bacteria | 502 |
| 915 | Ga0439445_0118230 | 3300042004 | Bacteria | 760 |
| 916 | Ga0439449_0219225 | 3300042007 | Bacteria | 713 |
| 917 | Ga0439450_044909 | 3300042008 | Bacteria | 1036 |
| 918 | Ga0439454_076130 | 3300042011 | Bacteria | 602 |
| 919 | Ga0439462_0030492 | 3300042015 | Bacteria | 1427 |
| 920 | Ga0450912_020394 | 3300042116 | Bacteria | 637 |
| 921 | Ga0450912_037144 | 3300042116 | Bacteria | 520 |
| 922 | Ga0450917_008273 | 3300042120 | Bacteria | 803 |
| 923 | Ga0450919_008293 | 3300042121 | Bacteria | 1205 |
| 924 | Ga0450920_015070 | 3300042122 | Bacteria | 1467 |
| 925 | Ga0450923_039264 | 3300042125 | Bacteria | 990 |
| 926 | Ga0450888_001212 | 3300042126 | Bacteria | 2462 |
| 927 | Ga0450890_000667 | 3300042127 | Bacteria | 4999 |
| 928 | Ga0450890_009886 | 3300042127 | Bacteria | 1225 |
| 929 | Ga0450891_000038 | 3300042129 | Bacteria | 9579 |
| 930 | Ga0450892_002137 | 3300042130 | Bacteria | 1724 |
| 931 | Ga0450896_010182 | 3300042133 | Bacteria | 1317 |
| 932 | Ga0450896_013473 | 3300042133 | Bacteria | 1163 |
| 933 | Ga0450899_012978 | 3300042135 | Bacteria | 938 |
| 934 | Ga0450903_048854 | 3300042138 | Bacteria | 621 |
| 935 | Ga0450904_014314 | 3300042139 | Bacteria | 791 |
| 936 | Ga0450905_013636 | 3300042142 | Bacteria | 1153 |
| 937 | Ga0450889_000077 | 3300042144 | Bacteria | 8873 |
| 938 | Ga0439444_0025232 | 3300042437 | Bacteria | 1080 |
| 939 | Ga0439459_0006048 | 3300042438 | Bacteria | 2006 |
| 940 | Ga0439459_0135819 | 3300042438 | Bacteria | 632 |
| 941 | Ga0439464_0063933 | 3300042439 | Bacteria | 1080 |
| 942 | Ga0439464_0075616 | 3300042439 | Bacteria | 1001 |
| 943 | Ga0450918_000994 | 3300042531 | Bacteria | 5874 |
| 944 | Ga0450918_103656 | 3300042531 | Bacteria | 558 |
| 945 | Ga0450893_0000835 | 3300042532 | Bacteria | 4555 |
| 946 | Ga0451577_0003346 | 3300042876 | Bacteria | 17953 |
| 947 | Ga0451577_0049233 | 3300042876 | Bacteria | 3763 |
| 948 | Ga0466969_0000009 | 3300044656 | Bacteria | 125464 |
| 949 | Ga0466969_0033505 | 3300044656 | Bacteria | 2607 |
| 950 | Ga0466969_0099931 | 3300044656 | Bacteria | 1366 |
| 951 | Ga0466972_0000303 | 3300044658 | Bacteria | 29316 |
| 952 | Ga0466972_0017775 | 3300044658 | Bacteria | 3559 |
| 953 | Ga0466972_0411468 | 3300044658 | Bacteria | 634 |
| 954 | Ga0466965_0029857 | 3300044683 | Bacteria | 2654 |
| 955 | Ga0466965_0054438 | 3300044683 | Bacteria | 1989 |
| 956 | Ga0466965_0121033 | 3300044683 | Bacteria | 1352 |
| 957 | Ga0466965_0255796 | 3300044683 | Bacteria | 940 |
| 958 | Ga0466965_0365573 | 3300044683 | Bacteria | 792 |
| 959 | Ga0466965_0380129 | 3300044683 | Bacteria | 777 |
| 960 | Ga0466966_0006238 | 3300044684 | Bacteria | 7883 |
| 961 | Ga0466966_0085141 | 3300044684 | Bacteria | 1965 |
| 962 | Ga0466961_0007837 | 3300044693 | Bacteria | 6800 |
| 963 | Ga0466961_0113254 | 3300044693 | Bacteria | 1705 |
| 964 | Ga0466961_0120872 | 3300044693 | Bacteria | 1645 |
| 965 | Ga0466961_0217368 | 3300044693 | Bacteria | 1178 |
| 966 | Ga0466963_0070042 | 3300044694 | Bacteria | 2358 |
| 967 | Ga0466963_0169972 | 3300044694 | Bacteria | 1519 |
| 968 | Ga0466964_0008231 | 3300044706 | Bacteria | 3912 |
| 969 | Ga0466964_0102018 | 3300044706 | Bacteria | 1266 |
| 970 | Ga0453684_0425781 | 3300044712 | Bacteria | 1482 |
| 971 | Ga0453684_0633040 | 3300044712 | Bacteria | 1169 |
| 972 | Ga0453684_1176294 | 3300044712 | Bacteria | 806 |
| 973 | Ga0453684_1260097 | 3300044712 | Bacteria | 773 |
| 974 | Ga0466971_0005085 | 3300044719 | Bacteria | 5697 |
| 975 | Ga0466971_0490179 | 3300044719 | Bacteria | 606 |
| 976 | Ga0466968_0015588 | 3300044735 | Bacteria | 3014 |
| 977 | Ga0466968_0124907 | 3300044735 | Bacteria | 1167 |
| 978 | Ga0466970_0065532 | 3300044765 | Bacteria | 1949 |
| 979 | Ga0466957_0029032 | 3300044842 | Bacteria | 3295 |
| 980 | Ga0466957_0043697 | 3300044842 | Bacteria | 2714 |
| 981 | Ga0466960_0019732 | 3300044901 | Bacteria | 2975 |
| 982 | Ga0466959_0006139 | 3300045049 | Bacteria | 8300 |
| 983 | Ga0466959_0024130 | 3300045049 | Bacteria | 4502 |
| 984 | Ga0466959_0038351 | 3300045049 | Bacteria | 3540 |
| 985 | Ga0466959_1162274 | 3300045049 | Bacteria | 513 |
| 986 | Ga0451576_0744631 | 3300045051 | Bacteria | 1029 |
| 987 | Ga0451576_0923382 | 3300045051 | Bacteria | 915 |
| 988 | Ga0451576_1970887 | 3300045051 | Bacteria | 602 |
| 989 | Ga0451576_2468493 | 3300045051 | Bacteria | 531 |
| 990 | Ga0466958_0055977 | 3300045836 | Bacteria | 2394 |
| 991 | Ga0466958_0125402 | 3300045836 | Bacteria | 1610 |
| 992 | Ga0466967_0235571 | 3300045976 | Bacteria | 1744 |
| 993 | Ga0495592_0541922 | 3300046454 | Bacteria | 717 |
| 994 | Ga0495603_0132725 | 3300046455 | Bacteria | 1450 |
| 995 | Ga0495603_0292470 | 3300046455 | Bacteria | 936 |
| 996 | Ga0495590_0020006 | 3300046457 | Bacteria | 2380 |
| 997 | Ga0495651_0718940 | 3300046462 | Bacteria | 621 |
| 998 | Ga0495580_0116562 | 3300046472 | Bacteria | 1855 |
| 999 | Ga0495580_0156185 | 3300046472 | Bacteria | 1580 |
| 1000 | Ga0495662_0110735 | 3300046476 | Bacteria | 1346 |
| 1001 | Ga0495664_0738531 | 3300046477 | Bacteria | 581 |
| 1002 | Ga0495610_0077829 | 3300046512 | Bacteria | 1531 |
| 1003 | Ga0495618_0309727 | 3300046514 | Bacteria | 980 |
| 1004 | Ga0495632_0007493 | 3300046519 | Bacteria | 6846 |
| 1005 | Ga0495643_0037769 | 3300046522 | Bacteria | 2647 |
| 1006 | Ga0495643_0178509 | 3300046522 | Bacteria | 1033 |
| 1007 | Ga0495643_0337173 | 3300046522 | Bacteria | 678 |
| 1008 | Ga0495663_0037655 | 3300046525 | Bacteria | 1459 |
| 1009 | Ga0495642_0046396 | 3300046528 | Bacteria | 1778 |
| 1010 | Ga0495654_0392669 | 3300046530 | Bacteria | 552 |
| 1011 | Ga0495665_0343081 | 3300046531 | Bacteria | 761 |
| 1012 | Ga0495640_0088699 | 3300046533 | Bacteria | 2044 |
| 1013 | Ga0495586_0417385 | 3300046535 | Bacteria | 773 |
| 1014 | Ga0495598_0218020 | 3300046537 | Bacteria | 695 |
| 1015 | Ga0495609_0218623 | 3300046538 | Bacteria | 792 |
| 1016 | Ga0495621_0022142 | 3300046539 | Bacteria | 2103 |
| 1017 | Ga0495621_0059719 | 3300046539 | Bacteria | 1382 |
| 1018 | Ga0495621_0162629 | 3300046539 | Bacteria | 883 |
| 1019 | Ga0495597_0289147 | 3300046542 | Bacteria | 637 |
| 1020 | Ga0495645_0202214 | 3300046543 | Bacteria | 1347 |
| 1021 | Ga0495633_0316998 | 3300046558 | Bacteria | 708 |
| 1022 | Ga0495633_0397649 | 3300046558 | Bacteria | 623 |
| 1023 | Ga0495667_0225288 | 3300046559 | Bacteria | 1196 |
| 1024 | Ga0495668_0304446 | 3300046616 | Bacteria | 874 |
| 1025 | Ga0495634_0368209 | 3300046642 | Bacteria | 858 |
| 1026 | Ga0495611_0330984 | 3300046648 | Bacteria | 700 |
| 1027 | Ga0495625_0482719 | 3300046660 | Bacteria | 760 |
| 1028 | Ga0495635_0352832 | 3300046663 | Bacteria | 981 |
| 1029 | Ga0495647_0073734 | 3300046681 | Bacteria | 1371 |
| 1030 | Ga0495658_0023972 | 3300046683 | Bacteria | 3245 |
| 1031 | Ga0495658_0056885 | 3300046683 | Bacteria | 2232 |
| 1032 | Ga0495658_0814340 | 3300046683 | Bacteria | 598 |
| 1033 | Ga0495658_1092499 | 3300046683 | Bacteria | 508 |
| 1034 | Ga0495670_0048271 | 3300046691 | Bacteria | 2130 |
| 1035 | Ga0495670_0385768 | 3300046691 | Bacteria | 756 |
| 1036 | Ga0495649_0129737 | 3300046694 | Bacteria | 1330 |
| 1037 | Ga0495600_0813015 | 3300046809 | Bacteria | 556 |
| 1038 | Ga0495660_0010853 | 3300046810 | Bacteria | 5292 |
| 1039 | Ga0495660_0396678 | 3300046810 | Bacteria | 605 |
| 1040 | Ga0495581_0527471 | 3300047315 | Bacteria | 686 |
| 1041 | Ga0495674_0630149 | 3300047319 | Bacteria | 847 |
| 1042 | Ga0495676_1039322 | 3300047321 | Bacteria | 522 |
| 1043 | Ga0495687_006891 | 3300047443 | Bacteria | 6845 |
| 1044 | Ga0495687_011062 | 3300047443 | Bacteria | 4882 |
| 1045 | Ga0495675_0788963 | 3300047444 | Bacteria | 527 |
| 1046 | Ga0495684_0048209 | 3300047471 | Bacteria | 3258 |
| 1047 | Ga0496100_0457234 | 3300048903 | Bacteria | 979 |
| 1048 | Ga0496100_1189419 | 3300048903 | Bacteria | 601 |
| 1049 | Ga0496100_1638673 | 3300048903 | Bacteria | 509 |
| 1050 | Ga0496101_0107488 | 3300048904 | Bacteria | 2096 |
| 1051 | Ga0496101_0792050 | 3300048904 | Bacteria | 748 |
| 1052 | Ga0496102_0065346 | 3300048905 | Bacteria | 3334 |
| 1053 | Ga0496104_0077738 | 3300048907 | Bacteria | 3162 |
| 1054 | Ga0496104_0243643 | 3300048907 | Bacteria | 1710 |
| 1055 | Ga0496104_0469705 | 3300048907 | Bacteria | 1169 |
| 1056 | Ga0496104_1589975 | 3300048907 | Bacteria | 556 |
| 1057 | Ga0496105_0036788 | 3300048908 | Bacteria | 4034 |
| 1058 | Ga0496105_0095091 | 3300048908 | Bacteria | 2461 |
| 1059 | Ga0496105_0610421 | 3300048908 | Bacteria | 846 |
| 1060 | Ga0496106_0046614 | 3300048909 | Bacteria | 3259 |
| 1061 | Ga0496106_1457746 | 3300048909 | Bacteria | 528 |
| 1062 | Ga0496107_0051049 | 3300048910 | Bacteria | 2982 |
| 1063 | Ga0496107_0297231 | 3300048910 | Bacteria | 1202 |
| 1064 | Ga0496107_0596399 | 3300048910 | Bacteria | 817 |
| 1065 | Ga0496108_0021457 | 3300048911 | Bacteria | 5310 |
| 1066 | Ga0496108_0148087 | 3300048911 | Bacteria | 2025 |
| 1067 | Ga0496108_1320020 | 3300048911 | Bacteria | 606 |
| 1068 | Ga0496108_1509713 | 3300048911 | Bacteria | 559 |
| 1069 | Ga0496109_0094545 | 3300048912 | Bacteria | 2767 |
| 1070 | Ga0496109_0245942 | 3300048912 | Bacteria | 1684 |
| 1071 | Ga0496109_0390803 | 3300048912 | Bacteria | 1314 |
| 1072 | Ga0496109_0775212 | 3300048912 | Bacteria | 897 |
| 1073 | Ga0496109_1197313 | 3300048912 | Bacteria | 696 |
| 1074 | Ga0496109_1384869 | 3300048912 | Bacteria | 639 |
| 1075 | Ga0496109_1581517 | 3300048912 | Bacteria | 590 |
| 1076 | Ga0496110_0092477 | 3300048913 | Bacteria | 2707 |
| 1077 | Ga0496110_0252319 | 3300048913 | Bacteria | 1606 |
| 1078 | Ga0496110_0389566 | 3300048913 | Bacteria | 1270 |
| 1079 | Ga0496110_0946500 | 3300048913 | Bacteria | 768 |
| 1080 | Ga0496110_1388901 | 3300048913 | Bacteria | 612 |
| 1081 | Ga0496112_0039732 | 3300048915 | Bacteria | 4599 |
| 1082 | Ga0496112_1814954 | 3300048915 | Bacteria | 522 |
| 1083 | Ga0496113_0071241 | 3300048916 | Bacteria | 2644 |
| 1084 | Ga0496113_0102226 | 3300048916 | Bacteria | 2222 |
| 1085 | Ga0496113_0621467 | 3300048916 | Bacteria | 865 |
| 1086 | Ga0496113_0937481 | 3300048916 | Bacteria | 684 |
| 1087 | Ga0496113_1108128 | 3300048916 | Bacteria | 621 |
| 1088 | Ga0496114_0008894 | 3300048917 | Bacteria | 7963 |
| 1089 | Ga0496114_0951788 | 3300048917 | Bacteria | 741 |
| 1090 | Ga0496114_1351303 | 3300048917 | Bacteria | 600 |
| 1091 | Ga0496115_1114636 | 3300048918 | Bacteria | 597 |
| 1092 | Ga0496118_0152022 | 3300048921 | Bacteria | 1447 |
| 1093 | Ga0496121_0134613 | 3300048924 | Bacteria | 1843 |
| 1094 | Ga0496122_0522641 | 3300048925 | Bacteria | 572 |
| 1095 | Ga0496123_0449855 | 3300048926 | Bacteria | 574 |
| 1096 | Ga0496124_0000089 | 3300048927 | Bacteria | 192423 |
| 1097 | Ga0496125_0308353 | 3300048928 | Bacteria | 966 |
| 1098 | Ga0496125_0481248 | 3300048928 | Bacteria | 703 |
| 1099 | Ga0496125_0772769 | 3300048928 | Bacteria | 500 |
| 1100 | Ga0501306_072310 | 3300049127 | Bacteria | 584 |
| 1101 | Ga0501308_013624 | 3300049128 | Bacteria | 942 |
| 1102 | Ga0501308_047802 | 3300049128 | Bacteria | 619 |
| 1103 | Ga0501310_001719 | 3300049130 | Bacteria | 2015 |
| 1104 | Ga0501304_013783 | 3300049160 | Bacteria | 743 |
| 1105 | Ga0501305_076265 | 3300049161 | Bacteria | 596 |
| 1106 | Ga0495678_266541 | 3300049459 | Bacteria | 505 |
| 1107 | Ga0495682_0045286 | 3300049460 | Bacteria | 1608 |
| 1108 | Ga0501290_055454 | 3300049513 | Bacteria | 627 |
| 1109 | Ga0501291_001998 | 3300049514 | Bacteria | 2403 |
| 1110 | Ga0501294_009959 | 3300049517 | Bacteria | 936 |
| 1111 | Ga0501295_039868 | 3300049518 | Bacteria | 970 |
| 1112 | Ga0501296_009534 | 3300049519 | Bacteria | 1139 |
| 1113 | Ga0501297_007843 | 3300049520 | Bacteria | 1167 |
| 1114 | Ga0501298_022067 | 3300049521 | Bacteria | 1197 |
| 1115 | Ga0501300_002663 | 3300049523 | Bacteria | 2675 |
| 1116 | Ga0501311_036903 | 3300049527 | Bacteria | 728 |
| 1117 | Ga0501312_011659 | 3300049528 | Bacteria | 1198 |
| 1118 | Ga0501312_090299 | 3300049528 | Bacteria | 564 |
| 1119 | Ga0501313_069197 | 3300049529 | Bacteria | 509 |
| 1120 | Ga0501314_000884 | 3300049530 | Bacteria | 2014 |
| 1121 | Ga0501314_018859 | 3300049530 | Bacteria | 705 |
| 1122 | Ga0501315_009330 | 3300049531 | Bacteria | 1158 |
| 1123 | Ga0501317_044182 | 3300049533 | Bacteria | 690 |
| 1124 | Ga0501318_036241 | 3300049534 | Bacteria | 690 |
| 1125 | Ga0501319_014471 | 3300049535 | Bacteria | 662 |
| 1126 | Ga0501321_065683 | 3300049537 | Bacteria | 556 |
| 1127 | Ga0501323_070860 | 3300049539 | Bacteria | 558 |
| 1128 | Ga0501034_0408271 | 3300049571 | Bacteria | 1280 |
| 1129 | Ga0501047_0549524 | 3300049581 | Bacteria | 979 |
| 1130 | Ga0501067_0819311 | 3300049583 | Bacteria | 524 |
| 1131 | Ga0501199_003769 | 3300049650 | Bacteria | 1468 |
| 1132 | Ga0501201_001747 | 3300049651 | Bacteria | 2014 |
| 1133 | Ga0501202_021014 | 3300049652 | Bacteria | 1301 |
| 1134 | Ga0501206_050724 | 3300049653 | Bacteria | 660 |
| 1135 | Ga0501208_095721 | 3300049655 | Bacteria | 630 |
| 1136 | Ga0501211_001829 | 3300049658 | Bacteria | 2267 |
| 1137 | Ga0501217_145839 | 3300049661 | Bacteria | 704 |
| 1138 | Ga0501223_025635 | 3300049663 | Bacteria | 1147 |
| 1139 | Ga0501227_019570 | 3300049665 | Bacteria | 1545 |
