F491756

General Info

Members Datasets Scaffolds Average Seq Length
1213 460 1211 71

Family's Representative Sequence

Representative Sequence 3300044658|Ga0466972_0000303|Ga0466972_0000303_18099_18353
Length 84
Sequence MADQGLIGFDQRIMSDTPKRAATVEVVAADLQGPGVVFCPNPKMPLWSNHPRVFIDVATTGEGWCPYCSTVYKLKAGEKLPAHH

Samples

Sample ID Description Type Environment
1 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
2 2831864461 Roseateles noduli HZ7 Isolate Nodule
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
78 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
79 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
80 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
81 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
82 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
83 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
94 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
95 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
96 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
97 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
111 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
112 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
113 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
114 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
115 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
116 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
117 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
118 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
119 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
131 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
132 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
133 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
203 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
204 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
206 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
207 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
211 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
212 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
213 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
214 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
215 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
216 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
217 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
218 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
219 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
220 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
221 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
222 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
223 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
224 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
225 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
226 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
227 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
228 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
229 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
230 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
231 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
232 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
233 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
234 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
235 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
236 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
237 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
238 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
239 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
240 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
241 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
242 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
243 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
244 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
245 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
246 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
247 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
248 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
249 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
250 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
251 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
252 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
253 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
254 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
255 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
256 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
257 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
258 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
259 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
260 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
261 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
262 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
263 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
264 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
265 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
266 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
267 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
268 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
269 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
270 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
271 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
272 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
273 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
274 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
275 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
276 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
277 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
278 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
279 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
280 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
281 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
282 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
283 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
284 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
285 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
286 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
287 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
288 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
289 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
290 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
291 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
292 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
293 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
294 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
295 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
296 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
297 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
298 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
299 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
300 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
301 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
302 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
303 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
304 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
305 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
306 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
307 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
308 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
309 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
310 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
311 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
312 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
313 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
314 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
315 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
316 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
317 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
318 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
319 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
320 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
321 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
322 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
323 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
324 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
325 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
326 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
327 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
328 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
329 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
330 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
331 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
332 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
333 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
334 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
335 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
336 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
337 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
338 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
339 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
340 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
341 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
342 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
343 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
344 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
345 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
346 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
347 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
348 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
349 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
350 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
351 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
352 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
353 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
354 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
355 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
356 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
357 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
358 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
359 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
360 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
361 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
362 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
363 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
364 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
365 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
366 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
367 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
368 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
369 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
370 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
371 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
372 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
373 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
374 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
375 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
376 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
377 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
378 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
379 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
380 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
381 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
382 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
383 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
384 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
390 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
391 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
392 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
393 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
394 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
395 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
396 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
397 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
398 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
399 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
408 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
409 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
410 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
411 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
412 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
413 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
414 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
415 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
416 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
417 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
418 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
419 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
420 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
421 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
422 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
423 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
424 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
425 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
426 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
427 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
428 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
429 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
430 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
431 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
432 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
433 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
434 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
435 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
436 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
437 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
438 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
439 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
440 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
441 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
442 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
443 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
444 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
445 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
446 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
447 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
448 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
449 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
450 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
451 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
452 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
453 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
454 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
455 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
456 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
457 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
458 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
459 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
460 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.35
Metatranscriptomes 1.48
Isolates 0.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.56
Nodule 0.49
Rhizoplane 4.53
Rhizosphere 81.62
Stem 0
Stem Tuber 0
Unclassified 3.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10021994 3300002077 Bacteria 1253
2 JGI24742J22300_10081240 3300002244 Bacteria 613
3 rootH1_10003598 3300003316 Bacteria 4171
4 rootH2_10029593 3300003320 Bacteria 2113
5 rootL2_10001906 3300003322 Bacteria 13343
6 rootL2_10027947 3300003322 Bacteria 28083
7 rootH1_10003292 3300003323 Bacteria 2196
8 rootH1_10003293 3300003323 Bacteria 15628
9 Ga0055526_1024551 3300003771 Bacteria 1967
10 Ga0055524_1000162 3300003775 Bacteria 77486
11 Ga0055528_1075278 3300003790 Bacteria 602
12 Ga0055530_10005149 3300003791 Bacteria 6376
13 Ga0055530_10024256 3300003791 Bacteria 1725
14 Ga0055540_1000007 3300003792 Bacteria 318178
15 Ga0055540_1048691 3300003792 Bacteria 882
16 Ga0055531_10002886 3300003794 Bacteria 11193
17 Ga0055531_10013558 3300003794 Bacteria 3748
18 Ga0055531_10013883 3300003794 Bacteria 3677
19 Ga0055531_10119979 3300003794 Bacteria 514
20 Ga0065165_1000086 3300005262 Bacteria 154235
21 Ga0065165_1003210 3300005262 Bacteria 11915
22 Ga0065715_10150019 3300005293 Bacteria 1740
23 Ga0065707_10107246 3300005295 Bacteria 2562
24 Ga0065707_10218566 3300005295 Bacteria 1217
25 Ga0070658_10037488 3300005327 Bacteria 3908
26 Ga0070658_10532818 3300005327 Bacteria 1016
27 Ga0070658_10712175 3300005327 Bacteria 871
28 Ga0070658_11431759 3300005327 Bacteria 599
29 Ga0070676_10000461 3300005328 Bacteria 19451
30 Ga0070676_10188357 3300005328 Bacteria 1345
31 Ga0070676_10568668 3300005328 Bacteria 814
32 Ga0070676_10749959 3300005328 Bacteria 716
33 Ga0070676_10916169 3300005328 Bacteria 654
34 Ga0070683_100002657 3300005329 Bacteria 14284
35 Ga0070683_100756950 3300005329 Bacteria 931
36 Ga0070683_101712464 3300005329 Bacteria 604
37 Ga0070683_102167617 3300005329 Bacteria 534
38 Ga0070690_100061053 3300005330 Bacteria 2427
39 Ga0070690_100128639 3300005330 Bacteria 1708
40 Ga0070690_100953649 3300005330 Bacteria 674
41 Ga0070670_100082742 3300005331 Bacteria 2758
42 Ga0070670_100121665 3300005331 Bacteria 2251
43 Ga0070670_100157279 3300005331 Bacteria 1969
44 Ga0070670_100163031 3300005331 Bacteria 1932
45 Ga0070670_100277458 3300005331 Bacteria 1463
46 Ga0070670_100321255 3300005331 Bacteria 1356
47 Ga0070670_100740322 3300005331 Bacteria 885
48 Ga0070670_100767372 3300005331 Bacteria 869
49 Ga0070670_100788634 3300005331 Bacteria 857
50 Ga0070670_100894621 3300005331 Bacteria 805
51 Ga0070670_101209809 3300005331 Bacteria 690
52 Ga0070677_10007562 3300005333 Bacteria 3632
53 Ga0070677_10013313 3300005333 Bacteria 2875
54 Ga0070677_10088375 3300005333 Bacteria 1342
55 Ga0070677_10161518 3300005333 Bacteria 1052
56 Ga0070677_10379619 3300005333 Bacteria 739
57 Ga0070677_10404198 3300005333 Bacteria 720
58 Ga0070677_10496518 3300005333 Bacteria 661
59 Ga0070677_10623503 3300005333 Bacteria 600
60 Ga0068869_100005237 3300005334 Bacteria 8145
61 Ga0068869_100056006 3300005334 Bacteria 2874
62 Ga0068869_100214971 3300005334 Bacteria 1521
63 Ga0068869_100385446 3300005334 Bacteria 1149
64 Ga0068869_100978383 3300005334 Bacteria 736
65 Ga0068869_101444504 3300005334 Bacteria 610
66 Ga0068869_101614653 3300005334 Bacteria 578
67 Ga0070666_10172127 3300005335 Bacteria 1516
68 Ga0070666_10205065 3300005335 Bacteria 1387
69 Ga0070666_10336329 3300005335 Bacteria 1079
70 Ga0070666_10495351 3300005335 Bacteria 885
71 Ga0070666_10986349 3300005335 Bacteria 625
72 Ga0070680_100033672 3300005336 Bacteria 4131
73 Ga0070682_100729376 3300005337 Bacteria 798
74 Ga0070682_100803104 3300005337 Bacteria 764
75 Ga0068868_100003772 3300005338 Bacteria 10579
76 Ga0068868_100038470 3300005338 Bacteria 3713
77 Ga0068868_100098048 3300005338 Bacteria 2369
78 Ga0068868_100222516 3300005338 Bacteria 1581
79 Ga0070660_100038847 3300005339 Bacteria 3615
80 Ga0070660_100292667 3300005339 Bacteria 1334
81 Ga0070660_100573144 3300005339 Bacteria 942
82 Ga0070660_100645233 3300005339 Bacteria 886
83 Ga0070660_101892275 3300005339 Bacteria 508
84 Ga0070689_100126876 3300005340 Bacteria 2043
85 Ga0070689_100615911 3300005340 Bacteria 941
86 Ga0070687_100070250 3300005343 Bacteria 1878
87 Ga0070687_100318600 3300005343 Bacteria 993
88 Ga0070661_100033916 3300005344 Bacteria 3700
89 Ga0070661_100503360 3300005344 Bacteria 970
90 Ga0070692_10125892 3300005345 Bacteria 1435
91 Ga0070692_11218408 3300005345 Bacteria 537
92 Ga0070668_100072024 3300005347 Bacteria 2692
93 Ga0070668_100117952 3300005347 Bacteria 2118
94 Ga0070668_100321570 3300005347 Bacteria 1303
95 Ga0070668_100682415 3300005347 Bacteria 905
96 Ga0070668_100731276 3300005347 Bacteria 875
97 Ga0070668_101044436 3300005347 Bacteria 736
98 Ga0070668_102270204 3300005347 Bacteria 502
99 Ga0070669_100012530 3300005353 Bacteria 6014
100 Ga0070669_100059940 3300005353 Bacteria 2794
101 Ga0070669_100125241 3300005353 Bacteria 1965
102 Ga0070669_100187143 3300005353 Bacteria 1622
103 Ga0070669_100364633 3300005353 Bacteria 1175
104 Ga0070669_100415872 3300005353 Bacteria 1103
105 Ga0070675_100036510 3300005354 Bacteria 3999
106 Ga0070675_100081897 3300005354 Bacteria 2692
107 Ga0070675_100150278 3300005354 Bacteria 1996
108 Ga0070675_100390177 3300005354 Bacteria 1240
109 Ga0070675_100995825 3300005354 Bacteria 769
110 Ga0070675_101291210 3300005354 Bacteria 672
111 Ga0070671_100000158 3300005355 Bacteria 44456
112 Ga0070671_100001245 3300005355 Bacteria 19079
113 Ga0070671_100030059 3300005355 Bacteria 4483
114 Ga0070671_100050580 3300005355 Bacteria 3456
115 Ga0070671_100150995 3300005355 Bacteria 1962
116 Ga0070671_100214533 3300005355 Bacteria 1633
117 Ga0070671_100251765 3300005355 Bacteria 1500
118 Ga0070671_100487619 3300005355 Bacteria 1059
119 Ga0070671_100551903 3300005355 Bacteria 993
120 Ga0070671_100615511 3300005355 Bacteria 939
121 Ga0070671_100770803 3300005355 Bacteria 837
122 Ga0070671_101927230 3300005355 Bacteria 526
123 Ga0070674_100053422 3300005356 Bacteria 2789
124 Ga0070674_100401175 3300005356 Bacteria 1120
125 Ga0070674_100545946 3300005356 Bacteria 972
126 Ga0070674_101538775 3300005356 Bacteria 598
127 Ga0070674_101954598 3300005356 Bacteria 533
128 Ga0070673_100003957 3300005364 Bacteria 9311
129 Ga0070673_100110117 3300005364 Bacteria 2283
130 Ga0070673_100148749 3300005364 Bacteria 1982
131 Ga0070673_100150067 3300005364 Bacteria 1973
132 Ga0070673_100199811 3300005364 Bacteria 1721
133 Ga0070673_100485714 3300005364 Bacteria 1115
134 Ga0070673_100609217 3300005364 Bacteria 997
135 Ga0070673_100741796 3300005364 Bacteria 904
136 Ga0070673_100781873 3300005364 Bacteria 880
137 Ga0070673_101500526 3300005364 Bacteria 636
138 Ga0070673_102203326 3300005364 Bacteria 524
139 Ga0070659_100003957 3300005366 Bacteria 10542
140 Ga0070659_100536357 3300005366 Bacteria 1000
141 Ga0070667_100046188 3300005367 Bacteria 3663
142 Ga0070667_100054743 3300005367 Bacteria 3369
143 Ga0070667_100210364 3300005367 Bacteria 1728
144 Ga0070667_100332487 3300005367 Bacteria 1373
145 Ga0070667_100445002 3300005367 Bacteria 1183
146 Ga0070667_100531703 3300005367 Bacteria 1079
147 Ga0070667_101014174 3300005367 Bacteria 775
148 Ga0070667_101092396 3300005367 Bacteria 745
149 Ga0070703_10493164 3300005406 Bacteria 550
150 Ga0070701_10128634 3300005438 Bacteria 1436
151 Ga0070700_100152310 3300005441 Bacteria 1583
152 Ga0070663_100013605 3300005455 Bacteria 5193
153 Ga0070663_100052271 3300005455 Bacteria 2914
154 Ga0070663_100822722 3300005455 Bacteria 798
155 Ga0070663_100956393 3300005455 Bacteria 743
156 Ga0070663_101635755 3300005455 Bacteria 575
157 Ga0070678_100003077 3300005456 Bacteria 9249
158 Ga0070678_100019501 3300005456 Bacteria 4424
159 Ga0070678_100025454 3300005456 Bacteria 3981
160 Ga0070678_100075598 3300005456 Bacteria 2534
161 Ga0070678_100339332 3300005456 Bacteria 1288
162 Ga0070678_100394619 3300005456 Bacteria 1200
163 Ga0070678_100412546 3300005456 Bacteria 1176
164 Ga0070678_100448670 3300005456 Bacteria 1129
165 Ga0070678_100559072 3300005456 Bacteria 1017
166 Ga0070678_100830827 3300005456 Bacteria 840
167 Ga0070678_102089001 3300005456 Bacteria 536
168 Ga0070662_100001692 3300005457 Bacteria 13562
169 Ga0070662_100002939 3300005457 Bacteria 10601
170 Ga0070662_100014752 3300005457 Bacteria 5223
171 Ga0070662_100106521 3300005457 Bacteria 2130
172 Ga0070662_100178967 3300005457 Bacteria 1670
173 Ga0070662_100188941 3300005457 Bacteria 1628
174 Ga0070662_100288194 3300005457 Bacteria 1330
175 Ga0070662_101202280 3300005457 Bacteria 652
176 Ga0070662_101684507 3300005457 Bacteria 548
177 Ga0070681_10099309 3300005458 Bacteria 2857
178 Ga0068867_100009697 3300005459 Bacteria 6789
179 Ga0068867_100099529 3300005459 Bacteria 2218
180 Ga0068867_100123681 3300005459 Bacteria 2002
181 Ga0068867_100136026 3300005459 Bacteria 1915