| 1140 | Ga0501233_001981 | 3300049668 | Bacteria | 3566 |
| 1141 | Ga0501235_002121 | 3300049669 | Bacteria | 4260 |
| 1142 | Ga0501236_012853 | 3300049670 | Bacteria | 1136 |
| 1143 | Ga0501255_003573 | 3300049684 | Bacteria | 1453 |
| 1144 | Ga0501257_030638 | 3300049686 | Bacteria | 1296 |
| 1145 | Ga0501258_001648 | 3300049687 | Bacteria | 1863 |
| 1146 | Ga0501258_032800 | 3300049687 | Bacteria | 663 |
| 1147 | Ga0501259_115694 | 3300049688 | Bacteria | 632 |
| 1148 | Ga0501221_019877 | 3300049704 | Bacteria | 1307 |
| 1149 | Ga0501225_0011857 | 3300049705 | Bacteria | 2452 |
| 1150 | Ga0501229_032828 | 3300049706 | Bacteria | 717 |
| 1151 | Ga0501262_002466 | 3300049759 | Bacteria | 2096 |
| 1152 | Ga0501265_003770 | 3300049762 | Bacteria | 1722 |
| 1153 | Ga0501266_085748 | 3300049763 | Bacteria | 540 |
| 1154 | Ga0501267_000056 | 3300049764 | Bacteria | 6569 |
| 1155 | Ga0501268_066803 | 3300049765 | Bacteria | 721 |
| 1156 | Ga0501269_016545 | 3300049766 | Bacteria | 909 |
| 1157 | Ga0501272_015592 | 3300049769 | Bacteria | 885 |
| 1158 | Ga0501274_015371 | 3300049771 | Bacteria | 750 |
| 1159 | Ga0501282_005077 | 3300049778 | Bacteria | 1407 |
| 1160 | Ga0501035_0111125 | 3300049822 | Bacteria | 2402 |
| 1161 | nmdc:mga03683_231906_c1 | 3300050489 | Bacteria | 854 |
| 1162 | nmdc:mga03683_425286_c1 | 3300050489 | Bacteria | 637 |
| 1163 | nmdc:mga03683_90593_c1 | 3300050489 | Bacteria | 1333 |
| 1164 | nmdc:mga03683_96688_c1 | 3300050489 | Bacteria | 1294 |
| 1165 | nmdc:mga03n38_109784_c1 | 3300050490 | Bacteria | 1342 |
| 1166 | nmdc:mga03n38_814307_c1 | 3300050490 | Bacteria | 544 |
| 1167 | nmdc:mga03n38_845685_c1 | 3300050490 | Bacteria | 535 |
| 1168 | nmdc:mga0k408_173989_c1 | 3300050493 | Bacteria | 1283 |
| 1169 | nmdc:mga0k408_19343_c1 | 3300050493 | Bacteria | 3805 |
| 1170 | nmdc:mga0k408_19622_c1 | 3300050493 | Bacteria | 3781 |
| 1171 | nmdc:mga0k408_32128_c1 | 3300050493 | Bacteria | 2999 |
| 1172 | nmdc:mga0k408_33920_c1 | 3300050493 | Bacteria | 2921 |
| 1173 | nmdc:mga0k408_409501_c1 | 3300050493 | Bacteria | 807 |
| 1174 | nmdc:mga0k408_58093_c1 | 3300050493 | Bacteria | 2247 |
| 1175 | nmdc:mga0k408_735492_c1 | 3300050493 | Bacteria | 577 |
| 1176 | nmdc:mga0k408_8304_c1 | 3300050493 | Bacteria | 5571 |
| 1177 | nmdc:mga0k408_9558_c1 | 3300050493 | Bacteria | 5231 |
| 1178 | nmdc:mga06z11_337268_c1 | 3300050494 | Bacteria | 901 |
| 1179 | nmdc:mga06z11_343415_c1 | 3300050494 | Bacteria | 893 |
| 1180 | nmdc:mga06z11_406722_c1 | 3300050494 | Bacteria | 819 |
| 1181 | nmdc:mga06z11_462098_c1 | 3300050494 | Bacteria | 767 |
| 1182 | nmdc:mga06z11_542945_c1 | 3300050494 | Bacteria | 706 |
| 1183 | nmdc:mga04h51_226751_c1 | 3300050495 | Bacteria | 742 |
| 1184 | nmdc:mga07m45_1252_c1 | 3300050496 | Bacteria | 11547 |
| 1185 | nmdc:mga07m45_136922_c1 | 3300050496 | Bacteria | 1418 |
| 1186 | nmdc:mga07m45_148114_c1 | 3300050496 | Bacteria | 1361 |
| 1187 | nmdc:mga07m45_184627_c1 | 3300050496 | Bacteria | 1213 |
| 1188 | nmdc:mga07m45_232051_c1 | 3300050496 | Bacteria | 1074 |
| 1189 | nmdc:mga07m45_23841_c2 | 3300050496 | Bacteria | 1569 |
| 1190 | nmdc:mga07m45_31872_c1 | 3300050496 | Bacteria | 2922 |
| 1191 | nmdc:mga07m45_432176_c1 | 3300050496 | Bacteria | 764 |
| 1192 | nmdc:mga07m45_44069_c1 | 3300050496 | Bacteria | 2503 |
| 1193 | nmdc:mga07m45_5744_c1 | 3300050496 | Bacteria | 3162 |
| 1194 | nmdc:mga07m45_8788_c1 | 3300050496 | Bacteria | 5208 |
| 1195 | nmdc:mga08y16_1044261_c1 | 3300050511 | Bacteria | 795 |
| 1196 | nmdc:mga08y16_1950544_c1 | 3300050511 | Bacteria | 537 |
| 1197 | nmdc:mga0sz30_46262_c1 | 3300050516 | Bacteria | 1837 |
| 1198 | nmdc:mga0sz30_89692_c1 | 3300050516 | Bacteria | 1337 |
| 1199 | Ga0495601_0950493 | 3300053077 | Bacteria | 542 |
| 1200 | Ga0495619_0187972 | 3300053085 | Bacteria | 1430 |
| 1201 | Ga0500583_0499237 | 3300053092 | Bacteria | 572 |
| 1202 | Ga0500651_0304817 | 3300053093 | Bacteria | 913 |
| 1203 | Ga0500650_0060669 | 3300053098 | Bacteria | 1766 |
| 1204 | Ga0500658_0002795 | 3300053134 | Bacteria | 6699 |
| 1205 | Ga0500561_0251506 | 3300053137 | Bacteria | 562 |
| 1206 | Ga0500568_0204579 | 3300053139 | Bacteria | 722 |
| 1207 | Ga0500622_0005593 | 3300053156 | Bacteria | 7496 |
| 1208 | Ga0590071_001624 | 3300059421 | Bacteria | 5872 |
| 1209 | Ga0590074_063491 | 3300059423 | Bacteria | 689 |
| 1210 | Ga0466962_0036494 | 3300061719 | Bacteria | 2352 |
| 1211 | Ga0466962_0089450 | 3300061719 | Bacteria | 1474 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005339 | Ga0070660_100292667 | Ga0070660_1002926672 | 65 |
| 2 | 3300041460 | Ga0451802_0239083 | Ga0451802_0239083_275_484 | 65 |
| 3 | 3300005262 | Ga0065165_1003210 | Ga0065165_100321011 | 66 |
| 4 | 3300006195 | Ga0075366_10200269 | Ga0075366_102002692 | 66 |
| 5 | 3300014325 | Ga0163163_13048771 | Ga0163163_130487712 | 66 |
| 6 | 3300028794 | Ga0307515_10000013 | Ga0307515_10000013235 | 66 |
| 7 | 3300031456 | Ga0307513_10762378 | Ga0307513_107623782 | 66 |
| 8 | 3300044658 | Ga0466972_0017775 | Ga0466972_0017775_954_1169 | 66 |
| 9 | 3300050493 | nmdc:mga0k408_19622_c1 | nmdc:mga0k408_19622_c1_3449_3664 | 66 |
| 10 | iso_pu_bacteria | 2643221644 | 2644245090 | 66 |
| 11 | 3300002244 | JGI24742J22300_10081240 | JGI24742J22300_100812401 | 67 |
| 12 | 3300005295 | Ga0065707_10107246 | Ga0065707_101072462 | 67 |
| 13 | 3300005295 | Ga0065707_10218566 | Ga0065707_102185661 | 67 |
| 14 | 3300005327 | Ga0070658_10037488 | Ga0070658_100374884 | 67 |
| 15 | 3300005327 | Ga0070658_10532818 | Ga0070658_105328182 | 67 |
| 16 | 3300005327 | Ga0070658_10712175 | Ga0070658_107121752 | 67 |
| 17 | 3300005327 | Ga0070658_11431759 | Ga0070658_114317592 | 67 |
| 18 | 3300005328 | Ga0070676_10000461 | Ga0070676_100004617 | 67 |
| 19 | 3300005328 | Ga0070676_10568668 | Ga0070676_105686681 | 67 |
| 20 | 3300005328 | Ga0070676_10916169 | Ga0070676_109161692 | 67 |
| 21 | 3300005329 | Ga0070683_100002657 | Ga0070683_10000265711 | 67 |
| 22 | 3300005329 | Ga0070683_101712464 | Ga0070683_1017124642 | 67 |
| 23 | 3300005329 | Ga0070683_102167617 | Ga0070683_1021676172 | 67 |
| 24 | 3300005330 | Ga0070690_100061053 | Ga0070690_1000610531 | 67 |
| 25 | 3300005331 | Ga0070670_100082742 | Ga0070670_1000827424 | 67 |
| 26 | 3300005331 | Ga0070670_100121665 | Ga0070670_1001216653 | 67 |
| 27 | 3300005331 | Ga0070670_100157279 | Ga0070670_1001572791 | 67 |
| 28 | 3300005331 | Ga0070670_100321255 | Ga0070670_1003212552 | 67 |
| 29 | 3300005331 | Ga0070670_100740322 | Ga0070670_1007403222 | 67 |
| 30 | 3300005331 | Ga0070670_100788634 | Ga0070670_1007886342 | 67 |
| 31 | 3300005331 | Ga0070670_100894621 | Ga0070670_1008946211 | 67 |
| 32 | 3300005331 | Ga0070670_101209809 | Ga0070670_1012098091 | 67 |
| 33 | 3300005333 | Ga0070677_10013313 | Ga0070677_100133133 | 67 |
| 34 | 3300005333 | Ga0070677_10088375 | Ga0070677_100883752 | 67 |
| 35 | 3300005333 | Ga0070677_10161518 | Ga0070677_101615182 | 67 |
| 36 | 3300005333 | Ga0070677_10404198 | Ga0070677_104041982 | 67 |
| 37 | 3300005333 | Ga0070677_10496518 | Ga0070677_104965182 | 67 |
| 38 | 3300005334 | Ga0068869_100005237 | Ga0068869_10000523711 | 67 |
| 39 | 3300005334 | Ga0068869_100214971 | Ga0068869_1002149712 | 67 |
| 40 | 3300005334 | Ga0068869_100385446 | Ga0068869_1003854462 | 67 |
| 41 | 3300005334 | Ga0068869_100978383 | Ga0068869_1009783831 | 67 |
| 42 | 3300005334 | Ga0068869_101444504 | Ga0068869_1014445042 | 67 |
| 43 | 3300005334 | Ga0068869_101614653 | Ga0068869_1016146531 | 67 |
| 44 | 3300005335 | Ga0070666_10205065 | Ga0070666_102050652 | 67 |
| 45 | 3300005335 | Ga0070666_10336329 | Ga0070666_103363292 | 67 |
| 46 | 3300005335 | Ga0070666_10495351 | Ga0070666_104953512 | 67 |
| 47 | 3300005335 | Ga0070666_10986349 | Ga0070666_109863492 | 67 |
| 48 | 3300005336 | Ga0070680_100033672 | Ga0070680_1000336722 | 67 |
| 49 | 3300005337 | Ga0070682_100729376 | Ga0070682_1007293762 | 67 |
| 50 | 3300005337 | Ga0070682_100803104 | Ga0070682_1008031042 | 67 |
| 51 | 3300005338 | Ga0068868_100038470 | Ga0068868_1000384702 | 67 |
| 52 | 3300005338 | Ga0068868_100098048 | Ga0068868_1000980484 | 67 |
| 53 | 3300005338 | Ga0068868_100222516 | Ga0068868_1002225163 | 67 |
| 54 | 3300005339 | Ga0070660_100038847 | Ga0070660_1000388472 | 67 |
| 55 | 3300005339 | Ga0070660_100573144 | Ga0070660_1005731442 | 67 |
| 56 | 3300005339 | Ga0070660_100645233 | Ga0070660_1006452332 | 67 |
| 57 | 3300005339 | Ga0070660_101892275 | Ga0070660_1018922752 | 67 |
| 58 | 3300005340 | Ga0070689_100615911 | Ga0070689_1006159112 | 67 |
| 59 | 3300005343 | Ga0070687_100070250 | Ga0070687_1000702503 | 67 |
| 60 | 3300005343 | Ga0070687_100318600 | Ga0070687_1003186002 | 67 |
| 61 | 3300005344 | Ga0070661_100033916 | Ga0070661_1000339164 | 67 |
| 62 | 3300005345 | Ga0070692_10125892 | Ga0070692_101258922 | 67 |
| 63 | 3300005345 | Ga0070692_11218408 | Ga0070692_112184081 | 67 |
| 64 | 3300005347 | Ga0070668_100072024 | Ga0070668_1000720242 | 67 |
| 65 | 3300005347 | Ga0070668_100321570 | Ga0070668_1003215701 | 67 |
| 66 | 3300005347 | Ga0070668_100682415 | Ga0070668_1006824151 | 67 |
| 67 | 3300005347 | Ga0070668_100731276 | Ga0070668_1007312761 | 67 |
| 68 | 3300005347 | Ga0070668_102270204 | Ga0070668_1022702042 | 67 |
| 69 | 3300005353 | Ga0070669_100012530 | Ga0070669_1000125303 | 67 |
| 70 | 3300005353 | Ga0070669_100059940 | Ga0070669_1000599404 | 67 |
| 71 | 3300005353 | Ga0070669_100125241 | Ga0070669_1001252412 | 67 |
| 72 | 3300005353 | Ga0070669_100187143 | Ga0070669_1001871433 | 67 |
| 73 | 3300005354 | Ga0070675_100081897 | Ga0070675_1000818974 | 67 |
| 74 | 3300005354 | Ga0070675_100995825 | Ga0070675_1009958252 | 67 |
| 75 | 3300005354 | Ga0070675_101291210 | Ga0070675_1012912102 | 67 |
| 76 | 3300005355 | Ga0070671_100000158 | Ga0070671_10000015830 | 67 |
| 77 | 3300005355 | Ga0070671_100030059 | Ga0070671_1000300592 | 67 |
| 78 | 3300005355 | Ga0070671_100050580 | Ga0070671_1000505804 | 67 |
| 79 | 3300005355 | Ga0070671_100150995 | Ga0070671_1001509952 | 67 |
| 80 | 3300005355 | Ga0070671_100214533 | Ga0070671_1002145331 | 67 |
| 81 | 3300005355 | Ga0070671_100251765 | Ga0070671_1002517652 | 67 |
| 82 | 3300005355 | Ga0070671_100487619 | Ga0070671_1004876192 | 67 |
| 83 | 3300005355 | Ga0070671_100551903 | Ga0070671_1005519032 | 67 |
| 84 | 3300005355 | Ga0070671_100615511 | Ga0070671_1006155112 | 67 |
| 85 | 3300005355 | Ga0070671_100770803 | Ga0070671_1007708032 | 67 |
| 86 | 3300005355 | Ga0070671_101927230 | Ga0070671_1019272302 | 67 |
| 87 | 3300005356 | Ga0070674_100053422 | Ga0070674_1000534224 | 67 |
| 88 | 3300005356 | Ga0070674_100401175 | Ga0070674_1004011752 | 67 |
| 89 | 3300005356 | Ga0070674_101538775 | Ga0070674_1015387752 | 67 |
| 90 | 3300005364 | Ga0070673_100110117 | Ga0070673_1001101173 | 67 |
| 91 | 3300005364 | Ga0070673_100148749 | Ga0070673_1001487493 | 67 |
| 92 | 3300005364 | Ga0070673_100150067 | Ga0070673_1001500672 | 67 |
| 93 | 3300005364 | Ga0070673_100485714 | Ga0070673_1004857142 | 67 |
| 94 | 3300005364 | Ga0070673_100741796 | Ga0070673_1007417962 | 67 |
| 95 | 3300005364 | Ga0070673_100781873 | Ga0070673_1007818732 | 67 |
| 96 | 3300005364 | Ga0070673_101500526 | Ga0070673_1015005262 | 67 |
| 97 | 3300005366 | Ga0070659_100003957 | Ga0070659_10000395711 | 67 |
| 98 | 3300005366 | Ga0070659_100536357 | Ga0070659_1005363571 | 67 |
| 99 | 3300005367 | Ga0070667_100046188 | Ga0070667_1000461882 | 67 |
| 100 | 3300005367 | Ga0070667_100210364 | Ga0070667_1002103642 | 67 |
| 101 | 3300005367 | Ga0070667_100445002 | Ga0070667_1004450022 | 67 |
| 102 | 3300005367 | Ga0070667_100531703 | Ga0070667_1005317032 | 67 |
| 103 | 3300005367 | Ga0070667_101014174 | Ga0070667_1010141742 | 67 |
| 104 | 3300005367 | Ga0070667_101092396 | Ga0070667_1010923961 | 67 |
| 105 | 3300005406 | Ga0070703_10493164 | Ga0070703_104931642 | 67 |
| 106 | 3300005441 | Ga0070700_100152310 | Ga0070700_1001523102 | 67 |
| 107 | 3300005455 | Ga0070663_100013605 | Ga0070663_1000136056 | 67 |
| 108 | 3300005455 | Ga0070663_100822722 | Ga0070663_1008227222 | 67 |
| 109 | 3300005455 | Ga0070663_100956393 | Ga0070663_1009563932 | 67 |
| 110 | 3300005456 | Ga0070678_100019501 | Ga0070678_1000195016 | 67 |
| 111 | 3300005456 | Ga0070678_100075598 | Ga0070678_1000755981 | 67 |
| 112 | 3300005456 | Ga0070678_100339332 | Ga0070678_1003393322 | 67 |
| 113 | 3300005456 | Ga0070678_100394619 | Ga0070678_1003946191 | 67 |
| 114 | 3300005456 | Ga0070678_100448670 | Ga0070678_1004486702 | 67 |
| 115 | 3300005456 | Ga0070678_100559072 | Ga0070678_1005590722 | 67 |
| 116 | 3300005456 | Ga0070678_102089001 | Ga0070678_1020890011 | 67 |
| 117 | 3300005457 | Ga0070662_100002939 | Ga0070662_1000029392 | 67 |
| 118 | 3300005457 | Ga0070662_100106521 | Ga0070662_1001065213 | 67 |
| 119 | 3300005457 | Ga0070662_100288194 | Ga0070662_1002881942 | 67 |
| 120 | 3300005457 | Ga0070662_101202280 | Ga0070662_1012022801 | 67 |
| 121 | 3300005457 | Ga0070662_101684507 | Ga0070662_1016845072 | 67 |
| 122 | 3300005458 | Ga0070681_10099309 | Ga0070681_100993092 | 67 |
| 123 | 3300005459 | Ga0068867_100099529 | Ga0068867_1000995292 | 67 |
| 124 | 3300005459 | Ga0068867_100123681 | Ga0068867_1001236811 | 67 |
| 125 | 3300005459 | Ga0068867_100136026 | Ga0068867_1001360263 | 67 |
| 126 | 3300005459 | Ga0068867_100684096 | Ga0068867_1006840962 | 67 |
| 127 | 3300005459 | Ga0068867_100870639 | Ga0068867_1008706392 | 67 |
| 128 | 3300005459 | Ga0068867_100982266 | Ga0068867_1009822662 | 67 |
| 129 | 3300005466 | Ga0070685_10090539 | Ga0070685_100905393 | 67 |
| 130 | 3300005466 | Ga0070685_10687883 | Ga0070685_106878831 | 67 |
| 131 | 3300005518 | Ga0070699_101251718 | Ga0070699_1012517181 | 67 |
| 132 | 3300005530 | Ga0070679_100001707 | Ga0070679_1000017078 | 67 |
| 133 | 3300005530 | Ga0070679_101606854 | Ga0070679_1016068542 | 67 |
| 134 | 3300005530 | Ga0070679_101718106 | Ga0070679_1017181062 | 67 |
| 135 | 3300005535 | Ga0070684_100031437 | Ga0070684_1000314374 | 67 |
| 136 | 3300005539 | Ga0068853_100108265 | Ga0068853_1001082652 | 67 |
| 137 | 3300005539 | Ga0068853_100261617 | Ga0068853_1002616172 | 67 |
| 138 | 3300005539 | Ga0068853_100285282 | Ga0068853_1002852821 | 67 |
| 139 | 3300005539 | Ga0068853_100331799 | Ga0068853_1003317992 | 67 |
| 140 | 3300005543 | Ga0070672_100036467 | Ga0070672_1000364675 | 67 |
| 141 | 3300005543 | Ga0070672_100078038 | Ga0070672_1000780382 | 67 |
| 142 | 3300005543 | Ga0070672_100182863 | Ga0070672_1001828632 | 67 |
| 143 | 3300005543 | Ga0070672_100206087 | Ga0070672_1002060871 | 67 |
| 144 | 3300005543 | Ga0070672_100617109 | Ga0070672_1006171092 | 67 |
| 145 | 3300005543 | Ga0070672_100678166 | Ga0070672_1006781662 | 67 |
| 146 | 3300005543 | Ga0070672_101163559 | Ga0070672_1011635592 | 67 |
| 147 | 3300005543 | Ga0070672_101655846 | Ga0070672_1016558462 | 67 |
| 148 | 3300005543 | Ga0070672_101695320 | Ga0070672_1016953202 | 67 |
| 149 | 3300005544 | Ga0070686_100807700 | Ga0070686_1008077002 | 67 |
| 150 | 3300005547 | Ga0070693_100025694 | Ga0070693_1000256944 | 67 |
| 151 | 3300005547 | Ga0070693_100026782 | Ga0070693_1000267821 | 67 |
| 152 | 3300005547 | Ga0070693_100027109 | Ga0070693_1000271094 | 67 |
| 153 | 3300005548 | Ga0070665_100158936 | Ga0070665_1001589364 | 67 |
| 154 | 3300005548 | Ga0070665_100415534 | Ga0070665_1004155342 | 67 |
| 155 | 3300005548 | Ga0070665_100680788 | Ga0070665_1006807882 | 67 |
| 156 | 3300005548 | Ga0070665_101563223 | Ga0070665_1015632232 | 67 |
| 157 | 3300005563 | Ga0068855_100007939 | Ga0068855_1000079398 | 67 |
| 158 | 3300005564 | Ga0070664_100145676 | Ga0070664_1001456763 | 67 |
| 159 | 3300005564 | Ga0070664_100181364 | Ga0070664_1001813642 | 67 |
| 160 | 3300005564 | Ga0070664_100277123 | Ga0070664_1002771232 | 67 |
| 161 | 3300005564 | Ga0070664_100279810 | Ga0070664_1002798102 | 67 |
| 162 | 3300005564 | Ga0070664_100849782 | Ga0070664_1008497822 | 67 |
| 163 | 3300005564 | Ga0070664_101018464 | Ga0070664_1010184642 | 67 |
| 164 | 3300005564 | Ga0070664_102088786 | Ga0070664_1020887862 | 67 |
| 165 | 3300005564 | Ga0070664_102189124 | Ga0070664_1021891242 | 67 |
| 166 | 3300005577 | Ga0068857_100069270 | Ga0068857_1000692704 | 67 |
| 167 | 3300005577 | Ga0068857_100575627 | Ga0068857_1005756272 | 67 |
| 168 | 3300005577 | Ga0068857_101143615 | Ga0068857_1011436152 | 67 |
| 169 | 3300005578 | Ga0068854_100152030 | Ga0068854_1001520302 | 67 |
| 170 | 3300005578 | Ga0068854_100268962 | Ga0068854_1002689622 | 67 |
| 171 | 3300005578 | Ga0068854_100279967 | Ga0068854_1002799672 | 67 |
| 172 | 3300005578 | Ga0068854_100520375 | Ga0068854_1005203752 | 67 |
| 173 | 3300005578 | Ga0068854_101934454 | Ga0068854_1019344542 | 67 |
| 174 | 3300005614 | Ga0068856_100065004 | Ga0068856_1000650043 | 67 |
| 175 | 3300005614 | Ga0068856_100107970 | Ga0068856_1001079703 | 67 |
| 176 | 3300005616 | Ga0068852_100012164 | Ga0068852_10001216410 | 67 |
| 177 | 3300005616 | Ga0068852_100064917 | Ga0068852_1000649173 | 67 |
| 178 | 3300005616 | Ga0068852_100158582 | Ga0068852_1001585822 | 67 |
| 179 | 3300005616 | Ga0068852_100493379 | Ga0068852_1004933792 | 67 |
| 180 | 3300005616 | Ga0068852_100925162 | Ga0068852_1009251621 | 67 |
| 181 | 3300005616 | Ga0068852_101194951 | Ga0068852_1011949512 | 67 |
| 182 | 3300005616 | Ga0068852_101993887 | Ga0068852_1019938872 | 67 |
| 183 | 3300005616 | Ga0068852_102574464 | Ga0068852_1025744642 | 67 |
| 184 | 3300005617 | Ga0068859_100100711 | Ga0068859_1001007112 | 67 |
| 185 | 3300005617 | Ga0068859_100151854 | Ga0068859_1001518543 | 67 |
| 186 | 3300005617 | Ga0068859_102193399 | Ga0068859_1021933992 | 67 |
| 187 | 3300005618 | Ga0068864_100018827 | Ga0068864_1000188275 | 67 |
| 188 | 3300005618 | Ga0068864_100025050 | Ga0068864_1000250506 | 67 |
| 189 | 3300005618 | Ga0068864_100062621 | Ga0068864_1000626214 | 67 |
| 190 | 3300005618 | Ga0068864_100303311 | Ga0068864_1003033112 | 67 |
| 191 | 3300005618 | Ga0068864_100320948 | Ga0068864_1003209482 | 67 |
| 192 | 3300005618 | Ga0068864_100490563 | Ga0068864_1004905632 | 67 |
| 193 | 3300005618 | Ga0068864_101766259 | Ga0068864_1017662591 | 67 |
| 194 | 3300005618 | Ga0068864_101777824 | Ga0068864_1017778242 | 67 |
| 195 | 3300005718 | Ga0068866_10013545 | Ga0068866_100135455 | 67 |
| 196 | 3300005718 | Ga0068866_10119182 | Ga0068866_101191821 | 67 |
| 197 | 3300005719 | Ga0068861_100006706 | Ga0068861_1000067068 | 67 |
| 198 | 3300005719 | Ga0068861_100065336 | Ga0068861_1000653364 | 67 |
| 199 | 3300005719 | Ga0068861_101294117 | Ga0068861_1012941172 | 67 |
| 200 | 3300005834 | Ga0068851_10045937 | Ga0068851_100459372 | 67 |
| 201 | 3300005834 | Ga0068851_10077405 | Ga0068851_100774051 | 67 |
| 202 | 3300005834 | Ga0068851_10160215 | Ga0068851_101602152 | 67 |
| 203 | 3300005834 | Ga0068851_10678497 | Ga0068851_106784972 | 67 |
| 204 | 3300005834 | Ga0068851_11107248 | Ga0068851_111072482 | 67 |
| 205 | 3300005840 | Ga0068870_10156643 | Ga0068870_101566432 | 67 |
| 206 | 3300005840 | Ga0068870_10879111 | Ga0068870_108791112 | 67 |
| 207 | 3300005841 | Ga0068863_100001141 | Ga0068863_10000114124 | 67 |
| 208 | 3300005841 | Ga0068863_100207098 | Ga0068863_1002070981 | 67 |
| 209 | 3300005841 | Ga0068863_100288882 | Ga0068863_1002888822 | 67 |
| 210 | 3300005841 | Ga0068863_100491709 | Ga0068863_1004917092 | 67 |
| 211 | 3300005841 | Ga0068863_100507872 | Ga0068863_1005078721 | 67 |
| 212 | 3300005841 | Ga0068863_101332759 | Ga0068863_1013327592 | 67 |
| 213 | 3300005841 | Ga0068863_101716211 | Ga0068863_1017162112 | 67 |
| 214 | 3300005841 | Ga0068863_102285774 | Ga0068863_1022857742 | 67 |
| 215 | 3300005842 | Ga0068858_100056525 | Ga0068858_1000565252 | 67 |
| 216 | 3300005842 | Ga0068858_100472602 | Ga0068858_1004726022 | 67 |
| 217 | 3300005842 | Ga0068858_100619547 | Ga0068858_1006195472 | 67 |
| 218 | 3300005842 | Ga0068858_101583262 | Ga0068858_1015832622 | 67 |
| 219 | 3300005843 | Ga0068860_100031504 | Ga0068860_1000315048 | 67 |
| 220 | 3300005843 | Ga0068860_100048517 | Ga0068860_1000485171 | 67 |
| 221 | 3300005843 | Ga0068860_100120719 | Ga0068860_1001207193 | 67 |
| 222 | 3300005843 | Ga0068860_100446547 | Ga0068860_1004465472 | 67 |
| 223 | 3300005843 | Ga0068860_101431122 | Ga0068860_1014311222 | 67 |
| 224 | 3300005844 | Ga0068862_100065510 | Ga0068862_1000655102 | 67 |
| 225 | 3300005844 | Ga0068862_100281501 | Ga0068862_1002815012 | 67 |
| 226 | 3300005844 | Ga0068862_100913861 | Ga0068862_1009138612 | 67 |
| 227 | 3300005844 | Ga0068862_101123099 | Ga0068862_1011230992 | 67 |
| 228 | 3300006177 | Ga0075362_10711960 | Ga0075362_107119602 | 67 |
| 229 | 3300006178 | Ga0075367_10070169 | Ga0075367_100701693 | 67 |
| 230 | 3300006195 | Ga0075366_10163695 | Ga0075366_101636951 | 67 |
| 231 | 3300006195 | Ga0075366_10386666 | Ga0075366_103866662 | 67 |
| 232 | 3300006237 | Ga0097621_100004806 | Ga0097621_1000048063 | 67 |
| 233 | 3300006237 | Ga0097621_100012924 | Ga0097621_1000129245 | 67 |
| 234 | 3300006237 | Ga0097621_100074567 | Ga0097621_1000745672 | 67 |
| 235 | 3300006237 | Ga0097621_100458396 | Ga0097621_1004583962 | 67 |
| 236 | 3300006237 | Ga0097621_100834024 | Ga0097621_1008340242 | 67 |
| 237 | 3300006237 | Ga0097621_100881830 | Ga0097621_1008818302 | 67 |
| 238 | 3300006237 | Ga0097621_100940208 | Ga0097621_1009402082 | 67 |
| 239 | 3300006353 | Ga0075370_10006917 | Ga0075370_100069176 | 67 |
| 240 | 3300006353 | Ga0075370_10029651 | Ga0075370_100296515 | 67 |
| 241 | 3300006353 | Ga0075370_10233950 | Ga0075370_102339502 | 67 |
| 242 | 3300006353 | Ga0075370_10843060 | Ga0075370_108430602 | 67 |
| 243 | 3300006358 | Ga0068871_100005787 | Ga0068871_10000578710 | 67 |
| 244 | 3300006358 | Ga0068871_100013396 | Ga0068871_1000133966 | 67 |
| 245 | 3300006358 | Ga0068871_100180950 | Ga0068871_1001809503 | 67 |
| 246 | 3300006358 | Ga0068871_101474077 | Ga0068871_1014740772 | 67 |
| 247 | 3300006881 | Ga0068865_100054762 | Ga0068865_1000547623 | 67 |
| 248 | 3300006881 | Ga0068865_100217594 | Ga0068865_1002175942 | 67 |
| 249 | 3300006881 | Ga0068865_100259807 | Ga0068865_1002598072 | 67 |
| 250 | 3300006881 | Ga0068865_100340111 | Ga0068865_1003401112 | 67 |
| 251 | 3300006881 | Ga0068865_100581052 | Ga0068865_1005810522 | 67 |
| 252 | 3300006931 | Ga0097620_100100703 | Ga0097620_1001007034 | 67 |
| 253 | 3300006931 | Ga0097620_100151853 | Ga0097620_1001518533 | 67 |
| 254 | 3300006931 | Ga0097620_102193390 | Ga0097620_1021933902 | 67 |
| 255 | 3300009092 | Ga0105250_10520863 | Ga0105250_105208632 | 67 |
| 256 | 3300009093 | Ga0105240_11260290 | Ga0105240_112602902 | 67 |
| 257 | 3300009094 | Ga0111539_11836921 | Ga0111539_118369212 | 67 |
| 258 | 3300009094 | Ga0111539_12240810 | Ga0111539_122408102 | 67 |
| 259 | 3300009098 | Ga0105245_10554247 | Ga0105245_105542472 | 67 |
| 260 | 3300009148 | Ga0105243_10364805 | Ga0105243_103648051 | 67 |
| 261 | 3300009148 | Ga0105243_11509329 | Ga0105243_115093292 | 67 |
| 262 | 3300009148 | Ga0105243_12962686 | Ga0105243_129626862 | 67 |
| 263 | 3300009148 | Ga0105243_13125384 | Ga0105243_131253842 | 67 |
| 264 | 3300009174 | Ga0105241_11217970 | Ga0105241_112179701 | 67 |
| 265 | 3300009176 | Ga0105242_10013753 | Ga0105242_100137532 | 67 |
| 266 | 3300009176 | Ga0105242_11641046 | Ga0105242_116410462 | 67 |
| 267 | 3300009176 | Ga0105242_12479464 | Ga0105242_124794642 | 67 |
| 268 | 3300009177 | Ga0105248_10028131 | Ga0105248_100281317 | 67 |
| 269 | 3300009177 | Ga0105248_10042274 | Ga0105248_100422744 | 67 |
| 270 | 3300009177 | Ga0105248_10206255 | Ga0105248_102062552 | 67 |
| 271 | 3300009177 | Ga0105248_10286139 | Ga0105248_102861391 | 67 |
| 272 | 3300009177 | Ga0105248_10563000 | Ga0105248_105630002 | 67 |
| 273 | 3300009177 | Ga0105248_11414358 | Ga0105248_114143582 | 67 |
| 274 | 3300009545 | Ga0105237_11637547 | Ga0105237_116375471 | 67 |
| 275 | 3300009551 | Ga0105238_10058508 | Ga0105238_100585082 | 67 |
| 276 | 3300009551 | Ga0105238_11841186 | Ga0105238_118411861 | 67 |
| 277 | 3300009553 | Ga0105249_10008180 | Ga0105249_1000818010 | 67 |
| 278 | 3300009553 | Ga0105249_11120382 | Ga0105249_111203822 | 67 |
| 279 | 3300009553 | Ga0105249_11585481 | Ga0105249_115854812 | 67 |
| 280 | 3300010375 | Ga0105239_10277231 | Ga0105239_102772313 | 67 |
| 281 | 3300011119 | Ga0105246_10682207 | Ga0105246_106822072 | 67 |
| 282 | 3300012500 | Ga0157314_1008272 | Ga0157314_10082722 | 67 |
| 283 | 3300012515 | Ga0157338_1018411 | Ga0157338_10184112 | 67 |
| 284 | 3300013100 | Ga0157373_10124484 | Ga0157373_101244843 | 67 |
| 285 | 3300013102 | Ga0157371_10042098 | Ga0157371_100420982 | 67 |
| 286 | 3300013102 | Ga0157371_10229125 | Ga0157371_102291252 | 67 |
| 287 | 3300013102 | Ga0157371_11542036 | Ga0157371_115420361 | 67 |
| 288 | 3300013104 | Ga0157370_11798996 | Ga0157370_117989962 | 67 |
| 289 | 3300013104 | Ga0157370_12071504 | Ga0157370_120715042 | 67 |
| 290 | 3300013105 | Ga0157369_10002529 | Ga0157369_1000252921 | 67 |
| 291 | 3300013105 | Ga0157369_11424531 | Ga0157369_114245312 | 67 |
| 292 | 3300013296 | Ga0157374_10015370 | Ga0157374_100153702 | 67 |
| 293 | 3300013296 | Ga0157374_10037388 | Ga0157374_100373882 | 67 |
| 294 | 3300013296 | Ga0157374_10346616 | Ga0157374_103466163 | 67 |
| 295 | 3300013297 | Ga0157378_10402459 | Ga0157378_104024592 | 67 |
| 296 | 3300013306 | Ga0163162_10181851 | Ga0163162_101818512 | 67 |
| 297 | 3300013306 | Ga0163162_10384122 | Ga0163162_103841222 | 67 |
| 298 | 3300013306 | Ga0163162_10794400 | Ga0163162_107944002 | 67 |
| 299 | 3300013306 | Ga0163162_10897855 | Ga0163162_108978552 | 67 |
| 300 | 3300013306 | Ga0163162_12311543 | Ga0163162_123115431 | 67 |
| 301 | 3300013307 | Ga0157372_10008954 | Ga0157372_1000895413 | 67 |
| 302 | 3300013307 | Ga0157372_10095594 | Ga0157372_100955946 | 67 |
| 303 | 3300013307 | Ga0157372_11348096 | Ga0157372_113480962 | 67 |
| 304 | 3300013307 | Ga0157372_11559918 | Ga0157372_115599182 | 67 |
| 305 | 3300013308 | Ga0157375_10054149 | Ga0157375_100541496 | 67 |
| 306 | 3300013308 | Ga0157375_10772242 | Ga0157375_107722422 | 67 |
| 307 | 3300013308 | Ga0157375_10919768 | Ga0157375_109197682 | 67 |
| 308 | 3300013308 | Ga0157375_11153051 | Ga0157375_111530512 | 67 |
| 309 | 3300014325 | Ga0163163_10443619 | Ga0163163_104436192 | 67 |
| 310 | 3300014325 | Ga0163163_12002836 | Ga0163163_120028362 | 67 |
| 311 | 3300014325 | Ga0163163_12632753 | Ga0163163_126327532 | 67 |
| 312 | 3300014326 | Ga0157380_10092961 | Ga0157380_100929612 | 67 |
| 313 | 3300014326 | Ga0157380_10675391 | Ga0157380_106753912 | 67 |
| 314 | 3300014326 | Ga0157380_13534103 | Ga0157380_135341031 | 67 |
| 315 | 3300014968 | Ga0157379_10017047 | Ga0157379_100170472 | 67 |