182 Ga0068867_100167727 3300005459 Bacteria 1736
183 Ga0068867_100414451 3300005459 Bacteria 1139
184 Ga0068867_100684096 3300005459 Bacteria 903
185 Ga0068867_100870639 3300005459 Bacteria 808
186 Ga0068867_100982266 3300005459 Bacteria 764
187 Ga0068867_101558170 3300005459 Bacteria 617
188 Ga0068867_101855947 3300005459 Bacteria 568
189 Ga0070685_10090539 3300005466 Bacteria 1851
190 Ga0070685_10687883 3300005466 Bacteria 745
191 Ga0070685_11562629 3300005466 Bacteria 510
192 Ga0070707_100145184 3300005468 Bacteria 2309
193 Ga0070698_100396623 3300005471 Bacteria 1313
194 Ga0070699_100475545 3300005518 Bacteria 1134
195 Ga0070699_101251718 3300005518 Bacteria 681
196 Ga0070679_100001707 3300005530 Bacteria 19792
197 Ga0070679_101606854 3300005530 Bacteria 598
198 Ga0070679_101718106 3300005530 Bacteria 576
199 Ga0070684_100031437 3300005535 Bacteria 4519
200 Ga0068853_100059642 3300005539 Bacteria 3297
201 Ga0068853_100108265 3300005539 Bacteria 2465
202 Ga0068853_100261617 3300005539 Bacteria 1591
203 Ga0068853_100285282 3300005539 Bacteria 1523
204 Ga0068853_100331799 3300005539 Bacteria 1412
205 Ga0068853_102079339 3300005539 Bacteria 551
206 Ga0070672_100020047 3300005543 Bacteria 4870
207 Ga0070672_100036467 3300005543 Bacteria 3746
208 Ga0070672_100078038 3300005543 Bacteria 2649
209 Ga0070672_100167529 3300005543 Bacteria 1825
210 Ga0070672_100182863 3300005543 Bacteria 1747
211 Ga0070672_100206087 3300005543 Bacteria 1646
212 Ga0070672_100273181 3300005543 Bacteria 1428
213 Ga0070672_100617109 3300005543 Bacteria 945
214 Ga0070672_100678166 3300005543 Bacteria 901
215 Ga0070672_101163559 3300005543 Bacteria 686
216 Ga0070672_101237582 3300005543 Bacteria 665
217 Ga0070672_101655846 3300005543 Bacteria 574
218 Ga0070672_101695320 3300005543 Bacteria 568
219 Ga0070686_100189355 3300005544 Bacteria 1467
220 Ga0070686_100807700 3300005544 Bacteria 756
221 Ga0070693_100025694 3300005547 Bacteria 3171
222 Ga0070693_100026782 3300005547 Bacteria 3115
223 Ga0070693_100027109 3300005547 Bacteria 3100
224 Ga0070665_100158936 3300005548 Bacteria 2261
225 Ga0070665_100415534 3300005548 Bacteria 1354
226 Ga0070665_100680788 3300005548 Bacteria 1041
227 Ga0070665_101563223 3300005548 Bacteria 668
228 Ga0068855_100007939 3300005563 Bacteria 12823
229 Ga0068855_101240944 3300005563 Bacteria 774
230 Ga0070664_100145676 3300005564 Bacteria 2088
231 Ga0070664_100181364 3300005564 Bacteria 1871
232 Ga0070664_100277123 3300005564 Bacteria 1512
233 Ga0070664_100279810 3300005564 Bacteria 1504
234 Ga0070664_100849782 3300005564 Bacteria 855
235 Ga0070664_101018464 3300005564 Bacteria 779
236 Ga0070664_101147251 3300005564 Bacteria 732
237 Ga0070664_102088786 3300005564 Bacteria 538
238 Ga0070664_102089009 3300005564 Bacteria 538
239 Ga0070664_102189124 3300005564 Bacteria 525
240 Ga0068857_100055768 3300005577 Bacteria 3506
241 Ga0068857_100069270 3300005577 Bacteria 3141
242 Ga0068857_100575627 3300005577 Bacteria 1062
243 Ga0068857_101143615 3300005577 Bacteria 753
244 Ga0068854_100152030 3300005578 Bacteria 1786
245 Ga0068854_100268962 3300005578 Bacteria 1368
246 Ga0068854_100279967 3300005578 Bacteria 1342
247 Ga0068854_100520375 3300005578 Bacteria 1005
248 Ga0068854_101016874 3300005578 Bacteria 735
249 Ga0068854_101189659 3300005578 Bacteria 682
250 Ga0068854_101934454 3300005578 Bacteria 543
251 Ga0068856_100024547 3300005614 Bacteria 5869
252 Ga0068856_100065004 3300005614 Bacteria 3604
253 Ga0068856_100107970 3300005614 Bacteria 2779
254 Ga0068856_100405615 3300005614 Bacteria 1383
255 Ga0068852_100012164 3300005616 Bacteria 6518
256 Ga0068852_100064917 3300005616 Bacteria 3183
257 Ga0068852_100158582 3300005616 Bacteria 2110
258 Ga0068852_100200369 3300005616 Bacteria 1889
259 Ga0068852_100493379 3300005616 Bacteria 1218
260 Ga0068852_100925162 3300005616 Bacteria 889
261 Ga0068852_100960817 3300005616 Bacteria 872
262 Ga0068852_101194951 3300005616 Bacteria 781
263 Ga0068852_101993887 3300005616 Bacteria 602
264 Ga0068852_102574464 3300005616 Bacteria 528
265 Ga0068859_100100711 3300005617 Bacteria 2945
266 Ga0068859_100151854 3300005617 Bacteria 2391
267 Ga0068859_100658925 3300005617 Bacteria 1139
268 Ga0068859_102193399 3300005617 Bacteria 609
269 Ga0068864_100005884 3300005618 Bacteria 10049
270 Ga0068864_100018827 3300005618 Bacteria 5772
271 Ga0068864_100025050 3300005618 Bacteria 5022
272 Ga0068864_100062621 3300005618 Bacteria 3223
273 Ga0068864_100303311 3300005618 Bacteria 1496
274 Ga0068864_100320948 3300005618 Bacteria 1455
275 Ga0068864_100490563 3300005618 Bacteria 1180
276 Ga0068864_100763044 3300005618 Bacteria 948
277 Ga0068864_101766259 3300005618 Bacteria 623
278 Ga0068864_101777824 3300005618 Bacteria 621
279 Ga0068866_10013545 3300005718 Bacteria 3581
280 Ga0068866_10119182 3300005718 Bacteria 1484
281 Ga0068866_10191098 3300005718 Bacteria 1216
282 Ga0068861_100006706 3300005719 Bacteria 7868
283 Ga0068861_100011826 3300005719 Bacteria 6074
284 Ga0068861_100065336 3300005719 Bacteria 2802
285 Ga0068861_101294117 3300005719 Bacteria 709
286 Ga0068851_10045937 3300005834 Bacteria 2208
287 Ga0068851_10077405 3300005834 Bacteria 1731
288 Ga0068851_10132817 3300005834 Bacteria 1347
289 Ga0068851_10160215 3300005834 Bacteria 1236
290 Ga0068851_10678497 3300005834 Bacteria 633
291 Ga0068851_11107248 3300005834 Bacteria 503
292 Ga0068870_10156643 3300005840 Bacteria 1347
293 Ga0068870_10317538 3300005840 Bacteria 989
294 Ga0068870_10645284 3300005840 Bacteria 724
295 Ga0068870_10879111 3300005840 Bacteria 632
296 Ga0068870_11017869 3300005840 Bacteria 592
297 Ga0068863_100001141 3300005841 Bacteria 26504
298 Ga0068863_100010494 3300005841 Bacteria 9002
299 Ga0068863_100207098 3300005841 Bacteria 1888
300 Ga0068863_100271550 3300005841 Bacteria 1641
301 Ga0068863_100288882 3300005841 Bacteria 1589
302 Ga0068863_100491709 3300005841 Bacteria 1207
303 Ga0068863_100507872 3300005841 Bacteria 1187
304 Ga0068863_101332759 3300005841 Bacteria 725
305 Ga0068863_101716211 3300005841 Bacteria 638
306 Ga0068863_102285774 3300005841 Bacteria 550
307 Ga0068858_100000259 3300005842 Bacteria 56570
308 Ga0068858_100056525 3300005842 Bacteria 3626
309 Ga0068858_100435158 3300005842 Bacteria 1263
310 Ga0068858_100472602 3300005842 Bacteria 1209
311 Ga0068858_100619547 3300005842 Bacteria 1050
312 Ga0068858_101583262 3300005842 Bacteria 646
313 Ga0068860_100031504 3300005843 Bacteria 5097
314 Ga0068860_100048517 3300005843 Bacteria 4047
315 Ga0068860_100120719 3300005843 Bacteria 2510
316 Ga0068860_100446547 3300005843 Bacteria 1285
317 Ga0068860_100620520 3300005843 Bacteria 1088
318 Ga0068860_100647217 3300005843 Bacteria 1065
319 Ga0068860_101431122 3300005843 Bacteria 713
320 Ga0068862_100060510 3300005844 Bacteria 3253
321 Ga0068862_100065510 3300005844 Bacteria 3129
322 Ga0068862_100281501 3300005844 Bacteria 1524
323 Ga0068862_100807123 3300005844 Bacteria 917
324 Ga0068862_100913861 3300005844 Bacteria 863
325 Ga0068862_101123099 3300005844 Bacteria 782
326 Ga0075365_10096479 3300006038 Bacteria 2020
327 Ga0075365_10753128 3300006038 Bacteria 688
328 Ga0075368_10032256 3300006042 Bacteria 2034
329 Ga0075368_10040488 3300006042 Bacteria 1830
330 Ga0075363_100151243 3300006048 Bacteria 1310
331 Ga0075363_100234652 3300006048 Bacteria 1054
332 Ga0075364_10093210 3300006051 Bacteria 2000
333 Ga0075432_10085198 3300006058 Bacteria 1150
334 Ga0070715_10484768 3300006163 Bacteria 705
335 Ga0075362_10109550 3300006177 Bacteria 1299
336 Ga0075362_10112124 3300006177 Bacteria 1284
337 Ga0075362_10377743 3300006177 Bacteria 712
338 Ga0075362_10680226 3300006177 Bacteria 536
339 Ga0075362_10711960 3300006177 Bacteria 524
340 Ga0075367_10030819 3300006178 Bacteria 3077
341 Ga0075367_10070169 3300006178 Bacteria 2105
342 Ga0075367_10101024 3300006178 Bacteria 1763
343 Ga0075367_10295551 3300006178 Bacteria 1019
344 Ga0075369_10035715 3300006186 Bacteria 2113
345 Ga0075369_10053081 3300006186 Bacteria 1758
346 Ga0075369_10443126 3300006186 Bacteria 614
347 Ga0075366_10001728 3300006195 Bacteria 10989
348 Ga0075366_10029122 3300006195 Bacteria 3243
349 Ga0075366_10052841 3300006195 Bacteria 2414
350 Ga0075366_10155127 3300006195 Bacteria 1387
351 Ga0075366_10163695 3300006195 Bacteria 1348
352 Ga0075366_10184230 3300006195 Bacteria 1268
353 Ga0075366_10200269 3300006195 Bacteria 1214
354 Ga0075366_10386666 3300006195 Bacteria 861
355 Ga0075366_10461532 3300006195 Bacteria 784
356 Ga0075366_10631272 3300006195 Bacteria 664
357 Ga0097621_100004806 3300006237 Bacteria 9459
358 Ga0097621_100012924 3300006237 Bacteria 6204
359 Ga0097621_100018962 3300006237 Bacteria 5272
360 Ga0097621_100074567 3300006237 Bacteria 2810
361 Ga0097621_100458396 3300006237 Bacteria 1149
362 Ga0097621_100834024 3300006237 Bacteria 856
363 Ga0097621_100881830 3300006237 Bacteria 832
364 Ga0097621_100940208 3300006237 Bacteria 806
365 Ga0075370_10006917 3300006353 Bacteria 5745
366 Ga0075370_10011994 3300006353 Bacteria 4568
367 Ga0075370_10029181 3300006353 Bacteria 3071
368 Ga0075370_10029651 3300006353 Bacteria 3048
369 Ga0075370_10032930 3300006353 Bacteria 2900
370 Ga0075370_10057682 3300006353 Bacteria 2207
371 Ga0075370_10233950 3300006353 Bacteria 1087
372 Ga0075370_10381496 3300006353 Bacteria 844
373 Ga0075370_10843060 3300006353 Bacteria 559
374 Ga0068871_100005787 3300006358 Bacteria 8684
375 Ga0068871_100013396 3300006358 Bacteria 6084
376 Ga0068871_100180950 3300006358 Bacteria 1811
377 Ga0068871_100335857 3300006358 Bacteria 1333
378 Ga0068871_101348847 3300006358 Bacteria 671
379 Ga0068871_101474077 3300006358 Bacteria 642
380 Ga0075430_101699021 3300006846 Bacteria 518
381 Ga0068865_100054762 3300006881 Bacteria 2773
382 Ga0068865_100217594 3300006881 Bacteria 1492
383 Ga0068865_100259807 3300006881 Bacteria 1374
384 Ga0068865_100340111 3300006881 Bacteria 1213
385 Ga0068865_100581052 3300006881 Bacteria 944
386 Ga0097620_100100703 3300006931 Bacteria 2945
387 Ga0097620_100151853 3300006931 Bacteria 2391
388 Ga0097620_100658915 3300006931 Bacteria 1139
389 Ga0097620_102193390 3300006931 Bacteria 609
390 Ga0099824_1052367 3300006942 Bacteria 737
391 Ga0099823_1000003 3300006944 Bacteria 189058
392 Ga0079104_1000009 3300006946 Bacteria 367015
393 Ga0105244_10316941 3300009036 Bacteria 720
394 Ga0105250_10520863 3300009092 Bacteria 542
395 Ga0105240_11260290 3300009093 Bacteria 781
396 Ga0105240_11408338 3300009093 Bacteria 733
397 Ga0111539_11836921 3300009094 Bacteria 703
398 Ga0111539_12240810 3300009094 Bacteria 634
399 Ga0105245_10554247 3300009098 Bacteria 1172
400 Ga0105243_10364805 3300009148 Bacteria 1331
401 Ga0105243_11509329 3300009148 Bacteria 696
402 Ga0105243_11798883 3300009148 Bacteria 644
403 Ga0105243_12962686 3300009148 Bacteria 515
404 Ga0105243_13125384 3300009148 Bacteria 501
405 Ga0105241_10272826 3300009174 Bacteria 1442
406 Ga0105241_11217970 3300009174 Bacteria 714
407 Ga0105242_10013753 3300009176 Bacteria 6263
408 Ga0105242_11641046 3300009176 Bacteria 678
409 Ga0105242_12479464 3300009176 Bacteria 567
410 Ga0105248_10028131 3300009177 Bacteria 6261
411 Ga0105248_10042274 3300009177 Bacteria 5111
412 Ga0105248_10206255 3300009177 Bacteria 2215
413 Ga0105248_10286139 3300009177 Bacteria 1856
414 Ga0105248_10563000 3300009177 Bacteria 1286
415 Ga0105248_10880348 3300009177 Bacteria 1011
416 Ga0105248_11098229 3300009177 Bacteria 899
417 Ga0105248_11414358 3300009177 Bacteria 787
418 Ga0105237_10041408 3300009545 Bacteria 4645
419 Ga0105237_11637547 3300009545 Bacteria 651
420 Ga0105238_10058508 3300009551 Bacteria 3863
421 Ga0105238_10623624 3300009551 Bacteria 1087
422 Ga0105238_11658774 3300009551 Bacteria 670
423 Ga0105238_11841186 3300009551 Bacteria 638
424 Ga0105238_11890695 3300009551 Bacteria 630
425 Ga0105249_10008180 3300009553 Bacteria 9116
426 Ga0105249_10016884 3300009553 Bacteria 6478
427 Ga0105249_11120382 3300009553 Bacteria 857
428 Ga0105249_11585481 3300009553 Bacteria 727
429 Ga0105239_10085568 3300010375 Bacteria 3475
430 Ga0105239_10277231 3300010375 Bacteria 1887
431 Ga0105246_10682207 3300011119 Bacteria 898
432 Ga0157317_1000186 3300012475 Bacteria 2176
433 Ga0157319_1000002 3300012497 Bacteria 410803
434 Ga0157314_1008272 3300012500 Bacteria 856
435 Ga0157338_1018411 3300012515 Bacteria 791
436 Ga0157373_10124484 3300013100 Bacteria 1813
437 Ga0157371_10042098 3300013102 Bacteria 3256
438 Ga0157371_10229125 3300013102 Bacteria 1335
439 Ga0157371_11542036 3300013102 Bacteria 519
440 Ga0157370_11307137 3300013104 Bacteria 653
441 Ga0157370_11798996 3300013104 Bacteria 550
442 Ga0157370_12071504 3300013104 Bacteria 510
443 Ga0157369_10002529 3300013105 Bacteria 21858
444 Ga0157369_11424531 3300013105 Bacteria 705
445 Ga0157374_10015370 3300013296 Bacteria 6713
446 Ga0157374_10037388 3300013296 Bacteria 4455
447 Ga0157374_10346616 3300013296 Bacteria 1475
448 Ga0157374_10477754 3300013296 Bacteria 1249
449 Ga0157378_10402459 3300013297 Bacteria 1349
450 Ga0163162_10019201 3300013306 Bacteria 6702
451 Ga0163162_10118418 3300013306 Bacteria 2750
452 Ga0163162_10181851 3300013306 Bacteria 2229
453 Ga0163162_10384122 3300013306 Bacteria 1537
454 Ga0163162_10794400 3300013306 Bacteria 1064
455 Ga0163162_10897855 3300013306 Bacteria 999
456 Ga0163162_12311543 3300013306 Bacteria 618
457 Ga0157372_10008954 3300013307 Bacteria 10636
458 Ga0157372_10095594 3300013307 Bacteria 3385
459 Ga0157372_11348096 3300013307 Bacteria 823
460 Ga0157372_11559918 3300013307 Bacteria 760
461 Ga0157375_10003085 3300013308 Bacteria 14462
462 Ga0157375_10054149 3300013308 Bacteria 3951
463 Ga0157375_10115460 3300013308 Bacteria 2787
464 Ga0157375_10772242 3300013308 Bacteria 1111
465 Ga0157375_10919768 3300013308 Bacteria 1018
466 Ga0157375_11153051 3300013308 Bacteria 908
467 Ga0157375_13758463 3300013308 Bacteria 504
468 Ga0163163_10129271 3300014325 Bacteria 2566
469 Ga0163163_10443619 3300014325 Bacteria 1358
470 Ga0163163_10663707 3300014325 Bacteria 1106
471 Ga0163163_12002836 3300014325 Bacteria 639
472 Ga0163163_12632753 3300014325 Bacteria 560
473 Ga0163163_13048771 3300014325 Bacteria 522
474 Ga0157380_10079211 3300014326 Bacteria 2683
475 Ga0157380_10092961 3300014326 Bacteria 2493
476 Ga0157380_10675391 3300014326 Bacteria 1034
477 Ga0157380_10868749 3300014326 Bacteria 925
478 Ga0157380_13534103 3300014326 Bacteria 501
479 Ga0157377_10401551 3300014745 Bacteria 933
480 Ga0157379_10017047 3300014968 Bacteria 6395
481 Ga0157379_10041700 3300014968 Bacteria 4097
482 Ga0157379_10042358 3300014968 Bacteria 4065
483 Ga0157379_10133470 3300014968 Bacteria 2236
484 Ga0157379_10527442 3300014968 Bacteria 1097
485 Ga0157376_10014509 3300014969 Bacteria 5917
486 Ga0157376_10062388 3300014969 Bacteria 3136
487 Ga0157376_10073392 3300014969 Bacteria 2913
488 Ga0157376_10272779 3300014969 Bacteria 1590
489 Ga0182006_1205986 3300015261 Bacteria 651
490 Ga0163161_10016875 3300017792 Bacteria 5103
491 Ga0163161_10075187 3300017792 Bacteria 2478
492 Ga0163161_10181529 3300017792 Bacteria 1614
493 Ga0163161_10260221 3300017792 Bacteria 1355
494 Ga0163161_11754518 3300017792 Bacteria 551
495 Ga0213872_10000211 3300021361 Bacteria 51730
496 Ga0213874_10023839 3300021377 Bacteria 1711
497 Ga0213876_10046569 3300021384 Bacteria 2293
498 Ga0209258_106366 3300025242 Bacteria 1860
499 Ga0209565_1012512 3300025263 Bacteria 2021
500 Ga0209673_1003399 3300025273 Bacteria 9436
501 Ga0209673_1051533 3300025273 Bacteria 1085
502 Ga0209675_1009399 3300025291 Bacteria 3460
503 Ga0209564_1000229 3300025295 Bacteria 125047
504 Ga0209050_1000246 3300025298 Bacteria 116721
505 Ga0209050_1016802 3300025298 Bacteria 2966
506 Ga0209050_1060364 3300025298 Bacteria 899
507 Ga0209256_1000019 3300025299 Bacteria 558627
508 Ga0209256_1000072 3300025299 Bacteria 239812
509 Ga0209256_1004519 3300025299 Bacteria 8681
510 Ga0209051_1000004 3300025303 Bacteria 1155596
511 Ga0209051_1001942 3300025303 Bacteria 15920
512 Ga0209051_1136781 3300025303 Bacteria 596
513 Ga0209257_1000038 3300025304 Bacteria 609032
514 Ga0209257_1000044 3300025304 Bacteria 486709
515 Ga0209257_1000385 3300025304 Bacteria 88117
516 Ga0209257_1001796 3300025304 Bacteria 23562
517 Ga0209257_1008778 3300025304 Bacteria 5617
518 Ga0207656_10095821 3300025321 Bacteria 1354
519 Ga0207656_10261619 3300025321 Bacteria 850
520 Ga0207656_10568260 3300025321 Bacteria 578
521 Ga0207653_10421378 3300025885 Bacteria 524
522 Ga0207682_10012060 3300025893 Bacteria 3375
523 Ga0207682_10186938 3300025893 Bacteria 948
524 Ga0207682_10275583 3300025893 Bacteria 786
525 Ga0207682_10314062 3300025893 Bacteria 736
526 Ga0207682_10555219 3300025893 Bacteria 543
527 Ga0207642_10121417 3300025899 Bacteria 1348
528 Ga0207642_10638210 3300025899 Bacteria 666
529 Ga0207688_10030759 3300025901 Bacteria 2961
530 Ga0207688_10582553 3300025901 Bacteria 704
531 Ga0207688_10716116 3300025901 Bacteria 633
532 Ga0207680_10263175 3300025903 Bacteria 1194
533 Ga0207680_10280727 3300025903 Bacteria 1157
534 Ga0207680_11175949 3300025903 Bacteria 547
535 Ga0207647_10454839 3300025904 Bacteria 717
536 Ga0207685_10196175 3300025905 Bacteria 945
537 Ga0207645_10035303 3300025907 Bacteria 3210
538 Ga0207645_10042617 3300025907 Bacteria 2904
539 Ga0207645_10283491 3300025907 Bacteria 1100
540 Ga0207645_10317180 3300025907 Bacteria 1039
541 Ga0207645_10576488 3300025907 Bacteria 764
542 Ga0207643_10026655 3300025908 Bacteria 3200
543 Ga0207643_10637350 3300025908 Bacteria 687
544 Ga0207643_10639793 3300025908 Bacteria 686
545 Ga0207643_11150028 3300025908 Bacteria 500
546 Ga0207705_10061289 3300025909 Bacteria 2717
547 Ga0207705_10311029 3300025909 Bacteria 1209
548 Ga0207705_11288080 3300025909 Bacteria 558
549 Ga0207684_10004630 3300025910 Bacteria 12912
550 Ga0207654_10161056 3300025911 Bacteria 1450
551 Ga0207707_10073153 3300025912 Bacteria 2988
552 Ga0207695_10250268 3300025913 Bacteria 1671
553 Ga0207695_11149153 3300025913 Bacteria 656
554 Ga0207671_10017203 3300025914 Bacteria 5585
555 Ga0207660_10060825 3300025917 Bacteria 2717
556 Ga0207662_10113501 3300025918 Bacteria 1692
557 Ga0207662_10181173 3300025918 Bacteria 1356
558 Ga0207657_10092016 3300025919 Bacteria 2528
559 Ga0207657_10300745 3300025919 Bacteria 1271
560 Ga0207657_10502183 3300025919 Bacteria 950
561 Ga0207657_11004917 3300025919 Bacteria 640
562 Ga0207649_10002033 3300025920 Bacteria 11512
563 Ga0207649_10511011 3300025920 Bacteria 915
564 Ga0207649_10552236 3300025920 Bacteria 881
565 Ga0207649_10581904 3300025920 Bacteria 859
566 Ga0207649_11385791 3300025920 Bacteria 556
567 Ga0207652_10006365 3300025921 Bacteria 9535
568 Ga0207652_10567489 3300025921 Bacteria 1019
569 Ga0207652_11006912 3300025921 Bacteria 732
570 Ga0207646_10133400 3300025922 Bacteria 2236
571 Ga0207681_10001527 3300025923 Bacteria 14917
572 Ga0207681_10039148 3300025923 Bacteria 3145
573 Ga0207681_10286602 3300025923 Bacteria 1298
574 Ga0207681_11033633 3300025923 Bacteria 690
575 Ga0207681_11367583 3300025923 Bacteria 594
576 Ga0207694_10015626 3300025924 Bacteria 5726
577 Ga0207694_11151574 3300025924 Bacteria 656
578 Ga0207694_11516164 3300025924 Bacteria 566
579 Ga0207694_11526959 3300025924 Bacteria 563
580 Ga0207650_10012223 3300025925 Bacteria 5924
581 Ga0207650_10075854 3300025925 Bacteria 2539
582 Ga0207650_10121643 3300025925 Bacteria 2033
583 Ga0207650_10176777 3300025925 Bacteria 1699
584 Ga0207650_10244739 3300025925 Bacteria 1450
585 Ga0207650_10996471 3300025925 Bacteria 713
586 Ga0207650_11008863 3300025925 Bacteria 708
587 Ga0207650_11334132 3300025925 Bacteria 610
588 Ga0207659_10001630 3300025926 Bacteria 13323
589 Ga0207659_10010794 3300025926 Bacteria 5749
590 Ga0207659_10105131 3300025926 Bacteria 2136
591 Ga0207659_10158022 3300025926 Bacteria 1777
592 Ga0207659_10261462 3300025926 Bacteria 1408
593 Ga0207687_10008433 3300025927 Bacteria 6739
594 Ga0207687_10077309 3300025927 Bacteria 2393
595 Ga0207687_11701710 3300025927 Bacteria 541
596 Ga0207687_11707794 3300025927 Bacteria 540
597 Ga0207644_10000042 3300025931 Bacteria 112685
598 Ga0207644_10054871 3300025931 Bacteria 2870
599 Ga0207644_10163644 3300025931 Bacteria 1731
600 Ga0207644_10246026 3300025931 Bacteria 1425
601 Ga0207644_10976995 3300025931 Bacteria 710
602 Ga0207644_11749109 3300025931 Bacteria 520
603 Ga0207690_10008281 3300025932 Bacteria 6167
604 Ga0207690_10509942 3300025932 Bacteria 974
605 Ga0207690_10745156 3300025932 Bacteria 807
606 Ga0207690_11652560 3300025932 Bacteria 535
607 Ga0207706_10005001 3300025933 Bacteria 12380
608 Ga0207706_10005687 3300025933 Bacteria 11610
609 Ga0207706_10026753 3300025933 Bacteria 5164
610 Ga0207706_10067926 3300025933 Bacteria 3137
611 Ga0207706_10138168 3300025933 Bacteria 2144
612 Ga0207706_10379379 3300025933 Bacteria 1227
613 Ga0207706_11369876 3300025933 Bacteria 582
614 Ga0207686_10325134 3300025934 Bacteria 1150
615 Ga0207686_10330696 3300025934 Bacteria 1141
616 Ga0207686_10408659 3300025934 Bacteria 1036
617 Ga0207709_10386814 3300025935 Bacteria 1066
618 Ga0207709_10646511 3300025935 Bacteria 842
619 Ga0207709_10680611 3300025935 Bacteria 822
620 Ga0207709_10689438 3300025935 Bacteria 817
621 Ga0207709_11578893 3300025935 Bacteria 545
622 Ga0207670_10727338 3300025936 Bacteria 823
623 Ga0207669_10974537 3300025937 Bacteria 711
624 Ga0207669_11693468 3300025937 Bacteria 540
625 Ga0207704_10180766 3300025938 Bacteria 1524
626 Ga0207704_10353622 3300025938 Bacteria 1145
627 Ga0207704_11218645 3300025938 Bacteria 642
628 Ga0207665_10096334 3300025939 Bacteria 2058
629 Ga0207691_10013989 3300025940 Bacteria 7656
630 Ga0207691_10086275 3300025940 Bacteria 2816
631 Ga0207691_10087701 3300025940 Bacteria 2792
632 Ga0207691_10093639 3300025940 Bacteria 2689
633 Ga0207691_10112255 3300025940 Bacteria 2423
634 Ga0207691_10113757 3300025940 Bacteria 2405
635 Ga0207691_10148946 3300025940 Bacteria 2058
636 Ga0207691_10208529 3300025940 Bacteria 1698
637 Ga0207691_10507322 3300025940 Bacteria 1024
638 Ga0207691_10511258 3300025940 Bacteria 1020
639 Ga0207711_10003933 3300025941 Bacteria 12779
640 Ga0207711_10033806 3300025941 Bacteria 4328
641 Ga0207711_10156494 3300025941 Bacteria 2060
642 Ga0207711_10196560 3300025941 Bacteria 1839
643 Ga0207711_10263223 3300025941 Bacteria 1585
644 Ga0207711_10290088 3300025941 Bacteria 1508
645 Ga0207711_10410320 3300025941 Bacteria 1259
646 Ga0207711_10482421 3300025941 Bacteria 1155
647 Ga0207711_10642204 3300025941 Bacteria 990
648 Ga0207689_10002895 3300025942 Bacteria 15837
649 Ga0207689_10034592 3300025942 Bacteria 4196
650 Ga0207689_10182281 3300025942 Bacteria 1731
651 Ga0207689_10185674 3300025942 Bacteria 1715
652 Ga0207689_10573459 3300025942 Bacteria 948
653 Ga0207661_10919929 3300025944 Bacteria 805
654 Ga0207679_10071379 3300025945 Bacteria 2619
655 Ga0207679_10307546 3300025945 Bacteria 1368
656 Ga0207679_10364340 3300025945 Bacteria 1263
657 Ga0207679_10379413 3300025945 Bacteria 1239
658 Ga0207679_10432498 3300025945 Bacteria 1164
659 Ga0207679_10450536 3300025945 Bacteria 1141
660 Ga0207679_10629805 3300025945 Bacteria 969
661 Ga0207679_10999529 3300025945 Bacteria 767
662 Ga0207667_10902073 3300025949 Bacteria 876
663 Ga0207651_10170129 3300025960 Bacteria 1717
664 Ga0207651_10209051 3300025960 Bacteria 1569
665 Ga0207651_10354218 3300025960 Bacteria 1237
666 Ga0207651_10436994 3300025960 Bacteria 1120
667 Ga0207651_10514551 3300025960 Bacteria 1036
668 Ga0207651_10666144 3300025960 Bacteria 914
669 Ga0207651_10775515 3300025960 Bacteria 849
670 Ga0207651_11396709 3300025960 Bacteria 630
671 Ga0207651_11757787 3300025960 Bacteria 558
672 Ga0207712_10082265 3300025961 Bacteria 2347
673 Ga0207712_10434957 3300025961 Bacteria 1110
674 Ga0207712_11143249 3300025961 Bacteria 694
675 Ga0207712_11276954 3300025961 Bacteria 656
676 Ga0207668_10100445 3300025972 Bacteria 2148
677 Ga0207668_10101101 3300025972 Bacteria 2142
678 Ga0207668_10474314 3300025972 Bacteria 1072
679 Ga0207668_11976703 3300025972 Bacteria 525
680 Ga0207640_10020844 3300025981 Bacteria 3896
681 Ga0207640_10296935 3300025981 Bacteria 1276
682 Ga0207640_10368080 3300025981 Bacteria 1160
683 Ga0207640_10495554 3300025981 Bacteria 1016
684 Ga0207658_10005557 3300025986 Bacteria 8628
685 Ga0207658_10013827 3300025986 Bacteria 5522
686 Ga0207658_10041532 3300025986 Bacteria 3331
687 Ga0207658_10844757 3300025986 Bacteria 832
688 Ga0207658_10927550 3300025986 Bacteria 793
689 Ga0207658_11274281 3300025986 Bacteria 672
690 Ga0207677_10028291 3300026023 Bacteria 3542
691 Ga0207677_10030155 3300026023 Bacteria 3458
692 Ga0207677_10104794 3300026023 Bacteria 2091
693 Ga0207677_10164116 3300026023 Bacteria 1729
694 Ga0207677_11622288 3300026023 Bacteria 599