| 316 | 3300014968 | Ga0157379_10041700 | Ga0157379_100417003 | 67 |
| 317 | 3300014968 | Ga0157379_10042358 | Ga0157379_100423584 | 67 |
| 318 | 3300014968 | Ga0157379_10133470 | Ga0157379_101334704 | 67 |
| 319 | 3300014968 | Ga0157379_10527442 | Ga0157379_105274422 | 67 |
| 320 | 3300014969 | Ga0157376_10014509 | Ga0157376_100145098 | 67 |
| 321 | 3300014969 | Ga0157376_10272779 | Ga0157376_102727792 | 67 |
| 322 | 3300015261 | Ga0182006_1205986 | Ga0182006_12059862 | 67 |
| 323 | 3300017792 | Ga0163161_10016875 | Ga0163161_100168758 | 67 |
| 324 | 3300017792 | Ga0163161_10181529 | Ga0163161_101815292 | 67 |
| 325 | 3300017792 | Ga0163161_11754518 | Ga0163161_117545182 | 67 |
| 326 | 3300021361 | Ga0213872_10000211 | Ga0213872_1000021110 | 67 |
| 327 | 3300021377 | Ga0213874_10023839 | Ga0213874_100238392 | 67 |
| 328 | 3300021384 | Ga0213876_10046569 | Ga0213876_100465692 | 67 |
| 329 | 3300025321 | Ga0207656_10261619 | Ga0207656_102616192 | 67 |
| 330 | 3300025321 | Ga0207656_10568260 | Ga0207656_105682601 | 67 |
| 331 | 3300025885 | Ga0207653_10421378 | Ga0207653_104213781 | 67 |
| 332 | 3300025893 | Ga0207682_10186938 | Ga0207682_101869382 | 67 |
| 333 | 3300025893 | Ga0207682_10275583 | Ga0207682_102755832 | 67 |
| 334 | 3300025893 | Ga0207682_10314062 | Ga0207682_103140621 | 67 |
| 335 | 3300025893 | Ga0207682_10555219 | Ga0207682_105552192 | 67 |
| 336 | 3300025899 | Ga0207642_10121417 | Ga0207642_101214172 | 67 |
| 337 | 3300025899 | Ga0207642_10638210 | Ga0207642_106382102 | 67 |
| 338 | 3300025901 | Ga0207688_10030759 | Ga0207688_100307594 | 67 |
| 339 | 3300025901 | Ga0207688_10582553 | Ga0207688_105825532 | 67 |
| 340 | 3300025901 | Ga0207688_10716116 | Ga0207688_107161162 | 67 |
| 341 | 3300025903 | Ga0207680_10280727 | Ga0207680_102807272 | 67 |
| 342 | 3300025903 | Ga0207680_11175949 | Ga0207680_111759492 | 67 |
| 343 | 3300025904 | Ga0207647_10454839 | Ga0207647_104548392 | 67 |
| 344 | 3300025905 | Ga0207685_10196175 | Ga0207685_101961751 | 67 |
| 345 | 3300025907 | Ga0207645_10042617 | Ga0207645_100426174 | 67 |
| 346 | 3300025907 | Ga0207645_10576488 | Ga0207645_105764882 | 67 |
| 347 | 3300025908 | Ga0207643_10026655 | Ga0207643_100266553 | 67 |
| 348 | 3300025909 | Ga0207705_10061289 | Ga0207705_100612894 | 67 |
| 349 | 3300025909 | Ga0207705_11288080 | Ga0207705_112880802 | 67 |
| 350 | 3300025911 | Ga0207654_10161056 | Ga0207654_101610562 | 67 |
| 351 | 3300025912 | Ga0207707_10073153 | Ga0207707_100731534 | 67 |
| 352 | 3300025917 | Ga0207660_10060825 | Ga0207660_100608253 | 67 |
| 353 | 3300025918 | Ga0207662_10113501 | Ga0207662_101135013 | 67 |
| 354 | 3300025918 | Ga0207662_10181173 | Ga0207662_101811732 | 67 |
| 355 | 3300025919 | Ga0207657_10092016 | Ga0207657_100920162 | 67 |
| 356 | 3300025919 | Ga0207657_10300745 | Ga0207657_103007452 | 67 |
| 357 | 3300025919 | Ga0207657_10502183 | Ga0207657_105021832 | 67 |
| 358 | 3300025919 | Ga0207657_11004917 | Ga0207657_110049172 | 67 |
| 359 | 3300025920 | Ga0207649_10002033 | Ga0207649_1000203314 | 67 |
| 360 | 3300025920 | Ga0207649_10511011 | Ga0207649_105110112 | 67 |
| 361 | 3300025920 | Ga0207649_10552236 | Ga0207649_105522362 | 67 |
| 362 | 3300025920 | Ga0207649_11385791 | Ga0207649_113857912 | 67 |
| 363 | 3300025921 | Ga0207652_10006365 | Ga0207652_100063658 | 67 |
| 364 | 3300025921 | Ga0207652_10567489 | Ga0207652_105674892 | 67 |
| 365 | 3300025921 | Ga0207652_11006912 | Ga0207652_110069122 | 67 |
| 366 | 3300025923 | Ga0207681_10001527 | Ga0207681_100015273 | 67 |
| 367 | 3300025923 | Ga0207681_10286602 | Ga0207681_102866022 | 67 |
| 368 | 3300025924 | Ga0207694_10015626 | Ga0207694_100156266 | 67 |
| 369 | 3300025924 | Ga0207694_11151574 | Ga0207694_111515742 | 67 |
| 370 | 3300025924 | Ga0207694_11526959 | Ga0207694_115269592 | 67 |
| 371 | 3300025925 | Ga0207650_10075854 | Ga0207650_100758542 | 67 |
| 372 | 3300025925 | Ga0207650_10121643 | Ga0207650_101216432 | 67 |
| 373 | 3300025925 | Ga0207650_10176777 | Ga0207650_101767772 | 67 |
| 374 | 3300025925 | Ga0207650_10244739 | Ga0207650_102447392 | 67 |
| 375 | 3300025925 | Ga0207650_11008863 | Ga0207650_110088632 | 67 |
| 376 | 3300025926 | Ga0207659_10001630 | Ga0207659_100016307 | 67 |
| 377 | 3300025926 | Ga0207659_10105131 | Ga0207659_101051312 | 67 |
| 378 | 3300025926 | Ga0207659_10261462 | Ga0207659_102614622 | 67 |
| 379 | 3300025927 | Ga0207687_10008433 | Ga0207687_100084332 | 67 |
| 380 | 3300025927 | Ga0207687_10077309 | Ga0207687_100773092 | 67 |
| 381 | 3300025927 | Ga0207687_11707794 | Ga0207687_117077941 | 67 |
| 382 | 3300025931 | Ga0207644_10000042 | Ga0207644_1000004236 | 67 |
| 383 | 3300025931 | Ga0207644_10163644 | Ga0207644_101636442 | 67 |
| 384 | 3300025931 | Ga0207644_10246026 | Ga0207644_102460262 | 67 |
| 385 | 3300025931 | Ga0207644_10976995 | Ga0207644_109769952 | 67 |
| 386 | 3300025931 | Ga0207644_11749109 | Ga0207644_117491092 | 67 |
| 387 | 3300025932 | Ga0207690_10008281 | Ga0207690_100082812 | 67 |
| 388 | 3300025932 | Ga0207690_10509942 | Ga0207690_105099422 | 67 |
| 389 | 3300025932 | Ga0207690_10745156 | Ga0207690_107451562 | 67 |
| 390 | 3300025932 | Ga0207690_11652560 | Ga0207690_116525601 | 67 |
| 391 | 3300025933 | Ga0207706_10005687 | Ga0207706_1000568712 | 67 |
| 392 | 3300025933 | Ga0207706_10026753 | Ga0207706_100267534 | 67 |
| 393 | 3300025933 | Ga0207706_10138168 | Ga0207706_101381683 | 67 |
| 394 | 3300025933 | Ga0207706_10379379 | Ga0207706_103793792 | 67 |
| 395 | 3300025933 | Ga0207706_11369876 | Ga0207706_113698762 | 67 |
| 396 | 3300025934 | Ga0207686_10330696 | Ga0207686_103306962 | 67 |
| 397 | 3300025934 | Ga0207686_10408659 | Ga0207686_104086592 | 67 |
| 398 | 3300025935 | Ga0207709_10646511 | Ga0207709_106465112 | 67 |
| 399 | 3300025935 | Ga0207709_10680611 | Ga0207709_106806112 | 67 |
| 400 | 3300025935 | Ga0207709_11578893 | Ga0207709_115788931 | 67 |
| 401 | 3300025936 | Ga0207670_10727338 | Ga0207670_107273382 | 67 |
| 402 | 3300025937 | Ga0207669_11693468 | Ga0207669_116934682 | 67 |
| 403 | 3300025938 | Ga0207704_10180766 | Ga0207704_101807662 | 67 |
| 404 | 3300025938 | Ga0207704_10353622 | Ga0207704_103536222 | 67 |
| 405 | 3300025938 | Ga0207704_11218645 | Ga0207704_112186452 | 67 |
| 406 | 3300025939 | Ga0207665_10096334 | Ga0207665_100963341 | 67 |
| 407 | 3300025940 | Ga0207691_10013989 | Ga0207691_100139892 | 67 |
| 408 | 3300025940 | Ga0207691_10086275 | Ga0207691_100862754 | 67 |
| 409 | 3300025940 | Ga0207691_10112255 | Ga0207691_101122554 | 67 |
| 410 | 3300025940 | Ga0207691_10113757 | Ga0207691_101137573 | 67 |
| 411 | 3300025940 | Ga0207691_10148946 | Ga0207691_101489463 | 67 |
| 412 | 3300025941 | Ga0207711_10003933 | Ga0207711_1000393311 | 67 |
| 413 | 3300025941 | Ga0207711_10033806 | Ga0207711_100338063 | 67 |
| 414 | 3300025941 | Ga0207711_10156494 | Ga0207711_101564943 | 67 |
| 415 | 3300025941 | Ga0207711_10263223 | Ga0207711_102632232 | 67 |
| 416 | 3300025941 | Ga0207711_10482421 | Ga0207711_104824212 | 67 |
| 417 | 3300025941 | Ga0207711_10642204 | Ga0207711_106422042 | 67 |
| 418 | 3300025942 | Ga0207689_10002895 | Ga0207689_1000289511 | 67 |
| 419 | 3300025942 | Ga0207689_10034592 | Ga0207689_100345922 | 67 |
| 420 | 3300025942 | Ga0207689_10573459 | Ga0207689_105734592 | 67 |
| 421 | 3300025944 | Ga0207661_10919929 | Ga0207661_109199292 | 67 |
| 422 | 3300025945 | Ga0207679_10071379 | Ga0207679_100713794 | 67 |
| 423 | 3300025945 | Ga0207679_10307546 | Ga0207679_103075462 | 67 |
| 424 | 3300025945 | Ga0207679_10379413 | Ga0207679_103794134 | 67 |
| 425 | 3300025945 | Ga0207679_10450536 | Ga0207679_104505362 | 67 |
| 426 | 3300025945 | Ga0207679_10629805 | Ga0207679_106298052 | 67 |
| 427 | 3300025945 | Ga0207679_10999529 | Ga0207679_109995292 | 67 |
| 428 | 3300025960 | Ga0207651_10209051 | Ga0207651_102090512 | 67 |
| 429 | 3300025960 | Ga0207651_10354218 | Ga0207651_103542182 | 67 |
| 430 | 3300025960 | Ga0207651_10436994 | Ga0207651_104369942 | 67 |
| 431 | 3300025960 | Ga0207651_10775515 | Ga0207651_107755152 | 67 |
| 432 | 3300025961 | Ga0207712_10082265 | Ga0207712_100822653 | 67 |
| 433 | 3300025961 | Ga0207712_11143249 | Ga0207712_111432492 | 67 |
| 434 | 3300025972 | Ga0207668_10100445 | Ga0207668_101004453 | 67 |
| 435 | 3300025972 | Ga0207668_10474314 | Ga0207668_104743142 | 67 |
| 436 | 3300025972 | Ga0207668_11976703 | Ga0207668_119767032 | 67 |
| 437 | 3300025981 | Ga0207640_10020844 | Ga0207640_100208446 | 67 |
| 438 | 3300025981 | Ga0207640_10368080 | Ga0207640_103680802 | 67 |
| 439 | 3300025981 | Ga0207640_10495554 | Ga0207640_104955542 | 67 |
| 440 | 3300025986 | Ga0207658_10013827 | Ga0207658_100138274 | 67 |
| 441 | 3300025986 | Ga0207658_10041532 | Ga0207658_100415325 | 67 |
| 442 | 3300025986 | Ga0207658_10844757 | Ga0207658_108447572 | 67 |
| 443 | 3300025986 | Ga0207658_10927550 | Ga0207658_109275502 | 67 |
| 444 | 3300026023 | Ga0207677_10104794 | Ga0207677_101047942 | 67 |
| 445 | 3300026023 | Ga0207677_10164116 | Ga0207677_101641162 | 67 |
| 446 | 3300026023 | Ga0207677_11622288 | Ga0207677_116222882 | 67 |
| 447 | 3300026023 | Ga0207677_12103329 | Ga0207677_121033292 | 67 |
| 448 | 3300026035 | Ga0207703_10007108 | Ga0207703_100071086 | 67 |
| 449 | 3300026035 | Ga0207703_10020187 | Ga0207703_100201872 | 67 |
| 450 | 3300026035 | Ga0207703_10124604 | Ga0207703_101246044 | 67 |
| 451 | 3300026035 | Ga0207703_10488216 | Ga0207703_104882162 | 67 |
| 452 | 3300026035 | Ga0207703_12034965 | Ga0207703_120349652 | 67 |
| 453 | 3300026041 | Ga0207639_10030055 | Ga0207639_100300554 | 67 |
| 454 | 3300026067 | Ga0207678_10003767 | Ga0207678_1000376710 | 67 |
| 455 | 3300026067 | Ga0207678_10420686 | Ga0207678_104206862 | 67 |
| 456 | 3300026067 | Ga0207678_11816775 | Ga0207678_118167752 | 67 |
| 457 | 3300026075 | Ga0207708_10238106 | Ga0207708_102381062 | 67 |
| 458 | 3300026078 | Ga0207702_10004875 | Ga0207702_100048755 | 67 |
| 459 | 3300026078 | Ga0207702_10973022 | Ga0207702_109730222 | 67 |
| 460 | 3300026088 | Ga0207641_10016191 | Ga0207641_100161915 | 67 |
| 461 | 3300026088 | Ga0207641_10027686 | Ga0207641_100276861 | 67 |
| 462 | 3300026088 | Ga0207641_10043194 | Ga0207641_100431943 | 67 |
| 463 | 3300026088 | Ga0207641_10244794 | Ga0207641_102447943 | 67 |
| 464 | 3300026088 | Ga0207641_10289757 | Ga0207641_102897572 | 67 |
| 465 | 3300026089 | Ga0207648_10019721 | Ga0207648_100197219 | 67 |
| 466 | 3300026089 | Ga0207648_10158812 | Ga0207648_101588122 | 67 |
| 467 | 3300026089 | Ga0207648_10336740 | Ga0207648_103367402 | 67 |
| 468 | 3300026095 | Ga0207676_10028649 | Ga0207676_100286495 | 67 |
| 469 | 3300026095 | Ga0207676_10121175 | Ga0207676_101211752 | 67 |
| 470 | 3300026095 | Ga0207676_10231393 | Ga0207676_102313932 | 67 |
| 471 | 3300026095 | Ga0207676_10287685 | Ga0207676_102876852 | 67 |
| 472 | 3300026095 | Ga0207676_10313279 | Ga0207676_103132792 | 67 |
| 473 | 3300026095 | Ga0207676_11684430 | Ga0207676_116844302 | 67 |
| 474 | 3300026116 | Ga0207674_10014711 | Ga0207674_100147113 | 67 |
| 475 | 3300026116 | Ga0207674_10018509 | Ga0207674_100185096 | 67 |
| 476 | 3300026116 | Ga0207674_10037010 | Ga0207674_100370107 | 67 |
| 477 | 3300026118 | Ga0207675_100003221 | Ga0207675_10000322110 | 67 |
| 478 | 3300026118 | Ga0207675_100104404 | Ga0207675_1001044044 | 67 |
| 479 | 3300026121 | Ga0207683_10047843 | Ga0207683_100478436 | 67 |
| 480 | 3300026121 | Ga0207683_10447901 | Ga0207683_104479012 | 67 |
| 481 | 3300026121 | Ga0207683_11032758 | Ga0207683_110327582 | 67 |
| 482 | 3300026121 | Ga0207683_11887413 | Ga0207683_118874132 | 67 |
| 483 | 3300026142 | Ga0207698_10002589 | Ga0207698_1000258913 | 67 |
| 484 | 3300026142 | Ga0207698_10030656 | Ga0207698_100306562 | 67 |
| 485 | 3300026142 | Ga0207698_10275652 | Ga0207698_102756522 | 67 |
| 486 | 3300026142 | Ga0207698_11414492 | Ga0207698_114144922 | 67 |
| 487 | 3300026142 | Ga0207698_11646563 | Ga0207698_116465632 | 67 |
| 488 | 3300026142 | Ga0207698_11676086 | Ga0207698_116760861 | 67 |
| 489 | 3300026142 | Ga0207698_11863146 | Ga0207698_118631462 | 67 |
| 490 | 3300026142 | Ga0207698_12199648 | Ga0207698_121996482 | 67 |
| 491 | 3300028379 | Ga0268266_11978636 | Ga0268266_119786362 | 67 |
| 492 | 3300028380 | Ga0268265_10077470 | Ga0268265_100774702 | 67 |
| 493 | 3300028380 | Ga0268265_10600875 | Ga0268265_106008752 | 67 |
| 494 | 3300028380 | Ga0268265_10743641 | Ga0268265_107436412 | 67 |
| 495 | 3300028380 | Ga0268265_11307156 | Ga0268265_113071562 | 67 |
| 496 | 3300028381 | Ga0268264_10006446 | Ga0268264_100064462 | 67 |
| 497 | 3300028381 | Ga0268264_10067766 | Ga0268264_100677663 | 67 |
| 498 | 3300028381 | Ga0268264_10564191 | Ga0268264_105641912 | 67 |
| 499 | 3300028381 | Ga0268264_11997984 | Ga0268264_119979842 | 67 |
| 500 | 3300031548 | Ga0307408_100430249 | Ga0307408_1004302492 | 67 |
| 501 | 3300031731 | Ga0307405_10026040 | Ga0307405_100260402 | 67 |
| 502 | 3300031852 | Ga0307410_10484526 | Ga0307410_104845262 | 67 |
| 503 | 3300031911 | Ga0307412_10105704 | Ga0307412_101057042 | 67 |
| 504 | 3300032002 | Ga0307416_101029015 | Ga0307416_1010290152 | 67 |
| 505 | 3300032005 | Ga0307411_10743827 | Ga0307411_107438272 | 67 |
| 506 | 3300032126 | Ga0307415_100001187 | Ga0307415_1000011874 | 67 |
| 507 | 3300035089 | Ga0373944_0183056 | Ga0373944_0183056_492_701 | 67 |
| 508 | 3300035115 | Ga0373941_0041699 | Ga0373941_0041699_1074_1283 | 67 |
| 509 | 3300035116 | Ga0373945_0311832 | Ga0373945_0311832_446_655 | 67 |
| 510 | 3300035119 | Ga0373956_0432069 | Ga0373956_0432069_167_376 | 67 |
| 511 | 3300035120 | Ga0373957_0062678 | Ga0373957_0062678_664_873 | 67 |
| 512 | 3300035121 | Ga0373960_0234561 | Ga0373960_0234561_23_232 | 67 |
| 513 | 3300035172 | Ga0373955_0688087 | Ga0373955_0688087_118_327 | 67 |
| 514 | 3300035242 | Ga0373962_0018166 | Ga0373962_0018166_1333_1542 | 67 |
| 515 | 3300035410 | Ga0373924_0038467 | Ga0373924_0038467_1584_1793 | 67 |
| 516 | 3300035691 | Ga0373931_0001033 | Ga0373931_0001033_577_786 | 67 |
| 517 | 3300035692 | Ga0373935_0259327 | Ga0373935_0259327_863_1072 | 67 |
| 518 | 3300035692 | Ga0373935_0330311 | Ga0373935_0330311_578_787 | 67 |
| 519 | 3300035692 | Ga0373935_1141289 | Ga0373935_1141289_170_379 | 67 |
| 520 | 3300035695 | Ga0373927_0075418 | Ga0373927_0075418_1075_1284 | 67 |
| 521 | 3300035695 | Ga0373927_0496591 | Ga0373927_0496591_534_743 | 67 |
| 522 | 3300035725 | Ga0373947_0045257 | Ga0373947_0045257_200_409 | 67 |
| 523 | 3300035725 | Ga0373947_0171299 | Ga0373947_0171299_1106_1342 | 67 |
| 524 | 3300036401 | Ga0373937_0769336 | Ga0373937_0769336_485_694 | 67 |
| 525 | 3300037068 | Ga0373925_0004378 | Ga0373925_0004378_355_564 | 67 |
| 526 | 3300037068 | Ga0373925_0079048 | Ga0373925_0079048_344_553 | 67 |
| 527 | 3300037068 | Ga0373925_0271315 | Ga0373925_0271315_287_496 | 67 |
| 528 | 3300037853 | Ga0436364_0677523 | Ga0436364_0677523_38_247 | 67 |
| 529 | 3300039437 | Ga0436365_0312685 | Ga0436365_0312685_1260_1469 | 67 |
| 530 | 3300039447 | Ga0436361_0019501 | Ga0436361_0019501_5049_5258 | 67 |
| 531 | 3300039447 | Ga0436361_1031544 | Ga0436361_1031544_3057_3266 | 67 |
| 532 | 3300039447 | Ga0436361_1220274 | Ga0436361_1220274_40708_40917 | 67 |
| 533 | 3300039450 | Ga0436363_1209952 | Ga0436363_1209952_1473_1682 | 67 |
| 534 | 3300039453 | Ga0436362_0064679 | Ga0436362_0064679_307_516 | 67 |
| 535 | 3300041463 | Ga0451804_0191505 | Ga0451804_0191505_194_403 | 67 |
| 536 | 3300041463 | Ga0451804_0632507 | Ga0451804_0632507_83_292 | 67 |
| 537 | 3300041501 | Ga0451845_0298283 | Ga0451845_0298283_87_296 | 67 |
| 538 | 3300041512 | Ga0451853_1131216 | Ga0451853_1131216_303_512 | 67 |
| 539 | 3300044735 | Ga0466968_0015588 | Ga0466968_0015588_2480_2695 | 67 |
| 540 | 3300045051 | Ga0451576_0744631 | Ga0451576_0744631_202_411 | 67 |
| 541 | 3300045051 | Ga0451576_1970887 | Ga0451576_1970887_276_509 | 67 |
| 542 | 3300046454 | Ga0495592_0541922 | Ga0495592_0541922_340_576 | 67 |
| 543 | 3300046455 | Ga0495603_0292470 | Ga0495603_0292470_124_333 | 67 |
| 544 | 3300046462 | Ga0495651_0718940 | Ga0495651_0718940_74_283 | 67 |
| 545 | 3300046472 | Ga0495580_0116562 | Ga0495580_0116562_404_613 | 67 |
| 546 | 3300046472 | Ga0495580_0156185 | Ga0495580_0156185_294_503 | 67 |
| 547 | 3300046476 | Ga0495662_0110735 | Ga0495662_0110735_1094_1303 | 67 |
| 548 | 3300046477 | Ga0495664_0738531 | Ga0495664_0738531_142_351 | 67 |
| 549 | 3300046514 | Ga0495618_0309727 | Ga0495618_0309727_746_955 | 67 |
| 550 | 3300046522 | Ga0495643_0037769 | Ga0495643_0037769_2263_2481 | 67 |
| 551 | 3300046531 | Ga0495665_0343081 | Ga0495665_0343081_503_712 | 67 |
| 552 | 3300046533 | Ga0495640_0088699 | Ga0495640_0088699_95_331 | 67 |
| 553 | 3300046535 | Ga0495586_0417385 | Ga0495586_0417385_134_343 | 67 |
| 554 | 3300046543 | Ga0495645_0202214 | Ga0495645_0202214_724_933 | 67 |
| 555 | 3300046558 | Ga0495633_0316998 | Ga0495633_0316998_394_609 | 67 |
| 556 | 3300046559 | Ga0495667_0225288 | Ga0495667_0225288_497_706 | 67 |
| 557 | 3300046642 | Ga0495634_0368209 | Ga0495634_0368209_548_760 | 67 |
| 558 | 3300046663 | Ga0495635_0352832 | Ga0495635_0352832_128_337 | 67 |
| 559 | 3300046683 | Ga0495658_0023972 | Ga0495658_0023972_2262_2471 | 67 |
| 560 | 3300046683 | Ga0495658_0814340 | Ga0495658_0814340_221_430 | 67 |
| 561 | 3300046683 | Ga0495658_1092499 | Ga0495658_1092499_194_403 | 67 |
| 562 | 3300046809 | Ga0495600_0813015 | Ga0495600_0813015_85_297 | 67 |
| 563 | 3300047315 | Ga0495581_0527471 | Ga0495581_0527471_399_608 | 67 |
| 564 | 3300047319 | Ga0495674_0630149 | Ga0495674_0630149_277_486 | 67 |
| 565 | 3300047444 | Ga0495675_0788963 | Ga0495675_0788963_252_461 | 67 |
| 566 | 3300047471 | Ga0495684_0048209 | Ga0495684_0048209_1145_1354 | 67 |
| 567 | 3300048903 | Ga0496100_0457234 | Ga0496100_0457234_390_599 | 67 |
| 568 | 3300048903 | Ga0496100_1189419 | Ga0496100_1189419_16_225 | 67 |
| 569 | 3300048904 | Ga0496101_0107488 | Ga0496101_0107488_178_387 | 67 |
| 570 | 3300048904 | Ga0496101_0792050 | Ga0496101_0792050_234_443 | 67 |
| 571 | 3300048905 | Ga0496102_0065346 | Ga0496102_0065346_1406_1615 | 67 |
| 572 | 3300048907 | Ga0496104_0243643 | Ga0496104_0243643_1367_1576 | 67 |
| 573 | 3300048907 | Ga0496104_1589975 | Ga0496104_1589975_133_342 | 67 |
| 574 | 3300048908 | Ga0496105_0095091 | Ga0496105_0095091_2052_2261 | 67 |
| 575 | 3300048908 | Ga0496105_0610421 | Ga0496105_0610421_265_474 | 67 |
| 576 | 3300048909 | Ga0496106_0046614 | Ga0496106_0046614_1417_1626 | 67 |
| 577 | 3300048909 | Ga0496106_1457746 | Ga0496106_1457746_253_465 | 67 |
| 578 | 3300048910 | Ga0496107_0051049 | Ga0496107_0051049_1300_1509 | 67 |
| 579 | 3300048911 | Ga0496108_0021457 | Ga0496108_0021457_74_283 | 67 |
| 580 | 3300048911 | Ga0496108_0148087 | Ga0496108_0148087_1186_1395 | 67 |
| 581 | 3300048911 | Ga0496108_1320020 | Ga0496108_1320020_184_399 | 67 |
| 582 | 3300048912 | Ga0496109_0094545 | Ga0496109_0094545_147_362 | 67 |
| 583 | 3300048912 | Ga0496109_0245942 | Ga0496109_0245942_1084_1293 | 67 |
| 584 | 3300048912 | Ga0496109_0390803 | Ga0496109_0390803_374_583 | 67 |
| 585 | 3300048912 | Ga0496109_0775212 | Ga0496109_0775212_663_887 | 67 |
| 586 | 3300048913 | Ga0496110_0389566 | Ga0496110_0389566_809_1018 | 67 |
| 587 | 3300048913 | Ga0496110_0946500 | Ga0496110_0946500_394_603 | 67 |
| 588 | 3300048913 | Ga0496110_1388901 | Ga0496110_1388901_263_478 | 67 |
| 589 | 3300048915 | Ga0496112_0039732 | Ga0496112_0039732_2999_3208 | 67 |
| 590 | 3300048915 | Ga0496112_1814954 | Ga0496112_1814954_59_268 | 67 |
| 591 | 3300048916 | Ga0496113_0071241 | Ga0496113_0071241_958_1167 | 67 |
| 592 | 3300048916 | Ga0496113_0102226 | Ga0496113_0102226_1848_2057 | 67 |
| 593 | 3300048916 | Ga0496113_0621467 | Ga0496113_0621467_306_524 | 67 |
| 594 | 3300048916 | Ga0496113_0937481 | Ga0496113_0937481_228_437 | 67 |
| 595 | 3300048916 | Ga0496113_1108128 | Ga0496113_1108128_188_403 | 67 |
| 596 | 3300048917 | Ga0496114_1351303 | Ga0496114_1351303_258_467 | 67 |
| 597 | 3300048918 | Ga0496115_1114636 | Ga0496115_1114636_325_534 | 67 |
| 598 | 3300049528 | Ga0501312_090299 | Ga0501312_090299_322_540 | 67 |
| 599 | 3300049530 | Ga0501314_018859 | Ga0501314_018859_453_671 | 67 |
| 600 | 3300049537 | Ga0501321_065683 | Ga0501321_065683_217_435 | 67 |
| 601 | 3300049583 | Ga0501067_0819311 | Ga0501067_0819311_251_460 | 67 |
| 602 | 3300049763 | Ga0501266_085748 | Ga0501266_085748_287_505 | 67 |
| 603 | 3300049822 | Ga0501035_0111125 | Ga0501035_0111125_277_486 | 67 |
| 604 | 3300050489 | nmdc:mga03683_425286_c1 | nmdc:mga03683_425286_c1_316_534 | 67 |
| 605 | 3300050493 | nmdc:mga0k408_33920_c1 | nmdc:mga0k408_33920_c1_2689_2907 | 67 |
| 606 | 3300050494 | nmdc:mga06z11_337268_c1 | nmdc:mga06z11_337268_c1_14_232 | 67 |
| 607 | 3300050496 | nmdc:mga07m45_136922_c1 | nmdc:mga07m45_136922_c1_441_659 | 67 |
| 608 | 3300050496 | nmdc:mga07m45_148114_c1 | nmdc:mga07m45_148114_c1_927_1163 | 67 |
| 609 | 3300050496 | nmdc:mga07m45_23841_c2 | nmdc:mga07m45_23841_c2_96_314 | 67 |
| 610 | 3300050496 | nmdc:mga07m45_5744_c1 | nmdc:mga07m45_5744_c1_2931_3152 | 67 |
| 611 | 3300050511 | nmdc:mga08y16_1044261_c1 | nmdc:mga08y16_1044261_c1_374_583 | 67 |
| 612 | 3300053077 | Ga0495601_0950493 | Ga0495601_0950493_214_429 | 67 |
| 613 | 3300053085 | Ga0495619_0187972 | Ga0495619_0187972_996_1205 | 67 |
| 614 | 3300003791 | Ga0055530_10005149 | Ga0055530_100051499 | 68 |
| 615 | 3300003791 | Ga0055530_10024256 | Ga0055530_100242561 | 68 |
| 616 | 3300003792 | Ga0055540_1000007 | Ga0055540_1000007225 | 68 |
| 617 | 3300003794 | Ga0055531_10013883 | Ga0055531_100138833 | 68 |
| 618 | 3300005331 | Ga0070670_100163031 | Ga0070670_1001630313 | 68 |
| 619 | 3300005459 | Ga0068867_101855947 | Ga0068867_1018559472 | 68 |
| 620 | 3300005543 | Ga0070672_101237582 | Ga0070672_1012375822 | 68 |
| 621 | 3300005564 | Ga0070664_102089009 | Ga0070664_1020890092 | 68 |
| 622 | 3300005614 | Ga0068856_100024547 | Ga0068856_1000245473 | 68 |
| 623 | 3300005618 | Ga0068864_100763044 | Ga0068864_1007630442 | 68 |
| 624 | 3300005841 | Ga0068863_100271550 | Ga0068863_1002715502 | 68 |
| 625 | 3300005842 | Ga0068858_100435158 | Ga0068858_1004351582 | 68 |
| 626 | 3300006048 | Ga0075363_100234652 | Ga0075363_1002346522 | 68 |
| 627 | 3300006163 | Ga0070715_10484768 | Ga0070715_104847682 | 68 |
| 628 | 3300006177 | Ga0075362_10109550 | Ga0075362_101095502 | 68 |
| 629 | 3300006358 | Ga0068871_101348847 | Ga0068871_1013488472 | 68 |
| 630 | 3300006946 | Ga0079104_1000009 | Ga0079104_100000977 | 68 |
| 631 | 3300009177 | Ga0105248_10880348 | Ga0105248_108803482 | 68 |
| 632 | 3300009551 | Ga0105238_10623624 | Ga0105238_106236241 | 68 |
| 633 | 3300013296 | Ga0157374_10477754 | Ga0157374_104777541 | 68 |
| 634 | 3300013308 | Ga0157375_10003085 | Ga0157375_1000308511 | 68 |
| 635 | 3300014325 | Ga0163163_10129271 | Ga0163163_101292712 | 68 |
| 636 | 3300025263 | Ga0209565_1012512 | Ga0209565_10125122 | 68 |
| 637 | 3300025291 | Ga0209675_1009399 | Ga0209675_10093993 | 68 |
| 638 | 3300025298 | Ga0209050_1000246 | Ga0209050_100024677 | 68 |
| 639 | 3300025298 | Ga0209050_1016802 | Ga0209050_10168022 | 68 |
| 640 | 3300025299 | Ga0209256_1000019 | Ga0209256_1000019132 | 68 |
| 641 | 3300025303 | Ga0209051_1000004 | Ga0209051_1000004279 | 68 |
| 642 | 3300025304 | Ga0209257_1000038 | Ga0209257_1000038413 | 68 |
| 643 | 3300025304 | Ga0209257_1000044 | Ga0209257_1000044146 | 68 |
| 644 | 3300025925 | Ga0207650_11334132 | Ga0207650_113341322 | 68 |
| 645 | 3300025940 | Ga0207691_10511258 | Ga0207691_105112582 | 68 |
| 646 | 3300025941 | Ga0207711_10290088 | Ga0207711_102900882 | 68 |
| 647 | 3300026023 | Ga0207677_10030155 | Ga0207677_100301556 | 68 |
| 648 | 3300026035 | Ga0207703_11007532 | Ga0207703_110075322 | 68 |
| 649 | 3300026078 | Ga0207702_10162793 | Ga0207702_101627932 | 68 |
| 650 | 3300026078 | Ga0207702_10619397 | Ga0207702_106193972 | 68 |
| 651 | 3300026088 | Ga0207641_10249076 | Ga0207641_102490762 | 68 |
| 652 | 3300026089 | Ga0207648_11699060 | Ga0207648_116990602 | 68 |
| 653 | 3300026095 | Ga0207676_10023252 | Ga0207676_100232526 | 68 |
| 654 | 3300027111 | Ga0209281_1000023 | Ga0209281_1000023310 | 68 |
| 655 | 3300028794 | Ga0307515_10000037 | Ga0307515_1000003783 | 68 |
| 656 | 3300028794 | Ga0307515_10591478 | Ga0307515_105914782 | 68 |
| 657 | 3300031548 | Ga0307408_100059178 | Ga0307408_1000591782 | 68 |
| 658 | 3300031548 | Ga0307408_100724192 | Ga0307408_1007241922 | 68 |
| 659 | 3300031649 | Ga0307514_10000533 | Ga0307514_1000053313 | 68 |
| 660 | 3300031731 | Ga0307405_10041390 | Ga0307405_100413903 | 68 |
| 661 | 3300031731 | Ga0307405_11477972 | Ga0307405_114779722 | 68 |
| 662 | 3300031824 | Ga0307413_10030250 | Ga0307413_100302504 | 68 |
| 663 | 3300031824 | Ga0307413_10324676 | Ga0307413_103246762 | 68 |
| 664 | 3300031852 | Ga0307410_10005676 | Ga0307410_100056767 | 68 |
| 665 | 3300031901 | Ga0307406_10002787 | Ga0307406_100027877 | 68 |
| 666 | 3300031901 | Ga0307406_10236256 | Ga0307406_102362562 | 68 |
| 667 | 3300031903 | Ga0307407_10095579 | Ga0307407_100955792 | 68 |
| 668 | 3300031903 | Ga0307407_10422176 | Ga0307407_104221761 | 68 |
| 669 | 3300031903 | Ga0307407_11078698 | Ga0307407_110786981 | 68 |
| 670 | 3300031911 | Ga0307412_10053728 | Ga0307412_100537282 | 68 |
| 671 | 3300031911 | Ga0307412_11063416 | Ga0307412_110634162 | 68 |
| 672 | 3300031995 | Ga0307409_100036556 | Ga0307409_1000365562 | 68 |
| 673 | 3300031995 | Ga0307409_100561838 | Ga0307409_1005618382 | 68 |
| 674 | 3300032002 | Ga0307416_100231616 | Ga0307416_1002316163 | 68 |
| 675 | 3300032002 | Ga0307416_101076444 | Ga0307416_1010764442 | 68 |
| 676 | 3300032002 | Ga0307416_103051478 | Ga0307416_1030514781 | 68 |
| 677 | 3300032004 | Ga0307414_10888069 | Ga0307414_108880692 | 68 |
| 678 | 3300032005 | Ga0307411_10004113 | Ga0307411_100041132 | 68 |
| 679 | 3300032005 | Ga0307411_10125064 | Ga0307411_101250643 | 68 |
| 680 | 3300032005 | Ga0307411_11304475 | Ga0307411_113044752 | 68 |
| 681 | 3300035116 | Ga0373945_0131295 | Ga0373945_0131295_117_329 | 68 |
| 682 | 3300035724 | Ga0373933_0169041 | Ga0373933_0169041_1103_1309 | 68 |
| 683 | 3300036401 | Ga0373937_0459011 | Ga0373937_0459011_939_1145 | 68 |
| 684 | 3300039438 | Ga0436360_1262653 | Ga0436360_1262653_48_254 | 68 |
| 685 | 3300039450 | Ga0436363_0126290 | Ga0436363_0126290_195_401 | 68 |
| 686 | 3300041498 | Ga0451841_1083417 | Ga0451841_1083417_92_304 | 68 |
| 687 | 3300042121 | Ga0450919_008293 | Ga0450919_008293_523_741 | 68 |
| 688 | 3300042122 | Ga0450920_015070 | Ga0450920_015070_1028_1246 | 68 |
| 689 | 3300042125 | Ga0450923_039264 | Ga0450923_039264_602_820 | 68 |