695 Ga0207677_12103329 3300026023 Bacteria 525
696 Ga0207703_10001748 3300026035 Bacteria 19439
697 Ga0207703_10007108 3300026035 Bacteria 8907
698 Ga0207703_10020187 3300026035 Bacteria 5210
699 Ga0207703_10124604 3300026035 Bacteria 2216
700 Ga0207703_10488216 3300026035 Bacteria 1155
701 Ga0207703_11007532 3300026035 Bacteria 799
702 Ga0207703_12034965 3300026035 Bacteria 550
703 Ga0207639_10030055 3300026041 Bacteria 3982
704 Ga0207639_10183239 3300026041 Bacteria 1783
705 Ga0207639_10199709 3300026041 Bacteria 1714
706 Ga0207639_11242500 3300026041 Bacteria 699
707 Ga0207639_11597682 3300026041 Bacteria 612
708 Ga0207678_10003767 3300026067 Bacteria 13637
709 Ga0207678_10018029 3300026067 Bacteria 6202
710 Ga0207678_10420686 3300026067 Bacteria 1159
711 Ga0207678_11075367 3300026067 Bacteria 712
712 Ga0207678_11816775 3300026067 Bacteria 533
713 Ga0207708_10238106 3300026075 Bacteria 1463
714 Ga0207708_10545729 3300026075 Bacteria 977
715 Ga0207702_10004875 3300026078 Bacteria 11814
716 Ga0207702_10162793 3300026078 Bacteria 2039
717 Ga0207702_10619397 3300026078 Bacteria 1063
718 Ga0207702_10973022 3300026078 Bacteria 842
719 Ga0207702_11899300 3300026078 Bacteria 587
720 Ga0207641_10016191 3300026088 Bacteria 6106
721 Ga0207641_10020236 3300026088 Bacteria 5464
722 Ga0207641_10027686 3300026088 Bacteria 4682
723 Ga0207641_10043194 3300026088 Bacteria 3784
724 Ga0207641_10244794 3300026088 Bacteria 1672
725 Ga0207641_10249076 3300026088 Bacteria 1658
726 Ga0207641_10289757 3300026088 Bacteria 1543
727 Ga0207641_10447897 3300026088 Bacteria 1247
728 Ga0207641_11799220 3300026088 Bacteria 614
729 Ga0207648_10019721 3300026089 Bacteria 6083
730 Ga0207648_10029021 3300026089 Bacteria 4905
731 Ga0207648_10053971 3300026089 Bacteria 3511
732 Ga0207648_10146863 3300026089 Bacteria 2080
733 Ga0207648_10158812 3300026089 Bacteria 1996
734 Ga0207648_10336740 3300026089 Bacteria 1358
735 Ga0207648_10781787 3300026089 Bacteria 888
736 Ga0207648_11699060 3300026089 Bacteria 593
737 Ga0207676_10000660 3300026095 Bacteria 27633
738 Ga0207676_10023252 3300026095 Bacteria 4569
739 Ga0207676_10028649 3300026095 Bacteria 4162
740 Ga0207676_10121175 3300026095 Bacteria 2206
741 Ga0207676_10231393 3300026095 Bacteria 1652
742 Ga0207676_10287685 3300026095 Bacteria 1495
743 Ga0207676_10313279 3300026095 Bacteria 1437
744 Ga0207676_11684430 3300026095 Bacteria 632
745 Ga0207674_10014711 3300026116 Bacteria 8629
746 Ga0207674_10018509 3300026116 Bacteria 7570
747 Ga0207674_10037010 3300026116 Bacteria 5079
748 Ga0207674_10825990 3300026116 Bacteria 894
749 Ga0207675_100003221 3300026118 Bacteria 16017
750 Ga0207675_100019157 3300026118 Bacteria 6387
751 Ga0207675_100104404 3300026118 Bacteria 2671
752 Ga0207683_10047843 3300026121 Bacteria 3745
753 Ga0207683_10070308 3300026121 Bacteria 3092
754 Ga0207683_10178407 3300026121 Bacteria 1926
755 Ga0207683_10407713 3300026121 Bacteria 1251
756 Ga0207683_10447901 3300026121 Bacteria 1190
757 Ga0207683_11032758 3300026121 Bacteria 763
758 Ga0207683_11887413 3300026121 Bacteria 546
759 Ga0207698_10002589 3300026142 Bacteria 10755
760 Ga0207698_10030656 3300026142 Bacteria 3871
761 Ga0207698_10048051 3300026142 Bacteria 3237
762 Ga0207698_10275652 3300026142 Bacteria 1553
763 Ga0207698_11414492 3300026142 Bacteria 711
764 Ga0207698_11533569 3300026142 Bacteria 682
765 Ga0207698_11646563 3300026142 Bacteria 657
766 Ga0207698_11676086 3300026142 Bacteria 651
767 Ga0207698_11863146 3300026142 Bacteria 616
768 Ga0207698_12199648 3300026142 Bacteria 564
769 Ga0209281_1000023 3300027111 Bacteria 519955
770 Ga0209389_1033766 3300027296 Bacteria 4208
771 Ga0209371_1036352 3300027312 Bacteria 1030
772 Ga0209813_10009482 3300027866 Bacteria 2491
773 Ga0209813_10073825 3300027866 Bacteria 1114
774 Ga0207428_11165531 3300027907 Bacteria 537
775 Ga0268266_11978636 3300028379 Bacteria 556
776 Ga0268265_10077470 3300028380 Bacteria 2611
777 Ga0268265_10109496 3300028380 Bacteria 2251
778 Ga0268265_10600875 3300028380 Bacteria 1051
779 Ga0268265_10743641 3300028380 Bacteria 951
780 Ga0268265_11307156 3300028380 Bacteria 725
781 Ga0268264_10006446 3300028381 Bacteria 9879
782 Ga0268264_10067766 3300028381 Bacteria 3013
783 Ga0268264_10363049 3300028381 Bacteria 1382
784 Ga0268264_10564191 3300028381 Bacteria 1118
785 Ga0268264_10680355 3300028381 Bacteria 1020
786 Ga0268264_11997984 3300028381 Bacteria 589
787 Ga0307517_10074242 3300028786 Bacteria 3002
788 Ga0307517_10173931 3300028786 Bacteria 1408
789 Ga0307517_10267130 3300028786 Bacteria 987
790 Ga0307515_10000013 3300028794 Bacteria 568456
791 Ga0307515_10000037 3300028794 Bacteria 331970
792 Ga0307515_10105571 3300028794 Bacteria 3352
793 Ga0307515_10105752 3300028794 Bacteria 3347
794 Ga0307515_10409874 3300028794 Bacteria 978
795 Ga0307515_10591478 3300028794 Bacteria 720
796 Ga0268256_1044252 3300030500 Bacteria 977
797 Ga0307512_10175569 3300030522 Bacteria 1217
798 Ga0265316_10000180 3300031344 Bacteria 71764
799 Ga0307513_10754781 3300031456 Bacteria 678
800 Ga0307513_10762378 3300031456 Bacteria 673
801 Ga0307509_10861347 3300031507 Bacteria 571
802 Ga0307408_100014492 3300031548 Bacteria 5238
803 Ga0307408_100059178 3300031548 Bacteria 2788
804 Ga0307408_100430249 3300031548 Bacteria 1140
805 Ga0307408_100724192 3300031548 Bacteria 896
806 Ga0307508_10517386 3300031616 Bacteria 789
807 Ga0307514_10000533 3300031649 Bacteria 74078
808 Ga0307516_10004112 3300031730 Bacteria 18151
809 Ga0307516_10847704 3300031730 Bacteria 577
810 Ga0307405_10026040 3300031731 Bacteria 3368
811 Ga0307405_10041390 3300031731 Bacteria 2796
812 Ga0307405_11477972 3300031731 Bacteria 596
813 Ga0307413_10030250 3300031824 Bacteria 3040
814 Ga0307413_10324676 3300031824 Bacteria 1177
815 Ga0307410_10005676 3300031852 Bacteria 6639
816 Ga0307410_10484526 3300031852 Bacteria 1015
817 Ga0307406_10002787 3300031901 Bacteria 9539
818 Ga0307406_10236256 3300031901 Bacteria 1368
819 Ga0307407_10095579 3300031903 Bacteria 1832
820 Ga0307407_10422176 3300031903 Bacteria 961
821 Ga0307407_11078698 3300031903 Bacteria 623
822 Ga0307412_10053728 3300031911 Bacteria 2671
823 Ga0307412_10105704 3300031911 Bacteria 2000
824 Ga0307412_11063416 3300031911 Bacteria 718
825 Ga0307409_100036556 3300031995 Bacteria 3611
826 Ga0307409_100561838 3300031995 Bacteria 1122
827 Ga0307409_101671358 3300031995 Bacteria 665
828 Ga0307416_100231616 3300032002 Bacteria 1781
829 Ga0307416_101029015 3300032002 Bacteria 927
830 Ga0307416_101076444 3300032002 Bacteria 908
831 Ga0307416_101546051 3300032002 Bacteria 769
832 Ga0307416_103051478 3300032002 Bacteria 560
833 Ga0307414_10888069 3300032004 Bacteria 817
834 Ga0307411_10004113 3300032005 Bacteria 6903
835 Ga0307411_10008760 3300032005 Bacteria 5264
836 Ga0307411_10125064 3300032005 Bacteria 1868
837 Ga0307411_10743827 3300032005 Bacteria 858
838 Ga0307411_11304475 3300032005 Bacteria 661
839 Ga0307415_100001187 3300032126 Bacteria 12187
840 Ga0307510_10256422 3300033180 Bacteria 1233
841 Ga0373948_0017056 3300034817 Bacteria 1349
842 Ga0373950_0010239 3300034818 Bacteria 1511
843 Ga0373940_0000136 3300035088 Bacteria 9391
844 Ga0373944_0040391 3300035089 Bacteria 1440
845 Ga0373944_0183056 3300035089 Bacteria 752
846 Ga0373949_0095761 3300035090 Bacteria 808
847 Ga0373939_0000059 3300035114 Bacteria 38006
848 Ga0373941_0041699 3300035115 Bacteria 1422
849 Ga0373945_0131295 3300035116 Bacteria 1004
850 Ga0373945_0311832 3300035116 Bacteria 676
851 Ga0373956_0432069 3300035119 Bacteria 629
852 Ga0373957_0062678 3300035120 Bacteria 1443
853 Ga0373960_0001178 3300035121 Bacteria 5698
854 Ga0373960_0234561 3300035121 Bacteria 661
855 Ga0373955_0688087 3300035172 Bacteria 627
856 Ga0373962_0018166 3300035242 Bacteria 1828
857 Ga0373924_0038467 3300035410 Bacteria 1952
858 Ga0373931_0000334 3300035691 Bacteria 19574
859 Ga0373931_0001033 3300035691 Bacteria 11770
860 Ga0373935_0259327 3300035692 Bacteria 1219
861 Ga0373935_0330311 3300035692 Bacteria 1084
862 Ga0373935_1141289 3300035692 Bacteria 580
863 Ga0373927_0075418 3300035695 Bacteria 2184
864 Ga0373927_0496591 3300035695 Bacteria 806
865 Ga0373933_0169041 3300035724 Bacteria 1391
866 Ga0373947_0045257 3300035725 Bacteria 2633
867 Ga0373947_0171299 3300035725 Bacteria 1409
868 Ga0373937_0459011 3300036401 Bacteria 1210
869 Ga0373937_0769336 3300036401 Bacteria 910
870 Ga0373925_0004378 3300037068 Bacteria 10673
871 Ga0373925_0079048 3300037068 Bacteria 2498
872 Ga0373925_0271315 3300037068 Bacteria 1365
873 Ga0395900_0000387 3300037418 Bacteria 63605
874 Ga0395898_0000958 3300037466 Bacteria 45958
875 Ga0395898_0729126 3300037466 Bacteria 933
876 Ga0395905_0017509 3300037471 Bacteria 6803
877 Ga0395905_0043266 3300037471 Bacteria 4225
878 Ga0395905_0082870 3300037471 Bacteria 3005
879 Ga0395905_0212641 3300037471 Bacteria 1811
880 Ga0395905_0630520 3300037471 Bacteria 974
881 Ga0395905_0888196 3300037471 Bacteria 794
882 Ga0395905_1415934 3300037471 Bacteria 599
883 Ga0436364_0410954 3300037853 Bacteria 785
884 Ga0436364_0677523 3300037853 Bacteria 682
885 Ga0436365_0312685 3300039437 Bacteria 4619
886 Ga0436360_1262653 3300039438 Bacteria 1764
887 Ga0436361_0019501 3300039447 Bacteria 28508
888 Ga0436361_1031544 3300039447 Bacteria 8114
889 Ga0436361_1220274 3300039447 Bacteria 48509
890 Ga0436363_0126290 3300039450 Bacteria 503
891 Ga0436363_1209952 3300039450 Bacteria 2781
892 Ga0436362_0064679 3300039453 Bacteria 657
893 Ga0439453_0092932 3300041408 Bacteria 664
894 Ga0439461_0066004 3300041410 Bacteria 830
895 Ga0439465_0042070 3300041413 Bacteria 1480
896 Ga0451789_0529892 3300041443 Bacteria 609
897 Ga0451791_0898320 3300041451 Bacteria 695
898 Ga0451793_1409532 3300041452 Bacteria 924
899 Ga0451795_1063439 3300041456 Bacteria 520
900 Ga0451798_0749136 3300041458 Bacteria 558
901 Ga0451802_0239083 3300041460 Bacteria 521
902 Ga0451802_1320011 3300041460 Bacteria 638
903 Ga0451804_0191505 3300041463 Bacteria 888
904 Ga0451804_0632507 3300041463 Bacteria 508
905 Ga0451804_0639527 3300041463 Bacteria 529
906 Ga0451841_1083417 3300041498 Bacteria 619
907 Ga0451845_0298283 3300041501 Bacteria 569
908 Ga0451849_1244220 3300041505 Bacteria 710
909 Ga0451851_1153008 3300041507 Bacteria 578
910 Ga0451853_1131216 3300041512 Bacteria 791
911 Ga0451853_3130241 3300041512 Bacteria 512
912 Ga0439433_0032858 3300041999 Bacteria 1191
913 Ga0439441_170853 3300042001 Bacteria 519
914 Ga0439441_185558 3300042001 Bacteria 502
915 Ga0439445_0118230 3300042004 Bacteria 760
916 Ga0439449_0219225 3300042007 Bacteria 713
917 Ga0439450_044909 3300042008 Bacteria 1036
918 Ga0439454_076130 3300042011 Bacteria 602
919 Ga0439462_0030492 3300042015 Bacteria 1427
920 Ga0450912_020394 3300042116 Bacteria 637
921 Ga0450912_037144 3300042116 Bacteria 520
922 Ga0450917_008273 3300042120 Bacteria 803
923 Ga0450919_008293 3300042121 Bacteria 1205
924 Ga0450920_015070 3300042122 Bacteria 1467
925 Ga0450923_039264 3300042125 Bacteria 990
926 Ga0450888_001212 3300042126 Bacteria 2462
927 Ga0450890_000667 3300042127 Bacteria 4999
928 Ga0450890_009886 3300042127 Bacteria 1225
929 Ga0450891_000038 3300042129 Bacteria 9579
930 Ga0450892_002137 3300042130 Bacteria 1724
931 Ga0450896_010182 3300042133 Bacteria 1317
932 Ga0450896_013473 3300042133 Bacteria 1163
933 Ga0450899_012978 3300042135 Bacteria 938
934 Ga0450903_048854 3300042138 Bacteria 621
935 Ga0450904_014314 3300042139 Bacteria 791
936 Ga0450905_013636 3300042142 Bacteria 1153
937 Ga0450889_000077 3300042144 Bacteria 8873
938 Ga0439444_0025232 3300042437 Bacteria 1080
939 Ga0439459_0006048 3300042438 Bacteria 2006
940 Ga0439459_0135819 3300042438 Bacteria 632
941 Ga0439464_0063933 3300042439 Bacteria 1080
942 Ga0439464_0075616 3300042439 Bacteria 1001
943 Ga0450918_000994 3300042531 Bacteria 5874
944 Ga0450918_103656 3300042531 Bacteria 558
945 Ga0450893_0000835 3300042532 Bacteria 4555
946 Ga0451577_0003346 3300042876 Bacteria 17953
947 Ga0451577_0049233 3300042876 Bacteria 3763
948 Ga0466969_0000009 3300044656 Bacteria 125464
949 Ga0466969_0033505 3300044656 Bacteria 2607
950 Ga0466969_0099931 3300044656 Bacteria 1366
951 Ga0466972_0000303 3300044658 Bacteria 29316
952 Ga0466972_0017775 3300044658 Bacteria 3559
953 Ga0466972_0411468 3300044658 Bacteria 634
954 Ga0466965_0029857 3300044683 Bacteria 2654
955 Ga0466965_0054438 3300044683 Bacteria 1989
956 Ga0466965_0121033 3300044683 Bacteria 1352
957 Ga0466965_0255796 3300044683 Bacteria 940
958 Ga0466965_0365573 3300044683 Bacteria 792
959 Ga0466965_0380129 3300044683 Bacteria 777
960 Ga0466966_0006238 3300044684 Bacteria 7883
961 Ga0466966_0085141 3300044684 Bacteria 1965
962 Ga0466961_0007837 3300044693 Bacteria 6800
963 Ga0466961_0113254 3300044693 Bacteria 1705
964 Ga0466961_0120872 3300044693 Bacteria 1645
965 Ga0466961_0217368 3300044693 Bacteria 1178
966 Ga0466963_0070042 3300044694 Bacteria 2358
967 Ga0466963_0169972 3300044694 Bacteria 1519
968 Ga0466964_0008231 3300044706 Bacteria 3912
969 Ga0466964_0102018 3300044706 Bacteria 1266
970 Ga0453684_0425781 3300044712 Bacteria 1482
971 Ga0453684_0633040 3300044712 Bacteria 1169
972 Ga0453684_1176294 3300044712 Bacteria 806
973 Ga0453684_1260097 3300044712 Bacteria 773
974 Ga0466971_0005085 3300044719 Bacteria 5697
975 Ga0466971_0490179 3300044719 Bacteria 606
976 Ga0466968_0015588 3300044735 Bacteria 3014
977 Ga0466968_0124907 3300044735 Bacteria 1167
978 Ga0466970_0065532 3300044765 Bacteria 1949
979 Ga0466957_0029032 3300044842 Bacteria 3295
980 Ga0466957_0043697 3300044842 Bacteria 2714
981 Ga0466960_0019732 3300044901 Bacteria 2975
982 Ga0466959_0006139 3300045049 Bacteria 8300
983 Ga0466959_0024130 3300045049 Bacteria 4502
984 Ga0466959_0038351 3300045049 Bacteria 3540
985 Ga0466959_1162274 3300045049 Bacteria 513
986 Ga0451576_0744631 3300045051 Bacteria 1029
987 Ga0451576_0923382 3300045051 Bacteria 915
988 Ga0451576_1970887 3300045051 Bacteria 602
989 Ga0451576_2468493 3300045051 Bacteria 531
990 Ga0466958_0055977 3300045836 Bacteria 2394
991 Ga0466958_0125402 3300045836 Bacteria 1610
992 Ga0466967_0235571 3300045976 Bacteria 1744
993 Ga0495592_0541922 3300046454 Bacteria 717
994 Ga0495603_0132725 3300046455 Bacteria 1450
995 Ga0495603_0292470 3300046455 Bacteria 936
996 Ga0495590_0020006 3300046457 Bacteria 2380
997 Ga0495651_0718940 3300046462 Bacteria 621
998 Ga0495580_0116562 3300046472 Bacteria 1855
999 Ga0495580_0156185 3300046472 Bacteria 1580
1000 Ga0495662_0110735 3300046476 Bacteria 1346
1001 Ga0495664_0738531 3300046477 Bacteria 581
1002 Ga0495610_0077829 3300046512 Bacteria 1531
1003 Ga0495618_0309727 3300046514 Bacteria 980
1004 Ga0495632_0007493 3300046519 Bacteria 6846
1005 Ga0495643_0037769 3300046522 Bacteria 2647
1006 Ga0495643_0178509 3300046522 Bacteria 1033
1007 Ga0495643_0337173 3300046522 Bacteria 678
1008 Ga0495663_0037655 3300046525 Bacteria 1459
1009 Ga0495642_0046396 3300046528 Bacteria 1778
1010 Ga0495654_0392669 3300046530 Bacteria 552
1011 Ga0495665_0343081 3300046531 Bacteria 761
1012 Ga0495640_0088699 3300046533 Bacteria 2044
1013 Ga0495586_0417385 3300046535 Bacteria 773
1014 Ga0495598_0218020 3300046537 Bacteria 695
1015 Ga0495609_0218623 3300046538 Bacteria 792
1016 Ga0495621_0022142 3300046539 Bacteria 2103
1017 Ga0495621_0059719 3300046539 Bacteria 1382
1018 Ga0495621_0162629 3300046539 Bacteria 883
1019 Ga0495597_0289147 3300046542 Bacteria 637
1020 Ga0495645_0202214 3300046543 Bacteria 1347
1021 Ga0495633_0316998 3300046558 Bacteria 708
1022 Ga0495633_0397649 3300046558 Bacteria 623
1023 Ga0495667_0225288 3300046559 Bacteria 1196
1024 Ga0495668_0304446 3300046616 Bacteria 874
1025 Ga0495634_0368209 3300046642 Bacteria 858
1026 Ga0495611_0330984 3300046648 Bacteria 700
1027 Ga0495625_0482719 3300046660 Bacteria 760
1028 Ga0495635_0352832 3300046663 Bacteria 981
1029 Ga0495647_0073734 3300046681 Bacteria 1371
1030 Ga0495658_0023972 3300046683 Bacteria 3245
1031 Ga0495658_0056885 3300046683 Bacteria 2232
1032 Ga0495658_0814340 3300046683 Bacteria 598
1033 Ga0495658_1092499 3300046683 Bacteria 508
1034 Ga0495670_0048271 3300046691 Bacteria 2130
1035 Ga0495670_0385768 3300046691 Bacteria 756
1036 Ga0495649_0129737 3300046694 Bacteria 1330
1037 Ga0495600_0813015 3300046809 Bacteria 556
1038 Ga0495660_0010853 3300046810 Bacteria 5292
1039 Ga0495660_0396678 3300046810 Bacteria 605
1040 Ga0495581_0527471 3300047315 Bacteria 686
1041 Ga0495674_0630149 3300047319 Bacteria 847
1042 Ga0495676_1039322 3300047321 Bacteria 522
1043 Ga0495687_006891 3300047443 Bacteria 6845
1044 Ga0495687_011062 3300047443 Bacteria 4882
1045 Ga0495675_0788963 3300047444 Bacteria 527
1046 Ga0495684_0048209 3300047471 Bacteria 3258
1047 Ga0496100_0457234 3300048903 Bacteria 979
1048 Ga0496100_1189419 3300048903 Bacteria 601
1049 Ga0496100_1638673 3300048903 Bacteria 509
1050 Ga0496101_0107488 3300048904 Bacteria 2096
1051 Ga0496101_0792050 3300048904 Bacteria 748
1052 Ga0496102_0065346 3300048905 Bacteria 3334
1053 Ga0496104_0077738 3300048907 Bacteria 3162
1054 Ga0496104_0243643 3300048907 Bacteria 1710
1055 Ga0496104_0469705 3300048907 Bacteria 1169
1056 Ga0496104_1589975 3300048907 Bacteria 556
1057 Ga0496105_0036788 3300048908 Bacteria 4034
1058 Ga0496105_0095091 3300048908 Bacteria 2461
1059 Ga0496105_0610421 3300048908 Bacteria 846
1060 Ga0496106_0046614 3300048909 Bacteria 3259
1061 Ga0496106_1457746 3300048909 Bacteria 528
1062 Ga0496107_0051049 3300048910 Bacteria 2982
1063 Ga0496107_0297231 3300048910 Bacteria 1202
1064 Ga0496107_0596399 3300048910 Bacteria 817
1065 Ga0496108_0021457 3300048911 Bacteria 5310
1066 Ga0496108_0148087 3300048911 Bacteria 2025
1067 Ga0496108_1320020 3300048911 Bacteria 606
1068 Ga0496108_1509713 3300048911 Bacteria 559
1069 Ga0496109_0094545 3300048912 Bacteria 2767
1070 Ga0496109_0245942 3300048912 Bacteria 1684
1071 Ga0496109_0390803 3300048912 Bacteria 1314
1072 Ga0496109_0775212 3300048912 Bacteria 897
1073 Ga0496109_1197313 3300048912 Bacteria 696
1074 Ga0496109_1384869 3300048912 Bacteria 639
1075 Ga0496109_1581517 3300048912 Bacteria 590
1076 Ga0496110_0092477 3300048913 Bacteria 2707
1077 Ga0496110_0252319 3300048913 Bacteria 1606
1078 Ga0496110_0389566 3300048913 Bacteria 1270
1079 Ga0496110_0946500 3300048913 Bacteria 768
1080 Ga0496110_1388901 3300048913 Bacteria 612
1081 Ga0496112_0039732 3300048915 Bacteria 4599
1082 Ga0496112_1814954 3300048915 Bacteria 522
1083 Ga0496113_0071241 3300048916 Bacteria 2644
1084 Ga0496113_0102226 3300048916 Bacteria 2222
1085 Ga0496113_0621467 3300048916 Bacteria 865
1086 Ga0496113_0937481 3300048916 Bacteria 684
1087 Ga0496113_1108128 3300048916 Bacteria 621
1088 Ga0496114_0008894 3300048917 Bacteria 7963
1089 Ga0496114_0951788 3300048917 Bacteria 741
1090 Ga0496114_1351303 3300048917 Bacteria 600
1091 Ga0496115_1114636 3300048918 Bacteria 597
1092 Ga0496118_0152022 3300048921 Bacteria 1447
1093 Ga0496121_0134613 3300048924 Bacteria 1843
1094 Ga0496122_0522641 3300048925 Bacteria 572
1095 Ga0496123_0449855 3300048926 Bacteria 574
1096 Ga0496124_0000089 3300048927 Bacteria 192423
1097 Ga0496125_0308353 3300048928 Bacteria 966
1098 Ga0496125_0481248 3300048928 Bacteria 703
1099 Ga0496125_0772769 3300048928 Bacteria 500
1100 Ga0501306_072310 3300049127 Bacteria 584
1101 Ga0501308_013624 3300049128 Bacteria 942
1102 Ga0501308_047802 3300049128 Bacteria 619
1103 Ga0501310_001719 3300049130 Bacteria 2015
1104 Ga0501304_013783 3300049160 Bacteria 743
1105 Ga0501305_076265 3300049161 Bacteria 596
1106 Ga0495678_266541 3300049459 Bacteria 505
1107 Ga0495682_0045286 3300049460 Bacteria 1608
1108 Ga0501290_055454 3300049513 Bacteria 627
1109 Ga0501291_001998 3300049514 Bacteria 2403
1110 Ga0501294_009959 3300049517 Bacteria 936
1111 Ga0501295_039868 3300049518 Bacteria 970
1112 Ga0501296_009534 3300049519 Bacteria 1139
1113 Ga0501297_007843 3300049520 Bacteria 1167
1114 Ga0501298_022067 3300049521 Bacteria 1197
1115 Ga0501300_002663 3300049523 Bacteria 2675
1116 Ga0501311_036903 3300049527 Bacteria 728
1117 Ga0501312_011659 3300049528 Bacteria 1198
1118 Ga0501312_090299 3300049528 Bacteria 564
1119 Ga0501313_069197 3300049529 Bacteria 509
1120 Ga0501314_000884 3300049530 Bacteria 2014
1121 Ga0501314_018859 3300049530 Bacteria 705
1122 Ga0501315_009330 3300049531 Bacteria 1158
1123 Ga0501317_044182 3300049533 Bacteria 690
1124 Ga0501318_036241 3300049534 Bacteria 690
1125 Ga0501319_014471 3300049535 Bacteria 662
1126 Ga0501321_065683 3300049537 Bacteria 556
1127 Ga0501323_070860 3300049539 Bacteria 558
1128 Ga0501034_0408271 3300049571 Bacteria 1280
1129 Ga0501047_0549524 3300049581 Bacteria 979
1130 Ga0501067_0819311 3300049583 Bacteria 524
1131 Ga0501199_003769 3300049650 Bacteria 1468
1132 Ga0501201_001747 3300049651 Bacteria 2014
1133 Ga0501202_021014 3300049652 Bacteria 1301
1134 Ga0501206_050724 3300049653 Bacteria 660
1135 Ga0501208_095721 3300049655 Bacteria 630
1136 Ga0501211_001829 3300049658 Bacteria 2267
1137 Ga0501217_145839 3300049661 Bacteria 704
1138 Ga0501223_025635 3300049663 Bacteria 1147
1139 Ga0501227_019570 3300049665 Bacteria 1545
1140 Ga0501233_001981 3300049668 Bacteria 3566
1141 Ga0501235_002121 3300049669 Bacteria 4260
1142 Ga0501236_012853 3300049670 Bacteria 1136
1143 Ga0501255_003573 3300049684 Bacteria 1453
1144 Ga0501257_030638 3300049686 Bacteria 1296
1145 Ga0501258_001648 3300049687 Bacteria 1863
1146 Ga0501258_032800 3300049687 Bacteria 663
1147 Ga0501259_115694 3300049688 Bacteria 632
1148 Ga0501221_019877 3300049704 Bacteria 1307
1149 Ga0501225_0011857 3300049705 Bacteria 2452
1150 Ga0501229_032828 3300049706 Bacteria 717
1151 Ga0501262_002466 3300049759 Bacteria 2096
1152 Ga0501265_003770 3300049762 Bacteria 1722
1153 Ga0501266_085748 3300049763 Bacteria 540
1154 Ga0501267_000056 3300049764 Bacteria 6569
1155 Ga0501268_066803 3300049765 Bacteria 721
1156 Ga0501269_016545 3300049766 Bacteria 909
1157 Ga0501272_015592 3300049769 Bacteria 885
1158 Ga0501274_015371 3300049771 Bacteria 750
1159 Ga0501282_005077 3300049778 Bacteria 1407
1160 Ga0501035_0111125 3300049822 Bacteria 2402
1161 nmdc:mga03683_231906_c1 3300050489 Bacteria 854
1162 nmdc:mga03683_425286_c1 3300050489 Bacteria 637
1163 nmdc:mga03683_90593_c1 3300050489 Bacteria 1333
1164 nmdc:mga03683_96688_c1 3300050489 Bacteria 1294
1165 nmdc:mga03n38_109784_c1 3300050490 Bacteria 1342
1166 nmdc:mga03n38_814307_c1 3300050490 Bacteria 544
1167 nmdc:mga03n38_845685_c1 3300050490 Bacteria 535
1168 nmdc:mga0k408_173989_c1 3300050493 Bacteria 1283
1169 nmdc:mga0k408_19343_c1 3300050493 Bacteria 3805
1170 nmdc:mga0k408_19622_c1 3300050493 Bacteria 3781
1171 nmdc:mga0k408_32128_c1 3300050493 Bacteria 2999
1172 nmdc:mga0k408_33920_c1 3300050493 Bacteria 2921
1173 nmdc:mga0k408_409501_c1 3300050493 Bacteria 807
1174 nmdc:mga0k408_58093_c1 3300050493 Bacteria 2247
1175 nmdc:mga0k408_735492_c1 3300050493 Bacteria 577
1176 nmdc:mga0k408_8304_c1 3300050493 Bacteria 5571
1177 nmdc:mga0k408_9558_c1 3300050493 Bacteria 5231
1178 nmdc:mga06z11_337268_c1 3300050494 Bacteria 901
1179 nmdc:mga06z11_343415_c1 3300050494 Bacteria 893
1180 nmdc:mga06z11_406722_c1 3300050494 Bacteria 819
1181 nmdc:mga06z11_462098_c1 3300050494 Bacteria 767
1182 nmdc:mga06z11_542945_c1 3300050494 Bacteria 706
1183 nmdc:mga04h51_226751_c1 3300050495 Bacteria 742
1184 nmdc:mga07m45_1252_c1 3300050496 Bacteria 11547
1185 nmdc:mga07m45_136922_c1 3300050496 Bacteria 1418
1186 nmdc:mga07m45_148114_c1 3300050496 Bacteria 1361
1187 nmdc:mga07m45_184627_c1 3300050496 Bacteria 1213
1188 nmdc:mga07m45_232051_c1 3300050496 Bacteria 1074
1189 nmdc:mga07m45_23841_c2 3300050496 Bacteria 1569
1190 nmdc:mga07m45_31872_c1 3300050496 Bacteria 2922
1191 nmdc:mga07m45_432176_c1 3300050496 Bacteria 764
1192 nmdc:mga07m45_44069_c1 3300050496 Bacteria 2503
1193 nmdc:mga07m45_5744_c1 3300050496 Bacteria 3162
1194 nmdc:mga07m45_8788_c1 3300050496 Bacteria 5208
1195 nmdc:mga08y16_1044261_c1 3300050511 Bacteria 795
1196 nmdc:mga08y16_1950544_c1 3300050511 Bacteria 537
1197 nmdc:mga0sz30_46262_c1 3300050516 Bacteria 1837
1198 nmdc:mga0sz30_89692_c1 3300050516 Bacteria 1337
1199 Ga0495601_0950493 3300053077 Bacteria 542
1200 Ga0495619_0187972 3300053085 Bacteria 1430
1201 Ga0500583_0499237 3300053092 Bacteria 572
1202 Ga0500651_0304817 3300053093 Bacteria 913
1203 Ga0500650_0060669 3300053098 Bacteria 1766
1204 Ga0500658_0002795 3300053134 Bacteria 6699
1205 Ga0500561_0251506 3300053137 Bacteria 562
1206 Ga0500568_0204579 3300053139 Bacteria 722
1207 Ga0500622_0005593 3300053156 Bacteria 7496
1208 Ga0590071_001624 3300059421 Bacteria 5872
1209 Ga0590074_063491 3300059423 Bacteria 689
1210 Ga0466962_0036494 3300061719 Bacteria 2352
1211 Ga0466962_0089450 3300061719 Bacteria 1474

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005339 Ga0070660_100292667 Ga0070660_1002926672 65
2 3300041460 Ga0451802_0239083 Ga0451802_0239083_275_484 65
3 3300005262 Ga0065165_1003210 Ga0065165_100321011 66
4 3300006195 Ga0075366_10200269 Ga0075366_102002692 66
5 3300014325 Ga0163163_13048771 Ga0163163_130487712 66
6 3300028794 Ga0307515_10000013 Ga0307515_10000013235 66
7 3300031456 Ga0307513_10762378 Ga0307513_107623782 66
8 3300044658 Ga0466972_0017775 Ga0466972_0017775_954_1169 66
9 3300050493 nmdc:mga0k408_19622_c1 nmdc:mga0k408_19622_c1_3449_3664 66
10 iso_pu_bacteria 2643221644 2644245090 66
11 3300002244 JGI24742J22300_10081240 JGI24742J22300_100812401 67
12 3300005295 Ga0065707_10107246 Ga0065707_101072462 67
13 3300005295 Ga0065707_10218566 Ga0065707_102185661 67
14 3300005327 Ga0070658_10037488 Ga0070658_100374884 67
15 3300005327 Ga0070658_10532818 Ga0070658_105328182 67
16 3300005327 Ga0070658_10712175 Ga0070658_107121752 67
17 3300005327 Ga0070658_11431759 Ga0070658_114317592 67
18 3300005328 Ga0070676_10000461 Ga0070676_100004617 67
19 3300005328 Ga0070676_10568668 Ga0070676_105686681 67
20 3300005328 Ga0070676_10916169 Ga0070676_109161692 67
21 3300005329 Ga0070683_100002657 Ga0070683_10000265711 67
22 3300005329 Ga0070683_101712464 Ga0070683_1017124642 67
23 3300005329 Ga0070683_102167617 Ga0070683_1021676172 67
24 3300005330 Ga0070690_100061053 Ga0070690_1000610531 67
25 3300005331 Ga0070670_100082742 Ga0070670_1000827424 67
26 3300005331 Ga0070670_100121665 Ga0070670_1001216653 67
27 3300005331 Ga0070670_100157279 Ga0070670_1001572791 67
28 3300005331 Ga0070670_100321255 Ga0070670_1003212552 67
29 3300005331 Ga0070670_100740322 Ga0070670_1007403222 67
30 3300005331 Ga0070670_100788634 Ga0070670_1007886342 67
31 3300005331 Ga0070670_100894621 Ga0070670_1008946211 67
32 3300005331 Ga0070670_101209809 Ga0070670_1012098091 67
33 3300005333 Ga0070677_10013313 Ga0070677_100133133 67
34 3300005333 Ga0070677_10088375 Ga0070677_100883752 67
35 3300005333 Ga0070677_10161518 Ga0070677_101615182 67
36 3300005333 Ga0070677_10404198 Ga0070677_104041982 67
37 3300005333 Ga0070677_10496518 Ga0070677_104965182 67
38 3300005334 Ga0068869_100005237 Ga0068869_10000523711 67
39 3300005334 Ga0068869_100214971 Ga0068869_1002149712 67
40 3300005334 Ga0068869_100385446 Ga0068869_1003854462 67
41 3300005334 Ga0068869_100978383 Ga0068869_1009783831 67
42 3300005334 Ga0068869_101444504 Ga0068869_1014445042 67
43 3300005334 Ga0068869_101614653 Ga0068869_1016146531 67
44 3300005335 Ga0070666_10205065 Ga0070666_102050652 67
45 3300005335 Ga0070666_10336329 Ga0070666_103363292 67
46 3300005335 Ga0070666_10495351 Ga0070666_104953512 67
47 3300005335 Ga0070666_10986349 Ga0070666_109863492 67
48 3300005336 Ga0070680_100033672 Ga0070680_1000336722 67
49 3300005337 Ga0070682_100729376 Ga0070682_1007293762 67
50 3300005337 Ga0070682_100803104 Ga0070682_1008031042 67
51 3300005338 Ga0068868_100038470 Ga0068868_1000384702 67
52 3300005338 Ga0068868_100098048 Ga0068868_1000980484 67
53 3300005338 Ga0068868_100222516 Ga0068868_1002225163 67
54 3300005339 Ga0070660_100038847 Ga0070660_1000388472 67
55 3300005339 Ga0070660_100573144 Ga0070660_1005731442 67
56 3300005339 Ga0070660_100645233 Ga0070660_1006452332 67
57 3300005339 Ga0070660_101892275 Ga0070660_1018922752 67
58 3300005340 Ga0070689_100615911 Ga0070689_1006159112 67
59 3300005343 Ga0070687_100070250 Ga0070687_1000702503 67
60 3300005343 Ga0070687_100318600 Ga0070687_1003186002 67
61 3300005344 Ga0070661_100033916 Ga0070661_1000339164 67
62 3300005345 Ga0070692_10125892 Ga0070692_101258922 67
63 3300005345 Ga0070692_11218408 Ga0070692_112184081 67
64 3300005347 Ga0070668_100072024 Ga0070668_1000720242 67
65 3300005347 Ga0070668_100321570 Ga0070668_1003215701 67
66 3300005347 Ga0070668_100682415 Ga0070668_1006824151 67
67 3300005347 Ga0070668_100731276 Ga0070668_1007312761 67
68 3300005347 Ga0070668_102270204 Ga0070668_1022702042 67
69 3300005353 Ga0070669_100012530 Ga0070669_1000125303 67
70 3300005353 Ga0070669_100059940 Ga0070669_1000599404 67
71 3300005353 Ga0070669_100125241 Ga0070669_1001252412 67
72 3300005353 Ga0070669_100187143 Ga0070669_1001871433 67
73 3300005354 Ga0070675_100081897 Ga0070675_1000818974 67
74 3300005354 Ga0070675_100995825 Ga0070675_1009958252 67
75 3300005354 Ga0070675_101291210 Ga0070675_1012912102 67
76 3300005355 Ga0070671_100000158 Ga0070671_10000015830 67
77 3300005355 Ga0070671_100030059 Ga0070671_1000300592 67
78 3300005355 Ga0070671_100050580 Ga0070671_1000505804 67
79 3300005355 Ga0070671_100150995 Ga0070671_1001509952 67
80 3300005355 Ga0070671_100214533 Ga0070671_1002145331 67
81 3300005355 Ga0070671_100251765 Ga0070671_1002517652 67
82 3300005355 Ga0070671_100487619 Ga0070671_1004876192 67
83 3300005355 Ga0070671_100551903 Ga0070671_1005519032 67
84 3300005355 Ga0070671_100615511 Ga0070671_1006155112 67
85 3300005355 Ga0070671_100770803 Ga0070671_1007708032 67
86 3300005355 Ga0070671_101927230 Ga0070671_1019272302 67
87 3300005356 Ga0070674_100053422 Ga0070674_1000534224 67
88 3300005356 Ga0070674_100401175 Ga0070674_1004011752 67
89 3300005356 Ga0070674_101538775 Ga0070674_1015387752 67
90 3300005364 Ga0070673_100110117 Ga0070673_1001101173 67
91 3300005364 Ga0070673_100148749 Ga0070673_1001487493 67
92 3300005364 Ga0070673_100150067 Ga0070673_1001500672 67
93 3300005364 Ga0070673_100485714 Ga0070673_1004857142 67
94 3300005364 Ga0070673_100741796 Ga0070673_1007417962 67
95 3300005364 Ga0070673_100781873 Ga0070673_1007818732 67
96 3300005364 Ga0070673_101500526 Ga0070673_1015005262 67
97 3300005366 Ga0070659_100003957 Ga0070659_10000395711 67
98 3300005366 Ga0070659_100536357 Ga0070659_1005363571 67
99 3300005367 Ga0070667_100046188 Ga0070667_1000461882 67
100 3300005367 Ga0070667_100210364 Ga0070667_1002103642 67
101 3300005367 Ga0070667_100445002 Ga0070667_1004450022 67
102 3300005367 Ga0070667_100531703 Ga0070667_1005317032 67
103 3300005367 Ga0070667_101014174 Ga0070667_1010141742 67
104 3300005367 Ga0070667_101092396 Ga0070667_1010923961 67
105 3300005406 Ga0070703_10493164 Ga0070703_104931642 67
106 3300005441 Ga0070700_100152310 Ga0070700_1001523102 67
107 3300005455 Ga0070663_100013605 Ga0070663_1000136056 67
108 3300005455 Ga0070663_100822722 Ga0070663_1008227222 67
109 3300005455 Ga0070663_100956393 Ga0070663_1009563932 67
110 3300005456 Ga0070678_100019501 Ga0070678_1000195016 67
111 3300005456 Ga0070678_100075598 Ga0070678_1000755981 67
112 3300005456 Ga0070678_100339332 Ga0070678_1003393322 67
113 3300005456 Ga0070678_100394619 Ga0070678_1003946191 67
114 3300005456 Ga0070678_100448670 Ga0070678_1004486702 67
115 3300005456 Ga0070678_100559072 Ga0070678_1005590722 67
116 3300005456 Ga0070678_102089001 Ga0070678_1020890011 67
117 3300005457 Ga0070662_100002939 Ga0070662_1000029392 67
118 3300005457 Ga0070662_100106521 Ga0070662_1001065213 67
119 3300005457 Ga0070662_100288194 Ga0070662_1002881942 67
120 3300005457 Ga0070662_101202280 Ga0070662_1012022801 67
121 3300005457 Ga0070662_101684507 Ga0070662_1016845072 67
122 3300005458 Ga0070681_10099309 Ga0070681_100993092 67
123 3300005459 Ga0068867_100099529 Ga0068867_1000995292 67
124 3300005459 Ga0068867_100123681 Ga0068867_1001236811 67
125 3300005459 Ga0068867_100136026 Ga0068867_1001360263 67
126 3300005459 Ga0068867_100684096 Ga0068867_1006840962 67
127 3300005459 Ga0068867_100870639 Ga0068867_1008706392 67
128 3300005459 Ga0068867_100982266 Ga0068867_1009822662 67
129 3300005466 Ga0070685_10090539 Ga0070685_100905393 67
130 3300005466 Ga0070685_10687883 Ga0070685_106878831 67
131 3300005518 Ga0070699_101251718 Ga0070699_1012517181 67
132 3300005530 Ga0070679_100001707 Ga0070679_1000017078 67
133 3300005530 Ga0070679_101606854 Ga0070679_1016068542 67
134 3300005530 Ga0070679_101718106 Ga0070679_1017181062 67
135 3300005535 Ga0070684_100031437 Ga0070684_1000314374 67
136 3300005539 Ga0068853_100108265 Ga0068853_1001082652 67
137 3300005539 Ga0068853_100261617 Ga0068853_1002616172 67
138 3300005539 Ga0068853_100285282 Ga0068853_1002852821 67
139 3300005539 Ga0068853_100331799 Ga0068853_1003317992 67
140 3300005543 Ga0070672_100036467 Ga0070672_1000364675 67
141 3300005543 Ga0070672_100078038 Ga0070672_1000780382 67
142 3300005543 Ga0070672_100182863 Ga0070672_1001828632 67
143 3300005543 Ga0070672_100206087 Ga0070672_1002060871 67
144 3300005543 Ga0070672_100617109 Ga0070672_1006171092 67
145 3300005543 Ga0070672_100678166 Ga0070672_1006781662 67
146 3300005543 Ga0070672_101163559 Ga0070672_1011635592 67
147 3300005543 Ga0070672_101655846 Ga0070672_1016558462 67
148 3300005543 Ga0070672_101695320 Ga0070672_1016953202 67
149 3300005544 Ga0070686_100807700 Ga0070686_1008077002 67
150 3300005547 Ga0070693_100025694 Ga0070693_1000256944 67
151 3300005547 Ga0070693_100026782 Ga0070693_1000267821 67
152 3300005547 Ga0070693_100027109 Ga0070693_1000271094 67
153 3300005548 Ga0070665_100158936 Ga0070665_1001589364 67
154 3300005548 Ga0070665_100415534 Ga0070665_1004155342 67
155 3300005548 Ga0070665_100680788 Ga0070665_1006807882 67
156 3300005548 Ga0070665_101563223 Ga0070665_1015632232 67
157 3300005563 Ga0068855_100007939 Ga0068855_1000079398 67
158 3300005564 Ga0070664_100145676 Ga0070664_1001456763 67
159 3300005564 Ga0070664_100181364 Ga0070664_1001813642 67
160 3300005564 Ga0070664_100277123 Ga0070664_1002771232 67
161 3300005564 Ga0070664_100279810 Ga0070664_1002798102 67
162 3300005564 Ga0070664_100849782 Ga0070664_1008497822 67
163 3300005564 Ga0070664_101018464 Ga0070664_1010184642 67
164 3300005564 Ga0070664_102088786 Ga0070664_1020887862 67
165 3300005564 Ga0070664_102189124 Ga0070664_1021891242 67
166 3300005577 Ga0068857_100069270 Ga0068857_1000692704 67
167 3300005577 Ga0068857_100575627 Ga0068857_1005756272 67
168 3300005577 Ga0068857_101143615 Ga0068857_1011436152 67
169 3300005578 Ga0068854_100152030 Ga0068854_1001520302 67
170 3300005578 Ga0068854_100268962 Ga0068854_1002689622 67
171 3300005578 Ga0068854_100279967 Ga0068854_1002799672 67
172 3300005578 Ga0068854_100520375 Ga0068854_1005203752 67
173 3300005578 Ga0068854_101934454 Ga0068854_1019344542 67
174 3300005614 Ga0068856_100065004 Ga0068856_1000650043 67
175 3300005614 Ga0068856_100107970 Ga0068856_1001079703 67
176 3300005616 Ga0068852_100012164 Ga0068852_10001216410 67
177 3300005616 Ga0068852_100064917 Ga0068852_1000649173 67
178 3300005616 Ga0068852_100158582 Ga0068852_1001585822 67
179 3300005616 Ga0068852_100493379 Ga0068852_1004933792 67
180 3300005616 Ga0068852_100925162 Ga0068852_1009251621 67
181 3300005616 Ga0068852_101194951 Ga0068852_1011949512 67
182 3300005616 Ga0068852_101993887 Ga0068852_1019938872 67
183 3300005616 Ga0068852_102574464 Ga0068852_1025744642 67
184 3300005617 Ga0068859_100100711 Ga0068859_1001007112 67
185 3300005617 Ga0068859_100151854 Ga0068859_1001518543 67
186 3300005617 Ga0068859_102193399 Ga0068859_1021933992 67
187 3300005618 Ga0068864_100018827 Ga0068864_1000188275 67
188 3300005618 Ga0068864_100025050 Ga0068864_1000250506 67
189 3300005618 Ga0068864_100062621 Ga0068864_1000626214 67
190 3300005618 Ga0068864_100303311 Ga0068864_1003033112 67
191 3300005618 Ga0068864_100320948 Ga0068864_1003209482 67
192 3300005618 Ga0068864_100490563 Ga0068864_1004905632 67
193 3300005618 Ga0068864_101766259 Ga0068864_1017662591 67
194 3300005618 Ga0068864_101777824 Ga0068864_1017778242 67
195 3300005718 Ga0068866_10013545 Ga0068866_100135455 67
196 3300005718 Ga0068866_10119182 Ga0068866_101191821 67
197 3300005719 Ga0068861_100006706 Ga0068861_1000067068 67
198 3300005719 Ga0068861_100065336 Ga0068861_1000653364 67
199 3300005719 Ga0068861_101294117 Ga0068861_1012941172 67
200 3300005834 Ga0068851_10045937 Ga0068851_100459372 67
201 3300005834 Ga0068851_10077405 Ga0068851_100774051 67
202 3300005834 Ga0068851_10160215 Ga0068851_101602152 67
203 3300005834 Ga0068851_10678497 Ga0068851_106784972 67
204 3300005834 Ga0068851_11107248 Ga0068851_111072482 67
205 3300005840 Ga0068870_10156643 Ga0068870_101566432 67
206 3300005840 Ga0068870_10879111 Ga0068870_108791112 67
207 3300005841 Ga0068863_100001141 Ga0068863_10000114124 67
208 3300005841 Ga0068863_100207098 Ga0068863_1002070981 67
209 3300005841 Ga0068863_100288882 Ga0068863_1002888822 67
210 3300005841 Ga0068863_100491709 Ga0068863_1004917092 67
211 3300005841 Ga0068863_100507872 Ga0068863_1005078721 67
212 3300005841 Ga0068863_101332759 Ga0068863_1013327592 67
213 3300005841 Ga0068863_101716211 Ga0068863_1017162112 67
214 3300005841 Ga0068863_102285774 Ga0068863_1022857742 67
215 3300005842 Ga0068858_100056525 Ga0068858_1000565252 67
216 3300005842 Ga0068858_100472602 Ga0068858_1004726022 67
217 3300005842 Ga0068858_100619547 Ga0068858_1006195472 67
218 3300005842 Ga0068858_101583262 Ga0068858_1015832622 67
219 3300005843 Ga0068860_100031504 Ga0068860_1000315048 67
220 3300005843 Ga0068860_100048517 Ga0068860_1000485171 67
221 3300005843 Ga0068860_100120719 Ga0068860_1001207193 67
222 3300005843 Ga0068860_100446547 Ga0068860_1004465472 67
223 3300005843 Ga0068860_101431122 Ga0068860_1014311222 67
224 3300005844 Ga0068862_100065510 Ga0068862_1000655102 67
225 3300005844 Ga0068862_100281501 Ga0068862_1002815012 67
226 3300005844 Ga0068862_100913861 Ga0068862_1009138612 67
227 3300005844 Ga0068862_101123099 Ga0068862_1011230992 67
228 3300006177 Ga0075362_10711960 Ga0075362_107119602 67
229 3300006178 Ga0075367_10070169 Ga0075367_100701693 67
230 3300006195 Ga0075366_10163695 Ga0075366_101636951 67
231 3300006195 Ga0075366_10386666 Ga0075366_103866662 67
232 3300006237 Ga0097621_100004806 Ga0097621_1000048063 67
233 3300006237 Ga0097621_100012924 Ga0097621_1000129245 67
234 3300006237 Ga0097621_100074567 Ga0097621_1000745672 67
235 3300006237 Ga0097621_100458396 Ga0097621_1004583962 67
236 3300006237 Ga0097621_100834024 Ga0097621_1008340242 67
237 3300006237 Ga0097621_100881830 Ga0097621_1008818302 67
238 3300006237 Ga0097621_100940208 Ga0097621_1009402082 67
239 3300006353 Ga0075370_10006917 Ga0075370_100069176 67
240 3300006353 Ga0075370_10029651 Ga0075370_100296515 67
241 3300006353 Ga0075370_10233950 Ga0075370_102339502 67
242 3300006353 Ga0075370_10843060 Ga0075370_108430602 67
243 3300006358 Ga0068871_100005787 Ga0068871_10000578710 67
244 3300006358 Ga0068871_100013396 Ga0068871_1000133966 67
245 3300006358 Ga0068871_100180950 Ga0068871_1001809503 67
246 3300006358 Ga0068871_101474077 Ga0068871_1014740772 67
247 3300006881 Ga0068865_100054762 Ga0068865_1000547623 67
248 3300006881 Ga0068865_100217594 Ga0068865_1002175942 67
249 3300006881 Ga0068865_100259807 Ga0068865_1002598072 67
250 3300006881 Ga0068865_100340111 Ga0068865_1003401112 67
251 3300006881 Ga0068865_100581052 Ga0068865_1005810522 67
252 3300006931 Ga0097620_100100703 Ga0097620_1001007034 67
253 3300006931 Ga0097620_100151853 Ga0097620_1001518533 67
254 3300006931 Ga0097620_102193390 Ga0097620_1021933902 67
255 3300009092 Ga0105250_10520863 Ga0105250_105208632 67
256 3300009093 Ga0105240_11260290 Ga0105240_112602902 67
257 3300009094 Ga0111539_11836921 Ga0111539_118369212 67
258 3300009094 Ga0111539_12240810 Ga0111539_122408102 67
259 3300009098 Ga0105245_10554247 Ga0105245_105542472 67
260 3300009148 Ga0105243_10364805 Ga0105243_103648051 67
261 3300009148 Ga0105243_11509329 Ga0105243_115093292 67
262 3300009148 Ga0105243_12962686 Ga0105243_129626862 67
263 3300009148 Ga0105243_13125384 Ga0105243_131253842 67
264 3300009174 Ga0105241_11217970 Ga0105241_112179701 67
265 3300009176 Ga0105242_10013753 Ga0105242_100137532 67
266 3300009176 Ga0105242_11641046 Ga0105242_116410462 67
267 3300009176 Ga0105242_12479464 Ga0105242_124794642 67
268 3300009177 Ga0105248_10028131 Ga0105248_100281317 67
269 3300009177 Ga0105248_10042274 Ga0105248_100422744 67
270 3300009177 Ga0105248_10206255 Ga0105248_102062552 67
271 3300009177 Ga0105248_10286139 Ga0105248_102861391 67
272 3300009177 Ga0105248_10563000 Ga0105248_105630002 67
273 3300009177 Ga0105248_11414358 Ga0105248_114143582 67
274 3300009545 Ga0105237_11637547 Ga0105237_116375471 67
275 3300009551 Ga0105238_10058508 Ga0105238_100585082 67
276 3300009551 Ga0105238_11841186 Ga0105238_118411861 67
277 3300009553 Ga0105249_10008180 Ga0105249_1000818010 67
278 3300009553 Ga0105249_11120382 Ga0105249_111203822 67
279 3300009553 Ga0105249_11585481 Ga0105249_115854812 67
280 3300010375 Ga0105239_10277231 Ga0105239_102772313 67
281 3300011119 Ga0105246_10682207 Ga0105246_106822072 67
282 3300012500 Ga0157314_1008272 Ga0157314_10082722 67
283 3300012515 Ga0157338_1018411 Ga0157338_10184112 67
284 3300013100 Ga0157373_10124484 Ga0157373_101244843 67
285 3300013102 Ga0157371_10042098 Ga0157371_100420982 67
286 3300013102 Ga0157371_10229125 Ga0157371_102291252 67
287 3300013102 Ga0157371_11542036 Ga0157371_115420361 67
288 3300013104 Ga0157370_11798996 Ga0157370_117989962 67
289 3300013104 Ga0157370_12071504 Ga0157370_120715042 67
290 3300013105 Ga0157369_10002529 Ga0157369_1000252921 67
291 3300013105 Ga0157369_11424531 Ga0157369_114245312 67
292 3300013296 Ga0157374_10015370 Ga0157374_100153702 67
293 3300013296 Ga0157374_10037388 Ga0157374_100373882 67
294 3300013296 Ga0157374_10346616 Ga0157374_103466163 67
295 3300013297 Ga0157378_10402459 Ga0157378_104024592 67
296 3300013306 Ga0163162_10181851 Ga0163162_101818512 67
297 3300013306 Ga0163162_10384122 Ga0163162_103841222 67
298 3300013306 Ga0163162_10794400 Ga0163162_107944002 67
299 3300013306 Ga0163162_10897855 Ga0163162_108978552 67
300 3300013306 Ga0163162_12311543 Ga0163162_123115431 67
301 3300013307 Ga0157372_10008954 Ga0157372_1000895413 67
302 3300013307 Ga0157372_10095594 Ga0157372_100955946 67
303 3300013307 Ga0157372_11348096 Ga0157372_113480962 67
304 3300013307 Ga0157372_11559918 Ga0157372_115599182 67
305 3300013308 Ga0157375_10054149 Ga0157375_100541496 67
306 3300013308 Ga0157375_10772242 Ga0157375_107722422 67
307 3300013308 Ga0157375_10919768 Ga0157375_109197682 67
308 3300013308 Ga0157375_11153051 Ga0157375_111530512 67
309 3300014325 Ga0163163_10443619 Ga0163163_104436192 67
310 3300014325 Ga0163163_12002836 Ga0163163_120028362 67