| 690 | 3300042531 | Ga0450918_000994 | Ga0450918_000994_38_256 | 68 |
| 691 | 3300042876 | Ga0451577_0049233 | Ga0451577_0049233_2675_2890 | 68 |
| 692 | 3300044712 | Ga0453684_0425781 | Ga0453684_0425781_523_738 | 68 |
| 693 | 3300044712 | Ga0453684_1176294 | Ga0453684_1176294_470_679 | 68 |
| 694 | 3300045051 | Ga0451576_0923382 | Ga0451576_0923382_167_382 | 68 |
| 695 | 3300048903 | Ga0496100_1638673 | Ga0496100_1638673_159_374 | 68 |
| 696 | 3300048912 | Ga0496109_1384869 | Ga0496109_1384869_244_456 | 68 |
| 697 | 3300048917 | Ga0496114_0008894 | Ga0496114_0008894_7688_7906 | 68 |
| 698 | 3300048921 | Ga0496118_0152022 | Ga0496118_0152022_56_262 | 68 |
| 699 | 3300048924 | Ga0496121_0134613 | Ga0496121_0134613_143_349 | 68 |
| 700 | 3300048927 | Ga0496124_0000089 | Ga0496124_0000089_136928_137134 | 68 |
| 701 | 3300048928 | Ga0496125_0308353 | Ga0496125_0308353_152_358 | 68 |
| 702 | 3300048928 | Ga0496125_0772769 | Ga0496125_0772769_232_438 | 68 |
| 703 | 3300050489 | nmdc:mga03683_96688_c1 | nmdc:mga03683_96688_c1_120_338 | 68 |
| 704 | 3300050490 | nmdc:mga03n38_845685_c1 | nmdc:mga03n38_845685_c1_172_390 | 68 |
| 705 | iso_pu_bacteria | 2831864461 | 2831868659 | 68 |
| 706 | 3300003316 | rootH1_10003598 | rootH1_100035981 | 69 |
| 707 | 3300003320 | rootH2_10029593 | rootH2_100295934 | 69 |
| 708 | 3300003322 | rootL2_10001906 | rootL2_100019062 | 69 |
| 709 | 3300003322 | rootL2_10027947 | rootL2_1002794732 | 69 |
| 710 | 3300003323 | rootH1_10003292 | rootH1_100032924 | 69 |
| 711 | 3300003775 | Ga0055524_1000162 | Ga0055524_100016237 | 69 |
| 712 | 3300003794 | Ga0055531_10013558 | Ga0055531_100135582 | 69 |
| 713 | 3300003794 | Ga0055531_10119979 | Ga0055531_101199791 | 69 |
| 714 | 3300005293 | Ga0065715_10150019 | Ga0065715_101500193 | 69 |
| 715 | 3300005328 | Ga0070676_10188357 | Ga0070676_101883572 | 69 |
| 716 | 3300005328 | Ga0070676_10749959 | Ga0070676_107499592 | 69 |
| 717 | 3300005329 | Ga0070683_100756950 | Ga0070683_1007569502 | 69 |
| 718 | 3300005330 | Ga0070690_100128639 | Ga0070690_1001286392 | 69 |
| 719 | 3300005330 | Ga0070690_100953649 | Ga0070690_1009536491 | 69 |
| 720 | 3300005331 | Ga0070670_100277458 | Ga0070670_1002774582 | 69 |
| 721 | 3300005331 | Ga0070670_100767372 | Ga0070670_1007673722 | 69 |
| 722 | 3300005333 | Ga0070677_10007562 | Ga0070677_100075625 | 69 |
| 723 | 3300005333 | Ga0070677_10379619 | Ga0070677_103796192 | 69 |
| 724 | 3300005333 | Ga0070677_10623503 | Ga0070677_106235032 | 69 |
| 725 | 3300005334 | Ga0068869_100056006 | Ga0068869_1000560064 | 69 |
| 726 | 3300005335 | Ga0070666_10172127 | Ga0070666_101721272 | 69 |
| 727 | 3300005338 | Ga0068868_100003772 | Ga0068868_1000037723 | 69 |
| 728 | 3300005340 | Ga0070689_100126876 | Ga0070689_1001268763 | 69 |
| 729 | 3300005347 | Ga0070668_100117952 | Ga0070668_1001179522 | 69 |
| 730 | 3300005347 | Ga0070668_101044436 | Ga0070668_1010444361 | 69 |
| 731 | 3300005353 | Ga0070669_100364633 | Ga0070669_1003646332 | 69 |
| 732 | 3300005353 | Ga0070669_100415872 | Ga0070669_1004158722 | 69 |
| 733 | 3300005354 | Ga0070675_100036510 | Ga0070675_1000365105 | 69 |
| 734 | 3300005354 | Ga0070675_100150278 | Ga0070675_1001502783 | 69 |
| 735 | 3300005354 | Ga0070675_100390177 | Ga0070675_1003901772 | 69 |
| 736 | 3300005355 | Ga0070671_100001245 | Ga0070671_1000012456 | 69 |
| 737 | 3300005356 | Ga0070674_100545946 | Ga0070674_1005459462 | 69 |
| 738 | 3300005356 | Ga0070674_101954598 | Ga0070674_1019545981 | 69 |
| 739 | 3300005364 | Ga0070673_100003957 | Ga0070673_1000039575 | 69 |
| 740 | 3300005364 | Ga0070673_100199811 | Ga0070673_1001998112 | 69 |
| 741 | 3300005364 | Ga0070673_100609217 | Ga0070673_1006092172 | 69 |
| 742 | 3300005364 | Ga0070673_102203326 | Ga0070673_1022033261 | 69 |
| 743 | 3300005367 | Ga0070667_100054743 | Ga0070667_1000547432 | 69 |
| 744 | 3300005367 | Ga0070667_100332487 | Ga0070667_1003324872 | 69 |
| 745 | 3300005438 | Ga0070701_10128634 | Ga0070701_101286342 | 69 |
| 746 | 3300005455 | Ga0070663_100052271 | Ga0070663_1000522712 | 69 |
| 747 | 3300005455 | Ga0070663_101635755 | Ga0070663_1016357551 | 69 |
| 748 | 3300005456 | Ga0070678_100003077 | Ga0070678_10000307710 | 69 |
| 749 | 3300005456 | Ga0070678_100025454 | Ga0070678_1000254542 | 69 |
| 750 | 3300005456 | Ga0070678_100412546 | Ga0070678_1004125462 | 69 |
| 751 | 3300005456 | Ga0070678_100830827 | Ga0070678_1008308272 | 69 |
| 752 | 3300005457 | Ga0070662_100014752 | Ga0070662_1000147525 | 69 |
| 753 | 3300005457 | Ga0070662_100178967 | Ga0070662_1001789672 | 69 |
| 754 | 3300005457 | Ga0070662_100188941 | Ga0070662_1001889413 | 69 |
| 755 | 3300005459 | Ga0068867_100009697 | Ga0068867_1000096976 | 69 |
| 756 | 3300005459 | Ga0068867_100167727 | Ga0068867_1001677272 | 69 |
| 757 | 3300005459 | Ga0068867_100414451 | Ga0068867_1004144512 | 69 |
| 758 | 3300005459 | Ga0068867_101558170 | Ga0068867_1015581701 | 69 |
| 759 | 3300005466 | Ga0070685_11562629 | Ga0070685_115626292 | 69 |
| 760 | 3300005468 | Ga0070707_100145184 | Ga0070707_1001451843 | 69 |
| 761 | 3300005471 | Ga0070698_100396623 | Ga0070698_1003966231 | 69 |
| 762 | 3300005518 | Ga0070699_100475545 | Ga0070699_1004755452 | 69 |
| 763 | 3300005539 | Ga0068853_100059642 | Ga0068853_1000596422 | 69 |
| 764 | 3300005539 | Ga0068853_102079339 | Ga0068853_1020793391 | 69 |
| 765 | 3300005543 | Ga0070672_100020047 | Ga0070672_1000200472 | 69 |
| 766 | 3300005543 | Ga0070672_100167529 | Ga0070672_1001675292 | 69 |
| 767 | 3300005543 | Ga0070672_100273181 | Ga0070672_1002731812 | 69 |
| 768 | 3300005544 | Ga0070686_100189355 | Ga0070686_1001893552 | 69 |
| 769 | 3300005563 | Ga0068855_101240944 | Ga0068855_1012409442 | 69 |
| 770 | 3300005564 | Ga0070664_101147251 | Ga0070664_1011472512 | 69 |
| 771 | 3300005577 | Ga0068857_100055768 | Ga0068857_1000557682 | 69 |
| 772 | 3300005578 | Ga0068854_101016874 | Ga0068854_1010168742 | 69 |
| 773 | 3300005578 | Ga0068854_101189659 | Ga0068854_1011896592 | 69 |
| 774 | 3300005614 | Ga0068856_100405615 | Ga0068856_1004056152 | 69 |
| 775 | 3300005616 | Ga0068852_100200369 | Ga0068852_1002003692 | 69 |
| 776 | 3300005616 | Ga0068852_100960817 | Ga0068852_1009608172 | 69 |
| 777 | 3300005617 | Ga0068859_100658925 | Ga0068859_1006589251 | 69 |
| 778 | 3300005618 | Ga0068864_100005884 | Ga0068864_1000058842 | 69 |
| 779 | 3300005718 | Ga0068866_10191098 | Ga0068866_101910982 | 69 |
| 780 | 3300005719 | Ga0068861_100011826 | Ga0068861_1000118268 | 69 |
| 781 | 3300005834 | Ga0068851_10132817 | Ga0068851_101328172 | 69 |
| 782 | 3300005840 | Ga0068870_10317538 | Ga0068870_103175382 | 69 |
| 783 | 3300005840 | Ga0068870_10645284 | Ga0068870_106452842 | 69 |
| 784 | 3300005840 | Ga0068870_11017869 | Ga0068870_110178692 | 69 |
| 785 | 3300005841 | Ga0068863_100010494 | Ga0068863_1000104945 | 69 |
| 786 | 3300005842 | Ga0068858_100000259 | Ga0068858_10000025910 | 69 |
| 787 | 3300005843 | Ga0068860_100620520 | Ga0068860_1006205202 | 69 |
| 788 | 3300005844 | Ga0068862_100060510 | Ga0068862_1000605102 | 69 |
| 789 | 3300005844 | Ga0068862_100807123 | Ga0068862_1008071232 | 69 |
| 790 | 3300006038 | Ga0075365_10096479 | Ga0075365_100964792 | 69 |
| 791 | 3300006038 | Ga0075365_10753128 | Ga0075365_107531281 | 69 |
| 792 | 3300006042 | Ga0075368_10032256 | Ga0075368_100322562 | 69 |
| 793 | 3300006042 | Ga0075368_10040488 | Ga0075368_100404882 | 69 |
| 794 | 3300006048 | Ga0075363_100151243 | Ga0075363_1001512432 | 69 |
| 795 | 3300006051 | Ga0075364_10093210 | Ga0075364_100932103 | 69 |
| 796 | 3300006058 | Ga0075432_10085198 | Ga0075432_100851982 | 69 |
| 797 | 3300006177 | Ga0075362_10112124 | Ga0075362_101121242 | 69 |
| 798 | 3300006177 | Ga0075362_10377743 | Ga0075362_103777432 | 69 |
| 799 | 3300006177 | Ga0075362_10680226 | Ga0075362_106802261 | 69 |
| 800 | 3300006178 | Ga0075367_10030819 | Ga0075367_100308194 | 69 |
| 801 | 3300006178 | Ga0075367_10101024 | Ga0075367_101010243 | 69 |
| 802 | 3300006178 | Ga0075367_10295551 | Ga0075367_102955512 | 69 |
| 803 | 3300006186 | Ga0075369_10035715 | Ga0075369_100357152 | 69 |
| 804 | 3300006186 | Ga0075369_10053081 | Ga0075369_100530812 | 69 |
| 805 | 3300006186 | Ga0075369_10443126 | Ga0075369_104431262 | 69 |
| 806 | 3300006195 | Ga0075366_10001728 | Ga0075366_100017282 | 69 |
| 807 | 3300006195 | Ga0075366_10029122 | Ga0075366_100291223 | 69 |
| 808 | 3300006195 | Ga0075366_10052841 | Ga0075366_100528413 | 69 |
| 809 | 3300006195 | Ga0075366_10155127 | Ga0075366_101551272 | 69 |
| 810 | 3300006195 | Ga0075366_10184230 | Ga0075366_101842301 | 69 |
| 811 | 3300006195 | Ga0075366_10461532 | Ga0075366_104615322 | 69 |
| 812 | 3300006195 | Ga0075366_10631272 | Ga0075366_106312722 | 69 |
| 813 | 3300006237 | Ga0097621_100018962 | Ga0097621_1000189624 | 69 |
| 814 | 3300006353 | Ga0075370_10011994 | Ga0075370_100119947 | 69 |
| 815 | 3300006353 | Ga0075370_10029181 | Ga0075370_100291815 | 69 |
| 816 | 3300006353 | Ga0075370_10032930 | Ga0075370_100329302 | 69 |
| 817 | 3300006353 | Ga0075370_10057682 | Ga0075370_100576823 | 69 |
| 818 | 3300006353 | Ga0075370_10381496 | Ga0075370_103814962 | 69 |
| 819 | 3300006358 | Ga0068871_100335857 | Ga0068871_1003358572 | 69 |
| 820 | 3300006931 | Ga0097620_100658915 | Ga0097620_1006589151 | 69 |
| 821 | 3300009148 | Ga0105243_11798883 | Ga0105243_117988831 | 69 |
| 822 | 3300009174 | Ga0105241_10272826 | Ga0105241_102728261 | 69 |
| 823 | 3300009177 | Ga0105248_11098229 | Ga0105248_110982292 | 69 |
| 824 | 3300009545 | Ga0105237_10041408 | Ga0105237_100414083 | 69 |
| 825 | 3300009551 | Ga0105238_11658774 | Ga0105238_116587742 | 69 |
| 826 | 3300009551 | Ga0105238_11890695 | Ga0105238_118906952 | 69 |
| 827 | 3300009553 | Ga0105249_10016884 | Ga0105249_100168846 | 69 |
| 828 | 3300010375 | Ga0105239_10085568 | Ga0105239_100855684 | 69 |
| 829 | 3300012475 | Ga0157317_1000186 | Ga0157317_10001861 | 69 |
| 830 | 3300012497 | Ga0157319_1000002 | Ga0157319_1000002238 | 69 |
| 831 | 3300013104 | Ga0157370_11307137 | Ga0157370_113071372 | 69 |
| 832 | 3300013306 | Ga0163162_10019201 | Ga0163162_100192017 | 69 |
| 833 | 3300013306 | Ga0163162_10118418 | Ga0163162_101184184 | 69 |
| 834 | 3300013308 | Ga0157375_10115460 | Ga0157375_101154604 | 69 |
| 835 | 3300013308 | Ga0157375_13758463 | Ga0157375_137584632 | 69 |
| 836 | 3300014325 | Ga0163163_10663707 | Ga0163163_106637072 | 69 |
| 837 | 3300014326 | Ga0157380_10079211 | Ga0157380_100792114 | 69 |
| 838 | 3300014326 | Ga0157380_10868749 | Ga0157380_108687492 | 69 |
| 839 | 3300014745 | Ga0157377_10401551 | Ga0157377_104015512 | 69 |
| 840 | 3300014969 | Ga0157376_10062388 | Ga0157376_100623882 | 69 |
| 841 | 3300014969 | Ga0157376_10073392 | Ga0157376_100733922 | 69 |
| 842 | 3300017792 | Ga0163161_10075187 | Ga0163161_100751874 | 69 |
| 843 | 3300017792 | Ga0163161_10260221 | Ga0163161_102602212 | 69 |
| 844 | 3300025299 | Ga0209256_1000072 | Ga0209256_100007244 | 69 |
| 845 | 3300025303 | Ga0209051_1136781 | Ga0209051_11367811 | 69 |
| 846 | 3300025304 | Ga0209257_1000385 | Ga0209257_100038578 | 69 |
| 847 | 3300025304 | Ga0209257_1008778 | Ga0209257_10087784 | 69 |
| 848 | 3300025321 | Ga0207656_10095821 | Ga0207656_100958212 | 69 |
| 849 | 3300025893 | Ga0207682_10012060 | Ga0207682_100120602 | 69 |
| 850 | 3300025903 | Ga0207680_10263175 | Ga0207680_102631752 | 69 |
| 851 | 3300025907 | Ga0207645_10035303 | Ga0207645_100353034 | 69 |
| 852 | 3300025907 | Ga0207645_10283491 | Ga0207645_102834912 | 69 |
| 853 | 3300025907 | Ga0207645_10317180 | Ga0207645_103171802 | 69 |
| 854 | 3300025908 | Ga0207643_10637350 | Ga0207643_106373502 | 69 |
| 855 | 3300025908 | Ga0207643_10639793 | Ga0207643_106397932 | 69 |
| 856 | 3300025908 | Ga0207643_11150028 | Ga0207643_111500281 | 69 |
| 857 | 3300025909 | Ga0207705_10311029 | Ga0207705_103110292 | 69 |
| 858 | 3300025910 | Ga0207684_10004630 | Ga0207684_1000463014 | 69 |
| 859 | 3300025913 | Ga0207695_10250268 | Ga0207695_102502681 | 69 |
| 860 | 3300025914 | Ga0207671_10017203 | Ga0207671_100172032 | 69 |
| 861 | 3300025920 | Ga0207649_10581904 | Ga0207649_105819042 | 69 |
| 862 | 3300025922 | Ga0207646_10133400 | Ga0207646_101334003 | 69 |
| 863 | 3300025923 | Ga0207681_10039148 | Ga0207681_100391482 | 69 |
| 864 | 3300025923 | Ga0207681_11033633 | Ga0207681_110336332 | 69 |
| 865 | 3300025923 | Ga0207681_11367583 | Ga0207681_113675832 | 69 |
| 866 | 3300025924 | Ga0207694_11516164 | Ga0207694_115161642 | 69 |
| 867 | 3300025925 | Ga0207650_10012223 | Ga0207650_100122238 | 69 |
| 868 | 3300025925 | Ga0207650_10996471 | Ga0207650_109964712 | 69 |
| 869 | 3300025926 | Ga0207659_10010794 | Ga0207659_100107946 | 69 |
| 870 | 3300025926 | Ga0207659_10158022 | Ga0207659_101580222 | 69 |
| 871 | 3300025927 | Ga0207687_11701710 | Ga0207687_117017102 | 69 |
| 872 | 3300025931 | Ga0207644_10054871 | Ga0207644_100548713 | 69 |
| 873 | 3300025933 | Ga0207706_10067926 | Ga0207706_100679265 | 69 |
| 874 | 3300025934 | Ga0207686_10325134 | Ga0207686_103251342 | 69 |
| 875 | 3300025935 | Ga0207709_10386814 | Ga0207709_103868142 | 69 |
| 876 | 3300025935 | Ga0207709_10689438 | Ga0207709_106894382 | 69 |
| 877 | 3300025937 | Ga0207669_10974537 | Ga0207669_109745372 | 69 |
| 878 | 3300025940 | Ga0207691_10087701 | Ga0207691_100877014 | 69 |
| 879 | 3300025940 | Ga0207691_10093639 | Ga0207691_100936392 | 69 |
| 880 | 3300025940 | Ga0207691_10208529 | Ga0207691_102085292 | 69 |
| 881 | 3300025940 | Ga0207691_10507322 | Ga0207691_105073222 | 69 |
| 882 | 3300025941 | Ga0207711_10196560 | Ga0207711_101965603 | 69 |
| 883 | 3300025941 | Ga0207711_10410320 | Ga0207711_104103202 | 69 |
| 884 | 3300025942 | Ga0207689_10182281 | Ga0207689_101822811 | 69 |
| 885 | 3300025942 | Ga0207689_10185674 | Ga0207689_101856743 | 69 |
| 886 | 3300025945 | Ga0207679_10364340 | Ga0207679_103643402 | 69 |
| 887 | 3300025945 | Ga0207679_10432498 | Ga0207679_104324982 | 69 |
| 888 | 3300025949 | Ga0207667_10902073 | Ga0207667_109020732 | 69 |
| 889 | 3300025960 | Ga0207651_10170129 | Ga0207651_101701292 | 69 |
| 890 | 3300025960 | Ga0207651_10514551 | Ga0207651_105145512 | 69 |
| 891 | 3300025960 | Ga0207651_10666144 | Ga0207651_106661442 | 69 |
| 892 | 3300025960 | Ga0207651_11396709 | Ga0207651_113967092 | 69 |
| 893 | 3300025960 | Ga0207651_11757787 | Ga0207651_117577872 | 69 |
| 894 | 3300025961 | Ga0207712_10434957 | Ga0207712_104349572 | 69 |
| 895 | 3300025961 | Ga0207712_11276954 | Ga0207712_112769542 | 69 |
| 896 | 3300025972 | Ga0207668_10101101 | Ga0207668_101011012 | 69 |
| 897 | 3300025981 | Ga0207640_10296935 | Ga0207640_102969352 | 69 |
| 898 | 3300025986 | Ga0207658_10005557 | Ga0207658_100055572 | 69 |
| 899 | 3300025986 | Ga0207658_11274281 | Ga0207658_112742812 | 69 |
| 900 | 3300026023 | Ga0207677_10028291 | Ga0207677_100282912 | 69 |
| 901 | 3300026035 | Ga0207703_10001748 | Ga0207703_100017483 | 69 |
| 902 | 3300026041 | Ga0207639_10183239 | Ga0207639_101832392 | 69 |
| 903 | 3300026041 | Ga0207639_10199709 | Ga0207639_101997092 | 69 |
| 904 | 3300026041 | Ga0207639_11242500 | Ga0207639_112425002 | 69 |
| 905 | 3300026041 | Ga0207639_11597682 | Ga0207639_115976822 | 69 |
| 906 | 3300026067 | Ga0207678_10018029 | Ga0207678_100180293 | 69 |
| 907 | 3300026067 | Ga0207678_11075367 | Ga0207678_110753672 | 69 |
| 908 | 3300026075 | Ga0207708_10545729 | Ga0207708_105457292 | 69 |
| 909 | 3300026078 | Ga0207702_11899300 | Ga0207702_118993002 | 69 |
| 910 | 3300026088 | Ga0207641_10020236 | Ga0207641_100202362 | 69 |
| 911 | 3300026088 | Ga0207641_10447897 | Ga0207641_104478971 | 69 |
| 912 | 3300026088 | Ga0207641_11799220 | Ga0207641_117992202 | 69 |
| 913 | 3300026089 | Ga0207648_10029021 | Ga0207648_100290216 | 69 |
| 914 | 3300026089 | Ga0207648_10053971 | Ga0207648_100539714 | 69 |
| 915 | 3300026089 | Ga0207648_10146863 | Ga0207648_101468633 | 69 |
| 916 | 3300026089 | Ga0207648_10781787 | Ga0207648_107817872 | 69 |
| 917 | 3300026095 | Ga0207676_10000660 | Ga0207676_1000066029 | 69 |
| 918 | 3300026116 | Ga0207674_10825990 | Ga0207674_108259901 | 69 |
| 919 | 3300026118 | Ga0207675_100019157 | Ga0207675_1000191572 | 69 |
| 920 | 3300026121 | Ga0207683_10070308 | Ga0207683_100703082 | 69 |
| 921 | 3300026121 | Ga0207683_10178407 | Ga0207683_101784073 | 69 |
| 922 | 3300026121 | Ga0207683_10407713 | Ga0207683_104077132 | 69 |
| 923 | 3300026142 | Ga0207698_10048051 | Ga0207698_100480514 | 69 |
| 924 | 3300026142 | Ga0207698_11533569 | Ga0207698_115335692 | 69 |
| 925 | 3300027312 | Ga0209371_1036352 | Ga0209371_10363522 | 69 |
| 926 | 3300027866 | Ga0209813_10009482 | Ga0209813_100094823 | 69 |
| 927 | 3300027866 | Ga0209813_10073825 | Ga0209813_100738252 | 69 |
| 928 | 3300027907 | Ga0207428_11165531 | Ga0207428_111655312 | 69 |
| 929 | 3300028380 | Ga0268265_10109496 | Ga0268265_101094963 | 69 |
| 930 | 3300028381 | Ga0268264_10680355 | Ga0268264_106803552 | 69 |
| 931 | 3300028786 | Ga0307517_10074242 | Ga0307517_100742424 | 69 |
| 932 | 3300028786 | Ga0307517_10173931 | Ga0307517_101739312 | 69 |
| 933 | 3300028786 | Ga0307517_10267130 | Ga0307517_102671302 | 69 |
| 934 | 3300028794 | Ga0307515_10105571 | Ga0307515_101055713 | 69 |
| 935 | 3300028794 | Ga0307515_10105752 | Ga0307515_101057523 | 69 |
| 936 | 3300028794 | Ga0307515_10409874 | Ga0307515_104098742 | 69 |
| 937 | 3300030500 | Ga0268256_1044252 | Ga0268256_10442522 | 69 |
| 938 | 3300030522 | Ga0307512_10175569 | Ga0307512_101755692 | 69 |
| 939 | 3300031456 | Ga0307513_10754781 | Ga0307513_107547811 | 69 |
| 940 | 3300031507 | Ga0307509_10861347 | Ga0307509_108613472 | 69 |
| 941 | 3300031548 | Ga0307408_100014492 | Ga0307408_1000144928 | 69 |
| 942 | 3300031616 | Ga0307508_10517386 | Ga0307508_105173862 | 69 |
| 943 | 3300031730 | Ga0307516_10004112 | Ga0307516_1000411210 | 69 |
| 944 | 3300031730 | Ga0307516_10847704 | Ga0307516_108477042 | 69 |
| 945 | 3300031995 | Ga0307409_101671358 | Ga0307409_1016713582 | 69 |
| 946 | 3300032005 | Ga0307411_10008760 | Ga0307411_100087604 | 69 |
| 947 | 3300033180 | Ga0307510_10256422 | Ga0307510_102564222 | 69 |
| 948 | 3300034817 | Ga0373948_0017056 | Ga0373948_0017056_603_818 | 69 |
| 949 | 3300034818 | Ga0373950_0010239 | Ga0373950_0010239_1277_1492 | 69 |
| 950 | 3300035088 | Ga0373940_0000136 | Ga0373940_0000136_1272_1487 | 69 |
| 951 | 3300035089 | Ga0373944_0040391 | Ga0373944_0040391_910_1152 | 69 |
| 952 | 3300035090 | Ga0373949_0095761 | Ga0373949_0095761_75_290 | 69 |
| 953 | 3300035114 | Ga0373939_0000059 | Ga0373939_0000059_33020_33235 | 69 |
| 954 | 3300035121 | Ga0373960_0001178 | Ga0373960_0001178_4085_4300 | 69 |
| 955 | 3300035691 | Ga0373931_0000334 | Ga0373931_0000334_15473_15688 | 69 |
| 956 | 3300037466 | Ga0395898_0729126 | Ga0395898_0729126_368_577 | 69 |
| 957 | 3300037471 | Ga0395905_0212641 | Ga0395905_0212641_996_1205 | 69 |
| 958 | 3300037471 | Ga0395905_0888196 | Ga0395905_0888196_391_600 | 69 |
| 959 | 3300037853 | Ga0436364_0410954 | Ga0436364_0410954_317_538 | 69 |
| 960 | 3300041410 | Ga0439461_0066004 | Ga0439461_0066004_550_765 | 69 |
| 961 | 3300041452 | Ga0451793_1409532 | Ga0451793_1409532_256_483 | 69 |
| 962 | 3300041456 | Ga0451795_1063439 | Ga0451795_1063439_173_400 | 69 |
| 963 | 3300041458 | Ga0451798_0749136 | Ga0451798_0749136_104_322 | 69 |
| 964 | 3300041460 | Ga0451802_1320011 | Ga0451802_1320011_105_332 | 69 |
| 965 | 3300041463 | Ga0451804_0639527 | Ga0451804_0639527_263_490 | 69 |
| 966 | 3300041505 | Ga0451849_1244220 | Ga0451849_1244220_306_533 | 69 |
| 967 | 3300041507 | Ga0451851_1153008 | Ga0451851_1153008_99_326 | 69 |
| 968 | 3300041512 | Ga0451853_3130241 | Ga0451853_3130241_214_432 | 69 |
| 969 | 3300042001 | Ga0439441_185558 | Ga0439441_185558_25_243 | 69 |
| 970 | 3300042008 | Ga0439450_044909 | Ga0439450_044909_192_410 | 69 |
| 971 | 3300042011 | Ga0439454_076130 | Ga0439454_076130_326_541 | 69 |
| 972 | 3300042116 | Ga0450912_020394 | Ga0450912_020394_276_491 | 69 |
| 973 | 3300042116 | Ga0450912_037144 | Ga0450912_037144_269_481 | 69 |
| 974 | 3300042120 | Ga0450917_008273 | Ga0450917_008273_263_478 | 69 |
| 975 | 3300042126 | Ga0450888_001212 | Ga0450888_001212_1993_2208 | 69 |
| 976 | 3300042127 | Ga0450890_000667 | Ga0450890_000667_3053_3268 | 69 |
| 977 | 3300042127 | Ga0450890_009886 | Ga0450890_009886_830_1045 | 69 |
| 978 | 3300042129 | Ga0450891_000038 | Ga0450891_000038_6095_6310 | 69 |
| 979 | 3300042130 | Ga0450892_002137 | Ga0450892_002137_664_879 | 69 |
| 980 | 3300042138 | Ga0450903_048854 | Ga0450903_048854_221_436 | 69 |
| 981 | 3300042139 | Ga0450904_014314 | Ga0450904_014314_30_245 | 69 |
| 982 | 3300042142 | Ga0450905_013636 | Ga0450905_013636_731_946 | 69 |
| 983 | 3300042144 | Ga0450889_000077 | Ga0450889_000077_6018_6233 | 69 |
| 984 | 3300042437 | Ga0439444_0025232 | Ga0439444_0025232_747_962 | 69 |
| 985 | 3300042438 | Ga0439459_0006048 | Ga0439459_0006048_290_505 | 69 |
| 986 | 3300042438 | Ga0439459_0135819 | Ga0439459_0135819_204_419 | 69 |
| 987 | 3300042439 | Ga0439464_0063933 | Ga0439464_0063933_816_1034 | 69 |
| 988 | 3300042439 | Ga0439464_0075616 | Ga0439464_0075616_229_444 | 69 |
| 989 | 3300042531 | Ga0450918_103656 | Ga0450918_103656_11_253 | 69 |
| 990 | 3300042532 | Ga0450893_0000835 | Ga0450893_0000835_532_747 | 69 |
| 991 | 3300042876 | Ga0451577_0003346 | Ga0451577_0003346_10343_10567 | 69 |
| 992 | 3300044694 | Ga0466963_0169972 | Ga0466963_0169972_985_1200 | 69 |
| 993 | 3300044712 | Ga0453684_1260097 | Ga0453684_1260097_127_351 | 69 |
| 994 | 3300045051 | Ga0451576_2468493 | Ga0451576_2468493_51_266 | 69 |
| 995 | 3300046455 | Ga0495603_0132725 | Ga0495603_0132725_943_1185 | 69 |
| 996 | 3300046457 | Ga0495590_0020006 | Ga0495590_0020006_148_393 | 69 |
| 997 | 3300046512 | Ga0495610_0077829 | Ga0495610_0077829_227_472 | 69 |
| 998 | 3300046519 | Ga0495632_0007493 | Ga0495632_0007493_4566_4811 | 69 |
| 999 | 3300046522 | Ga0495643_0178509 | Ga0495643_0178509_702_929 | 69 |
| 1000 | 3300046525 | Ga0495663_0037655 | Ga0495663_0037655_43_270 | 69 |
| 1001 | 3300046528 | Ga0495642_0046396 | Ga0495642_0046396_107_340 | 69 |
| 1002 | 3300046530 | Ga0495654_0392669 | Ga0495654_0392669_110_355 | 69 |
| 1003 | 3300046537 | Ga0495598_0218020 | Ga0495598_0218020_199_441 | 69 |
| 1004 | 3300046538 | Ga0495609_0218623 | Ga0495609_0218623_397_642 | 69 |
| 1005 | 3300046539 | Ga0495621_0022142 | Ga0495621_0022142_131_346 | 69 |
| 1006 | 3300046539 | Ga0495621_0059719 | Ga0495621_0059719_948_1166 | 69 |
| 1007 | 3300046539 | Ga0495621_0162629 | Ga0495621_0162629_54_272 | 69 |
| 1008 | 3300046542 | Ga0495597_0289147 | Ga0495597_0289147_172_417 | 69 |
| 1009 | 3300046558 | Ga0495633_0397649 | Ga0495633_0397649_190_408 | 69 |
| 1010 | 3300046616 | Ga0495668_0304446 | Ga0495668_0304446_429_674 | 69 |
| 1011 | 3300046648 | Ga0495611_0330984 | Ga0495611_0330984_59_304 | 69 |
| 1012 | 3300046660 | Ga0495625_0482719 | Ga0495625_0482719_123_368 | 69 |
| 1013 | 3300046681 | Ga0495647_0073734 | Ga0495647_0073734_510_728 | 69 |
| 1014 | 3300046683 | Ga0495658_0056885 | Ga0495658_0056885_1694_1936 | 69 |
| 1015 | 3300046691 | Ga0495670_0385768 | Ga0495670_0385768_460_702 | 69 |
| 1016 | 3300046694 | Ga0495649_0129737 | Ga0495649_0129737_215_460 | 69 |
| 1017 | 3300046810 | Ga0495660_0010853 | Ga0495660_0010853_4940_5185 | 69 |
| 1018 | 3300046810 | Ga0495660_0396678 | Ga0495660_0396678_156_383 | 69 |
| 1019 | 3300047321 | Ga0495676_1039322 | Ga0495676_1039322_47_289 | 69 |
| 1020 | 3300047443 | Ga0495687_006891 | Ga0495687_006891_107_352 | 69 |
| 1021 | 3300047443 | Ga0495687_011062 | Ga0495687_011062_951_1196 | 69 |
| 1022 | 3300048907 | Ga0496104_0077738 | Ga0496104_0077738_2901_3143 | 69 |
| 1023 | 3300048907 | Ga0496104_0469705 | Ga0496104_0469705_745_963 | 69 |
| 1024 | 3300048908 | Ga0496105_0036788 | Ga0496105_0036788_2794_3036 | 69 |
| 1025 | 3300048910 | Ga0496107_0297231 | Ga0496107_0297231_513_755 | 69 |
| 1026 | 3300048913 | Ga0496110_0252319 | Ga0496110_0252319_1350_1592 | 69 |
| 1027 | 3300048917 | Ga0496114_0951788 | Ga0496114_0951788_248_490 | 69 |
| 1028 | 3300048925 | Ga0496122_0522641 | Ga0496122_0522641_135_377 | 69 |
| 1029 | 3300048926 | Ga0496123_0449855 | Ga0496123_0449855_83_325 | 69 |
| 1030 | 3300049127 | Ga0501306_072310 | Ga0501306_072310_122_337 | 69 |
| 1031 | 3300049128 | Ga0501308_013624 | Ga0501308_013624_198_413 | 69 |
| 1032 | 3300049128 | Ga0501308_047802 | Ga0501308_047802_274_489 | 69 |
| 1033 | 3300049130 | Ga0501310_001719 | Ga0501310_001719_854_1069 | 69 |
| 1034 | 3300049160 | Ga0501304_013783 | Ga0501304_013783_174_389 | 69 |
| 1035 | 3300049161 | Ga0501305_076265 | Ga0501305_076265_222_437 | 69 |
| 1036 | 3300049459 | Ga0495678_266541 | Ga0495678_266541_142_387 | 69 |
| 1037 | 3300049460 | Ga0495682_0045286 | Ga0495682_0045286_1204_1449 | 69 |
| 1038 | 3300049513 | Ga0501290_055454 | Ga0501290_055454_16_231 | 69 |
| 1039 | 3300049514 | Ga0501291_001998 | Ga0501291_001998_1980_2195 | 69 |
| 1040 | 3300049517 | Ga0501294_009959 | Ga0501294_009959_386_601 | 69 |
| 1041 | 3300049518 | Ga0501295_039868 | Ga0501295_039868_477_692 | 69 |
| 1042 | 3300049519 | Ga0501296_009534 | Ga0501296_009534_687_902 | 69 |
| 1043 | 3300049520 | Ga0501297_007843 | Ga0501297_007843_522_737 | 69 |
| 1044 | 3300049521 | Ga0501298_022067 | Ga0501298_022067_427_642 | 69 |
| 1045 | 3300049523 | Ga0501300_002663 | Ga0501300_002663_2387_2602 | 69 |
| 1046 | 3300049527 | Ga0501311_036903 | Ga0501311_036903_203_418 | 69 |
| 1047 | 3300049528 | Ga0501312_011659 | Ga0501312_011659_113_328 | 69 |
| 1048 | 3300049529 | Ga0501313_069197 | Ga0501313_069197_71_286 | 69 |
| 1049 | 3300049530 | Ga0501314_000884 | Ga0501314_000884_609_824 | 69 |
| 1050 | 3300049531 | Ga0501315_009330 | Ga0501315_009330_554_769 | 69 |
| 1051 | 3300049533 | Ga0501317_044182 | Ga0501317_044182_158_373 | 69 |
| 1052 | 3300049534 | Ga0501318_036241 | Ga0501318_036241_158_373 | 69 |
| 1053 | 3300049535 | Ga0501319_014471 | Ga0501319_014471_110_325 | 69 |
| 1054 | 3300049539 | Ga0501323_070860 | Ga0501323_070860_197_412 | 69 |
| 1055 | 3300049571 | Ga0501034_0408271 | Ga0501034_0408271_740_955 | 69 |
| 1056 | 3300049581 | Ga0501047_0549524 | Ga0501047_0549524_30_245 | 69 |
| 1057 | 3300049650 | Ga0501199_003769 | Ga0501199_003769_613_828 | 69 |
| 1058 | 3300049651 | Ga0501201_001747 | Ga0501201_001747_257_472 | 69 |
| 1059 | 3300049652 | Ga0501202_021014 | Ga0501202_021014_612_827 | 69 |
| 1060 | 3300049653 | Ga0501206_050724 | Ga0501206_050724_144_359 | 69 |
| 1061 | 3300049655 | Ga0501208_095721 | Ga0501208_095721_106_321 | 69 |
| 1062 | 3300049658 | Ga0501211_001829 | Ga0501211_001829_1154_1369 | 69 |
| 1063 | 3300049661 | Ga0501217_145839 | Ga0501217_145839_242_457 | 69 |