311 3300014325 Ga0163163_12632753 Ga0163163_126327532 67
312 3300014326 Ga0157380_10092961 Ga0157380_100929612 67
313 3300014326 Ga0157380_10675391 Ga0157380_106753912 67
314 3300014326 Ga0157380_13534103 Ga0157380_135341031 67
315 3300014968 Ga0157379_10017047 Ga0157379_100170472 67
316 3300014968 Ga0157379_10041700 Ga0157379_100417003 67
317 3300014968 Ga0157379_10042358 Ga0157379_100423584 67
318 3300014968 Ga0157379_10133470 Ga0157379_101334704 67
319 3300014968 Ga0157379_10527442 Ga0157379_105274422 67
320 3300014969 Ga0157376_10014509 Ga0157376_100145098 67
321 3300014969 Ga0157376_10272779 Ga0157376_102727792 67
322 3300015261 Ga0182006_1205986 Ga0182006_12059862 67
323 3300017792 Ga0163161_10016875 Ga0163161_100168758 67
324 3300017792 Ga0163161_10181529 Ga0163161_101815292 67
325 3300017792 Ga0163161_11754518 Ga0163161_117545182 67
326 3300021361 Ga0213872_10000211 Ga0213872_1000021110 67
327 3300021377 Ga0213874_10023839 Ga0213874_100238392 67
328 3300021384 Ga0213876_10046569 Ga0213876_100465692 67
329 3300025321 Ga0207656_10261619 Ga0207656_102616192 67
330 3300025321 Ga0207656_10568260 Ga0207656_105682601 67
331 3300025885 Ga0207653_10421378 Ga0207653_104213781 67
332 3300025893 Ga0207682_10186938 Ga0207682_101869382 67
333 3300025893 Ga0207682_10275583 Ga0207682_102755832 67
334 3300025893 Ga0207682_10314062 Ga0207682_103140621 67
335 3300025893 Ga0207682_10555219 Ga0207682_105552192 67
336 3300025899 Ga0207642_10121417 Ga0207642_101214172 67
337 3300025899 Ga0207642_10638210 Ga0207642_106382102 67
338 3300025901 Ga0207688_10030759 Ga0207688_100307594 67
339 3300025901 Ga0207688_10582553 Ga0207688_105825532 67
340 3300025901 Ga0207688_10716116 Ga0207688_107161162 67
341 3300025903 Ga0207680_10280727 Ga0207680_102807272 67
342 3300025903 Ga0207680_11175949 Ga0207680_111759492 67
343 3300025904 Ga0207647_10454839 Ga0207647_104548392 67
344 3300025905 Ga0207685_10196175 Ga0207685_101961751 67
345 3300025907 Ga0207645_10042617 Ga0207645_100426174 67
346 3300025907 Ga0207645_10576488 Ga0207645_105764882 67
347 3300025908 Ga0207643_10026655 Ga0207643_100266553 67
348 3300025909 Ga0207705_10061289 Ga0207705_100612894 67
349 3300025909 Ga0207705_11288080 Ga0207705_112880802 67
350 3300025911 Ga0207654_10161056 Ga0207654_101610562 67
351 3300025912 Ga0207707_10073153 Ga0207707_100731534 67
352 3300025917 Ga0207660_10060825 Ga0207660_100608253 67
353 3300025918 Ga0207662_10113501 Ga0207662_101135013 67
354 3300025918 Ga0207662_10181173 Ga0207662_101811732 67
355 3300025919 Ga0207657_10092016 Ga0207657_100920162 67
356 3300025919 Ga0207657_10300745 Ga0207657_103007452 67
357 3300025919 Ga0207657_10502183 Ga0207657_105021832 67
358 3300025919 Ga0207657_11004917 Ga0207657_110049172 67
359 3300025920 Ga0207649_10002033 Ga0207649_1000203314 67
360 3300025920 Ga0207649_10511011 Ga0207649_105110112 67
361 3300025920 Ga0207649_10552236 Ga0207649_105522362 67
362 3300025920 Ga0207649_11385791 Ga0207649_113857912 67
363 3300025921 Ga0207652_10006365 Ga0207652_100063658 67
364 3300025921 Ga0207652_10567489 Ga0207652_105674892 67
365 3300025921 Ga0207652_11006912 Ga0207652_110069122 67
366 3300025923 Ga0207681_10001527 Ga0207681_100015273 67
367 3300025923 Ga0207681_10286602 Ga0207681_102866022 67
368 3300025924 Ga0207694_10015626 Ga0207694_100156266 67
369 3300025924 Ga0207694_11151574 Ga0207694_111515742 67
370 3300025924 Ga0207694_11526959 Ga0207694_115269592 67
371 3300025925 Ga0207650_10075854 Ga0207650_100758542 67
372 3300025925 Ga0207650_10121643 Ga0207650_101216432 67
373 3300025925 Ga0207650_10176777 Ga0207650_101767772 67
374 3300025925 Ga0207650_10244739 Ga0207650_102447392 67
375 3300025925 Ga0207650_11008863 Ga0207650_110088632 67
376 3300025926 Ga0207659_10001630 Ga0207659_100016307 67
377 3300025926 Ga0207659_10105131 Ga0207659_101051312 67
378 3300025926 Ga0207659_10261462 Ga0207659_102614622 67
379 3300025927 Ga0207687_10008433 Ga0207687_100084332 67
380 3300025927 Ga0207687_10077309 Ga0207687_100773092 67
381 3300025927 Ga0207687_11707794 Ga0207687_117077941 67
382 3300025931 Ga0207644_10000042 Ga0207644_1000004236 67
383 3300025931 Ga0207644_10163644 Ga0207644_101636442 67
384 3300025931 Ga0207644_10246026 Ga0207644_102460262 67
385 3300025931 Ga0207644_10976995 Ga0207644_109769952 67
386 3300025931 Ga0207644_11749109 Ga0207644_117491092 67
387 3300025932 Ga0207690_10008281 Ga0207690_100082812 67
388 3300025932 Ga0207690_10509942 Ga0207690_105099422 67
389 3300025932 Ga0207690_10745156 Ga0207690_107451562 67
390 3300025932 Ga0207690_11652560 Ga0207690_116525601 67
391 3300025933 Ga0207706_10005687 Ga0207706_1000568712 67
392 3300025933 Ga0207706_10026753 Ga0207706_100267534 67
393 3300025933 Ga0207706_10138168 Ga0207706_101381683 67
394 3300025933 Ga0207706_10379379 Ga0207706_103793792 67
395 3300025933 Ga0207706_11369876 Ga0207706_113698762 67
396 3300025934 Ga0207686_10330696 Ga0207686_103306962 67
397 3300025934 Ga0207686_10408659 Ga0207686_104086592 67
398 3300025935 Ga0207709_10646511 Ga0207709_106465112 67
399 3300025935 Ga0207709_10680611 Ga0207709_106806112 67
400 3300025935 Ga0207709_11578893 Ga0207709_115788931 67
401 3300025936 Ga0207670_10727338 Ga0207670_107273382 67
402 3300025937 Ga0207669_11693468 Ga0207669_116934682 67
403 3300025938 Ga0207704_10180766 Ga0207704_101807662 67
404 3300025938 Ga0207704_10353622 Ga0207704_103536222 67
405 3300025938 Ga0207704_11218645 Ga0207704_112186452 67
406 3300025939 Ga0207665_10096334 Ga0207665_100963341 67
407 3300025940 Ga0207691_10013989 Ga0207691_100139892 67
408 3300025940 Ga0207691_10086275 Ga0207691_100862754 67
409 3300025940 Ga0207691_10112255 Ga0207691_101122554 67
410 3300025940 Ga0207691_10113757 Ga0207691_101137573 67
411 3300025940 Ga0207691_10148946 Ga0207691_101489463 67
412 3300025941 Ga0207711_10003933 Ga0207711_1000393311 67
413 3300025941 Ga0207711_10033806 Ga0207711_100338063 67
414 3300025941 Ga0207711_10156494 Ga0207711_101564943 67
415 3300025941 Ga0207711_10263223 Ga0207711_102632232 67
416 3300025941 Ga0207711_10482421 Ga0207711_104824212 67
417 3300025941 Ga0207711_10642204 Ga0207711_106422042 67
418 3300025942 Ga0207689_10002895 Ga0207689_1000289511 67
419 3300025942 Ga0207689_10034592 Ga0207689_100345922 67
420 3300025942 Ga0207689_10573459 Ga0207689_105734592 67
421 3300025944 Ga0207661_10919929 Ga0207661_109199292 67
422 3300025945 Ga0207679_10071379 Ga0207679_100713794 67
423 3300025945 Ga0207679_10307546 Ga0207679_103075462 67
424 3300025945 Ga0207679_10379413 Ga0207679_103794134 67
425 3300025945 Ga0207679_10450536 Ga0207679_104505362 67
426 3300025945 Ga0207679_10629805 Ga0207679_106298052 67
427 3300025945 Ga0207679_10999529 Ga0207679_109995292 67
428 3300025960 Ga0207651_10209051 Ga0207651_102090512 67
429 3300025960 Ga0207651_10354218 Ga0207651_103542182 67
430 3300025960 Ga0207651_10436994 Ga0207651_104369942 67
431 3300025960 Ga0207651_10775515 Ga0207651_107755152 67
432 3300025961 Ga0207712_10082265 Ga0207712_100822653 67
433 3300025961 Ga0207712_11143249 Ga0207712_111432492 67
434 3300025972 Ga0207668_10100445 Ga0207668_101004453 67
435 3300025972 Ga0207668_10474314 Ga0207668_104743142 67
436 3300025972 Ga0207668_11976703 Ga0207668_119767032 67
437 3300025981 Ga0207640_10020844 Ga0207640_100208446 67
438 3300025981 Ga0207640_10368080 Ga0207640_103680802 67
439 3300025981 Ga0207640_10495554 Ga0207640_104955542 67
440 3300025986 Ga0207658_10013827 Ga0207658_100138274 67
441 3300025986 Ga0207658_10041532 Ga0207658_100415325 67
442 3300025986 Ga0207658_10844757 Ga0207658_108447572 67
443 3300025986 Ga0207658_10927550 Ga0207658_109275502 67
444 3300026023 Ga0207677_10104794 Ga0207677_101047942 67
445 3300026023 Ga0207677_10164116 Ga0207677_101641162 67
446 3300026023 Ga0207677_11622288 Ga0207677_116222882 67
447 3300026023 Ga0207677_12103329 Ga0207677_121033292 67
448 3300026035 Ga0207703_10007108 Ga0207703_100071086 67
449 3300026035 Ga0207703_10020187 Ga0207703_100201872 67
450 3300026035 Ga0207703_10124604 Ga0207703_101246044 67
451 3300026035 Ga0207703_10488216 Ga0207703_104882162 67
452 3300026035 Ga0207703_12034965 Ga0207703_120349652 67
453 3300026041 Ga0207639_10030055 Ga0207639_100300554 67
454 3300026067 Ga0207678_10003767 Ga0207678_1000376710 67
455 3300026067 Ga0207678_10420686 Ga0207678_104206862 67
456 3300026067 Ga0207678_11816775 Ga0207678_118167752 67
457 3300026075 Ga0207708_10238106 Ga0207708_102381062 67
458 3300026078 Ga0207702_10004875 Ga0207702_100048755 67
459 3300026078 Ga0207702_10973022 Ga0207702_109730222 67
460 3300026088 Ga0207641_10016191 Ga0207641_100161915 67
461 3300026088 Ga0207641_10027686 Ga0207641_100276861 67
462 3300026088 Ga0207641_10043194 Ga0207641_100431943 67
463 3300026088 Ga0207641_10244794 Ga0207641_102447943 67
464 3300026088 Ga0207641_10289757 Ga0207641_102897572 67
465 3300026089 Ga0207648_10019721 Ga0207648_100197219 67
466 3300026089 Ga0207648_10158812 Ga0207648_101588122 67
467 3300026089 Ga0207648_10336740 Ga0207648_103367402 67
468 3300026095 Ga0207676_10028649 Ga0207676_100286495 67
469 3300026095 Ga0207676_10121175 Ga0207676_101211752 67
470 3300026095 Ga0207676_10231393 Ga0207676_102313932 67
471 3300026095 Ga0207676_10287685 Ga0207676_102876852 67
472 3300026095 Ga0207676_10313279 Ga0207676_103132792 67
473 3300026095 Ga0207676_11684430 Ga0207676_116844302 67
474 3300026116 Ga0207674_10014711 Ga0207674_100147113 67
475 3300026116 Ga0207674_10018509 Ga0207674_100185096 67
476 3300026116 Ga0207674_10037010 Ga0207674_100370107 67
477 3300026118 Ga0207675_100003221 Ga0207675_10000322110 67
478 3300026118 Ga0207675_100104404 Ga0207675_1001044044 67
479 3300026121 Ga0207683_10047843 Ga0207683_100478436 67
480 3300026121 Ga0207683_10447901 Ga0207683_104479012 67
481 3300026121 Ga0207683_11032758 Ga0207683_110327582 67
482 3300026121 Ga0207683_11887413 Ga0207683_118874132 67
483 3300026142 Ga0207698_10002589 Ga0207698_1000258913 67
484 3300026142 Ga0207698_10030656 Ga0207698_100306562 67
485 3300026142 Ga0207698_10275652 Ga0207698_102756522 67
486 3300026142 Ga0207698_11414492 Ga0207698_114144922 67
487 3300026142 Ga0207698_11646563 Ga0207698_116465632 67
488 3300026142 Ga0207698_11676086 Ga0207698_116760861 67
489 3300026142 Ga0207698_11863146 Ga0207698_118631462 67
490 3300026142 Ga0207698_12199648 Ga0207698_121996482 67
491 3300028379 Ga0268266_11978636 Ga0268266_119786362 67
492 3300028380 Ga0268265_10077470 Ga0268265_100774702 67
493 3300028380 Ga0268265_10600875 Ga0268265_106008752 67
494 3300028380 Ga0268265_10743641 Ga0268265_107436412 67
495 3300028380 Ga0268265_11307156 Ga0268265_113071562 67
496 3300028381 Ga0268264_10006446 Ga0268264_100064462 67
497 3300028381 Ga0268264_10067766 Ga0268264_100677663 67
498 3300028381 Ga0268264_10564191 Ga0268264_105641912 67
499 3300028381 Ga0268264_11997984 Ga0268264_119979842 67
500 3300031548 Ga0307408_100430249 Ga0307408_1004302492 67
501 3300031731 Ga0307405_10026040 Ga0307405_100260402 67
502 3300031852 Ga0307410_10484526 Ga0307410_104845262 67
503 3300031911 Ga0307412_10105704 Ga0307412_101057042 67
504 3300032002 Ga0307416_101029015 Ga0307416_1010290152 67
505 3300032005 Ga0307411_10743827 Ga0307411_107438272 67
506 3300032126 Ga0307415_100001187 Ga0307415_1000011874 67
507 3300035089 Ga0373944_0183056 Ga0373944_0183056_492_701 67
508 3300035115 Ga0373941_0041699 Ga0373941_0041699_1074_1283 67
509 3300035116 Ga0373945_0311832 Ga0373945_0311832_446_655 67
510 3300035119 Ga0373956_0432069 Ga0373956_0432069_167_376 67
511 3300035120 Ga0373957_0062678 Ga0373957_0062678_664_873 67
512 3300035121 Ga0373960_0234561 Ga0373960_0234561_23_232 67
513 3300035172 Ga0373955_0688087 Ga0373955_0688087_118_327 67
514 3300035242 Ga0373962_0018166 Ga0373962_0018166_1333_1542 67
515 3300035410 Ga0373924_0038467 Ga0373924_0038467_1584_1793 67
516 3300035691 Ga0373931_0001033 Ga0373931_0001033_577_786 67
517 3300035692 Ga0373935_0259327 Ga0373935_0259327_863_1072 67
518 3300035692 Ga0373935_0330311 Ga0373935_0330311_578_787 67
519 3300035692 Ga0373935_1141289 Ga0373935_1141289_170_379 67
520 3300035695 Ga0373927_0075418 Ga0373927_0075418_1075_1284 67
521 3300035695 Ga0373927_0496591 Ga0373927_0496591_534_743 67
522 3300035725 Ga0373947_0045257 Ga0373947_0045257_200_409 67
523 3300035725 Ga0373947_0171299 Ga0373947_0171299_1106_1342 67
524 3300036401 Ga0373937_0769336 Ga0373937_0769336_485_694 67
525 3300037068 Ga0373925_0004378 Ga0373925_0004378_355_564 67
526 3300037068 Ga0373925_0079048 Ga0373925_0079048_344_553 67
527 3300037068 Ga0373925_0271315 Ga0373925_0271315_287_496 67
528 3300037853 Ga0436364_0677523 Ga0436364_0677523_38_247 67
529 3300039437 Ga0436365_0312685 Ga0436365_0312685_1260_1469 67
530 3300039447 Ga0436361_0019501 Ga0436361_0019501_5049_5258 67
531 3300039447 Ga0436361_1031544 Ga0436361_1031544_3057_3266 67
532 3300039447 Ga0436361_1220274 Ga0436361_1220274_40708_40917 67
533 3300039450 Ga0436363_1209952 Ga0436363_1209952_1473_1682 67
534 3300039453 Ga0436362_0064679 Ga0436362_0064679_307_516 67
535 3300041463 Ga0451804_0191505 Ga0451804_0191505_194_403 67
536 3300041463 Ga0451804_0632507 Ga0451804_0632507_83_292 67
537 3300041501 Ga0451845_0298283 Ga0451845_0298283_87_296 67
538 3300041512 Ga0451853_1131216 Ga0451853_1131216_303_512 67
539 3300044735 Ga0466968_0015588 Ga0466968_0015588_2480_2695 67
540 3300045051 Ga0451576_0744631 Ga0451576_0744631_202_411 67
541 3300045051 Ga0451576_1970887 Ga0451576_1970887_276_509 67
542 3300046454 Ga0495592_0541922 Ga0495592_0541922_340_576 67
543 3300046455 Ga0495603_0292470 Ga0495603_0292470_124_333 67
544 3300046462 Ga0495651_0718940 Ga0495651_0718940_74_283 67
545 3300046472 Ga0495580_0116562 Ga0495580_0116562_404_613 67
546 3300046472 Ga0495580_0156185 Ga0495580_0156185_294_503 67
547 3300046476 Ga0495662_0110735 Ga0495662_0110735_1094_1303 67
548 3300046477 Ga0495664_0738531 Ga0495664_0738531_142_351 67
549 3300046514 Ga0495618_0309727 Ga0495618_0309727_746_955 67
550 3300046522 Ga0495643_0037769 Ga0495643_0037769_2263_2481 67
551 3300046531 Ga0495665_0343081 Ga0495665_0343081_503_712 67
552 3300046533 Ga0495640_0088699 Ga0495640_0088699_95_331 67
553 3300046535 Ga0495586_0417385 Ga0495586_0417385_134_343 67
554 3300046543 Ga0495645_0202214 Ga0495645_0202214_724_933 67
555 3300046558 Ga0495633_0316998 Ga0495633_0316998_394_609 67
556 3300046559 Ga0495667_0225288 Ga0495667_0225288_497_706 67
557 3300046642 Ga0495634_0368209 Ga0495634_0368209_548_760 67
558 3300046663 Ga0495635_0352832 Ga0495635_0352832_128_337 67
559 3300046683 Ga0495658_0023972 Ga0495658_0023972_2262_2471 67
560 3300046683 Ga0495658_0814340 Ga0495658_0814340_221_430 67
561 3300046683 Ga0495658_1092499 Ga0495658_1092499_194_403 67
562 3300046809 Ga0495600_0813015 Ga0495600_0813015_85_297 67
563 3300047315 Ga0495581_0527471 Ga0495581_0527471_399_608 67
564 3300047319 Ga0495674_0630149 Ga0495674_0630149_277_486 67
565 3300047444 Ga0495675_0788963 Ga0495675_0788963_252_461 67
566 3300047471 Ga0495684_0048209 Ga0495684_0048209_1145_1354 67
567 3300048903 Ga0496100_0457234 Ga0496100_0457234_390_599 67
568 3300048903 Ga0496100_1189419 Ga0496100_1189419_16_225 67
569 3300048904 Ga0496101_0107488 Ga0496101_0107488_178_387 67
570 3300048904 Ga0496101_0792050 Ga0496101_0792050_234_443 67
571 3300048905 Ga0496102_0065346 Ga0496102_0065346_1406_1615 67
572 3300048907 Ga0496104_0243643 Ga0496104_0243643_1367_1576 67
573 3300048907 Ga0496104_1589975 Ga0496104_1589975_133_342 67
574 3300048908 Ga0496105_0095091 Ga0496105_0095091_2052_2261 67
575 3300048908 Ga0496105_0610421 Ga0496105_0610421_265_474 67
576 3300048909 Ga0496106_0046614 Ga0496106_0046614_1417_1626 67
577 3300048909 Ga0496106_1457746 Ga0496106_1457746_253_465 67
578 3300048910 Ga0496107_0051049 Ga0496107_0051049_1300_1509 67
579 3300048911 Ga0496108_0021457 Ga0496108_0021457_74_283 67
580 3300048911 Ga0496108_0148087 Ga0496108_0148087_1186_1395 67
581 3300048911 Ga0496108_1320020 Ga0496108_1320020_184_399 67
582 3300048912 Ga0496109_0094545 Ga0496109_0094545_147_362 67
583 3300048912 Ga0496109_0245942 Ga0496109_0245942_1084_1293 67
584 3300048912 Ga0496109_0390803 Ga0496109_0390803_374_583 67
585 3300048912 Ga0496109_0775212 Ga0496109_0775212_663_887 67
586 3300048913 Ga0496110_0389566 Ga0496110_0389566_809_1018 67
587 3300048913 Ga0496110_0946500 Ga0496110_0946500_394_603 67
588 3300048913 Ga0496110_1388901 Ga0496110_1388901_263_478 67
589 3300048915 Ga0496112_0039732 Ga0496112_0039732_2999_3208 67
590 3300048915 Ga0496112_1814954 Ga0496112_1814954_59_268 67
591 3300048916 Ga0496113_0071241 Ga0496113_0071241_958_1167 67
592 3300048916 Ga0496113_0102226 Ga0496113_0102226_1848_2057 67
593 3300048916 Ga0496113_0621467 Ga0496113_0621467_306_524 67
594 3300048916 Ga0496113_0937481 Ga0496113_0937481_228_437 67
595 3300048916 Ga0496113_1108128 Ga0496113_1108128_188_403 67
596 3300048917 Ga0496114_1351303 Ga0496114_1351303_258_467 67
597 3300048918 Ga0496115_1114636 Ga0496115_1114636_325_534 67
598 3300049528 Ga0501312_090299 Ga0501312_090299_322_540 67
599 3300049530 Ga0501314_018859 Ga0501314_018859_453_671 67
600 3300049537 Ga0501321_065683 Ga0501321_065683_217_435 67
601 3300049583 Ga0501067_0819311 Ga0501067_0819311_251_460 67
602 3300049763 Ga0501266_085748 Ga0501266_085748_287_505 67
603 3300049822 Ga0501035_0111125 Ga0501035_0111125_277_486 67
604 3300050489 nmdc:mga03683_425286_c1 nmdc:mga03683_425286_c1_316_534 67
605 3300050493 nmdc:mga0k408_33920_c1 nmdc:mga0k408_33920_c1_2689_2907 67
606 3300050494 nmdc:mga06z11_337268_c1 nmdc:mga06z11_337268_c1_14_232 67
607 3300050496 nmdc:mga07m45_136922_c1 nmdc:mga07m45_136922_c1_441_659 67
608 3300050496 nmdc:mga07m45_148114_c1 nmdc:mga07m45_148114_c1_927_1163 67
609 3300050496 nmdc:mga07m45_23841_c2 nmdc:mga07m45_23841_c2_96_314 67
610 3300050496 nmdc:mga07m45_5744_c1 nmdc:mga07m45_5744_c1_2931_3152 67
611 3300050511 nmdc:mga08y16_1044261_c1 nmdc:mga08y16_1044261_c1_374_583 67
612 3300053077 Ga0495601_0950493 Ga0495601_0950493_214_429 67
613 3300053085 Ga0495619_0187972 Ga0495619_0187972_996_1205 67
614 3300003791 Ga0055530_10005149 Ga0055530_100051499 68
615 3300003791 Ga0055530_10024256 Ga0055530_100242561 68
616 3300003792 Ga0055540_1000007 Ga0055540_1000007225 68
617 3300003794 Ga0055531_10013883 Ga0055531_100138833 68
618 3300005331 Ga0070670_100163031 Ga0070670_1001630313 68
619 3300005459 Ga0068867_101855947 Ga0068867_1018559472 68
620 3300005543 Ga0070672_101237582 Ga0070672_1012375822 68
621 3300005564 Ga0070664_102089009 Ga0070664_1020890092 68
622 3300005614 Ga0068856_100024547 Ga0068856_1000245473 68
623 3300005618 Ga0068864_100763044 Ga0068864_1007630442 68
624 3300005841 Ga0068863_100271550 Ga0068863_1002715502 68
625 3300005842 Ga0068858_100435158 Ga0068858_1004351582 68
626 3300006048 Ga0075363_100234652 Ga0075363_1002346522 68
627 3300006163 Ga0070715_10484768 Ga0070715_104847682 68
628 3300006177 Ga0075362_10109550 Ga0075362_101095502 68
629 3300006358 Ga0068871_101348847 Ga0068871_1013488472 68
630 3300006946 Ga0079104_1000009 Ga0079104_100000977 68
631 3300009177 Ga0105248_10880348 Ga0105248_108803482 68
632 3300009551 Ga0105238_10623624 Ga0105238_106236241 68
633 3300013296 Ga0157374_10477754 Ga0157374_104777541 68
634 3300013308 Ga0157375_10003085 Ga0157375_1000308511 68
635 3300014325 Ga0163163_10129271 Ga0163163_101292712 68
636 3300025263 Ga0209565_1012512 Ga0209565_10125122 68
637 3300025291 Ga0209675_1009399 Ga0209675_10093993 68
638 3300025298 Ga0209050_1000246 Ga0209050_100024677 68
639 3300025298 Ga0209050_1016802 Ga0209050_10168022 68
640 3300025299 Ga0209256_1000019 Ga0209256_1000019132 68
641 3300025303 Ga0209051_1000004 Ga0209051_1000004279 68
642 3300025304 Ga0209257_1000038 Ga0209257_1000038413 68
643 3300025304 Ga0209257_1000044 Ga0209257_1000044146 68
644 3300025925 Ga0207650_11334132 Ga0207650_113341322 68
645 3300025940 Ga0207691_10511258 Ga0207691_105112582 68
646 3300025941 Ga0207711_10290088 Ga0207711_102900882 68
647 3300026023 Ga0207677_10030155 Ga0207677_100301556 68
648 3300026035 Ga0207703_11007532 Ga0207703_110075322 68
649 3300026078 Ga0207702_10162793 Ga0207702_101627932 68
650 3300026078 Ga0207702_10619397 Ga0207702_106193972 68
651 3300026088 Ga0207641_10249076 Ga0207641_102490762 68
652 3300026089 Ga0207648_11699060 Ga0207648_116990602 68
653 3300026095 Ga0207676_10023252 Ga0207676_100232526 68
654 3300027111 Ga0209281_1000023 Ga0209281_1000023310 68
655 3300028794 Ga0307515_10000037 Ga0307515_1000003783 68
656 3300028794 Ga0307515_10591478 Ga0307515_105914782 68
657 3300031548 Ga0307408_100059178 Ga0307408_1000591782 68
658 3300031548 Ga0307408_100724192 Ga0307408_1007241922 68
659 3300031649 Ga0307514_10000533 Ga0307514_1000053313 68
660 3300031731 Ga0307405_10041390 Ga0307405_100413903 68
661 3300031731 Ga0307405_11477972 Ga0307405_114779722 68
662 3300031824 Ga0307413_10030250 Ga0307413_100302504 68
663 3300031824 Ga0307413_10324676 Ga0307413_103246762 68
664 3300031852 Ga0307410_10005676 Ga0307410_100056767 68
665 3300031901 Ga0307406_10002787 Ga0307406_100027877 68
666 3300031901 Ga0307406_10236256 Ga0307406_102362562 68
667 3300031903 Ga0307407_10095579 Ga0307407_100955792 68
668 3300031903 Ga0307407_10422176 Ga0307407_104221761 68
669 3300031903 Ga0307407_11078698 Ga0307407_110786981 68
670 3300031911 Ga0307412_10053728 Ga0307412_100537282 68
671 3300031911 Ga0307412_11063416 Ga0307412_110634162 68
672 3300031995 Ga0307409_100036556 Ga0307409_1000365562 68
673 3300031995 Ga0307409_100561838 Ga0307409_1005618382 68
674 3300032002 Ga0307416_100231616 Ga0307416_1002316163 68
675 3300032002 Ga0307416_101076444 Ga0307416_1010764442 68
676 3300032002 Ga0307416_103051478 Ga0307416_1030514781 68
677 3300032004 Ga0307414_10888069 Ga0307414_108880692 68
678 3300032005 Ga0307411_10004113 Ga0307411_100041132 68
679 3300032005 Ga0307411_10125064 Ga0307411_101250643 68
680 3300032005 Ga0307411_11304475 Ga0307411_113044752 68
681 3300035116 Ga0373945_0131295 Ga0373945_0131295_117_329 68
682 3300035724 Ga0373933_0169041 Ga0373933_0169041_1103_1309 68
683 3300036401 Ga0373937_0459011 Ga0373937_0459011_939_1145 68
684 3300039438 Ga0436360_1262653 Ga0436360_1262653_48_254 68
685 3300039450 Ga0436363_0126290 Ga0436363_0126290_195_401 68
686 3300041498 Ga0451841_1083417 Ga0451841_1083417_92_304 68
687 3300042121 Ga0450919_008293 Ga0450919_008293_523_741 68
688 3300042122 Ga0450920_015070 Ga0450920_015070_1028_1246 68
689 3300042125 Ga0450923_039264 Ga0450923_039264_602_820 68
690 3300042531 Ga0450918_000994 Ga0450918_000994_38_256 68
691 3300042876 Ga0451577_0049233 Ga0451577_0049233_2675_2890 68
692 3300044712 Ga0453684_0425781 Ga0453684_0425781_523_738 68
693 3300044712 Ga0453684_1176294 Ga0453684_1176294_470_679 68
694 3300045051 Ga0451576_0923382 Ga0451576_0923382_167_382 68
695 3300048903 Ga0496100_1638673 Ga0496100_1638673_159_374 68
696 3300048912 Ga0496109_1384869 Ga0496109_1384869_244_456 68
697 3300048917 Ga0496114_0008894 Ga0496114_0008894_7688_7906 68
698 3300048921 Ga0496118_0152022 Ga0496118_0152022_56_262 68
699 3300048924 Ga0496121_0134613 Ga0496121_0134613_143_349 68
700 3300048927 Ga0496124_0000089 Ga0496124_0000089_136928_137134 68
701 3300048928 Ga0496125_0308353 Ga0496125_0308353_152_358 68
702 3300048928 Ga0496125_0772769 Ga0496125_0772769_232_438 68
703 3300050489 nmdc:mga03683_96688_c1 nmdc:mga03683_96688_c1_120_338 68
704 3300050490 nmdc:mga03n38_845685_c1 nmdc:mga03n38_845685_c1_172_390 68
705 iso_pu_bacteria 2831864461 2831868659 68
706 3300003316 rootH1_10003598 rootH1_100035981 69
707 3300003320 rootH2_10029593 rootH2_100295934 69
708 3300003322 rootL2_10001906 rootL2_100019062 69
709 3300003322 rootL2_10027947 rootL2_1002794732 69
710 3300003323 rootH1_10003292 rootH1_100032924 69
711 3300003775 Ga0055524_1000162 Ga0055524_100016237 69
712 3300003794 Ga0055531_10013558 Ga0055531_100135582 69
713 3300003794 Ga0055531_10119979 Ga0055531_101199791 69
714 3300005293 Ga0065715_10150019 Ga0065715_101500193 69
715 3300005328 Ga0070676_10188357 Ga0070676_101883572 69
716 3300005328 Ga0070676_10749959 Ga0070676_107499592 69
717 3300005329 Ga0070683_100756950 Ga0070683_1007569502 69
718 3300005330 Ga0070690_100128639 Ga0070690_1001286392 69
719 3300005330 Ga0070690_100953649 Ga0070690_1009536491 69
720 3300005331 Ga0070670_100277458 Ga0070670_1002774582 69
721 3300005331 Ga0070670_100767372 Ga0070670_1007673722 69
722 3300005333 Ga0070677_10007562 Ga0070677_100075625 69
723 3300005333 Ga0070677_10379619 Ga0070677_103796192 69
724 3300005333 Ga0070677_10623503 Ga0070677_106235032 69
725 3300005334 Ga0068869_100056006 Ga0068869_1000560064 69
726 3300005335 Ga0070666_10172127 Ga0070666_101721272 69
727 3300005338 Ga0068868_100003772 Ga0068868_1000037723 69
728 3300005340 Ga0070689_100126876 Ga0070689_1001268763 69
729 3300005347 Ga0070668_100117952 Ga0070668_1001179522 69
730 3300005347 Ga0070668_101044436 Ga0070668_1010444361 69
731 3300005353 Ga0070669_100364633 Ga0070669_1003646332 69
732 3300005353 Ga0070669_100415872 Ga0070669_1004158722 69
733 3300005354 Ga0070675_100036510 Ga0070675_1000365105 69
734 3300005354 Ga0070675_100150278 Ga0070675_1001502783 69
735 3300005354 Ga0070675_100390177 Ga0070675_1003901772 69
736 3300005355 Ga0070671_100001245 Ga0070671_1000012456 69
737 3300005356 Ga0070674_100545946 Ga0070674_1005459462 69
738 3300005356 Ga0070674_101954598 Ga0070674_1019545981 69
739 3300005364 Ga0070673_100003957 Ga0070673_1000039575 69
740 3300005364 Ga0070673_100199811 Ga0070673_1001998112 69
741 3300005364 Ga0070673_100609217 Ga0070673_1006092172 69
742 3300005364 Ga0070673_102203326 Ga0070673_1022033261 69
743 3300005367 Ga0070667_100054743 Ga0070667_1000547432 69
744 3300005367 Ga0070667_100332487 Ga0070667_1003324872 69
745 3300005438 Ga0070701_10128634 Ga0070701_101286342 69
746 3300005455 Ga0070663_100052271 Ga0070663_1000522712 69
747 3300005455 Ga0070663_101635755 Ga0070663_1016357551 69
748 3300005456 Ga0070678_100003077 Ga0070678_10000307710 69
749 3300005456 Ga0070678_100025454 Ga0070678_1000254542 69
750 3300005456 Ga0070678_100412546 Ga0070678_1004125462 69
751 3300005456 Ga0070678_100830827 Ga0070678_1008308272 69
752 3300005457 Ga0070662_100014752 Ga0070662_1000147525 69
753 3300005457 Ga0070662_100178967 Ga0070662_1001789672 69
754 3300005457 Ga0070662_100188941 Ga0070662_1001889413 69
755 3300005459 Ga0068867_100009697 Ga0068867_1000096976 69
756 3300005459 Ga0068867_100167727 Ga0068867_1001677272 69
757 3300005459 Ga0068867_100414451 Ga0068867_1004144512 69
758 3300005459 Ga0068867_101558170 Ga0068867_1015581701 69
759 3300005466 Ga0070685_11562629 Ga0070685_115626292 69
760 3300005468 Ga0070707_100145184 Ga0070707_1001451843 69
761 3300005471 Ga0070698_100396623 Ga0070698_1003966231 69
762 3300005518 Ga0070699_100475545 Ga0070699_1004755452 69
763 3300005539 Ga0068853_100059642 Ga0068853_1000596422 69
764 3300005539 Ga0068853_102079339 Ga0068853_1020793391 69
765 3300005543 Ga0070672_100020047 Ga0070672_1000200472 69
766 3300005543 Ga0070672_100167529 Ga0070672_1001675292 69
767 3300005543 Ga0070672_100273181 Ga0070672_1002731812 69
768 3300005544 Ga0070686_100189355 Ga0070686_1001893552 69
769 3300005563 Ga0068855_101240944 Ga0068855_1012409442 69
770 3300005564 Ga0070664_101147251 Ga0070664_1011472512 69
771 3300005577 Ga0068857_100055768 Ga0068857_1000557682 69
772 3300005578 Ga0068854_101016874 Ga0068854_1010168742 69
773 3300005578 Ga0068854_101189659 Ga0068854_1011896592 69
774 3300005614 Ga0068856_100405615 Ga0068856_1004056152 69
775 3300005616 Ga0068852_100200369 Ga0068852_1002003692 69
776 3300005616 Ga0068852_100960817 Ga0068852_1009608172 69
777 3300005617 Ga0068859_100658925 Ga0068859_1006589251 69
778 3300005618 Ga0068864_100005884 Ga0068864_1000058842 69
779 3300005718 Ga0068866_10191098 Ga0068866_101910982 69
780 3300005719 Ga0068861_100011826 Ga0068861_1000118268 69
781 3300005834 Ga0068851_10132817 Ga0068851_101328172 69
782 3300005840 Ga0068870_10317538 Ga0068870_103175382 69
783 3300005840 Ga0068870_10645284 Ga0068870_106452842 69
784 3300005840 Ga0068870_11017869 Ga0068870_110178692 69
785 3300005841 Ga0068863_100010494 Ga0068863_1000104945 69
786 3300005842 Ga0068858_100000259 Ga0068858_10000025910 69
787 3300005843 Ga0068860_100620520 Ga0068860_1006205202 69
788 3300005844 Ga0068862_100060510 Ga0068862_1000605102 69
789 3300005844 Ga0068862_100807123 Ga0068862_1008071232 69
790 3300006038 Ga0075365_10096479 Ga0075365_100964792 69
791 3300006038 Ga0075365_10753128 Ga0075365_107531281 69
792 3300006042 Ga0075368_10032256 Ga0075368_100322562 69
793 3300006042 Ga0075368_10040488 Ga0075368_100404882 69
794 3300006048 Ga0075363_100151243 Ga0075363_1001512432 69
795 3300006051 Ga0075364_10093210 Ga0075364_100932103 69
796 3300006058 Ga0075432_10085198 Ga0075432_100851982 69
797 3300006177 Ga0075362_10112124 Ga0075362_101121242 69
798 3300006177 Ga0075362_10377743 Ga0075362_103777432 69
799 3300006177 Ga0075362_10680226 Ga0075362_106802261 69
800 3300006178 Ga0075367_10030819 Ga0075367_100308194 69
801 3300006178 Ga0075367_10101024 Ga0075367_101010243 69
802 3300006178 Ga0075367_10295551 Ga0075367_102955512 69
803 3300006186 Ga0075369_10035715 Ga0075369_100357152 69
804 3300006186 Ga0075369_10053081 Ga0075369_100530812 69
805 3300006186 Ga0075369_10443126 Ga0075369_104431262 69
806 3300006195 Ga0075366_10001728 Ga0075366_100017282 69
807 3300006195 Ga0075366_10029122 Ga0075366_100291223 69
808 3300006195 Ga0075366_10052841 Ga0075366_100528413 69
809 3300006195 Ga0075366_10155127 Ga0075366_101551272 69
810 3300006195 Ga0075366_10184230 Ga0075366_101842301 69
811 3300006195 Ga0075366_10461532 Ga0075366_104615322 69
812 3300006195 Ga0075366_10631272 Ga0075366_106312722 69
813 3300006237 Ga0097621_100018962 Ga0097621_1000189624 69
814 3300006353 Ga0075370_10011994 Ga0075370_100119947 69
815 3300006353 Ga0075370_10029181 Ga0075370_100291815 69
816 3300006353 Ga0075370_10032930 Ga0075370_100329302 69
817 3300006353 Ga0075370_10057682 Ga0075370_100576823 69
818 3300006353 Ga0075370_10381496 Ga0075370_103814962 69
819 3300006358 Ga0068871_100335857 Ga0068871_1003358572 69
820 3300006931 Ga0097620_100658915 Ga0097620_1006589151 69
821 3300009148 Ga0105243_11798883 Ga0105243_117988831 69
822 3300009174 Ga0105241_10272826 Ga0105241_102728261 69
823 3300009177 Ga0105248_11098229 Ga0105248_110982292 69
824 3300009545 Ga0105237_10041408 Ga0105237_100414083 69
825 3300009551 Ga0105238_11658774 Ga0105238_116587742 69
826 3300009551 Ga0105238_11890695 Ga0105238_118906952 69
827 3300009553 Ga0105249_10016884 Ga0105249_100168846 69
828 3300010375 Ga0105239_10085568 Ga0105239_100855684 69
829 3300012475 Ga0157317_1000186 Ga0157317_10001861 69
830 3300012497 Ga0157319_1000002 Ga0157319_1000002238 69
831 3300013104 Ga0157370_11307137 Ga0157370_113071372 69
832 3300013306 Ga0163162_10019201 Ga0163162_100192017 69
833 3300013306 Ga0163162_10118418 Ga0163162_101184184 69
834 3300013308 Ga0157375_10115460 Ga0157375_101154604 69
835 3300013308 Ga0157375_13758463 Ga0157375_137584632 69
836 3300014325 Ga0163163_10663707 Ga0163163_106637072 69
837 3300014326 Ga0157380_10079211 Ga0157380_100792114 69
838 3300014326 Ga0157380_10868749 Ga0157380_108687492 69
839 3300014745 Ga0157377_10401551 Ga0157377_104015512 69
840 3300014969 Ga0157376_10062388 Ga0157376_100623882 69
841 3300014969 Ga0157376_10073392 Ga0157376_100733922 69
842 3300017792 Ga0163161_10075187 Ga0163161_100751874 69
843 3300017792 Ga0163161_10260221 Ga0163161_102602212 69
844 3300025299 Ga0209256_1000072 Ga0209256_100007244 69
845 3300025303 Ga0209051_1136781 Ga0209051_11367811 69
846 3300025304 Ga0209257_1000385 Ga0209257_100038578 69
847 3300025304 Ga0209257_1008778 Ga0209257_10087784 69
848 3300025321 Ga0207656_10095821 Ga0207656_100958212 69
849 3300025893 Ga0207682_10012060 Ga0207682_100120602 69
850 3300025903 Ga0207680_10263175 Ga0207680_102631752 69
851 3300025907 Ga0207645_10035303 Ga0207645_100353034 69
852 3300025907 Ga0207645_10283491 Ga0207645_102834912 69
853 3300025907 Ga0207645_10317180 Ga0207645_103171802 69
854 3300025908 Ga0207643_10637350 Ga0207643_106373502 69
855 3300025908 Ga0207643_10639793 Ga0207643_106397932 69
856 3300025908 Ga0207643_11150028 Ga0207643_111500281 69
857 3300025909 Ga0207705_10311029 Ga0207705_103110292 69
858 3300025910 Ga0207684_10004630 Ga0207684_1000463014 69
859 3300025913 Ga0207695_10250268 Ga0207695_102502681 69
860 3300025914 Ga0207671_10017203 Ga0207671_100172032 69
861 3300025920 Ga0207649_10581904 Ga0207649_105819042 69
862 3300025922 Ga0207646_10133400 Ga0207646_101334003 69
863 3300025923 Ga0207681_10039148 Ga0207681_100391482 69
864 3300025923 Ga0207681_11033633 Ga0207681_110336332 69
865 3300025923 Ga0207681_11367583 Ga0207681_113675832 69
866 3300025924 Ga0207694_11516164 Ga0207694_115161642 69
867 3300025925 Ga0207650_10012223 Ga0207650_100122238 69
868 3300025925 Ga0207650_10996471 Ga0207650_109964712 69
869 3300025926 Ga0207659_10010794 Ga0207659_100107946 69
870 3300025926 Ga0207659_10158022 Ga0207659_101580222 69
871 3300025927 Ga0207687_11701710 Ga0207687_117017102 69
872 3300025931 Ga0207644_10054871 Ga0207644_100548713 69
873 3300025933 Ga0207706_10067926 Ga0207706_100679265 69
874 3300025934 Ga0207686_10325134 Ga0207686_103251342 69
875 3300025935 Ga0207709_10386814 Ga0207709_103868142 69
876 3300025935 Ga0207709_10689438 Ga0207709_106894382 69
877 3300025937 Ga0207669_10974537 Ga0207669_109745372 69
878 3300025940 Ga0207691_10087701 Ga0207691_100877014 69
879 3300025940 Ga0207691_10093639 Ga0207691_100936392 69
880 3300025940 Ga0207691_10208529 Ga0207691_102085292 69
881 3300025940 Ga0207691_10507322 Ga0207691_105073222 69
882 3300025941 Ga0207711_10196560 Ga0207711_101965603 69
883 3300025941 Ga0207711_10410320 Ga0207711_104103202 69
884 3300025942 Ga0207689_10182281 Ga0207689_101822811 69
885 3300025942 Ga0207689_10185674 Ga0207689_101856743 69
886 3300025945 Ga0207679_10364340 Ga0207679_103643402 69
887 3300025945 Ga0207679_10432498 Ga0207679_104324982 69
888 3300025949 Ga0207667_10902073 Ga0207667_109020732 69
889 3300025960 Ga0207651_10170129 Ga0207651_101701292 69
890 3300025960 Ga0207651_10514551 Ga0207651_105145512 69
891 3300025960 Ga0207651_10666144 Ga0207651_106661442 69
892 3300025960 Ga0207651_11396709 Ga0207651_113967092 69
893 3300025960 Ga0207651_11757787 Ga0207651_117577872 69
894 3300025961 Ga0207712_10434957 Ga0207712_104349572 69
895 3300025961 Ga0207712_11276954 Ga0207712_112769542 69
896 3300025972 Ga0207668_10101101 Ga0207668_101011012 69
897 3300025981 Ga0207640_10296935 Ga0207640_102969352 69
898 3300025986 Ga0207658_10005557 Ga0207658_100055572 69
899 3300025986 Ga0207658_11274281 Ga0207658_112742812 69
900 3300026023 Ga0207677_10028291 Ga0207677_100282912 69
901 3300026035 Ga0207703_10001748 Ga0207703_100017483 69
902 3300026041 Ga0207639_10183239 Ga0207639_101832392 69
903 3300026041 Ga0207639_10199709 Ga0207639_101997092 69
904 3300026041 Ga0207639_11242500 Ga0207639_112425002 69
905 3300026041 Ga0207639_11597682 Ga0207639_115976822 69
906 3300026067 Ga0207678_10018029 Ga0207678_100180293 69
907 3300026067 Ga0207678_11075367 Ga0207678_110753672 69
908 3300026075 Ga0207708_10545729 Ga0207708_105457292 69
909 3300026078 Ga0207702_11899300 Ga0207702_118993002 69
910 3300026088 Ga0207641_10020236 Ga0207641_100202362 69
911 3300026088 Ga0207641_10447897 Ga0207641_104478971 69
912 3300026088 Ga0207641_11799220 Ga0207641_117992202 69
913 3300026089 Ga0207648_10029021 Ga0207648_100290216 69
914 3300026089 Ga0207648_10053971 Ga0207648_100539714 69
915 3300026089 Ga0207648_10146863 Ga0207648_101468633 69
916 3300026089 Ga0207648_10781787 Ga0207648_107817872 69
917 3300026095 Ga0207676_10000660 Ga0207676_1000066029 69
918 3300026116 Ga0207674_10825990 Ga0207674_108259901 69
919 3300026118 Ga0207675_100019157 Ga0207675_1000191572 69
920 3300026121 Ga0207683_10070308 Ga0207683_100703082 69
921 3300026121 Ga0207683_10178407 Ga0207683_101784073 69
922 3300026121 Ga0207683_10407713 Ga0207683_104077132 69
923 3300026142 Ga0207698_10048051 Ga0207698_100480514 69
924 3300026142 Ga0207698_11533569 Ga0207698_115335692 69
925 3300027312 Ga0209371_1036352 Ga0209371_10363522 69
926 3300027866 Ga0209813_10009482 Ga0209813_100094823 69
927 3300027866 Ga0209813_10073825 Ga0209813_100738252 69
928 3300027907 Ga0207428_11165531 Ga0207428_111655312 69
929 3300028380 Ga0268265_10109496 Ga0268265_101094963 69
930 3300028381 Ga0268264_10680355 Ga0268264_106803552 69
931 3300028786 Ga0307517_10074242 Ga0307517_100742424 69
932 3300028786 Ga0307517_10173931 Ga0307517_101739312 69
933 3300028786 Ga0307517_10267130 Ga0307517_102671302 69
934 3300028794 Ga0307515_10105571 Ga0307515_101055713 69
935 3300028794 Ga0307515_10105752 Ga0307515_101057523 69
936 3300028794 Ga0307515_10409874 Ga0307515_104098742 69
937 3300030500 Ga0268256_1044252 Ga0268256_10442522 69
938 3300030522 Ga0307512_10175569 Ga0307512_101755692 69
939 3300031456 Ga0307513_10754781 Ga0307513_107547811 69
940 3300031507 Ga0307509_10861347 Ga0307509_108613472 69
941 3300031548 Ga0307408_100014492 Ga0307408_1000144928 69
942 3300031616 Ga0307508_10517386 Ga0307508_105173862 69
943 3300031730 Ga0307516_10004112 Ga0307516_1000411210 69
944 3300031730 Ga0307516_10847704 Ga0307516_108477042 69
945 3300031995 Ga0307409_101671358 Ga0307409_1016713582 69
946 3300032005 Ga0307411_10008760 Ga0307411_100087604 69
947 3300033180 Ga0307510_10256422 Ga0307510_102564222 69
948 3300034817 Ga0373948_0017056 Ga0373948_0017056_603_818 69
949 3300034818 Ga0373950_0010239 Ga0373950_0010239_1277_1492 69
950 3300035088 Ga0373940_0000136 Ga0373940_0000136_1272_1487 69
951 3300035089 Ga0373944_0040391 Ga0373944_0040391_910_1152 69
952 3300035090 Ga0373949_0095761 Ga0373949_0095761_75_290 69
953 3300035114 Ga0373939_0000059 Ga0373939_0000059_33020_33235 69
954 3300035121 Ga0373960_0001178 Ga0373960_0001178_4085_4300 69
955 3300035691 Ga0373931_0000334 Ga0373931_0000334_15473_15688 69
956 3300037466 Ga0395898_0729126 Ga0395898_0729126_368_577 69
957 3300037471 Ga0395905_0212641 Ga0395905_0212641_996_1205 69
958 3300037471 Ga0395905_0888196 Ga0395905_0888196_391_600 69
959 3300037853 Ga0436364_0410954 Ga0436364_0410954_317_538 69
960 3300041410 Ga0439461_0066004 Ga0439461_0066004_550_765 69
961 3300041452 Ga0451793_1409532 Ga0451793_1409532_256_483 69
962 3300041456 Ga0451795_1063439 Ga0451795_1063439_173_400 69
963 3300041458 Ga0451798_0749136 Ga0451798_0749136_104_322 69
964 3300041460 Ga0451802_1320011 Ga0451802_1320011_105_332 69
965 3300041463 Ga0451804_0639527 Ga0451804_0639527_263_490 69
966 3300041505 Ga0451849_1244220 Ga0451849_1244220_306_533 69
967 3300041507 Ga0451851_1153008 Ga0451851_1153008_99_326 69
968 3300041512 Ga0451853_3130241 Ga0451853_3130241_214_432 69
969 3300042001 Ga0439441_185558 Ga0439441_185558_25_243 69
970 3300042008 Ga0439450_044909 Ga0439450_044909_192_410 69
971 3300042011 Ga0439454_076130 Ga0439454_076130_326_541 69
972 3300042116 Ga0450912_020394 Ga0450912_020394_276_491 69
973 3300042116 Ga0450912_037144 Ga0450912_037144_269_481 69
974 3300042120 Ga0450917_008273 Ga0450917_008273_263_478 69
975 3300042126 Ga0450888_001212 Ga0450888_001212_1993_2208 69
976 3300042127 Ga0450890_000667 Ga0450890_000667_3053_3268 69
977 3300042127 Ga0450890_009886 Ga0450890_009886_830_1045 69
978 3300042129 Ga0450891_000038 Ga0450891_000038_6095_6310 69
979 3300042130 Ga0450892_002137 Ga0450892_002137_664_879 69
980 3300042138 Ga0450903_048854 Ga0450903_048854_221_436 69
981 3300042139 Ga0450904_014314 Ga0450904_014314_30_245 69
982 3300042142 Ga0450905_013636 Ga0450905_013636_731_946 69
983 3300042144 Ga0450889_000077 Ga0450889_000077_6018_6233 69
984 3300042437 Ga0439444_0025232 Ga0439444_0025232_747_962 69
985 3300042438 Ga0439459_0006048 Ga0439459_0006048_290_505 69
986 3300042438 Ga0439459_0135819 Ga0439459_0135819_204_419 69
987 3300042439 Ga0439464_0063933 Ga0439464_0063933_816_1034 69
988 3300042439 Ga0439464_0075616 Ga0439464_0075616_229_444 69
989 3300042531 Ga0450918_103656 Ga0450918_103656_11_253 69
990 3300042532 Ga0450893_0000835 Ga0450893_0000835_532_747 69
991 3300042876 Ga0451577_0003346 Ga0451577_0003346_10343_10567 69
992 3300044694 Ga0466963_0169972 Ga0466963_0169972_985_1200 69
993 3300044712 Ga0453684_1260097 Ga0453684_1260097_127_351 69
994 3300045051 Ga0451576_2468493 Ga0451576_2468493_51_266 69
995 3300046455 Ga0495603_0132725 Ga0495603_0132725_943_1185 69
996 3300046457 Ga0495590_0020006 Ga0495590_0020006_148_393 69
997 3300046512 Ga0495610_0077829 Ga0495610_0077829_227_472 69
998 3300046519 Ga0495632_0007493 Ga0495632_0007493_4566_4811 69
999 3300046522 Ga0495643_0178509 Ga0495643_0178509_702_929 69
1000 3300046525 Ga0495663_0037655 Ga0495663_0037655_43_270 69
1001 3300046528 Ga0495642_0046396 Ga0495642_0046396_107_340 69
1002 3300046530 Ga0495654_0392669 Ga0495654_0392669_110_355 69
1003 3300046537 Ga0495598_0218020 Ga0495598_0218020_199_441 69
1004 3300046538 Ga0495609_0218623 Ga0495609_0218623_397_642 69
1005 3300046539 Ga0495621_0022142 Ga0495621_0022142_131_346 69
1006 3300046539 Ga0495621_0059719 Ga0495621_0059719_948_1166 69
1007 3300046539 Ga0495621_0162629 Ga0495621_0162629_54_272 69
1008 3300046542 Ga0495597_0289147 Ga0495597_0289147_172_417 69
1009 3300046558 Ga0495633_0397649 Ga0495633_0397649_190_408 69
1010 3300046616 Ga0495668_0304446 Ga0495668_0304446_429_674 69
1011 3300046648 Ga0495611_0330984 Ga0495611_0330984_59_304 69
1012 3300046660 Ga0495625_0482719 Ga0495625_0482719_123_368 69
1013 3300046681 Ga0495647_0073734 Ga0495647_0073734_510_728 69
1014 3300046683 Ga0495658_0056885 Ga0495658_0056885_1694_1936 69
1015 3300046691 Ga0495670_0385768 Ga0495670_0385768_460_702 69
1016 3300046694 Ga0495649_0129737 Ga0495649_0129737_215_460 69
1017 3300046810 Ga0495660_0010853 Ga0495660_0010853_4940_5185 69
1018 3300046810 Ga0495660_0396678 Ga0495660_0396678_156_383 69
1019 3300047321 Ga0495676_1039322 Ga0495676_1039322_47_289 69
1020 3300047443 Ga0495687_006891 Ga0495687_006891_107_352 69
1021 3300047443 Ga0495687_011062 Ga0495687_011062_951_1196 69
1022 3300048907 Ga0496104_0077738 Ga0496104_0077738_2901_3143 69
1023 3300048907 Ga0496104_0469705 Ga0496104_0469705_745_963 69
1024 3300048908 Ga0496105_0036788 Ga0496105_0036788_2794_3036 69
1025 3300048910 Ga0496107_0297231 Ga0496107_0297231_513_755 69
1026 3300048913 Ga0496110_0252319 Ga0496110_0252319_1350_1592 69
1027 3300048917 Ga0496114_0951788 Ga0496114_0951788_248_490 69
1028 3300048925 Ga0496122_0522641 Ga0496122_0522641_135_377 69
1029 3300048926 Ga0496123_0449855 Ga0496123_0449855_83_325 69
1030 3300049127 Ga0501306_072310 Ga0501306_072310_122_337 69
1031 3300049128 Ga0501308_013624 Ga0501308_013624_198_413 69
1032 3300049128 Ga0501308_047802 Ga0501308_047802_274_489 69
1033 3300049130 Ga0501310_001719 Ga0501310_001719_854_1069 69
1034 3300049160 Ga0501304_013783 Ga0501304_013783_174_389 69
1035 3300049161 Ga0501305_076265 Ga0501305_076265_222_437 69
1036 3300049459 Ga0495678_266541 Ga0495678_266541_142_387 69
1037 3300049460 Ga0495682_0045286 Ga0495682_0045286_1204_1449 69
1038 3300049513 Ga0501290_055454 Ga0501290_055454_16_231 69
1039 3300049514 Ga0501291_001998 Ga0501291_001998_1980_2195 69
1040 3300049517 Ga0501294_009959 Ga0501294_009959_386_601 69
1041 3300049518 Ga0501295_039868 Ga0501295_039868_477_692 69
1042 3300049519 Ga0501296_009534 Ga0501296_009534_687_902 69
1043 3300049520 Ga0501297_007843 Ga0501297_007843_522_737 69
1044 3300049521 Ga0501298_022067 Ga0501298_022067_427_642 69
1045 3300049523 Ga0501300_002663 Ga0501300_002663_2387_2602 69
1046 3300049527 Ga0501311_036903 Ga0501311_036903_203_418 69
1047 3300049528 Ga0501312_011659 Ga0501312_011659_113_328 69
1048 3300049529 Ga0501313_069197 Ga0501313_069197_71_286 69
1049 3300049530 Ga0501314_000884 Ga0501314_000884_609_824 69
1050 3300049531 Ga0501315_009330 Ga0501315_009330_554_769 69
1051 3300049533 Ga0501317_044182 Ga0501317_044182_158_373 69
1052 3300049534 Ga0501318_036241 Ga0501318_036241_158_373 69
1053 3300049535 Ga0501319_014471 Ga0501319_014471_110_325 69
1054 3300049539 Ga0501323_070860 Ga0501323_070860_197_412 69
1055 3300049571 Ga0501034_0408271 Ga0501034_0408271_740_955 69
1056 3300049581 Ga0501047_0549524 Ga0501047_0549524_30_245 69
1057 3300049650 Ga0501199_003769 Ga0501199_003769_613_828 69
1058 3300049651 Ga0501201_001747 Ga0501201_001747_257_472 69
1059 3300049652 Ga0501202_021014 Ga0501202_021014_612_827 69
1060 3300049653 Ga0501206_050724 Ga0501206_050724_144_359 69
1061 3300049655 Ga0501208_095721 Ga0501208_095721_106_321 69
1062 3300049658 Ga0501211_001829 Ga0501211_001829_1154_1369 69
1063 3300049661 Ga0501217_145839 Ga0501217_145839_242_457 69
1064 3300049663 Ga0501223_025635 Ga0501223_025635_576_791 69
1065 3300049665 Ga0501227_019570 Ga0501227_019570_830_1045 69
1066 3300049668 Ga0501233_001981 Ga0501233_001981_2875_3090 69
1067 3300049669 Ga0501235_002121 Ga0501235_002121_2783_2998 69
1068 3300049670 Ga0501236_012853 Ga0501236_012853_385_600 69
1069 3300049684 Ga0501255_003573 Ga0501255_003573_736_951 69
1070 3300049686 Ga0501257_030638 Ga0501257_030638_822_1037 69
1071 3300049687 Ga0501258_001648 Ga0501258_001648_495_710 69
1072 3300049687 Ga0501258_032800 Ga0501258_032800_284_499 69
1073 3300049688 Ga0501259_115694 Ga0501259_115694_332_547 69
1074 3300049704 Ga0501221_019877 Ga0501221_019877_585_800 69
1075 3300049705 Ga0501225_0011857 Ga0501225_0011857_2065_2280 69
1076 3300049706 Ga0501229_032828 Ga0501229_032828_122_337 69
1077 3300049759 Ga0501262_002466 Ga0501262_002466_1389_1604 69
1078 3300049762 Ga0501265_003770 Ga0501265_003770_1452_1667 69
1079 3300049764 Ga0501267_000056 Ga0501267_000056_4404_4619 69
1080 3300049765 Ga0501268_066803 Ga0501268_066803_249_464 69
1081 3300049766 Ga0501269_016545 Ga0501269_016545_159_374 69
1082 3300049769 Ga0501272_015592 Ga0501272_015592_532_747 69
1083 3300049771 Ga0501274_015371 Ga0501274_015371_515_730 69
1084 3300049778 Ga0501282_005077 Ga0501282_005077_443_658 69
1085 3300050489 nmdc:mga03683_231906_c1 nmdc:mga03683_231906_c1_42_287 69
1086 3300050489 nmdc:mga03683_90593_c1 nmdc:mga03683_90593_c1_574_819 69
1087 3300050490 nmdc:mga03n38_109784_c1 nmdc:mga03n38_109784_c1_493_738 69
1088 3300050490 nmdc:mga03n38_814307_c1 nmdc:mga03n38_814307_c1_258_479 69
1089 3300050493 nmdc:mga0k408_173989_c1 nmdc:mga0k408_173989_c1_227_442 69
1090 3300050493 nmdc:mga0k408_19343_c1 nmdc:mga0k408_19343_c1_1935_2150 69
1091 3300050493 nmdc:mga0k408_32128_c1 nmdc:mga0k408_32128_c1_1055_1276 69
1092 3300050493 nmdc:mga0k408_409501_c1 nmdc:mga0k408_409501_c1_565_786 69
1093 3300050493 nmdc:mga0k408_58093_c1 nmdc:mga0k408_58093_c1_365_610 69
1094 3300050493 nmdc:mga0k408_735492_c1 nmdc:mga0k408_735492_c1_258_473 69
1095 3300050493 nmdc:mga0k408_8304_c1 nmdc:mga0k408_8304_c1_5227_5454 69
1096 3300050493 nmdc:mga0k408_9558_c1 nmdc:mga0k408_9558_c1_85_330 69
1097 3300050494 nmdc:mga06z11_343415_c1 nmdc:mga06z11_343415_c1_208_429 69
1098 3300050494 nmdc:mga06z11_406722_c1 nmdc:mga06z11_406722_c1_246_461 69
1099 3300050494 nmdc:mga06z11_462098_c1 nmdc:mga06z11_462098_c1_173_388 69
1100 3300050494 nmdc:mga06z11_542945_c1 nmdc:mga06z11_542945_c1_366_611 69
1101 3300050495 nmdc:mga04h51_226751_c1 nmdc:mga04h51_226751_c1_404_625 69
1102 3300050496 nmdc:mga07m45_1252_c1 nmdc:mga07m45_1252_c1_229_474 69
1103 3300050496 nmdc:mga07m45_184627_c1 nmdc:mga07m45_184627_c1_911_1156 69
1104 3300050496 nmdc:mga07m45_232051_c1 nmdc:mga07m45_232051_c1_57_272 69
1105 3300050496 nmdc:mga07m45_31872_c1 nmdc:mga07m45_31872_c1_372_587 69
1106 3300050496 nmdc:mga07m45_432176_c1 nmdc:mga07m45_432176_c1_178_393 69
1107 3300050496 nmdc:mga07m45_44069_c1 nmdc:mga07m45_44069_c1_439_660 69
1108 3300050496 nmdc:mga07m45_8788_c1 nmdc:mga07m45_8788_c1_62_307 69
1109 3300050511 nmdc:mga08y16_1950544_c1 nmdc:mga08y16_1950544_c1_232_477 69
1110 3300050516 nmdc:mga0sz30_46262_c1 nmdc:mga0sz30_46262_c1_590_835 69
1111 3300050516 nmdc:mga0sz30_89692_c1 nmdc:mga0sz30_89692_c1_420_665 69
1112 3300053092 Ga0500583_0499237 Ga0500583_0499237_204_431 69
1113 3300053093 Ga0500651_0304817 Ga0500651_0304817_520_747 69
1114 3300053098 Ga0500650_0060669 Ga0500650_0060669_139_390 69
1115 3300053134 Ga0500658_0002795 Ga0500658_0002795_622_867 69
1116 3300053137 Ga0500561_0251506 Ga0500561_0251506_287_508 69
1117 3300053139 Ga0500568_0204579 Ga0500568_0204579_99_344 69
1118 3300059421 Ga0590071_001624 Ga0590071_001624_4654_4875 69
1119 3300059423 Ga0590074_063491 Ga0590074_063491_265_486 69
1120 3300002077 JGI24744J21845_10021994 JGI24744J21845_100219942 70
1121 3300003323 rootH1_10003293 rootH1_1000329318 70
1122 3300003771 Ga0055526_1024551 Ga0055526_10245513 70
1123 3300003790 Ga0055528_1075278 Ga0055528_10752781 70
1124 3300003792 Ga0055540_1048691 Ga0055540_10486912 70
1125 3300003794 Ga0055531_10002886 Ga0055531_100028863 70
1126 3300005262 Ga0065165_1000086 Ga0065165_100008641 70
1127 3300005344 Ga0070661_100503360 Ga0070661_1005033602 70
1128 3300005457 Ga0070662_100001692 Ga0070662_1000016929 70
1129 3300005843 Ga0068860_100647217 Ga0068860_1006472172 70
1130 3300006846 Ga0075430_101699021 Ga0075430_1016990212 70
1131 3300006942 Ga0099824_1052367 Ga0099824_10523672 70
1132 3300006944 Ga0099823_1000003 Ga0099823_1000003106 70
1133 3300009036 Ga0105244_10316941 Ga0105244_103169412 70
1134 3300009093 Ga0105240_11408338 Ga0105240_114083382 70
1135 3300025242 Ga0209258_106366 Ga0209258_1063662 70
1136 3300025273 Ga0209673_1003399 Ga0209673_10033992 70
1137 3300025273 Ga0209673_1051533 Ga0209673_10515332 70
1138 3300025295 Ga0209564_1000229 Ga0209564_100022980 70
1139 3300025298 Ga0209050_1060364 Ga0209050_10603642 70
1140 3300025299 Ga0209256_1004519 Ga0209256_10045192 70
1141 3300025303 Ga0209051_1001942 Ga0209051_10019427 70
1142 3300025304 Ga0209257_1001796 Ga0209257_100179626 70
1143 3300025913 Ga0207695_11149153 Ga0207695_111491531 70
1144 3300025933 Ga0207706_10005001 Ga0207706_100050012 70
1145 3300027296 Ga0209389_1033766 Ga0209389_10337663 70
1146 3300028381 Ga0268264_10363049 Ga0268264_103630492 70
1147 3300031344 Ga0265316_10000180 Ga0265316_1000018073 70
1148 3300032002 Ga0307416_101546051 Ga0307416_1015460512 70
1149 3300037418 Ga0395900_0000387 Ga0395900_0000387_54129_54347 70
1150 3300037466 Ga0395898_0000958 Ga0395898_0000958_37149_37367 70
1151 3300037471 Ga0395905_0017509 Ga0395905_0017509_6451_6666 70
1152 3300037471 Ga0395905_0043266 Ga0395905_0043266_3725_3943 70
1153 3300037471 Ga0395905_0082870 Ga0395905_0082870_50_265 70
1154 3300037471 Ga0395905_0630520 Ga0395905_0630520_589_804 70
1155 3300037471 Ga0395905_1415934 Ga0395905_1415934_151_363 70
1156 3300041408 Ga0439453_0092932 Ga0439453_0092932_256_477 70
1157 3300041413 Ga0439465_0042070 Ga0439465_0042070_1057_1278 70
1158 3300041443 Ga0451789_0529892 Ga0451789_0529892_319_549 70
1159 3300041451 Ga0451791_0898320 Ga0451791_0898320_249_470 70
1160 3300041999 Ga0439433_0032858 Ga0439433_0032858_318_536 70
1161 3300042001 Ga0439441_170853 Ga0439441_170853_249_467 70
1162 3300042004 Ga0439445_0118230 Ga0439445_0118230_326_547 70
1163 3300042007 Ga0439449_0219225 Ga0439449_0219225_58_297 70
1164 3300042015 Ga0439462_0030492 Ga0439462_0030492_389_607 70
1165 3300042133 Ga0450896_010182 Ga0450896_010182_171_386 70
1166 3300042133 Ga0450896_013473 Ga0450896_013473_211_432 70
1167 3300042135 Ga0450899_012978 Ga0450899_012978_65_280 70
1168 3300044656 Ga0466969_0000009 Ga0466969_0000009_19821_20039 70
1169 3300044656 Ga0466969_0033505 Ga0466969_0033505_1635_1847 70
1170 3300044656 Ga0466969_0099931 Ga0466969_0099931_631_849 70
1171 3300044658 Ga0466972_0000303 Ga0466972_0000303_18099_18353 70
1172 3300044658 Ga0466972_0411468 Ga0466972_0411468_257_469 70
1173 3300044683 Ga0466965_0029857 Ga0466965_0029857_2167_2421 70
1174 3300044683 Ga0466965_0054438 Ga0466965_0054438_547_765 70
1175 3300044683 Ga0466965_0121033 Ga0466965_0121033_304_519 70
1176 3300044683 Ga0466965_0255796 Ga0466965_0255796_537_755 70
1177 3300044683 Ga0466965_0365573 Ga0466965_0365573_339_551 70
1178 3300044683 Ga0466965_0380129 Ga0466965_0380129_134_376 70
1179 3300044684 Ga0466966_0006238 Ga0466966_0006238_2372_2584 70
1180 3300044684 Ga0466966_0085141 Ga0466966_0085141_995_1213 70
1181 3300044693 Ga0466961_0007837 Ga0466961_0007837_2372_2584 70
1182 3300044693 Ga0466961_0113254 Ga0466961_0113254_651_869 70
1183 3300044693 Ga0466961_0120872 Ga0466961_0120872_1321_1575 70
1184 3300044693 Ga0466961_0217368 Ga0466961_0217368_763_981 70
1185 3300044694 Ga0466963_0070042 Ga0466963_0070042_1062_1274 70
1186 3300044706 Ga0466964_0008231 Ga0466964_0008231_175_387 70
1187 3300044706 Ga0466964_0102018 Ga0466964_0102018_497_715 70
1188 3300044712 Ga0453684_0633040 Ga0453684_0633040_124_351 70
1189 3300044719 Ga0466971_0005085 Ga0466971_0005085_538_756 70
1190 3300044719 Ga0466971_0490179 Ga0466971_0490179_152_406 70
1191 3300044735 Ga0466968_0124907 Ga0466968_0124907_174_416 70
1192 3300044765 Ga0466970_0065532 Ga0466970_0065532_200_418 70
1193 3300044842 Ga0466957_0029032 Ga0466957_0029032_2803_3015 70
1194 3300044842 Ga0466957_0043697 Ga0466957_0043697_1844_2062 70
1195 3300044901 Ga0466960_0019732 Ga0466960_0019732_2575_2817 70
1196 3300045049 Ga0466959_0006139 Ga0466959_0006139_3489_3701 70
1197 3300045049 Ga0466959_0024130 Ga0466959_0024130_660_878 70
1198 3300045049 Ga0466959_0038351 Ga0466959_0038351_44_262 70
1199 3300045049 Ga0466959_1162274 Ga0466959_1162274_29_283 70
1200 3300045836 Ga0466958_0055977 Ga0466958_0055977_1248_1460 70
1201 3300045836 Ga0466958_0125402 Ga0466958_0125402_1166_1384 70
1202 3300045976 Ga0466967_0235571 Ga0466967_0235571_448_660 70
1203 3300046522 Ga0495643_0337173 Ga0495643_0337173_117_335 70
1204 3300046691 Ga0495670_0048271 Ga0495670_0048271_1672_1890 70
1205 3300048910 Ga0496107_0596399 Ga0496107_0596399_490_708 70
1206 3300048911 Ga0496108_1509713 Ga0496108_1509713_66_284 70
1207 3300048912 Ga0496109_1197313 Ga0496109_1197313_423_641 70
1208 3300048912 Ga0496109_1581517 Ga0496109_1581517_137_358 70
1209 3300048913 Ga0496110_0092477 Ga0496110_0092477_798_1019 70
1210 3300048928 Ga0496125_0481248 Ga0496125_0481248_219_437 70
1211 3300053156 Ga0500622_0005593 Ga0500622_0005593_5333_5551 70
1212 3300061719 Ga0466962_0036494 Ga0466962_0036494_1508_1720 70
1213 3300061719 Ga0466962_0089450 Ga0466962_0089450_727_945 70

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10276

zf-CHCC

Zinc-finger domain

34

72

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ar7-assembly1.cif.gz_R cryo-em structure of arabidopsis thaliana complex-i (open conformation) 0.7018 10 61
8esz-assembly1.cif.gz_S6 structure of mitochondrial complex i from drosophila melanogaster, helix-locked state 0.6979 11 61
7arb-assembly1.cif.gz_R cryo-em structure of arabidopsis thaliana complex-i (complete composition) 0.6955 10 61
8ba0-assembly1.cif.gz_R drosophila melanogaster complex i in the twisted state (dm2) 0.6861 11 61
7ar8-assembly1.cif.gz_R cryo-em structure of arabidopsis thaliana complex-i (closed conformation) 0.6821 10 61
ID Description Score Start End Superfamily
2jvmA01 Mainly Beta;Sandwich;HSP40/DNAj peptide-binding domain;q5lls5 like domains 0.693 9 61 2.60.260.40
af_P29505_31_113_2.60.11.10 Mainly Beta;Sandwich;Cytochrome C Oxidase; Chain F;Cytochrome c oxidase, subunit Vb 0.6082 9 61 2.60.11.10
2jvmA01 Mainly Beta;Sandwich;HSP40/DNAj peptide-binding domain;q5lls5 like domains 0.6071 9 61 2.60.260.40
2jz8A00 Mainly Beta;Sandwich;HSP40/DNAj peptide-binding domain;q5lls5 like domains 0.5677 9 66 2.60.260.40
af_Q7YZT6_879_985_1.20.58.1800 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.5291 13 43 1.20.58.1800
ID Description Score Start End GO Terms
AF-A0A519ZV48-F1-model_v4 Zinc-finger domain-containing protein 0.9245 8 70
AF-A0A4Q3R386-F1-model_v4 deleted 0.9005 8 70
AF-A0A1L1PQT8-F1-model_v4 Zinc-finger domain containing protein 0.8995 6 70
AF-A0A255ZKZ9-F1-model_v4 Zinc finger CHCC-type domain-containing protein 0.8951 8 70
AF-A0A4Q5PN54-F1-model_v4 Zinc-finger domain-containing protein 0.8907 6 70

Feature Viewer

pLDDT pTM Quality
81.83 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map