| 1064 | 3300049663 | Ga0501223_025635 | Ga0501223_025635_576_791 | 69 |
| 1065 | 3300049665 | Ga0501227_019570 | Ga0501227_019570_830_1045 | 69 |
| 1066 | 3300049668 | Ga0501233_001981 | Ga0501233_001981_2875_3090 | 69 |
| 1067 | 3300049669 | Ga0501235_002121 | Ga0501235_002121_2783_2998 | 69 |
| 1068 | 3300049670 | Ga0501236_012853 | Ga0501236_012853_385_600 | 69 |
| 1069 | 3300049684 | Ga0501255_003573 | Ga0501255_003573_736_951 | 69 |
| 1070 | 3300049686 | Ga0501257_030638 | Ga0501257_030638_822_1037 | 69 |
| 1071 | 3300049687 | Ga0501258_001648 | Ga0501258_001648_495_710 | 69 |
| 1072 | 3300049687 | Ga0501258_032800 | Ga0501258_032800_284_499 | 69 |
| 1073 | 3300049688 | Ga0501259_115694 | Ga0501259_115694_332_547 | 69 |
| 1074 | 3300049704 | Ga0501221_019877 | Ga0501221_019877_585_800 | 69 |
| 1075 | 3300049705 | Ga0501225_0011857 | Ga0501225_0011857_2065_2280 | 69 |
| 1076 | 3300049706 | Ga0501229_032828 | Ga0501229_032828_122_337 | 69 |
| 1077 | 3300049759 | Ga0501262_002466 | Ga0501262_002466_1389_1604 | 69 |
| 1078 | 3300049762 | Ga0501265_003770 | Ga0501265_003770_1452_1667 | 69 |
| 1079 | 3300049764 | Ga0501267_000056 | Ga0501267_000056_4404_4619 | 69 |
| 1080 | 3300049765 | Ga0501268_066803 | Ga0501268_066803_249_464 | 69 |
| 1081 | 3300049766 | Ga0501269_016545 | Ga0501269_016545_159_374 | 69 |
| 1082 | 3300049769 | Ga0501272_015592 | Ga0501272_015592_532_747 | 69 |
| 1083 | 3300049771 | Ga0501274_015371 | Ga0501274_015371_515_730 | 69 |
| 1084 | 3300049778 | Ga0501282_005077 | Ga0501282_005077_443_658 | 69 |
| 1085 | 3300050489 | nmdc:mga03683_231906_c1 | nmdc:mga03683_231906_c1_42_287 | 69 |
| 1086 | 3300050489 | nmdc:mga03683_90593_c1 | nmdc:mga03683_90593_c1_574_819 | 69 |
| 1087 | 3300050490 | nmdc:mga03n38_109784_c1 | nmdc:mga03n38_109784_c1_493_738 | 69 |
| 1088 | 3300050490 | nmdc:mga03n38_814307_c1 | nmdc:mga03n38_814307_c1_258_479 | 69 |
| 1089 | 3300050493 | nmdc:mga0k408_173989_c1 | nmdc:mga0k408_173989_c1_227_442 | 69 |
| 1090 | 3300050493 | nmdc:mga0k408_19343_c1 | nmdc:mga0k408_19343_c1_1935_2150 | 69 |
| 1091 | 3300050493 | nmdc:mga0k408_32128_c1 | nmdc:mga0k408_32128_c1_1055_1276 | 69 |
| 1092 | 3300050493 | nmdc:mga0k408_409501_c1 | nmdc:mga0k408_409501_c1_565_786 | 69 |
| 1093 | 3300050493 | nmdc:mga0k408_58093_c1 | nmdc:mga0k408_58093_c1_365_610 | 69 |
| 1094 | 3300050493 | nmdc:mga0k408_735492_c1 | nmdc:mga0k408_735492_c1_258_473 | 69 |
| 1095 | 3300050493 | nmdc:mga0k408_8304_c1 | nmdc:mga0k408_8304_c1_5227_5454 | 69 |
| 1096 | 3300050493 | nmdc:mga0k408_9558_c1 | nmdc:mga0k408_9558_c1_85_330 | 69 |
| 1097 | 3300050494 | nmdc:mga06z11_343415_c1 | nmdc:mga06z11_343415_c1_208_429 | 69 |
| 1098 | 3300050494 | nmdc:mga06z11_406722_c1 | nmdc:mga06z11_406722_c1_246_461 | 69 |
| 1099 | 3300050494 | nmdc:mga06z11_462098_c1 | nmdc:mga06z11_462098_c1_173_388 | 69 |
| 1100 | 3300050494 | nmdc:mga06z11_542945_c1 | nmdc:mga06z11_542945_c1_366_611 | 69 |
| 1101 | 3300050495 | nmdc:mga04h51_226751_c1 | nmdc:mga04h51_226751_c1_404_625 | 69 |
| 1102 | 3300050496 | nmdc:mga07m45_1252_c1 | nmdc:mga07m45_1252_c1_229_474 | 69 |
| 1103 | 3300050496 | nmdc:mga07m45_184627_c1 | nmdc:mga07m45_184627_c1_911_1156 | 69 |
| 1104 | 3300050496 | nmdc:mga07m45_232051_c1 | nmdc:mga07m45_232051_c1_57_272 | 69 |
| 1105 | 3300050496 | nmdc:mga07m45_31872_c1 | nmdc:mga07m45_31872_c1_372_587 | 69 |
| 1106 | 3300050496 | nmdc:mga07m45_432176_c1 | nmdc:mga07m45_432176_c1_178_393 | 69 |
| 1107 | 3300050496 | nmdc:mga07m45_44069_c1 | nmdc:mga07m45_44069_c1_439_660 | 69 |
| 1108 | 3300050496 | nmdc:mga07m45_8788_c1 | nmdc:mga07m45_8788_c1_62_307 | 69 |
| 1109 | 3300050511 | nmdc:mga08y16_1950544_c1 | nmdc:mga08y16_1950544_c1_232_477 | 69 |
| 1110 | 3300050516 | nmdc:mga0sz30_46262_c1 | nmdc:mga0sz30_46262_c1_590_835 | 69 |
| 1111 | 3300050516 | nmdc:mga0sz30_89692_c1 | nmdc:mga0sz30_89692_c1_420_665 | 69 |
| 1112 | 3300053092 | Ga0500583_0499237 | Ga0500583_0499237_204_431 | 69 |
| 1113 | 3300053093 | Ga0500651_0304817 | Ga0500651_0304817_520_747 | 69 |
| 1114 | 3300053098 | Ga0500650_0060669 | Ga0500650_0060669_139_390 | 69 |
| 1115 | 3300053134 | Ga0500658_0002795 | Ga0500658_0002795_622_867 | 69 |
| 1116 | 3300053137 | Ga0500561_0251506 | Ga0500561_0251506_287_508 | 69 |
| 1117 | 3300053139 | Ga0500568_0204579 | Ga0500568_0204579_99_344 | 69 |
| 1118 | 3300059421 | Ga0590071_001624 | Ga0590071_001624_4654_4875 | 69 |
| 1119 | 3300059423 | Ga0590074_063491 | Ga0590074_063491_265_486 | 69 |
| 1120 | 3300002077 | JGI24744J21845_10021994 | JGI24744J21845_100219942 | 70 |
| 1121 | 3300003323 | rootH1_10003293 | rootH1_1000329318 | 70 |
| 1122 | 3300003771 | Ga0055526_1024551 | Ga0055526_10245513 | 70 |
| 1123 | 3300003790 | Ga0055528_1075278 | Ga0055528_10752781 | 70 |
| 1124 | 3300003792 | Ga0055540_1048691 | Ga0055540_10486912 | 70 |
| 1125 | 3300003794 | Ga0055531_10002886 | Ga0055531_100028863 | 70 |
| 1126 | 3300005262 | Ga0065165_1000086 | Ga0065165_100008641 | 70 |
| 1127 | 3300005344 | Ga0070661_100503360 | Ga0070661_1005033602 | 70 |
| 1128 | 3300005457 | Ga0070662_100001692 | Ga0070662_1000016929 | 70 |
| 1129 | 3300005843 | Ga0068860_100647217 | Ga0068860_1006472172 | 70 |
| 1130 | 3300006846 | Ga0075430_101699021 | Ga0075430_1016990212 | 70 |
| 1131 | 3300006942 | Ga0099824_1052367 | Ga0099824_10523672 | 70 |
| 1132 | 3300006944 | Ga0099823_1000003 | Ga0099823_1000003106 | 70 |
| 1133 | 3300009036 | Ga0105244_10316941 | Ga0105244_103169412 | 70 |
| 1134 | 3300009093 | Ga0105240_11408338 | Ga0105240_114083382 | 70 |
| 1135 | 3300025242 | Ga0209258_106366 | Ga0209258_1063662 | 70 |
| 1136 | 3300025273 | Ga0209673_1003399 | Ga0209673_10033992 | 70 |
| 1137 | 3300025273 | Ga0209673_1051533 | Ga0209673_10515332 | 70 |
| 1138 | 3300025295 | Ga0209564_1000229 | Ga0209564_100022980 | 70 |
| 1139 | 3300025298 | Ga0209050_1060364 | Ga0209050_10603642 | 70 |
| 1140 | 3300025299 | Ga0209256_1004519 | Ga0209256_10045192 | 70 |
| 1141 | 3300025303 | Ga0209051_1001942 | Ga0209051_10019427 | 70 |
| 1142 | 3300025304 | Ga0209257_1001796 | Ga0209257_100179626 | 70 |
| 1143 | 3300025913 | Ga0207695_11149153 | Ga0207695_111491531 | 70 |
| 1144 | 3300025933 | Ga0207706_10005001 | Ga0207706_100050012 | 70 |
| 1145 | 3300027296 | Ga0209389_1033766 | Ga0209389_10337663 | 70 |
| 1146 | 3300028381 | Ga0268264_10363049 | Ga0268264_103630492 | 70 |
| 1147 | 3300031344 | Ga0265316_10000180 | Ga0265316_1000018073 | 70 |
| 1148 | 3300032002 | Ga0307416_101546051 | Ga0307416_1015460512 | 70 |
| 1149 | 3300037418 | Ga0395900_0000387 | Ga0395900_0000387_54129_54347 | 70 |
| 1150 | 3300037466 | Ga0395898_0000958 | Ga0395898_0000958_37149_37367 | 70 |
| 1151 | 3300037471 | Ga0395905_0017509 | Ga0395905_0017509_6451_6666 | 70 |
| 1152 | 3300037471 | Ga0395905_0043266 | Ga0395905_0043266_3725_3943 | 70 |
| 1153 | 3300037471 | Ga0395905_0082870 | Ga0395905_0082870_50_265 | 70 |
| 1154 | 3300037471 | Ga0395905_0630520 | Ga0395905_0630520_589_804 | 70 |
| 1155 | 3300037471 | Ga0395905_1415934 | Ga0395905_1415934_151_363 | 70 |
| 1156 | 3300041408 | Ga0439453_0092932 | Ga0439453_0092932_256_477 | 70 |
| 1157 | 3300041413 | Ga0439465_0042070 | Ga0439465_0042070_1057_1278 | 70 |
| 1158 | 3300041443 | Ga0451789_0529892 | Ga0451789_0529892_319_549 | 70 |
| 1159 | 3300041451 | Ga0451791_0898320 | Ga0451791_0898320_249_470 | 70 |
| 1160 | 3300041999 | Ga0439433_0032858 | Ga0439433_0032858_318_536 | 70 |
| 1161 | 3300042001 | Ga0439441_170853 | Ga0439441_170853_249_467 | 70 |
| 1162 | 3300042004 | Ga0439445_0118230 | Ga0439445_0118230_326_547 | 70 |
| 1163 | 3300042007 | Ga0439449_0219225 | Ga0439449_0219225_58_297 | 70 |
| 1164 | 3300042015 | Ga0439462_0030492 | Ga0439462_0030492_389_607 | 70 |
| 1165 | 3300042133 | Ga0450896_010182 | Ga0450896_010182_171_386 | 70 |
| 1166 | 3300042133 | Ga0450896_013473 | Ga0450896_013473_211_432 | 70 |
| 1167 | 3300042135 | Ga0450899_012978 | Ga0450899_012978_65_280 | 70 |
| 1168 | 3300044656 | Ga0466969_0000009 | Ga0466969_0000009_19821_20039 | 70 |
| 1169 | 3300044656 | Ga0466969_0033505 | Ga0466969_0033505_1635_1847 | 70 |
| 1170 | 3300044656 | Ga0466969_0099931 | Ga0466969_0099931_631_849 | 70 |
| 1171 | 3300044658 | Ga0466972_0000303 | Ga0466972_0000303_18099_18353 | 70 |
| 1172 | 3300044658 | Ga0466972_0411468 | Ga0466972_0411468_257_469 | 70 |
| 1173 | 3300044683 | Ga0466965_0029857 | Ga0466965_0029857_2167_2421 | 70 |
| 1174 | 3300044683 | Ga0466965_0054438 | Ga0466965_0054438_547_765 | 70 |
| 1175 | 3300044683 | Ga0466965_0121033 | Ga0466965_0121033_304_519 | 70 |
| 1176 | 3300044683 | Ga0466965_0255796 | Ga0466965_0255796_537_755 | 70 |
| 1177 | 3300044683 | Ga0466965_0365573 | Ga0466965_0365573_339_551 | 70 |
| 1178 | 3300044683 | Ga0466965_0380129 | Ga0466965_0380129_134_376 | 70 |
| 1179 | 3300044684 | Ga0466966_0006238 | Ga0466966_0006238_2372_2584 | 70 |
| 1180 | 3300044684 | Ga0466966_0085141 | Ga0466966_0085141_995_1213 | 70 |
| 1181 | 3300044693 | Ga0466961_0007837 | Ga0466961_0007837_2372_2584 | 70 |
| 1182 | 3300044693 | Ga0466961_0113254 | Ga0466961_0113254_651_869 | 70 |
| 1183 | 3300044693 | Ga0466961_0120872 | Ga0466961_0120872_1321_1575 | 70 |
| 1184 | 3300044693 | Ga0466961_0217368 | Ga0466961_0217368_763_981 | 70 |
| 1185 | 3300044694 | Ga0466963_0070042 | Ga0466963_0070042_1062_1274 | 70 |
| 1186 | 3300044706 | Ga0466964_0008231 | Ga0466964_0008231_175_387 | 70 |
| 1187 | 3300044706 | Ga0466964_0102018 | Ga0466964_0102018_497_715 | 70 |
| 1188 | 3300044712 | Ga0453684_0633040 | Ga0453684_0633040_124_351 | 70 |
| 1189 | 3300044719 | Ga0466971_0005085 | Ga0466971_0005085_538_756 | 70 |
| 1190 | 3300044719 | Ga0466971_0490179 | Ga0466971_0490179_152_406 | 70 |
| 1191 | 3300044735 | Ga0466968_0124907 | Ga0466968_0124907_174_416 | 70 |
| 1192 | 3300044765 | Ga0466970_0065532 | Ga0466970_0065532_200_418 | 70 |
| 1193 | 3300044842 | Ga0466957_0029032 | Ga0466957_0029032_2803_3015 | 70 |
| 1194 | 3300044842 | Ga0466957_0043697 | Ga0466957_0043697_1844_2062 | 70 |
| 1195 | 3300044901 | Ga0466960_0019732 | Ga0466960_0019732_2575_2817 | 70 |
| 1196 | 3300045049 | Ga0466959_0006139 | Ga0466959_0006139_3489_3701 | 70 |
| 1197 | 3300045049 | Ga0466959_0024130 | Ga0466959_0024130_660_878 | 70 |
| 1198 | 3300045049 | Ga0466959_0038351 | Ga0466959_0038351_44_262 | 70 |
| 1199 | 3300045049 | Ga0466959_1162274 | Ga0466959_1162274_29_283 | 70 |
| 1200 | 3300045836 | Ga0466958_0055977 | Ga0466958_0055977_1248_1460 | 70 |
| 1201 | 3300045836 | Ga0466958_0125402 | Ga0466958_0125402_1166_1384 | 70 |
| 1202 | 3300045976 | Ga0466967_0235571 | Ga0466967_0235571_448_660 | 70 |
| 1203 | 3300046522 | Ga0495643_0337173 | Ga0495643_0337173_117_335 | 70 |
| 1204 | 3300046691 | Ga0495670_0048271 | Ga0495670_0048271_1672_1890 | 70 |
| 1205 | 3300048910 | Ga0496107_0596399 | Ga0496107_0596399_490_708 | 70 |
| 1206 | 3300048911 | Ga0496108_1509713 | Ga0496108_1509713_66_284 | 70 |
| 1207 | 3300048912 | Ga0496109_1197313 | Ga0496109_1197313_423_641 | 70 |
| 1208 | 3300048912 | Ga0496109_1581517 | Ga0496109_1581517_137_358 | 70 |
| 1209 | 3300048913 | Ga0496110_0092477 | Ga0496110_0092477_798_1019 | 70 |
| 1210 | 3300048928 | Ga0496125_0481248 | Ga0496125_0481248_219_437 | 70 |
| 1211 | 3300053156 | Ga0500622_0005593 | Ga0500622_0005593_5333_5551 | 70 |
| 1212 | 3300061719 | Ga0466962_0036494 | Ga0466962_0036494_1508_1720 | 70 |
| 1213 | 3300061719 | Ga0466962_0089450 | Ga0466962_0089450_727_945 | 70 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7ar7-assembly1.cif.gz_R | cryo-em structure of arabidopsis thaliana complex-i (open conformation) | 0.7018 | 10 | 61 |
| 8esz-assembly1.cif.gz_S6 | structure of mitochondrial complex i from drosophila melanogaster, helix-locked state | 0.6979 | 11 | 61 |
| 7arb-assembly1.cif.gz_R | cryo-em structure of arabidopsis thaliana complex-i (complete composition) | 0.6955 | 10 | 61 |
| 8ba0-assembly1.cif.gz_R | drosophila melanogaster complex i in the twisted state (dm2) | 0.6861 | 11 | 61 |
| 7ar8-assembly1.cif.gz_R | cryo-em structure of arabidopsis thaliana complex-i (closed conformation) | 0.6821 | 10 | 61 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2jvmA01 | Mainly Beta;Sandwich;HSP40/DNAj peptide-binding domain;q5lls5 like domains | 0.693 | 9 | 61 | 2.60.260.40 |
| af_P29505_31_113_2.60.11.10 | Mainly Beta;Sandwich;Cytochrome C Oxidase; Chain F;Cytochrome c oxidase, subunit Vb | 0.6082 | 9 | 61 | 2.60.11.10 |
| 2jvmA01 | Mainly Beta;Sandwich;HSP40/DNAj peptide-binding domain;q5lls5 like domains | 0.6071 | 9 | 61 | 2.60.260.40 |
| 2jz8A00 | Mainly Beta;Sandwich;HSP40/DNAj peptide-binding domain;q5lls5 like domains | 0.5677 | 9 | 66 | 2.60.260.40 |
| af_Q7YZT6_879_985_1.20.58.1800 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.5291 | 13 | 43 | 1.20.58.1800 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A519ZV48-F1-model_v4 | Zinc-finger domain-containing protein | 0.9245 | 8 | 70 |
|
| AF-A0A4Q3R386-F1-model_v4 | deleted | 0.9005 | 8 | 70 |
|
| AF-A0A1L1PQT8-F1-model_v4 | Zinc-finger domain containing protein | 0.8995 | 6 | 70 |
|
| AF-A0A255ZKZ9-F1-model_v4 | Zinc finger CHCC-type domain-containing protein | 0.8951 | 8 | 70 |
|
| AF-A0A4Q5PN54-F1-model_v4 | Zinc-finger domain-containing protein | 0.8907 | 6 | 70 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar