F491678
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1208 | 369 | 1206 | 388 |
Family's Representative Sequence
| Representative Sequence | 3300005617|Ga0068859_100281519|Ga0068859_1002815192 |
| Length | 437 |
| Sequence | MKVSSFEFRVSGPAAPRKNQSRRLHRRGVAKEPETRNINMVMSAKTKSDNIVAIEEQYQVATYKKMPVVAERGEGVWLFTSDGERYLDLYGGHAVAGTGHCHPHVVSAIKNQADRLLFYSNLVYSEARARAAEKLVSIAPESLTKAFFCNSGTEANENAMRMARMATGREQVITFGGGFHGRTADAISATFLGKYREIGKPNVPGHLKAEFGDIENVRGLADESVAAIMLEPIQSMAGVRMAGSEYYQALRELCDQRGIVLIYDEVQTGVGRTGEWFFAGSDAGDGVVPDIVTLAKALGSGIPVGACLVTEKISSQIKENDLGTTFGGGMMAMAAVSATLEAIENDGMLANVRAVEAHLRERLKEVEQVVAVHGKGLLLGLEFADKAKPVHEGLLEQKIITGTSSDPRVLRLLPPLCLQKDQVDLFVDALGKVFAQS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2833640130 | Mariniflexile sp. TRM1-10 | Isolate | Rhizosphere |
| 3 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
| 4 | 3300000531 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled | Metagenome | Rhizosphere |
| 5 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 6 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 7 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 8 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 9 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 10 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 11 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 76 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 77 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 78 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 79 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 80 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 81 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 82 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 83 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 84 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 85 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 86 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 87 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 88 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 94 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 95 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 96 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 97 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 98 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 99 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 100 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 101 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 102 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 104 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 118 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 135 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 136 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 199 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 200 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 204 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 205 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 206 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 207 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 208 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 209 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 210 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 211 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 212 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 213 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 214 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 215 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 216 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 217 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 218 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 219 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 220 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 221 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 222 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 223 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 224 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 225 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 226 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 227 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 228 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 229 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 230 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 231 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 232 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 233 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 234 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 236 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 237 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 238 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 239 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 240 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 241 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 243 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 244 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 245 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 246 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 247 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 248 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 249 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 250 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 251 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 252 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 253 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 254 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 255 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 256 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 257 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 258 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 259 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 260 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 261 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 262 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 263 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 264 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 265 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 266 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 267 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 299 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 300 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 301 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 302 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 303 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 306 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 307 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 308 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 309 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 310 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 311 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 312 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 313 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 314 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 335 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 336 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 337 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 338 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 339 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 340 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 341 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 342 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 343 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 348 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 363 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 364 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 365 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 366 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 367 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 368 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.67 |
| Metatranscriptomes | 0.17 |
| Isolates | 0.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.66 |
| Nodule | 0 |
| Rhizoplane | 4.39 |
| Rhizosphere | 93.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_10898535 | 2162886012 | Bacteria | 1366 |
| 2 | CNBas_1000308 | 3300000531 | Bacteria | 1978 |
| 3 | LJQas_1000004 | 3300000549 | Bacteria | 34891 |
| 4 | JGI24748J21848_1000002 | 3300002074 | Bacteria | 426946 |
| 5 | JGI24034J26672_10000004 | 3300002239 | Bacteria | 426946 |
| 6 | JGI24751J29686_10000012 | 3300002459 | Bacteria | 115709 |
| 7 | JGI25406J46586_10004388 | 3300003203 | Bacteria | 6577 |
| 8 | JGI25406J46586_10006498 | 3300003203 | Bacteria | 5379 |
| 9 | rootH2_10076012 | 3300003320 | Bacteria | 2616 |
| 10 | Ga0065714_10064422 | 3300005288 | Bacteria | 270668 |
| 11 | Ga0065704_10000986 | 3300005289 | Bacteria | 13773 |
| 12 | Ga0065704_10142747 | 3300005289 | Bacteria | 1502 |
| 13 | Ga0065712_10067728 | 3300005290 | Bacteria | 178215 |
| 14 | Ga0065712_10085973 | 3300005290 | Bacteria | 2647 |
| 15 | Ga0065715_10100505 | 3300005293 | Bacteria | 3296 |
| 16 | Ga0065715_10112355 | 3300005293 | Bacteria | 2517 |
| 17 | Ga0065715_10148838 | 3300005293 | Bacteria | 1741 |
| 18 | Ga0065715_10167926 | 3300005293 | Bacteria | 1571 |
| 19 | Ga0065707_10000589 | 3300005295 | Bacteria | 29520 |
| 20 | Ga0065707_10001006 | 3300005295 | Bacteria | 8756 |
| 21 | Ga0065707_10082702 | 3300005295 | Bacteria | 12640 |
| 22 | Ga0065707_10134320 | 3300005295 | Bacteria | 1867 |
| 23 | Ga0070658_10014417 | 3300005327 | Bacteria | 6343 |
| 24 | Ga0070676_10002136 | 3300005328 | Bacteria | 10067 |
| 25 | Ga0070683_100245314 | 3300005329 | Bacteria | 1704 |
| 26 | Ga0070690_100009821 | 3300005330 | Bacteria | 5554 |
| 27 | Ga0070690_100038453 | 3300005330 | Bacteria | 3020 |
| 28 | Ga0070690_100069198 | 3300005330 | Unclassified | 2290 |
| 29 | Ga0070690_100109244 | 3300005330 | Bacteria | 1843 |
| 30 | Ga0070690_100158316 | 3300005330 | Bacteria | 1550 |
| 31 | Ga0070670_100000165 | 3300005331 | Bacteria | 59984 |
| 32 | Ga0070670_100002492 | 3300005331 | Bacteria | 15184 |
| 33 | Ga0070670_100026909 | 3300005331 | Bacteria | 4947 |
| 34 | Ga0070670_100034090 | 3300005331 | Bacteria | 4382 |
| 35 | Ga0070670_100199662 | 3300005331 | Bacteria | 1737 |
| 36 | Ga0070670_100237816 | 3300005331 | Bacteria | 1586 |
| 37 | Ga0070677_10076772 | 3300005333 | Unclassified | 1419 |
| 38 | Ga0068869_100012015 | 3300005334 | Bacteria | 5702 |
| 39 | Ga0068869_100017710 | 3300005334 | Unclassified | 4836 |
| 40 | Ga0068869_100018237 | 3300005334 | Bacteria | 4774 |
| 41 | Ga0068869_100050893 | 3300005334 | Bacteria | 3004 |
| 42 | Ga0068869_100052614 | 3300005334 | Bacteria | 2957 |
| 43 | Ga0068869_100133965 | 3300005334 | Bacteria | 1907 |
| 44 | Ga0068869_100203913 | 3300005334 | Bacteria | 1560 |
| 45 | Ga0070666_10017753 | 3300005335 | Bacteria | 4565 |
| 46 | Ga0070666_10066114 | 3300005335 | Unclassified | 2453 |
| 47 | Ga0070680_100000123 | 3300005336 | Bacteria | 45833 |
| 48 | Ga0070680_100075571 | 3300005336 | Bacteria | 2773 |
| 49 | Ga0070680_100170137 | 3300005336 | Unclassified | 1833 |
| 50 | Ga0070682_100000271 | 3300005337 | Bacteria | 37361 |
| 51 | Ga0070682_100018666 | 3300005337 | Bacteria | 4059 |
| 52 | Ga0070682_100219920 | 3300005337 | Bacteria | 1351 |
| 53 | Ga0068868_100067416 | 3300005338 | Bacteria | 2848 |
| 54 | Ga0068868_100074489 | 3300005338 | Bacteria | 2711 |
| 55 | Ga0068868_100099959 | 3300005338 | Bacteria | 2347 |
| 56 | Ga0068868_100164196 | 3300005338 | Bacteria | 1836 |
| 57 | Ga0070660_100046712 | 3300005339 | Bacteria | 3320 |
| 58 | Ga0070689_100001120 | 3300005340 | Bacteria | 16876 |
| 59 | Ga0070689_100042885 | 3300005340 | Bacteria | 3475 |
| 60 | Ga0070689_100051380 | 3300005340 | Bacteria | 3187 |
| 61 | Ga0070689_100100283 | 3300005340 | Unclassified | 2291 |
| 62 | Ga0070689_100136165 | 3300005340 | Bacteria | 1972 |
| 63 | Ga0070687_100128480 | 3300005343 | Bacteria | 1460 |
| 64 | Ga0070661_100014994 | 3300005344 | Bacteria | 5468 |
| 65 | Ga0070692_10014720 | 3300005345 | Bacteria | 3682 |
| 66 | Ga0070692_10056805 | 3300005345 | Bacteria | 2050 |
| 67 | Ga0070692_10069064 | 3300005345 | Bacteria | 1879 |
| 68 | Ga0070692_10077165 | 3300005345 | Bacteria | 1787 |
| 69 | Ga0070668_100188983 | 3300005347 | Bacteria | 1686 |
| 70 | Ga0070669_100000025 | 3300005353 | Bacteria | 170551 |
| 71 | Ga0070669_100023139 | 3300005353 | Bacteria | 4448 |
| 72 | Ga0070669_100180877 | 3300005353 | Bacteria | 1649 |
| 73 | Ga0070669_100190982 | 3300005353 | Bacteria | 1607 |
| 74 | Ga0070669_100211433 | 3300005353 | Unclassified | 1530 |
| 75 | Ga0070675_100137803 | 3300005354 | Bacteria | 2084 |
| 76 | Ga0070675_100141218 | 3300005354 | Bacteria | 2059 |
| 77 | Ga0070671_100002614 | 3300005355 | Bacteria | 13937 |
| 78 | Ga0070671_100025316 | 3300005355 | Bacteria | 4868 |
| 79 | Ga0070671_100032235 | 3300005355 | Bacteria | 4333 |
| 80 | Ga0070671_100039494 | 3300005355 | Bacteria | 3918 |
| 81 | Ga0070671_100115325 | 3300005355 | Unclassified | 2258 |
| 82 | Ga0070674_100000315 | 3300005356 | Bacteria | 23813 |
| 83 | Ga0070674_100086137 | 3300005356 | Bacteria | 2256 |
| 84 | Ga0070674_100125249 | 3300005356 | Bacteria | 1907 |
| 85 | Ga0070674_100130582 | 3300005356 | Bacteria | 1872 |
| 86 | Ga0070673_100036253 | 3300005364 | Bacteria | 3747 |
| 87 | Ga0070673_100043997 | 3300005364 | Unclassified | 3454 |
| 88 | Ga0070673_100049583 | 3300005364 | Unclassified | 3279 |
| 89 | Ga0070673_100057024 | 3300005364 | Bacteria | 3085 |
| 90 | Ga0070673_100090283 | 3300005364 | Bacteria | 2503 |
| 91 | Ga0070673_100118782 | 3300005364 | Bacteria | 2202 |
| 92 | Ga0070673_100133269 | 3300005364 | Bacteria | 2088 |
| 93 | Ga0070673_100145059 | 3300005364 | Bacteria | 2006 |
| 94 | Ga0070688_100034426 | 3300005365 | Unclassified | 3068 |
| 95 | Ga0070667_100036989 | 3300005367 | Bacteria | 4092 |
| 96 | Ga0070667_100043210 | 3300005367 | Bacteria | 3782 |
| 97 | Ga0070667_100070267 | 3300005367 | Bacteria | 2980 |
| 98 | Ga0070667_100256936 | 3300005367 | Bacteria | 1563 |
| 99 | Ga0070703_10000528 | 3300005406 | Bacteria | 14433 |
| 100 | Ga0070709_10000042 | 3300005434 | Bacteria | 105881 |
| 101 | Ga0070709_10000103 | 3300005434 | Bacteria | 60237 |
| 102 | Ga0070713_100008652 | 3300005436 | Bacteria | 7235 |
| 103 | Ga0070701_10021561 | 3300005438 | Bacteria | 3077 |
| 104 | Ga0070701_10031923 | 3300005438 | Bacteria | 2618 |
| 105 | Ga0070701_10039305 | 3300005438 | Bacteria | 2399 |
| 106 | Ga0070701_10157381 | 3300005438 | Bacteria | 1313 |
| 107 | Ga0070711_100000062 | 3300005439 | Bacteria | 64492 |
| 108 | Ga0070711_100000170 | 3300005439 | Bacteria | 34633 |
| 109 | Ga0070705_100000038 | 3300005440 | Bacteria | 66622 |
| 110 | Ga0070705_100002190 | 3300005440 | Bacteria | 9916 |
| 111 | Ga0070705_100012603 | 3300005440 | Bacteria | 4301 |
| 112 | Ga0070705_100016678 | 3300005440 | Bacteria | 3820 |
| 113 | Ga0070705_100018686 | 3300005440 | Bacteria | 3638 |
| 114 | Ga0070705_100156059 | 3300005440 | Bacteria | 1520 |
| 115 | Ga0070700_100000225 | 3300005441 | Bacteria | 31350 |
| 116 | Ga0070700_100008335 | 3300005441 | Bacteria | 5643 |
| 117 | Ga0070700_100037319 | 3300005441 | Bacteria | 2954 |
| 118 | Ga0070700_100056483 | 3300005441 | Unclassified | 2461 |
| 119 | Ga0070700_100128200 | 3300005441 | Bacteria | 1709 |
| 120 | Ga0070700_100133824 | 3300005441 | Bacteria | 1676 |
| 121 | Ga0070700_100139739 | 3300005441 | Bacteria | 1644 |
| 122 | Ga0070694_100000175 | 3300005444 | Bacteria | 33400 |
| 123 | Ga0070694_100011484 | 3300005444 | Bacteria | 5486 |
| 124 | Ga0070694_100013232 | 3300005444 | Bacteria | 5150 |
| 125 | Ga0070694_100043975 | 3300005444 | Bacteria | 2988 |
| 126 | Ga0070694_100048410 | 3300005444 | Bacteria | 2860 |
| 127 | Ga0070694_100057868 | 3300005444 | Bacteria | 2636 |
| 128 | Ga0070694_100075912 | 3300005444 | Bacteria | 2325 |
| 129 | Ga0070694_100092913 | 3300005444 | Bacteria | 2120 |
| 130 | Ga0070694_100135081 | 3300005444 | Bacteria | 1786 |
| 131 | Ga0070694_100226556 | 3300005444 | Bacteria | 1405 |
| 132 | Ga0070708_100001962 | 3300005445 | Bacteria | 15865 |
| 133 | Ga0070708_100010751 | 3300005445 | Bacteria | 7428 |
| 134 | Ga0070708_100155048 | 3300005445 | Bacteria | 2132 |
| 135 | Ga0070708_100222357 | 3300005445 | Bacteria | 1771 |
| 136 | Ga0070708_100245726 | 3300005445 | Unclassified | 1680 |
| 137 | Ga0070663_100083868 | 3300005455 | Bacteria | 2348 |
| 138 | Ga0070663_100098336 | 3300005455 | Bacteria | 2180 |
| 139 | Ga0070678_100293021 | 3300005456 | Bacteria | 1380 |
| 140 | Ga0070662_100004350 | 3300005457 | Bacteria | 8949 |
| 141 | Ga0070662_100129332 | 3300005457 | Bacteria | 1945 |
| 142 | Ga0070662_100169160 | 3300005457 | Unclassified | 1715 |
| 143 | Ga0070681_10001768 | 3300005458 | Bacteria | 19378 |
| 144 | Ga0070681_10002525 | 3300005458 | Bacteria | 16779 |
| 145 | Ga0070681_10003272 | 3300005458 | Bacteria | 15114 |
| 146 | Ga0070681_10014914 | 3300005458 | Bacteria | 7727 |
| 147 | Ga0070681_10029015 | 3300005458 | Bacteria | 5556 |
| 148 | Ga0070681_10044858 | 3300005458 | Bacteria | 4426 |
| 149 | Ga0070681_10053577 | 3300005458 | Bacteria | 4021 |
| 150 | Ga0070681_10076727 | 3300005458 | Bacteria | 3300 |
| 151 | Ga0070681_10109138 | 3300005458 | Bacteria | 2707 |
| 152 | Ga0070681_10109366 | 3300005458 | Bacteria | 2704 |
| 153 | Ga0070681_10277032 | 3300005458 | Bacteria | 1589 |
| 154 | Ga0070681_10286952 | 3300005458 | Bacteria | 1556 |
| 155 | Ga0068867_100001140 | 3300005459 | Bacteria | 18141 |
| 156 | Ga0068867_100064051 | 3300005459 | Bacteria | 2733 |
| 157 | Ga0068867_100259877 | 3300005459 | Bacteria | 1415 |
| 158 | Ga0070685_10002946 | 3300005466 | Bacteria | 8701 |
| 159 | Ga0070685_10045369 | 3300005466 | Unclassified | 2521 |
| 160 | Ga0070706_100000007 | 3300005467 | Bacteria | 228014 |
| 161 | Ga0070706_100000128 | 3300005467 | Bacteria | 92969 |
| 162 | Ga0070706_100001095 | 3300005467 | Bacteria | 29274 |
| 163 | Ga0070706_100013038 | 3300005467 | Bacteria | 7692 |
| 164 | Ga0070706_100019951 | 3300005467 | Bacteria | 6180 |
| 165 | Ga0070706_100028562 | 3300005467 | Bacteria | 5136 |
| 166 | Ga0070706_100092301 | 3300005467 | Bacteria | 2809 |
| 167 | Ga0070706_100163002 | 3300005467 | Bacteria | 2082 |
| 168 | Ga0070707_100000026 | 3300005468 | Bacteria | 124537 |
| 169 | Ga0070707_100007330 | 3300005468 | Bacteria | 10243 |
| 170 | Ga0070707_100012580 | 3300005468 | Bacteria | 7905 |
| 171 | Ga0070707_100029866 | 3300005468 | Bacteria | 5187 |
| 172 | Ga0070707_100109317 | 3300005468 | Unclassified | 2681 |
| 173 | Ga0070707_100137562 | 3300005468 | Bacteria | 2376 |
| 174 | Ga0070698_100001773 | 3300005471 | Bacteria | 24065 |
| 175 | Ga0070698_100004968 | 3300005471 | Bacteria | 14570 |
| 176 | Ga0070698_100005606 | 3300005471 | Bacteria | 13727 |
| 177 | Ga0070698_100011411 | 3300005471 | Bacteria | 9425 |
| 178 | Ga0070698_100013716 | 3300005471 | Bacteria | 8577 |
| 179 | Ga0070698_100034939 | 3300005471 | Bacteria | 5200 |
| 180 | Ga0070698_100043869 | 3300005471 | Bacteria | 4582 |
| 181 | Ga0070698_100111659 | 3300005471 | Bacteria | 2698 |
| 182 | Ga0070698_100127306 | 3300005471 | Bacteria | 2504 |
| 183 | Ga0070698_100204266 | 3300005471 | Bacteria | 1911 |
| 184 | Ga0070699_100000024 | 3300005518 | Bacteria | 161189 |
| 185 | Ga0070699_100000094 | 3300005518 | Bacteria | 85329 |
| 186 | Ga0070699_100001203 | 3300005518 | Bacteria | 23916 |
| 187 | Ga0070699_100001870 | 3300005518 | Bacteria | 19038 |
| 188 | Ga0070699_100002367 | 3300005518 | Bacteria | 16917 |
| 189 | Ga0070699_100012158 | 3300005518 | Bacteria | 7428 |
| 190 | Ga0070699_100078059 | 3300005518 | Bacteria | 2883 |
| 191 | Ga0070699_100094652 | 3300005518 | Bacteria | 2615 |
| 192 | Ga0070699_100137037 | 3300005518 | Bacteria | 2159 |
| 193 | Ga0070699_100173162 | 3300005518 | Unclassified | 1913 |
| 194 | Ga0070679_100000014 | 3300005530 | Bacteria | 150481 |
| 195 | Ga0070679_100006157 | 3300005530 | Bacteria | 11164 |
| 196 | Ga0070679_100008917 | 3300005530 | Bacteria | 9463 |
| 197 | Ga0070679_100045696 | 3300005530 | Bacteria | 4364 |
| 198 | Ga0070679_100080169 | 3300005530 | Bacteria | 3253 |
| 199 | Ga0070697_100000052 | 3300005536 | Bacteria | 88211 |
| 200 | Ga0070697_100000392 | 3300005536 | Bacteria | 33968 |
| 201 | Ga0070697_100001507 | 3300005536 | Bacteria | 17693 |
| 202 | Ga0070697_100012151 | 3300005536 | Bacteria | 6743 |
| 203 | Ga0070697_100042155 | 3300005536 | Bacteria | 3694 |
| 204 | Ga0070697_100083207 | 3300005536 | Bacteria | 2639 |
| 205 | Ga0068853_100008850 | 3300005539 | Bacteria | 8099 |
| 206 | Ga0068853_100034326 | 3300005539 | Bacteria | 4306 |
| 207 | Ga0068853_100039118 | 3300005539 | Bacteria | 4044 |
| 208 | Ga0068853_100127354 | 3300005539 | Bacteria | 2276 |
| 209 | Ga0070672_100012889 | 3300005543 | Bacteria | 5890 |
| 210 | Ga0070672_100154179 | 3300005543 | Bacteria | 1902 |
| 211 | Ga0070672_100173547 | 3300005543 | Bacteria | 1794 |
| 212 | Ga0070672_100189526 | 3300005543 | Bacteria | 1716 |
| 213 | Ga0070686_100017113 | 3300005544 | Bacteria | 4231 |
| 214 | Ga0070686_100017451 | 3300005544 | Bacteria | 4194 |
| 215 | Ga0070686_100027904 | 3300005544 | Unclassified | 3419 |
| 216 | Ga0070686_100058002 | 3300005544 | Bacteria | 2490 |
| 217 | Ga0070695_100006762 | 3300005545 | Bacteria | 6788 |
| 218 | Ga0070695_100045346 | 3300005545 | Unclassified | 2802 |
| 219 | Ga0070695_100055818 | 3300005545 | Bacteria | 2547 |
| 220 | Ga0070695_100063242 | 3300005545 | Bacteria | 2405 |
| 221 | Ga0070695_100109657 | 3300005545 | Bacteria | 1871 |
| 222 | Ga0070695_100186585 | 3300005545 | Bacteria | 1473 |
| 223 | Ga0070696_100001303 | 3300005546 | Bacteria | 16265 |
| 224 | Ga0070696_100002525 | 3300005546 | Bacteria | 12120 |
| 225 | Ga0070696_100010953 | 3300005546 | Bacteria | 6075 |
| 226 | Ga0070696_100029514 | 3300005546 | Bacteria | 3749 |
| 227 | Ga0070696_100038361 | 3300005546 | Unclassified | 3306 |
| 228 | Ga0070696_100098942 | 3300005546 | Unclassified | 2087 |
| 229 | Ga0070696_100113567 | 3300005546 | Bacteria | 1953 |
| 230 | Ga0070693_100001436 | 3300005547 | Bacteria | 10739 |
| 231 | Ga0070693_100021477 | 3300005547 | Bacteria | 3420 |
| 232 | Ga0070693_100110342 | 3300005547 | Bacteria | 1691 |
| 233 | Ga0070665_100000156 | 3300005548 | Bacteria | 124832 |
| 234 | Ga0070665_100002304 | 3300005548 | Bacteria | 21181 |
| 235 | Ga0070665_100007626 | 3300005548 | Bacteria | 11000 |
| 236 | Ga0070665_100253349 | 3300005548 | Bacteria | 1761 |
| 237 | Ga0070704_100005539 | 3300005549 | Bacteria | 7364 |
| 238 | Ga0070704_100024375 | 3300005549 | Bacteria | 3969 |
| 239 | Ga0070704_100036396 | 3300005549 | Bacteria | 3355 |
| 240 | Ga0070704_100057433 | 3300005549 | Bacteria | 2767 |
| 241 | Ga0070704_100074243 | 3300005549 | Bacteria | 2480 |
| 242 | Ga0070704_100109222 | 3300005549 | Bacteria | 2101 |
| 243 | Ga0070704_100145994 | 3300005549 | Bacteria | 1854 |
| 244 | Ga0070704_100222623 | 3300005549 | Bacteria | 1535 |
| 245 | Ga0068855_100006051 | 3300005563 | Bacteria | 14754 |
| 246 | Ga0068855_100009063 | 3300005563 | Bacteria | 12025 |
| 247 | Ga0070664_100007053 | 3300005564 | Bacteria | 9068 |
| 248 | Ga0070664_100009196 | 3300005564 | Bacteria | 8022 |
| 249 | Ga0070664_100018237 | 3300005564 | Bacteria | 5760 |
| 250 | Ga0070664_100052965 | 3300005564 | Bacteria | 3439 |
| 251 | Ga0068857_100001440 | 3300005577 | Bacteria | 18873 |
| 252 | Ga0068857_100043273 | 3300005577 | Bacteria | 3995 |
| 253 | Ga0068857_100095018 | 3300005577 | Bacteria | 2669 |
| 254 | Ga0068857_100118030 | 3300005577 | Bacteria | 2388 |
| 255 | Ga0068854_100246640 | 3300005578 | Bacteria | 1424 |
| 256 | Ga0068854_100302729 | 3300005578 | Unclassified | 1294 |
| 257 | Ga0068856_100041440 | 3300005614 | Bacteria | 4525 |
| 258 | Ga0068856_100096367 | 3300005614 | Bacteria | 2947 |
| 259 | Ga0068856_100260297 | 3300005614 | Bacteria | 1750 |
| 260 | Ga0070702_100013190 | 3300005615 | Bacteria | 4165 |
| 261 | Ga0068852_100144084 | 3300005616 | Unclassified | 2208 |
| 262 | Ga0068852_100148679 | 3300005616 | Bacteria | 2176 |
| 263 | Ga0068852_100164719 | 3300005616 | Bacteria | 2073 |
| 264 | Ga0068859_100008065 | 3300005617 | Bacteria | 10677 |
| 265 | Ga0068859_100008330 | 3300005617 | Bacteria | 10507 |
| 266 | Ga0068859_100020509 | 3300005617 | Bacteria | 6633 |
| 267 | Ga0068859_100030082 | 3300005617 | Bacteria | 5448 |
| 268 | Ga0068859_100039360 | 3300005617 | Bacteria | 4743 |
| 269 | Ga0068859_100091528 | 3300005617 | Bacteria | 3092 |
| 270 | Ga0068859_100113519 | 3300005617 | Bacteria | 2773 |
| 271 | Ga0068859_100121419 | 3300005617 | Unclassified | 2679 |
| 272 | Ga0068859_100122740 | 3300005617 | Bacteria | 2664 |
| 273 | Ga0068859_100154704 | 3300005617 | Bacteria | 2370 |
| 274 | Ga0068859_100178854 | 3300005617 | Bacteria | 2203 |
| 275 | Ga0068859_100246020 | 3300005617 | Bacteria | 1878 |
| 276 | Ga0068859_100281519 | 3300005617 | Bacteria | 1756 |
| 277 | Ga0068864_100003389 | 3300005618 | Bacteria | 13173 |
| 278 | Ga0068864_100012380 | 3300005618 | Bacteria | 7053 |
| 279 | Ga0068864_100052192 | 3300005618 | Bacteria | 3524 |
| 280 | Ga0068864_100067513 | 3300005618 | Bacteria | 3105 |
| 281 | Ga0068864_100070050 | 3300005618 | Bacteria | 3051 |
| 282 | Ga0068864_100120504 | 3300005618 | Unclassified | 2345 |
| 283 | Ga0068864_100223984 | 3300005618 | Bacteria | 1736 |
| 284 | Ga0068864_100328238 | 3300005618 | Bacteria | 1439 |
| 285 | Ga0068866_10000388 | 3300005718 | Bacteria | 20689 |
| 286 | Ga0068866_10022678 | 3300005718 | Bacteria | 2908 |
| 287 | Ga0068866_10054211 | 3300005718 | Bacteria | 2053 |
| 288 | Ga0068861_100076206 | 3300005719 | Bacteria | 2613 |
| 289 | Ga0068861_100137883 | 3300005719 | Bacteria | 1987 |
| 290 | Ga0068851_10000697 | 3300005834 | Bacteria | 14334 |
| 291 | Ga0068870_10084749 | 3300005840 | Bacteria | 1760 |
| 292 | Ga0068863_100010715 | 3300005841 | Bacteria | 8905 |
| 293 | Ga0068863_100011604 | 3300005841 | Bacteria | 8526 |
| 294 | Ga0068863_100030745 | 3300005841 | Bacteria | 5127 |
| 295 | Ga0068863_100032235 | 3300005841 | Bacteria | 4994 |
| 296 | Ga0068863_100045465 | 3300005841 | Bacteria | 4167 |
| 297 | Ga0068863_100188114 | 3300005841 | Bacteria | 1984 |
| 298 | Ga0068863_100273330 | 3300005841 | Bacteria | 1636 |
| 299 | Ga0068863_100315118 | 3300005841 | Bacteria | 1519 |
| 300 | Ga0068858_100000770 | 3300005842 | Bacteria | 33479 |
| 301 | Ga0068858_100016121 | 3300005842 | Bacteria | 7020 |
| 302 | Ga0068858_100022966 | 3300005842 | Bacteria | 5817 |
| 303 | Ga0068858_100040115 | 3300005842 | Bacteria | 4341 |
| 304 | Ga0068858_100090574 | 3300005842 | Bacteria | 2846 |
| 305 | Ga0068858_100105122 | 3300005842 | Bacteria | 2634 |
| 306 | Ga0068858_100146950 | 3300005842 | Unclassified | 2214 |
| 307 | Ga0068858_100167680 | 3300005842 | Unclassified | 2070 |
| 308 | Ga0068860_100001357 | 3300005843 | Bacteria | 26595 |
| 309 | Ga0068860_100010473 | 3300005843 | Bacteria | 9166 |
| 310 | Ga0068860_100056898 | 3300005843 | Bacteria | 3716 |
| 311 | Ga0068860_100084996 | 3300005843 | Bacteria | 3010 |
| 312 | Ga0068860_100101013 | 3300005843 | Bacteria | 2752 |
| 313 | Ga0068860_100134580 | 3300005843 | Bacteria | 2373 |
| 314 | Ga0068860_100159039 | 3300005843 | Bacteria | 2178 |
| 315 | Ga0068860_100375002 | 3300005843 | Bacteria | 1404 |
| 316 | Ga0068862_100000670 | 3300005844 | Bacteria | 35079 |
| 317 | Ga0068862_100009668 | 3300005844 | Bacteria | 7969 |
| 318 | Ga0068862_100015414 | 3300005844 | Bacteria | 6349 |
| 319 | Ga0068862_100034534 | 3300005844 | Bacteria | 4279 |
| 320 | Ga0068862_100119462 | 3300005844 | Unclassified | 2322 |
| 321 | Ga0068862_100124251 | 3300005844 | Bacteria | 2277 |
| 322 | Ga0081455_10000484 | 3300005937 | Bacteria | 51669 |
| 323 | Ga0081539_10000165 | 3300005985 | Bacteria | 153824 |
| 324 | Ga0081539_10000586 | 3300005985 | Bacteria | 74721 |
| 325 | Ga0081539_10000796 | 3300005985 | Bacteria | 61233 |
| 326 | Ga0081539_10000858 | 3300005985 | Bacteria | 58194 |
| 327 | Ga0081539_10103462 | 3300005985 | Bacteria | 1447 |
| 328 | Ga0070717_10031311 | 3300006028 | Bacteria | 4278 |
| 329 | Ga0070715_10000004 | 3300006163 | Bacteria | 305411 |
| 330 | Ga0070715_10008181 | 3300006163 | Bacteria | 3635 |
| 331 | Ga0070716_100000001 | 3300006173 | Bacteria | 400668 |
| 332 | Ga0070716_100016262 | 3300006173 | Bacteria | 3835 |
| 333 | Ga0070716_100078093 | 3300006173 | Bacteria | 1967 |
| 334 | Ga0070712_100057382 | 3300006175 | Bacteria | 2735 |
| 335 | Ga0070712_100070105 | 3300006175 | Bacteria | 2503 |
| 336 | Ga0070712_100098110 | 3300006175 | Bacteria | 2161 |
| 337 | Ga0097621_100014975 | 3300006237 | Bacteria | 5822 |
| 338 | Ga0097621_100027916 | 3300006237 | Bacteria | 4444 |
| 339 | Ga0097621_100058683 | 3300006237 | Bacteria | 3149 |
| 340 | Ga0097621_100141393 | 3300006237 | Bacteria | 2057 |
| 341 | Ga0068871_100014714 | 3300006358 | Bacteria | 5839 |
| 342 | Ga0068871_100015984 | 3300006358 | Bacteria | 5637 |
| 343 | Ga0075428_100000322 | 3300006844 | Bacteria | 47435 |
| 344 | Ga0075428_100099532 | 3300006844 | Bacteria | 3170 |
| 345 | Ga0075428_100128785 | 3300006844 | Bacteria | 2753 |
| 346 | Ga0075428_100139961 | 3300006844 | Archaea | 2631 |
| 347 | Ga0075428_100153120 | 3300006844 | Unclassified | 2505 |
| 348 | Ga0075428_100179649 | 3300006844 | Bacteria | 2291 |
| 349 | Ga0075428_100278170 | 3300006844 | Bacteria | 1801 |
| 350 | Ga0075428_100294492 | 3300006844 | Bacteria | 1745 |
| 351 | Ga0075428_100345217 | 3300006844 | Bacteria | 1598 |
| 352 | Ga0075428_100493664 | 3300006844 | Bacteria | 1310 |
| 353 | Ga0075430_100004678 | 3300006846 | Bacteria | 11505 |
| 354 | Ga0075430_100081711 | 3300006846 | Bacteria | 2707 |
| 355 | Ga0075430_100185324 | 3300006846 | Bacteria | 1731 |
| 356 | Ga0075430_100320474 | 3300006846 | Bacteria | 1281 |
| 357 | Ga0075431_100001136 | 3300006847 | Bacteria | 23886 |
| 358 | Ga0075431_100075968 | 3300006847 | Bacteria | 3467 |
| 359 | Ga0075431_100126116 | 3300006847 | Bacteria | 2641 |
| 360 | Ga0075433_10000891 | 3300006852 | Bacteria | 21039 |
| 361 | Ga0075433_10008768 | 3300006852 | Bacteria | 8069 |
| 362 | Ga0075433_10034286 | 3300006852 | Bacteria | 4358 |
| 363 | Ga0075433_10052347 | 3300006852 | Bacteria | 3557 |
| 364 | Ga0075433_10079506 | 3300006852 | Bacteria | 2889 |
| 365 | Ga0075433_10084269 | 3300006852 | Unclassified | 2806 |
| 366 | Ga0075433_10126500 | 3300006852 | Bacteria | 2270 |
| 367 | Ga0075433_10164936 | 3300006852 | Bacteria | 1972 |
| 368 | Ga0075433_10167561 | 3300006852 | Bacteria | 1955 |
| 369 | Ga0075433_10194447 | 3300006852 | Bacteria | 1804 |
| 370 | Ga0075433_10254627 | 3300006852 | Bacteria | 1557 |
| 371 | Ga0075433_10256779 | 3300006852 | Bacteria | 1550 |
| 372 | Ga0075434_100019499 | 3300006871 | Bacteria | 6565 |
| 373 | Ga0075434_100111499 | 3300006871 | Bacteria | 2746 |
| 374 | Ga0075434_100132926 | 3300006871 | Bacteria | 2508 |
| 375 | Ga0075434_100142884 | 3300006871 | Bacteria | 2413 |
| 376 | Ga0075434_100157688 | 3300006871 | Bacteria | 2289 |
| 377 | Ga0075434_100188085 | 3300006871 | Bacteria | 2085 |
| 378 | Ga0075429_100000373 | 3300006880 | Bacteria | 33080 |
| 379 | Ga0075429_100003706 | 3300006880 | Bacteria | 13021 |
| 380 | Ga0075429_100081403 | 3300006880 | Bacteria | 2823 |
| 381 | Ga0075429_100100957 | 3300006880 | Bacteria | 2519 |
| 382 | Ga0075429_100101308 | 3300006880 | Bacteria | 2514 |
| 383 | Ga0068865_100000700 | 3300006881 | Bacteria | 18849 |
| 384 | Ga0068865_100067469 | 3300006881 | Bacteria | 2527 |
| 385 | Ga0068865_100134818 | 3300006881 | Unclassified | 1854 |
| 386 | Ga0075436_100000014 | 3300006914 | Bacteria | 175616 |
| 387 | Ga0075436_100000056 | 3300006914 | Bacteria | 65961 |
| 388 | Ga0075436_100000288 | 3300006914 | Bacteria | 31977 |
| 389 | Ga0075436_100070770 | 3300006914 | Bacteria | 2411 |
| 390 | Ga0097620_100008065 | 3300006931 | Bacteria | 10677 |
| 391 | Ga0097620_100008330 | 3300006931 | Bacteria | 10507 |
| 392 | Ga0097620_100020509 | 3300006931 | Bacteria | 6633 |
| 393 | Ga0097620_100030082 | 3300006931 | Bacteria | 5448 |
| 394 | Ga0097620_100039360 | 3300006931 | Bacteria | 4743 |
| 395 | Ga0097620_100091520 | 3300006931 | Bacteria | 3092 |
| 396 | Ga0097620_100113521 | 3300006931 | Bacteria | 2773 |
| 397 | Ga0097620_100121415 | 3300006931 | Unclassified | 2679 |
| 398 | Ga0097620_100122741 | 3300006931 | Bacteria | 2664 |
| 399 | Ga0097620_100154707 | 3300006931 | Bacteria | 2370 |
| 400 | Ga0097620_100178860 | 3300006931 | Bacteria | 2203 |
| 401 | Ga0097620_100246013 | 3300006931 | Bacteria | 1878 |
| 402 | Ga0097620_100281538 | 3300006931 | Bacteria | 1756 |
| 403 | Ga0075435_100000374 | 3300007076 | Bacteria | 27376 |
| 404 | Ga0075435_100018572 | 3300007076 | Bacteria | 5293 |
| 405 | Ga0075435_100021667 | 3300007076 | Bacteria | 4946 |
| 406 | Ga0075435_100075391 | 3300007076 | Bacteria | 2762 |
| 407 | Ga0075435_100131421 | 3300007076 | Bacteria | 2095 |
| 408 | Ga0105250_10000010 | 3300009092 | Bacteria | 298384 |
| 409 | Ga0105240_10000634 | 3300009093 | Bacteria | 64881 |
| 410 | Ga0105240_10004000 | 3300009093 | Bacteria | 22715 |
| 411 | Ga0105240_10004276 | 3300009093 | Bacteria | 21816 |
| 412 | Ga0105240_10010103 | 3300009093 | Bacteria | 13283 |
| 413 | Ga0105240_10043674 | 3300009093 | Bacteria | 5701 |
| 414 | Ga0105240_10332473 | 3300009093 | Bacteria | 1728 |
| 415 | Ga0105240_10367892 | 3300009093 | Bacteria | 1627 |
| 416 | Ga0111539_10003889 | 3300009094 | Bacteria | 19651 |
| 417 | Ga0111539_10027693 | 3300009094 | Bacteria | 6923 |
| 418 | Ga0111539_10046775 | 3300009094 | Bacteria | 5175 |
| 419 | Ga0111539_10055362 | 3300009094 | Bacteria | 4715 |
| 420 | Ga0111539_10075377 | 3300009094 | Bacteria | 3974 |
| 421 | Ga0111539_10091032 | 3300009094 | Bacteria | 3584 |
| 422 | Ga0111539_10141258 | 3300009094 | Bacteria | 2819 |
| 423 | Ga0111539_10152458 | 3300009094 | Bacteria | 2705 |
| 424 | Ga0111539_10156316 | 3300009094 | Bacteria | 2668 |
| 425 | Ga0111539_10218135 | 3300009094 | Bacteria | 2222 |
| 426 | Ga0111539_10253587 | 3300009094 | Bacteria | 2049 |
| 427 | Ga0111539_10461143 | 3300009094 | Bacteria | 1480 |
| 428 | Ga0105245_10017231 | 3300009098 | Bacteria | 6303 |
| 429 | Ga0105245_10027885 | 3300009098 | Bacteria | 4977 |
| 430 | Ga0105245_10030974 | 3300009098 | Bacteria | 4732 |
| 431 | Ga0105247_10000005 | 3300009101 | Bacteria | 426989 |
| 432 | Ga0105247_10008389 | 3300009101 | Bacteria | 6299 |
| 433 | Ga0105247_10010150 | 3300009101 | Bacteria | 5705 |
| 434 | Ga0114129_10002882 | 3300009147 | Bacteria | 24082 |
| 435 | Ga0114129_10017260 | 3300009147 | Bacteria | 10279 |
| 436 | Ga0114129_10035939 | 3300009147 | Bacteria | 6996 |
| 437 | Ga0114129_10054153 | 3300009147 | Bacteria | 5626 |
| 438 | Ga0114129_10114661 | 3300009147 | Bacteria | 3715 |
| 439 | Ga0114129_10117141 | 3300009147 | Bacteria | 3671 |
| 440 | Ga0114129_10256691 | 3300009147 | Unclassified | 2345 |
| 441 | Ga0114129_10629891 | 3300009147 | Bacteria | 1386 |
| 442 | Ga0114129_10636715 | 3300009147 | Bacteria | 1378 |
| 443 | Ga0105243_10000096 | 3300009148 | Bacteria | 100257 |
| 444 | Ga0105243_10001117 | 3300009148 | Bacteria | 24373 |
| 445 | Ga0105243_10054626 | 3300009148 | Bacteria | 3172 |
| 446 | Ga0105243_10112927 | 3300009148 | Bacteria | 2277 |
| 447 | Ga0105243_10200116 | 3300009148 | Bacteria | 1751 |
| 448 | Ga0105241_10001699 | 3300009174 | Bacteria | 16737 |
| 449 | Ga0105241_10013953 | 3300009174 | Bacteria | 5889 |
| 450 | Ga0105241_10246968 | 3300009174 | Bacteria | 1511 |
| 451 | Ga0105241_10376150 | 3300009174 | Bacteria | 1240 |
| 452 | Ga0105242_10000144 | 3300009176 | Bacteria | 51877 |
| 453 | Ga0105242_10002520 | 3300009176 | Bacteria | 14373 |
| 454 | Ga0105242_10003617 | 3300009176 | Bacteria | 12028 |
| 455 | Ga0105242_10019143 | 3300009176 | Bacteria | 5363 |
| 456 | Ga0105242_10019466 | 3300009176 | Bacteria | 5319 |
| 457 | Ga0105242_10057550 | 3300009176 | Unclassified | 3184 |
| 458 | Ga0105248_10005185 | 3300009177 | Bacteria | 14364 |
| 459 | Ga0105248_10008038 | 3300009177 | Bacteria | 11582 |
| 460 | Ga0105248_10008890 | 3300009177 | Bacteria | 11040 |
| 461 | Ga0105248_10035814 | 3300009177 | Bacteria | 5551 |
| 462 | Ga0105248_10048201 | 3300009177 | Bacteria | 4779 |
| 463 | Ga0105248_10081802 | 3300009177 | Bacteria | 3630 |
| 464 | Ga0105248_10091920 | 3300009177 | Bacteria | 3417 |
| 465 | Ga0105248_10112691 | 3300009177 | Bacteria | 3068 |
| 466 | Ga0105248_10136152 | 3300009177 | Bacteria | 2770 |
| 467 | Ga0105248_10268124 | 3300009177 | Bacteria | 1922 |
| 468 | Ga0105248_10296529 | 3300009177 | Bacteria | 1821 |
| 469 | Ga0105248_10348496 | 3300009177 | Bacteria | 1667 |
| 470 | Ga0105237_10001199 | 3300009545 | Bacteria | 34703 |
| 471 | Ga0105237_10016045 | 3300009545 | Bacteria | 7789 |
| 472 | Ga0105237_10349295 | 3300009545 | Unclassified | 1483 |
| 473 | Ga0105238_10027477 | 3300009551 | Bacteria | 5800 |
| 474 | Ga0105238_10047659 | 3300009551 | Bacteria | 4320 |
| 475 | Ga0105238_10067778 | 3300009551 | Bacteria | 3569 |
| 476 | Ga0105238_10081087 | 3300009551 | Bacteria | 3234 |
| 477 | Ga0105238_10121765 | 3300009551 | Bacteria | 2588 |
| 478 | Ga0105249_10000030 | 3300009553 | Bacteria | 221992 |
| 479 | Ga0105249_10017932 | 3300009553 | Bacteria | 6291 |
| 480 | Ga0105249_10022509 | 3300009553 | Bacteria | 5645 |
| 481 | Ga0105249_10257579 | 3300009553 | Bacteria | 1732 |
| 482 | Ga0099796_10014196 | 3300010159 | Bacteria | 2295 |
| 483 | Ga0105239_10031977 | 3300010375 | Bacteria | 5782 |
| 484 | Ga0105239_10059802 | 3300010375 | Bacteria | 4181 |
| 485 | Ga0105239_10113457 | 3300010375 | Bacteria | 3005 |
| 486 | Ga0105246_10002825 | 3300011119 | Bacteria | 10521 |
| 487 | Ga0105246_10023381 | 3300011119 | Bacteria | 3998 |
| 488 | Ga0105246_10043902 | 3300011119 | Bacteria | 3035 |
| 489 | Ga0105246_10091093 | 3300011119 | Bacteria | 2197 |
| 490 | Ga0157373_10040544 | 3300013100 | Bacteria | 3332 |
| 491 | Ga0157373_10143903 | 3300013100 | Bacteria | 1676 |
| 492 | Ga0157370_10003442 | 3300013104 | Bacteria | 18575 |
| 493 | Ga0157370_10038185 | 3300013104 | Bacteria | 4646 |
| 494 | Ga0157369_10115198 | 3300013105 | Bacteria | 2855 |
| 495 | Ga0157369_10240203 | 3300013105 | Bacteria | 1892 |
| 496 | Ga0157374_10039178 | 3300013296 | Bacteria | 4361 |
| 497 | Ga0157374_10120879 | 3300013296 | Bacteria | 2528 |
| 498 | Ga0157374_10174658 | 3300013296 | Bacteria | 2097 |
| 499 | Ga0157378_10000067 | 3300013297 | Bacteria | 92867 |
| 500 | Ga0157378_10004788 | 3300013297 | Bacteria | 11861 |
| 501 | Ga0157378_10006510 | 3300013297 | Bacteria | 10209 |
| 502 | Ga0157378_10017860 | 3300013297 | Bacteria | 6227 |
| 503 | Ga0157378_10026678 | 3300013297 | Bacteria | 5092 |
| 504 | Ga0157378_10044845 | 3300013297 | Unclassified | 3927 |
| 505 | Ga0157378_10067368 | 3300013297 | Bacteria | 3208 |
| 506 | Ga0157378_10083500 | 3300013297 | Bacteria | 2891 |
| 507 | Ga0157378_10126085 | 3300013297 | Bacteria | 2365 |
| 508 | Ga0157378_10137276 | 3300013297 | Bacteria | 2268 |
| 509 | Ga0163162_10000002 | 3300013306 | Bacteria | 717331 |
| 510 | Ga0163162_10017095 | 3300013306 | Bacteria | 7097 |
| 511 | Ga0163162_10025359 | 3300013306 | Bacteria | 5858 |
| 512 | Ga0163162_10029444 | 3300013306 | Bacteria | 5434 |
| 513 | Ga0163162_10034870 | 3300013306 | Bacteria | 5009 |
| 514 | Ga0163162_10052877 | 3300013306 | Bacteria | 4081 |
| 515 | Ga0163162_10097787 | 3300013306 | Bacteria | 3024 |
| 516 | Ga0163162_10219820 | 3300013306 | Unclassified | 2030 |
| 517 | Ga0163162_10227389 | 3300013306 | Bacteria | 1996 |
| 518 | Ga0157372_10249624 | 3300013307 | Bacteria | 2060 |
| 519 | Ga0157372_10339886 | 3300013307 | Bacteria | 1749 |
| 520 | Ga0157375_10009948 | 3300013308 | Bacteria | 8364 |
| 521 | Ga0157375_10011069 | 3300013308 | Bacteria | 7955 |
| 522 | Ga0157375_10015644 | 3300013308 | Bacteria | 6797 |
| 523 | Ga0157375_10029880 | 3300013308 | Bacteria | 5131 |
| 524 | Ga0157375_10043750 | 3300013308 | Bacteria | 4345 |
| 525 | Ga0157375_10045027 | 3300013308 | Bacteria | 4293 |
| 526 | Ga0157375_10382297 | 3300013308 | Bacteria | 1574 |
| 527 | Ga0163163_10001068 | 3300014325 | Bacteria | 23309 |
| 528 | Ga0163163_10015177 | 3300014325 | Bacteria | 7113 |
| 529 | Ga0163163_10015381 | 3300014325 | Bacteria | 7073 |
| 530 | Ga0163163_10017063 | 3300014325 | Bacteria | 6762 |
| 531 | Ga0163163_10018114 | 3300014325 | Bacteria | 6582 |
| 532 | Ga0163163_10040672 | 3300014325 | Bacteria | 4541 |
| 533 | Ga0163163_10048713 | 3300014325 | Bacteria | 4168 |
| 534 | Ga0163163_10083032 | 3300014325 | Unclassified | 3208 |
| 535 | Ga0163163_10112525 | 3300014325 | Bacteria | 2751 |
| 536 | Ga0163163_10113575 | 3300014325 | Bacteria | 2739 |
| 537 | Ga0163163_10149487 | 3300014325 | Bacteria | 2380 |
| 538 | Ga0163163_10188023 | 3300014325 | Bacteria | 2113 |
| 539 | Ga0163163_10205376 | 3300014325 | Bacteria | 2018 |
| 540 | Ga0163163_10210045 | 3300014325 | Bacteria | 1996 |
| 541 | Ga0163163_10324857 | 3300014325 | Unclassified | 1592 |
| 542 | Ga0157380_10001283 | 3300014326 | Bacteria | 16336 |
| 543 | Ga0157380_10002163 | 3300014326 | Bacteria | 13188 |
| 544 | Ga0157380_10004962 | 3300014326 | Bacteria | 9272 |
| 545 | Ga0157380_10041820 | 3300014326 | Bacteria | 3579 |
| 546 | Ga0157380_10045507 | 3300014326 | Bacteria | 3444 |
| 547 | Ga0157380_10100629 | 3300014326 | Bacteria | 2407 |
| 548 | Ga0157380_10108418 | 3300014326 | Bacteria | 2328 |
| 549 | Ga0157380_10111136 | 3300014326 | Bacteria | 2303 |
| 550 | Ga0157380_10196585 | 3300014326 | Bacteria | 1785 |
| 551 | Ga0157377_10007351 | 3300014745 | Bacteria | 5316 |
| 552 | Ga0157377_10033711 | 3300014745 | Bacteria | 2797 |
| 553 | Ga0157379_10000022 | 3300014968 | Bacteria | 90949 |
| 554 | Ga0157379_10014463 | 3300014968 | Bacteria | 6925 |
| 555 | Ga0157379_10054385 | 3300014968 | Unclassified | 3577 |
| 556 | Ga0157379_10108065 | 3300014968 | Bacteria | 2497 |
| 557 | Ga0157379_10241506 | 3300014968 | Bacteria | 1638 |
| 558 | Ga0157376_10008947 | 3300014969 | Bacteria | 7252 |
| 559 | Ga0163161_10001473 | 3300017792 | Bacteria | 17427 |
| 560 | Ga0163161_10006579 | 3300017792 | Bacteria | 8047 |
| 561 | Ga0163161_10046087 | 3300017792 | Bacteria | 3145 |
| 562 | Ga0213876_10000035 | 3300021384 | Bacteria | 186618 |
| 563 | Ga0213876_10000757 | 3300021384 | Bacteria | 22341 |
| 564 | Ga0213871_10002005 | 3300021441 | Bacteria | 3633 |
| 565 | Ga0207656_10009056 | 3300025321 | Bacteria | 3689 |
| 566 | Ga0207696_1000159 | 3300025711 | Bacteria | 111473 |
| 567 | Ga0207653_10000076 | 3300025885 | Bacteria | 72786 |
| 568 | Ga0207653_10000160 | 3300025885 | Bacteria | 47834 |
| 569 | Ga0207653_10000499 | 3300025885 | Bacteria | 15201 |
| 570 | Ga0207642_10000156 | 3300025899 | Bacteria | 19519 |
| 571 | Ga0207710_10000004 | 3300025900 | Bacteria | 846540 |
| 572 | Ga0207710_10002140 | 3300025900 | Bacteria | 9317 |
| 573 | Ga0207710_10011490 | 3300025900 | Bacteria | 3728 |
| 574 | Ga0207680_10038391 | 3300025903 | Bacteria | 2772 |
| 575 | Ga0207647_10013771 | 3300025904 | Bacteria | 5601 |
| 576 | Ga0207685_10000004 | 3300025905 | Bacteria | 305368 |
| 577 | Ga0207685_10017656 | 3300025905 | Bacteria | 2313 |
| 578 | Ga0207699_10000004 | 3300025906 | Bacteria | 567333 |
| 579 | Ga0207699_10000010 | 3300025906 | Bacteria | 295869 |
| 580 | Ga0207645_10001746 | 3300025907 | Bacteria | 17643 |
| 581 | Ga0207645_10026939 | 3300025907 | Bacteria | 3714 |
| 582 | Ga0207643_10095247 | 3300025908 | Bacteria | 1739 |
| 583 | Ga0207705_10015184 | 3300025909 | Bacteria | 5534 |
| 584 | Ga0207684_10000150 | 3300025910 | Bacteria | 121849 |
| 585 | Ga0207684_10000288 | 3300025910 | Bacteria | 72265 |
| 586 | Ga0207684_10022217 | 3300025910 | Bacteria | 5418 |
| 587 | Ga0207684_10029291 | 3300025910 | Bacteria | 4691 |
| 588 | Ga0207684_10042906 | 3300025910 | Bacteria | 3834 |
| 589 | Ga0207684_10090143 | 3300025910 | Bacteria | 2613 |
| 590 | Ga0207684_10121761 | 3300025910 | Bacteria | 2237 |
| 591 | Ga0207684_10264563 | 3300025910 | Bacteria | 1484 |
| 592 | Ga0207707_10000016 | 3300025912 | Bacteria | 256002 |
| 593 | Ga0207707_10001408 | 3300025912 | Bacteria | 22278 |
| 594 | Ga0207707_10003634 | 3300025912 | Bacteria | 13675 |
| 595 | Ga0207707_10005987 | 3300025912 | Bacteria | 10642 |
| 596 | Ga0207707_10006951 | 3300025912 | Bacteria | 9868 |
| 597 | Ga0207707_10007334 | 3300025912 | Bacteria | 9605 |
| 598 | Ga0207707_10012355 | 3300025912 | Bacteria | 7421 |
| 599 | Ga0207707_10085096 | 3300025912 | Bacteria | 2762 |
| 600 | Ga0207707_10123926 | 3300025912 | Bacteria | 2260 |
| 601 | Ga0207707_10159067 | 3300025912 | Bacteria | 1975 |
| 602 | Ga0207695_10007063 | 3300025913 | Bacteria | 14401 |
| 603 | Ga0207695_10016534 | 3300025913 | Bacteria | 8625 |
| 604 | Ga0207695_10105332 | 3300025913 | Bacteria | 2808 |
| 605 | Ga0207695_10127358 | 3300025913 | Unclassified | 2507 |
| 606 | Ga0207695_10129132 | 3300025913 | Bacteria | 2486 |
| 607 | Ga0207671_10066492 | 3300025914 | Bacteria | 2683 |
| 608 | Ga0207671_10140751 | 3300025914 | Bacteria | 1859 |
| 609 | Ga0207693_10199374 | 3300025915 | Bacteria | 1574 |
| 610 | Ga0207663_10000008 | 3300025916 | Bacteria | 205803 |
| 611 | Ga0207663_10115420 | 3300025916 | Unclassified | 1829 |
| 612 | Ga0207660_10000340 | 3300025917 | Bacteria | 30175 |
| 613 | Ga0207660_10242780 | 3300025917 | Bacteria | 1419 |
| 614 | Ga0207662_10124642 | 3300025918 | Bacteria | 1619 |
| 615 | Ga0207657_10057806 | 3300025919 | Unclassified | 3341 |
| 616 | Ga0207652_10000693 | 3300025921 | Bacteria | 32703 |
| 617 | Ga0207652_10003570 | 3300025921 | Bacteria | 12828 |
| 618 | Ga0207652_10018001 | 3300025921 | Bacteria | 5789 |
| 619 | Ga0207646_10000308 | 3300025922 | Bacteria | 66466 |
| 620 | Ga0207646_10008373 | 3300025922 | Bacteria | 10372 |
| 621 | Ga0207646_10009809 | 3300025922 | Bacteria | 9428 |
| 622 | Ga0207646_10022917 | 3300025922 | Bacteria | 5740 |
| 623 | Ga0207646_10047961 | 3300025922 | Bacteria | 3829 |
| 624 | Ga0207646_10084461 | 3300025922 | Bacteria | 2841 |
| 625 | Ga0207681_10000018 | 3300025923 | Bacteria | 278874 |
| 626 | Ga0207681_10000223 | 3300025923 | Bacteria | 44869 |
| 627 | Ga0207681_10240153 | 3300025923 | Bacteria | 1410 |
| 628 | Ga0207694_10018447 | 3300025924 | Bacteria | 5273 |
| 629 | Ga0207694_10102250 | 3300025924 | Bacteria | 2272 |
| 630 | Ga0207694_10106353 | 3300025924 | Bacteria | 2228 |
| 631 | Ga0207650_10000011 | 3300025925 | Bacteria | 450115 |
| 632 | Ga0207650_10001109 | 3300025925 | Bacteria | 19799 |
| 633 | Ga0207650_10101597 | 3300025925 | Bacteria | 2214 |
| 634 | Ga0207650_10113307 | 3300025925 | Bacteria | 2102 |
| 635 | Ga0207650_10227824 | 3300025925 | Bacteria | 1502 |
| 636 | Ga0207687_10014033 | 3300025927 | Bacteria | 5238 |
| 637 | Ga0207687_10015672 | 3300025927 | Bacteria | 4974 |
| 638 | Ga0207700_10016955 | 3300025928 | Bacteria | 4851 |
| 639 | Ga0207700_10100876 | 3300025928 | Bacteria | 2302 |
| 640 | Ga0207644_10009195 | 3300025931 | Bacteria | 6481 |
| 641 | Ga0207644_10021675 | 3300025931 | Bacteria | 4381 |
| 642 | Ga0207644_10022158 | 3300025931 | Bacteria | 4337 |
| 643 | Ga0207644_10033313 | 3300025931 | Bacteria | 3599 |
| 644 | Ga0207644_10078046 | 3300025931 | Bacteria | 2440 |
| 645 | Ga0207644_10094299 | 3300025931 | Bacteria | 2236 |
| 646 | Ga0207706_10000059 | 3300025933 | Bacteria | 111765 |
| 647 | Ga0207706_10023543 | 3300025933 | Bacteria | 5529 |
| 648 | Ga0207706_10025610 | 3300025933 | Bacteria | 5284 |
| 649 | Ga0207706_10033316 | 3300025933 | Bacteria | 4587 |
| 650 | Ga0207706_10057909 | 3300025933 | Bacteria | 3413 |
| 651 | Ga0207706_10064918 | 3300025933 | Bacteria | 3214 |
| 652 | Ga0207706_10126713 | 3300025933 | Unclassified | 2245 |
| 653 | Ga0207686_10000026 | 3300025934 | Bacteria | 169189 |
| 654 | Ga0207686_10000232 | 3300025934 | Bacteria | 42385 |
| 655 | Ga0207686_10000670 | 3300025934 | Bacteria | 21185 |
| 656 | Ga0207709_10000142 | 3300025935 | Bacteria | 100236 |
| 657 | Ga0207709_10002635 | 3300025935 | Bacteria | 11156 |
| 658 | Ga0207670_10001618 | 3300025936 | Bacteria | 11749 |
| 659 | Ga0207670_10045827 | 3300025936 | Bacteria | 2901 |
| 660 | Ga0207670_10093712 | 3300025936 | Bacteria | 2129 |
| 661 | Ga0207670_10153642 | 3300025936 | Bacteria | 1710 |
| 662 | Ga0207669_10015543 | 3300025937 | Bacteria | 3841 |
| 663 | Ga0207669_10088957 | 3300025937 | Bacteria | 2004 |
| 664 | Ga0207704_10131843 | 3300025938 | Bacteria | 1732 |
| 665 | Ga0207665_10000002 | 3300025939 | Bacteria | 267895 |
| 666 | Ga0207665_10041194 | 3300025939 | Bacteria | 3083 |
| 667 | Ga0207665_10066169 | 3300025939 | Bacteria | 2459 |
| 668 | Ga0207665_10085507 | 3300025939 | Bacteria | 2178 |
| 669 | Ga0207665_10092033 | 3300025939 | Bacteria | 2103 |
| 670 | Ga0207691_10025720 | 3300025940 | Bacteria | 5524 |
| 671 | Ga0207691_10091178 | 3300025940 | Bacteria | 2731 |
| 672 | Ga0207691_10218954 | 3300025940 | Bacteria | 1651 |
| 673 | Ga0207711_10004285 | 3300025941 | Bacteria | 12188 |
| 674 | Ga0207711_10007598 | 3300025941 | Bacteria | 9067 |
| 675 | Ga0207711_10031861 | 3300025941 | Bacteria | 4455 |
| 676 | Ga0207711_10046394 | 3300025941 | Bacteria | 3712 |
| 677 | Ga0207711_10151653 | 3300025941 | Bacteria | 2092 |
| 678 | Ga0207689_10004907 | 3300025942 | Bacteria | 12050 |
| 679 | Ga0207689_10005683 | 3300025942 | Bacteria | 11097 |
| 680 | Ga0207689_10066333 | 3300025942 | Bacteria | 2968 |
| 681 | Ga0207689_10164544 | 3300025942 | Unclassified | 1828 |
| 682 | Ga0207661_10033046 | 3300025944 | Bacteria | 4013 |
| 683 | Ga0207661_10187605 | 3300025944 | Bacteria | 1811 |
| 684 | Ga0207661_10212873 | 3300025944 | Bacteria | 1704 |
| 685 | Ga0207679_10057672 | 3300025945 | Bacteria | 2873 |
| 686 | Ga0207679_10060339 | 3300025945 | Bacteria | 2818 |
| 687 | Ga0207679_10067688 | 3300025945 | Bacteria | 2680 |
| 688 | Ga0207667_10008239 | 3300025949 | Bacteria | 12405 |
| 689 | Ga0207667_10037104 | 3300025949 | Bacteria | 5213 |
| 690 | Ga0207667_10079952 | 3300025949 | Bacteria | 3388 |
| 691 | Ga0207667_10094332 | 3300025949 | Unclassified | 3089 |
| 692 | Ga0207667_10214491 | 3300025949 | Bacteria | 1973 |
| 693 | Ga0207651_10044685 | 3300025960 | Unclassified | 2967 |
| 694 | Ga0207651_10068235 | 3300025960 | Bacteria | 2506 |
| 695 | Ga0207651_10116747 | 3300025960 | Bacteria | 2015 |
| 696 | Ga0207712_10000041 | 3300025961 | Bacteria | 180000 |
| 697 | Ga0207712_10003122 | 3300025961 | Bacteria | 10567 |
| 698 | Ga0207712_10004676 | 3300025961 | Bacteria | 8656 |
| 699 | Ga0207712_10016542 | 3300025961 | Bacteria | 4780 |
| 700 | Ga0207712_10026534 | 3300025961 | Bacteria | 3860 |
| 701 | Ga0207712_10041649 | 3300025961 | Unclassified | 3157 |
| 702 | Ga0207712_10177969 | 3300025961 | Bacteria | 1668 |
| 703 | Ga0207668_10000297 | 3300025972 | Bacteria | 32617 |
| 704 | Ga0207668_10169230 | 3300025972 | Bacteria | 1712 |
| 705 | Ga0207640_10023943 | 3300025981 | Bacteria | 3677 |
| 706 | Ga0207640_10130695 | 3300025981 | Bacteria | 1815 |
| 707 | Ga0207658_10078550 | 3300025986 | Unclassified | 2522 |
| 708 | Ga0207677_10067703 | 3300026023 | Bacteria | 2502 |
| 709 | Ga0207677_10159784 | 3300026023 | Unclassified | 1749 |
| 710 | Ga0207677_10217837 | 3300026023 | Bacteria | 1529 |
| 711 | Ga0207703_10000486 | 3300026035 | Bacteria | 41391 |
| 712 | Ga0207703_10077537 | 3300026035 | Bacteria | 2759 |
| 713 | Ga0207703_10079553 | 3300026035 | Bacteria | 2728 |
| 714 | Ga0207703_10102792 | 3300026035 | Bacteria | 2425 |
| 715 | Ga0207703_10115222 | 3300026035 | Bacteria | 2299 |
| 716 | Ga0207703_10162541 | 3300026035 | Bacteria | 1957 |
| 717 | Ga0207703_10162554 | 3300026035 | Bacteria | 1957 |
| 718 | Ga0207703_10199338 | 3300026035 | Bacteria | 1778 |
| 719 | Ga0207703_10365743 | 3300026035 | Unclassified | 1331 |
| 720 | Ga0207639_10017809 | 3300026041 | Bacteria | 5038 |
| 721 | Ga0207639_10031771 | 3300026041 | Bacteria | 3882 |
| 722 | Ga0207678_10032125 | 3300026067 | Bacteria | 4576 |
| 723 | Ga0207678_10105622 | 3300026067 | Bacteria | 2403 |
| 724 | Ga0207678_10189771 | 3300026067 | Bacteria | 1756 |
| 725 | Ga0207708_10000136 | 3300026075 | Bacteria | 57790 |
| 726 | Ga0207708_10005102 | 3300026075 | Bacteria | 9689 |
| 727 | Ga0207708_10023267 | 3300026075 | Bacteria | 4681 |
| 728 | Ga0207708_10040750 | 3300026075 | Bacteria | 3541 |
| 729 | Ga0207708_10050641 | 3300026075 | Unclassified | 3162 |
| 730 | Ga0207708_10071985 | 3300026075 | Bacteria | 2649 |
| 731 | Ga0207708_10179265 | 3300026075 | Unclassified | 1682 |
| 732 | Ga0207708_10190478 | 3300026075 | Bacteria | 1632 |
| 733 | Ga0207708_10206527 | 3300026075 | Bacteria | 1569 |
| 734 | Ga0207702_10246641 | 3300026078 | Bacteria | 1675 |
| 735 | Ga0207702_10253556 | 3300026078 | Bacteria | 1653 |
| 736 | Ga0207702_10397112 | 3300026078 | Bacteria | 1329 |
| 737 | Ga0207641_10063252 | 3300026088 | Bacteria | 3161 |
| 738 | Ga0207641_10070462 | 3300026088 | Bacteria | 3004 |
| 739 | Ga0207641_10126487 | 3300026088 | Bacteria | 2289 |
| 740 | Ga0207641_10135940 | 3300026088 | Bacteria | 2212 |
| 741 | Ga0207641_10221210 | 3300026088 | Bacteria | 1756 |
| 742 | Ga0207641_10230880 | 3300026088 | Bacteria | 1720 |
| 743 | Ga0207641_10239090 | 3300026088 | Bacteria | 1691 |
| 744 | Ga0207648_10000052 | 3300026089 | Bacteria | 107551 |
| 745 | Ga0207648_10004466 | 3300026089 | Bacteria | 14352 |
| 746 | Ga0207648_10176029 | 3300026089 | Unclassified | 1892 |
| 747 | Ga0207676_10005309 | 3300026095 | Bacteria | 9127 |
| 748 | Ga0207676_10020512 | 3300026095 | Bacteria | 4836 |
| 749 | Ga0207676_10059708 | 3300026095 | Bacteria | 3013 |
| 750 | Ga0207676_10085837 | 3300026095 | Bacteria | 2569 |
| 751 | Ga0207676_10095344 | 3300026095 | Bacteria | 2453 |
| 752 | Ga0207676_10169846 | 3300026095 | Bacteria | 1899 |
| 753 | Ga0207676_10198923 | 3300026095 | Bacteria | 1769 |
| 754 | Ga0207676_10303045 | 3300026095 | Unclassified | 1460 |
| 755 | Ga0207676_10343900 | 3300026095 | Bacteria | 1377 |
| 756 | Ga0207676_10393246 | 3300026095 | Bacteria | 1294 |
| 757 | Ga0207674_10000108 | 3300026116 | Bacteria | 95567 |
| 758 | Ga0207674_10018906 | 3300026116 | Bacteria | 7470 |
| 759 | Ga0207674_10025284 | 3300026116 | Bacteria | 6336 |
| 760 | Ga0207674_10078111 | 3300026116 | Unclassified | 3315 |
| 761 | Ga0207674_10104321 | 3300026116 | Bacteria | 2813 |
| 762 | Ga0207674_10105413 | 3300026116 | Bacteria | 2797 |
| 763 | Ga0207674_10210990 | 3300026116 | Bacteria | 1891 |
| 764 | Ga0207675_100001980 | 3300026118 | Bacteria | 20425 |
| 765 | Ga0207675_100003639 | 3300026118 | Bacteria | 15026 |
| 766 | Ga0207675_100014952 | 3300026118 | Bacteria | 7244 |
| 767 | Ga0207675_100021233 | 3300026118 | Bacteria | 6048 |
| 768 | Ga0207675_100128081 | 3300026118 | Bacteria | 2406 |
| 769 | Ga0207675_100173037 | 3300026118 | Bacteria | 2065 |
| 770 | Ga0207683_10013853 | 3300026121 | Bacteria | 6876 |
| 771 | Ga0207698_10085793 | 3300026142 | Bacteria | 2558 |
| 772 | Ga0207698_10145772 | 3300026142 | Bacteria | 2047 |
| 773 | Ga0209966_1011624 | 3300027695 | Bacteria | 1608 |
| 774 | Ga0209998_10012992 | 3300027717 | Bacteria | 1730 |
| 775 | Ga0207428_10082286 | 3300027907 | Bacteria | 2512 |
| 776 | Ga0265356_1001008 | 3300028017 | Bacteria | 4474 |
| 777 | Ga0268266_10000589 | 3300028379 | Bacteria | 50116 |
| 778 | Ga0268266_10000738 | 3300028379 | Bacteria | 43706 |
| 779 | Ga0268266_10005951 | 3300028379 | Bacteria | 11277 |
| 780 | Ga0268266_10211361 | 3300028379 | Bacteria | 1779 |
| 781 | Ga0268265_10000115 | 3300028380 | Bacteria | 100719 |
| 782 | Ga0268265_10011876 | 3300028380 | Bacteria | 5889 |
| 783 | Ga0268265_10018832 | 3300028380 | Bacteria | 4790 |
| 784 | Ga0268265_10073239 | 3300028380 | Bacteria | 2675 |
| 785 | Ga0268265_10119862 | 3300028380 | Bacteria | 2166 |
| 786 | Ga0268265_10125225 | 3300028380 | Bacteria | 2125 |
| 787 | Ga0268265_10128929 | 3300028380 | Bacteria | 2098 |
| 788 | Ga0268265_10145408 | 3300028380 | Bacteria | 1991 |
| 789 | Ga0268265_10268411 | 3300028380 | Bacteria | 1521 |
| 790 | Ga0268264_10015822 | 3300028381 | Bacteria | 6177 |
| 791 | Ga0268264_10022913 | 3300028381 | Bacteria | 5096 |
| 792 | Ga0268264_10030618 | 3300028381 | Bacteria | 4411 |
| 793 | Ga0268264_10049017 | 3300028381 | Bacteria | 3513 |
| 794 | Ga0268264_10100665 | 3300028381 | Bacteria | 2510 |
| 795 | Ga0268264_10130147 | 3300028381 | Bacteria | 2229 |
| 796 | Ga0268264_10164785 | 3300028381 | Bacteria | 2000 |
| 797 | Ga0268264_10214191 | 3300028381 | Bacteria | 1770 |
| 798 | Ga0265319_1004543 | 3300028563 | Bacteria | 6843 |
| 799 | Ga0265319_1023238 | 3300028563 | Bacteria | 2248 |
| 800 | Ga0265338_10012971 | 3300028800 | Bacteria | 9461 |
| 801 | Ga0265338_10029990 | 3300028800 | Bacteria | 5376 |
| 802 | Ga0265770_1000295 | 3300030878 | Bacteria | 6747 |
| 803 | Ga0265760_10002069 | 3300031090 | Bacteria | 5907 |
| 804 | Ga0265340_10054820 | 3300031247 | Bacteria | 1922 |
| 805 | Ga0265327_10012430 | 3300031251 | Bacteria | 5748 |
| 806 | Ga0307513_10002818 | 3300031456 | Bacteria | 23847 |
| 807 | Ga0307408_100000881 | 3300031548 | Bacteria | 23605 |
| 808 | Ga0307408_100025335 | 3300031548 | Bacteria | 4062 |
| 809 | Ga0307408_100039414 | 3300031548 | Bacteria | 3340 |
| 810 | Ga0307408_100079697 | 3300031548 | Bacteria | 2444 |
| 811 | Ga0307408_100084392 | 3300031548 | Bacteria | 2382 |
| 812 | Ga0307408_100169364 | 3300031548 | Bacteria | 1743 |
| 813 | Ga0307508_10049515 | 3300031616 | Bacteria | 3742 |
| 814 | Ga0316575_10019556 | 3300031665 | Bacteria | 2591 |
| 815 | Ga0316579_10050024 | 3300031691 | Bacteria | 1954 |
| 816 | Ga0316576_10115620 | 3300031727 | Bacteria | 2013 |
| 817 | Ga0316576_10264041 | 3300031727 | Bacteria | 1291 |
| 818 | Ga0316578_10011646 | 3300031728 | Bacteria | 4610 |
| 819 | Ga0316578_10014865 | 3300031728 | Bacteria | 4172 |
| 820 | Ga0307516_10003296 | 3300031730 | Bacteria | 20894 |
| 821 | Ga0307405_10001196 | 3300031731 | Bacteria | 10737 |
| 822 | Ga0307405_10010376 | 3300031731 | Bacteria | 4823 |
| 823 | Ga0307405_10015407 | 3300031731 | Bacteria | 4142 |
| 824 | Ga0307405_10077203 | 3300031731 | Bacteria | 2164 |
| 825 | Ga0316577_10084717 | 3300031733 | Bacteria | 1773 |
| 826 | Ga0307413_10000802 | 3300031824 | Bacteria | 10939 |
| 827 | Ga0307413_10035152 | 3300031824 | Bacteria | 2871 |
| 828 | Ga0307413_10104258 | 3300031824 | Unclassified | 1882 |
| 829 | Ga0307410_10013418 | 3300031852 | Bacteria | 4780 |
| 830 | Ga0307410_10015322 | 3300031852 | Bacteria | 4544 |
| 831 | Ga0307410_10031892 | 3300031852 | Bacteria | 3386 |
| 832 | Ga0307410_10114631 | 3300031852 | Bacteria | 1955 |
| 833 | Ga0307410_10188486 | 3300031852 | Bacteria | 1567 |
| 834 | Ga0307406_10030868 | 3300031901 | Bacteria | 3258 |
| 835 | Ga0307407_10001414 | 3300031903 | Bacteria | 8670 |
| 836 | Ga0307407_10003794 | 3300031903 | Bacteria | 6289 |
| 837 | Ga0307407_10017975 | 3300031903 | Bacteria | 3563 |
| 838 | Ga0307407_10018810 | 3300031903 | Unclassified | 3503 |
| 839 | Ga0307407_10136218 | 3300031903 | Bacteria | 1578 |
| 840 | Ga0307412_10051247 | 3300031911 | Bacteria | 2727 |
| 841 | Ga0307409_100013914 | 3300031995 | Bacteria | 5204 |
| 842 | Ga0307409_100035668 | 3300031995 | Bacteria | 3647 |
| 843 | Ga0307409_100038725 | 3300031995 | Bacteria | 3529 |
| 844 | Ga0307409_100049438 | 3300031995 | Bacteria | 3206 |
| 845 | Ga0307409_100096204 | 3300031995 | Bacteria | 2442 |
| 846 | Ga0307409_100098226 | 3300031995 | Bacteria | 2421 |
| 847 | Ga0307409_100129137 | 3300031995 | Bacteria | 2156 |
| 848 | Ga0307416_100003783 | 3300032002 | Bacteria | 8980 |
| 849 | Ga0307416_100023830 | 3300032002 | Bacteria | 4453 |
| 850 | Ga0307416_100068708 | 3300032002 | Bacteria | 2929 |
| 851 | Ga0307414_10002616 | 3300032004 | Bacteria | 9467 |
| 852 | Ga0307414_10011273 | 3300032004 | Bacteria | 5234 |
| 853 | Ga0307414_10029465 | 3300032004 | Bacteria | 3573 |
| 854 | Ga0307414_10040990 | 3300032004 | Bacteria | 3132 |
| 855 | Ga0307414_10041367 | 3300032004 | Bacteria | 3121 |
| 856 | Ga0307414_10069261 | 3300032004 | Bacteria | 2536 |
| 857 | Ga0307414_10292770 | 3300032004 | Bacteria | 1373 |
| 858 | Ga0307411_10015713 | 3300032005 | Bacteria | 4261 |
| 859 | Ga0307411_10049867 | 3300032005 | Bacteria | 2723 |
| 860 | Ga0307411_10121577 | 3300032005 | Bacteria | 1890 |
| 861 | Ga0307411_10278957 | 3300032005 | Bacteria | 1329 |
| 862 | Ga0307415_100017136 | 3300032126 | Bacteria | 4337 |
| 863 | Ga0307415_100024269 | 3300032126 | Bacteria | 3782 |
| 864 | Ga0307415_100025642 | 3300032126 | Bacteria | 3704 |
| 865 | Ga0307415_100029208 | 3300032126 | Bacteria | 3521 |
| 866 | Ga0307415_100051077 | 3300032126 | Bacteria | 2804 |
| 867 | Ga0307415_100144538 | 3300032126 | Bacteria | 1821 |
| 868 | Ga0307415_100308813 | 3300032126 | Bacteria | 1313 |
| 869 | Ga0307415_100327081 | 3300032126 | Bacteria | 1281 |
| 870 | Ga0316580_10020786 | 3300032139 | Bacteria | 2022 |
| 871 | Ga0373944_0029696 | 3300035089 | Bacteria | 1636 |
| 872 | Ga0373949_0009454 | 3300035090 | Bacteria | 2136 |
| 873 | Ga0373951_0003489 | 3300035091 | Bacteria | 3803 |
| 874 | Ga0373955_0004354 | 3300035172 | Bacteria | 6261 |
| 875 | Ga0373955_0041592 | 3300035172 | Bacteria | 2464 |
| 876 | Ga0373942_0015334 | 3300035207 | Bacteria | 1866 |
| 877 | Ga0373961_0000089 | 3300035241 | Bacteria | 49296 |
| 878 | Ga0373961_0025315 | 3300035241 | Unclassified | 1612 |
| 879 | Ga0316574_0095989 | 3300035398 | Bacteria | 1894 |
| 880 | Ga0373931_0014697 | 3300035691 | Bacteria | 3832 |
| 881 | Ga0373931_0075118 | 3300035691 | Bacteria | 1853 |
| 882 | Ga0373935_0021715 | 3300035692 | Bacteria | 3931 |
| 883 | Ga0373933_0018637 | 3300035724 | Bacteria | 3907 |
| 884 | Ga0373933_0032440 | 3300035724 | Bacteria | 3036 |
| 885 | Ga0373947_0025965 | 3300035725 | Bacteria | 3418 |
| 886 | Ga0373937_0003412 | 3300036401 | Bacteria | 13335 |
| 887 | Ga0373937_0069894 | 3300036401 | Bacteria | 3238 |
| 888 | Ga0373937_0180653 | 3300036401 | Unclassified | 1981 |
| 889 | Ga0373937_0268147 | 3300036401 | Bacteria | 1611 |
| 890 | Ga0316582_0030921 | 3300036647 | Bacteria | 3267 |
| 891 | Ga0316584_0000107 | 3300036712 | Bacteria | 34543 |
| 892 | Ga0316584_0016094 | 3300036712 | Bacteria | 5358 |
| 893 | Ga0316584_0050591 | 3300036712 | Bacteria | 3107 |
| 894 | Ga0395900_0333564 | 3300037418 | Unclassified | 1494 |
| 895 | Ga0395898_0002342 | 3300037466 | Bacteria | 22595 |
| 896 | Ga0395898_0082595 | 3300037466 | Bacteria | 3097 |
| 897 | Ga0395905_0011300 | 3300037471 | Bacteria | 8633 |
| 898 | Ga0395905_0135118 | 3300037471 | Bacteria | 2320 |
| 899 | Ga0395901_0109249 | 3300038443 | Bacteria | 2904 |
| 900 | Ga0242420_017283 | 3300038996 | Bacteria | 1262 |
| 901 | Ga0436365_0560037 | 3300039437 | Bacteria | 40140 |
| 902 | Ga0436365_0574100 | 3300039437 | Bacteria | 186636 |
| 903 | Ga0436365_1240077 | 3300039437 | Bacteria | 11182 |
| 904 | Ga0436360_0779618 | 3300039438 | Bacteria | 6561 |
| 905 | Ga0451791_1389195 | 3300041451 | Bacteria | 1531 |
| 906 | Ga0451837_0148417 | 3300041494 | Bacteria | 1540 |
| 907 | Ga0451841_0180974 | 3300041498 | Bacteria | 1350 |
| 908 | Ga0451849_1552928 | 3300041505 | Unclassified | 1847 |
| 909 | Ga0451851_0536537 | 3300041507 | Bacteria | 2777 |
| 910 | Ga0451853_3596503 | 3300041512 | Bacteria | 2415 |
| 911 | Ga0439446_0007471 | 3300042156 | Bacteria | 2875 |
| 912 | Ga0451577_0000070 | 3300042876 | Bacteria | 238621 |
| 913 | Ga0451577_0007964 | 3300042876 | Bacteria | 10348 |
| 914 | Ga0451577_0087277 | 3300042876 | Bacteria | 2783 |
| 915 | Ga0451577_0100330 | 3300042876 | Bacteria | 2586 |
| 916 | Ga0451577_0168572 | 3300042876 | Bacteria | 1973 |
| 917 | Ga0451577_0315986 | 3300042876 | Bacteria | 1416 |
| 918 | Ga0451577_0361662 | 3300042876 | Bacteria | 1316 |
| 919 | Ga0451577_0441354 | 3300042876 | Bacteria | 1182 |
| 920 | Ga0466969_0022971 | 3300044656 | Bacteria | 3215 |
| 921 | Ga0466966_0000214 | 3300044684 | Bacteria | 38731 |
| 922 | Ga0466966_0064825 | 3300044684 | Unclassified | 2299 |
| 923 | Ga0466961_0075509 | 3300044693 | Bacteria | 2136 |
| 924 | Ga0453684_0001009 | 3300044712 | Bacteria | 91051 |
| 925 | Ga0453684_0001823 | 3300044712 | Bacteria | 55993 |
| 926 | Ga0453684_0003029 | 3300044712 | Bacteria | 39066 |
| 927 | Ga0453684_0065194 | 3300044712 | Bacteria | 4646 |
| 928 | Ga0466971_0000271 | 3300044719 | Bacteria | 19954 |
| 929 | Ga0466959_0006185 | 3300045049 | Bacteria | 8272 |
| 930 | Ga0466959_0091763 | 3300045049 | Bacteria | 2180 |
| 931 | Ga0466959_0121417 | 3300045049 | Unclassified | 1857 |
| 932 | Ga0451576_0006316 | 3300045051 | Bacteria | 14568 |
| 933 | Ga0451576_0055561 | 3300045051 | Bacteria | 4141 |
| 934 | Ga0451576_0080048 | 3300045051 | Bacteria | 3399 |
| 935 | Ga0451576_0103405 | 3300045051 | Bacteria | 2963 |
| 936 | Ga0451576_0113471 | 3300045051 | Bacteria | 2821 |
| 937 | Ga0451576_0328968 | 3300045051 | Bacteria | 1599 |
| 938 | Ga0466958_0046222 | 3300045836 | Bacteria | 2627 |
| 939 | Ga0466958_0138930 | 3300045836 | Bacteria | 1529 |
| 940 | Ga0495592_0049237 | 3300046454 | Bacteria | 3132 |
| 941 | Ga0495650_0031792 | 3300046471 | Bacteria | 2370 |
| 942 | Ga0495580_0107492 | 3300046472 | Bacteria | 1937 |
| 943 | Ga0495582_0023393 | 3300046473 | Bacteria | 3380 |
| 944 | Ga0495639_0019962 | 3300046475 | Bacteria | 2926 |
| 945 | Ga0495662_0015260 | 3300046476 | Bacteria | 3733 |
| 946 | Ga0495662_0079644 | 3300046476 | Unclassified | 1593 |
| 947 | Ga0495618_0017642 | 3300046514 | Bacteria | 4379 |
| 948 | Ga0495618_0051458 | 3300046514 | Bacteria | 2602 |
| 949 | Ga0495628_0008816 | 3300046516 | Bacteria | 8632 |
| 950 | Ga0495628_0057975 | 3300046516 | Bacteria | 3045 |
| 951 | Ga0495630_0042713 | 3300046517 | Bacteria | 3385 |
| 952 | Ga0495630_0097774 | 3300046517 | Unclassified | 2220 |
| 953 | Ga0495630_0126675 | 3300046517 | Bacteria | 1938 |
| 954 | Ga0495663_0000607 | 3300046525 | Bacteria | 12470 |
| 955 | Ga0495666_0062925 | 3300046526 | Bacteria | 1771 |
| 956 | Ga0495652_0038143 | 3300046529 | Bacteria | 4164 |
| 957 | Ga0495586_0104360 | 3300046535 | Bacteria | 1575 |
| 958 | Ga0495587_0024436 | 3300046536 | Bacteria | 3703 |
| 959 | Ga0495598_0000020 | 3300046537 | Bacteria | 24699 |
| 960 | Ga0495598_0027906 | 3300046537 | Bacteria | 1561 |
| 961 | Ga0495621_0000177 | 3300046539 | Bacteria | 14531 |
| 962 | Ga0495621_0031168 | 3300046539 | Bacteria | 1828 |
| 963 | Ga0495645_0058538 | 3300046543 | Bacteria | 2795 |
| 964 | Ga0495668_0001582 | 3300046616 | Bacteria | 21462 |
| 965 | Ga0495634_0013645 | 3300046642 | Bacteria | 5869 |
| 966 | Ga0495634_0142676 | 3300046642 | Bacteria | 1520 |
| 967 | Ga0495659_0012373 | 3300046664 | Bacteria | 2762 |
| 968 | Ga0495657_0119437 | 3300046675 | Bacteria | 1662 |
| 969 | Ga0495599_0002951 | 3300046678 | Bacteria | 9897 |
| 970 | Ga0495646_0027523 | 3300046680 | Bacteria | 3567 |
| 971 | Ga0495658_0058458 | 3300046683 | Bacteria | 2206 |
| 972 | Ga0495658_0090198 | 3300046683 | Bacteria | 1814 |
| 973 | Ga0495624_0012863 | 3300046690 | Bacteria | 5712 |
| 974 | Ga0495604_0138028 | 3300047317 | Bacteria | 1745 |
| 975 | Ga0495674_0091294 | 3300047319 | Bacteria | 2601 |
| 976 | Ga0495674_0255206 | 3300047319 | Bacteria | 1442 |
| 977 | Ga0495672_0092196 | 3300047320 | Unclassified | 1661 |
| 978 | Ga0495680_0028564 | 3300047322 | Bacteria | 4572 |
| 979 | Ga0495602_0125162 | 3300048088 | Bacteria | 2060 |
| 980 | Ga0496101_0024925 | 3300048904 | Bacteria | 4146 |
| 981 | Ga0496101_0125196 | 3300048904 | Bacteria | 1947 |
| 982 | Ga0496102_0011655 | 3300048905 | Bacteria | 7587 |
| 983 | Ga0496102_0186607 | 3300048905 | Bacteria | 1954 |
| 984 | Ga0496104_0017719 | 3300048907 | Bacteria | 6491 |
| 985 | Ga0496104_0019967 | 3300048907 | Bacteria | 6136 |
| 986 | Ga0496104_0025907 | 3300048907 | Bacteria | 5408 |
| 987 | Ga0496104_0194574 | 3300048907 | Bacteria | 1940 |
| 988 | Ga0496104_0257594 | 3300048907 | Unclassified | 1658 |
| 989 | Ga0496105_0036438 | 3300048908 | Bacteria | 4052 |
| 990 | Ga0496105_0072154 | 3300048908 | Bacteria | 2854 |
| 991 | Ga0496105_0074777 | 3300048908 | Bacteria | 2799 |
| 992 | Ga0496105_0146984 | 3300048908 | Bacteria | 1938 |
| 993 | Ga0496106_0020548 | 3300048909 | Bacteria | 4902 |
| 994 | Ga0496106_0021671 | 3300048909 | Bacteria | 4771 |
| 995 | Ga0496106_0036945 | 3300048909 | Bacteria | 3653 |
| 996 | Ga0496106_0214596 | 3300048909 | Bacteria | 1534 |
| 997 | Ga0496107_0036452 | 3300048910 | Bacteria | 3528 |
| 998 | Ga0496107_0234784 | 3300048910 | Bacteria | 1365 |
| 999 | Ga0496107_0279814 | 3300048910 | Bacteria | 1242 |
| 1000 | Ga0496108_0001174 | 3300048911 | Bacteria | 20423 |
| 1001 | Ga0496108_0002629 | 3300048911 | Bacteria | 14390 |
| 1002 | Ga0496108_0014287 | 3300048911 | Bacteria | 6479 |
| 1003 | Ga0496108_0053828 | 3300048911 | Bacteria | 3376 |
| 1004 | Ga0496108_0088225 | 3300048911 | Bacteria | 2635 |
| 1005 | Ga0496108_0127870 | 3300048911 | Bacteria | 2182 |
| 1006 | Ga0496109_0008286 | 3300048912 | Bacteria | 8824 |
| 1007 | Ga0496109_0018708 | 3300048912 | Bacteria | 6090 |
| 1008 | Ga0496109_0048891 | 3300048912 | Bacteria | 3848 |
| 1009 | Ga0496109_0242854 | 3300048912 | Unclassified | 1695 |
| 1010 | Ga0496109_0360555 | 3300048912 | Bacteria | 1373 |
| 1011 | Ga0496110_0005400 | 3300048913 | Bacteria | 10020 |
| 1012 | Ga0496110_0048978 | 3300048913 | Bacteria | 3705 |
| 1013 | Ga0496110_0119780 | 3300048913 | Bacteria | 2371 |
| 1014 | Ga0496110_0228911 | 3300048913 | Bacteria | 1690 |
| 1015 | Ga0496111_0002035 | 3300048914 | Bacteria | 12035 |
| 1016 | Ga0496111_0036160 | 3300048914 | Bacteria | 3531 |
| 1017 | Ga0496112_0000393 | 3300048915 | Bacteria | 28527 |
| 1018 | Ga0496112_0045636 | 3300048915 | Bacteria | 4296 |
| 1019 | Ga0496112_0111166 | 3300048915 | Bacteria | 2710 |
| 1020 | Ga0496112_0211449 | 3300048915 | Bacteria | 1897 |
| 1021 | Ga0496112_0266828 | 3300048915 | Bacteria | 1661 |
| 1022 | Ga0496112_0283535 | 3300048915 | Bacteria | 1603 |
| 1023 | Ga0496113_0003534 | 3300048916 | Bacteria | 9379 |
| 1024 | Ga0496113_0036655 | 3300048916 | Bacteria | 3594 |
| 1025 | Ga0496113_0257721 | 3300048916 | Bacteria | 1393 |
| 1026 | Ga0496114_0000025 | 3300048917 | Bacteria | 213656 |
| 1027 | Ga0496114_0010422 | 3300048917 | Bacteria | 7394 |
| 1028 | Ga0496114_0021828 | 3300048917 | Bacteria | 5211 |
| 1029 | Ga0496114_0034690 | 3300048917 | Bacteria | 4163 |
| 1030 | Ga0496114_0310238 | 3300048917 | Bacteria | 1393 |
| 1031 | Ga0496115_0006586 | 3300048918 | Bacteria | 8513 |
| 1032 | Ga0501291_008599 | 3300049514 | Bacteria | 1414 |
| 1033 | Ga0501296_003974 | 3300049519 | Bacteria | 1597 |
| 1034 | Ga0501296_006756 | 3300049519 | Bacteria | 1307 |
| 1035 | Ga0501299_003152 | 3300049522 | Bacteria | 2365 |
| 1036 | Ga0501034_0009358 | 3300049571 | Bacteria | 10266 |
| 1037 | Ga0501034_0013257 | 3300049571 | Bacteria | 8491 |
| 1038 | Ga0501034_0152386 | 3300049571 | Bacteria | 2287 |
| 1039 | Ga0501038_0001788 | 3300049574 | Bacteria | 19956 |
| 1040 | Ga0501039_0155425 | 3300049575 | Bacteria | 1797 |
| 1041 | Ga0501039_0311870 | 3300049575 | Bacteria | 1237 |
| 1042 | Ga0501040_0069638 | 3300049576 | Bacteria | 2427 |
| 1043 | Ga0501040_0079064 | 3300049576 | Bacteria | 2276 |
| 1044 | Ga0501040_0130551 | 3300049576 | Bacteria | 1766 |
| 1045 | Ga0501041_0067616 | 3300049577 | Bacteria | 2190 |
| 1046 | Ga0501042_0145980 | 3300049578 | Unclassified | 1706 |
| 1047 | Ga0501046_0004345 | 3300049580 | Bacteria | 12903 |
| 1048 | Ga0501046_0043068 | 3300049580 | Unclassified | 3596 |
| 1049 | Ga0501046_0074636 | 3300049580 | Bacteria | 2631 |
| 1050 | Ga0501046_0085296 | 3300049580 | Bacteria | 2435 |
| 1051 | Ga0501047_0059929 | 3300049581 | Bacteria | 3675 |
| 1052 | Ga0501047_0135899 | 3300049581 | Bacteria | 2339 |
| 1053 | Ga0501048_0090928 | 3300049582 | Unclassified | 2153 |
| 1054 | Ga0501067_0000373 | 3300049583 | Bacteria | 24396 |
| 1055 | Ga0501067_0006399 | 3300049583 | Bacteria | 6523 |
| 1056 | Ga0501067_0015845 | 3300049583 | Bacteria | 4169 |
| 1057 | Ga0501067_0016404 | 3300049583 | Bacteria | 4092 |
| 1058 | Ga0501067_0050906 | 3300049583 | Bacteria | 2296 |
| 1059 | Ga0501068_0022799 | 3300049584 | Bacteria | 3665 |
| 1060 | Ga0501068_0034070 | 3300049584 | Bacteria | 3035 |
| 1061 | Ga0501068_0066596 | 3300049584 | Bacteria | 2194 |
| 1062 | Ga0501069_0026518 | 3300049585 | Bacteria | 3173 |
| 1063 | Ga0501069_0026736 | 3300049585 | Bacteria | 3160 |
| 1064 | Ga0501069_0027986 | 3300049585 | Bacteria | 3089 |
| 1065 | Ga0501069_0107070 | 3300049585 | Bacteria | 1590 |
| 1066 | Ga0501070_0031972 | 3300049586 | Bacteria | 4407 |
| 1067 | Ga0501070_0032397 | 3300049586 | Bacteria | 4373 |
| 1068 | Ga0501070_0105958 | 3300049586 | Bacteria | 2324 |
| 1069 | Ga0501071_0006278 | 3300049587 | Bacteria | 7711 |
| 1070 | Ga0501071_0015327 | 3300049587 | Bacteria | 5260 |
| 1071 | Ga0501071_0023799 | 3300049587 | Bacteria | 4280 |
| 1072 | Ga0501071_0026053 | 3300049587 | Bacteria | 4101 |
| 1073 | Ga0501071_0073577 | 3300049587 | Unclassified | 2493 |
| 1074 | Ga0501072_0003659 | 3300049588 | Bacteria | 11582 |
| 1075 | Ga0501072_0022208 | 3300049588 | Bacteria | 4923 |
| 1076 | Ga0501072_0057322 | 3300049588 | Bacteria | 3069 |
| 1077 | Ga0501073_0025880 | 3300049589 | Bacteria | 4203 |
| 1078 | Ga0501073_0159953 | 3300049589 | Bacteria | 1561 |
| 1079 | Ga0501074_0076769 | 3300049590 | Bacteria | 2397 |
| 1080 | Ga0501074_0081575 | 3300049590 | Bacteria | 2319 |
| 1081 | Ga0501074_0082341 | 3300049590 | Bacteria | 2308 |
| 1082 | Ga0501075_0011505 | 3300049591 | Bacteria | 6264 |
| 1083 | Ga0501075_0024437 | 3300049591 | Bacteria | 4432 |
| 1084 | Ga0501075_0031561 | 3300049591 | Unclassified | 3933 |
| 1085 | Ga0501075_0113825 | 3300049591 | Bacteria | 2057 |
| 1086 | Ga0501075_0169165 | 3300049591 | Bacteria | 1667 |
| 1087 | Ga0501075_0234248 | 3300049591 | Bacteria | 1400 |
| 1088 | Ga0501076_0008713 | 3300049592 | Bacteria | 7449 |
| 1089 | Ga0501076_0018058 | 3300049592 | Bacteria | 5369 |
| 1090 | Ga0501076_0133586 | 3300049592 | Bacteria | 2014 |
| 1091 | Ga0501076_0283528 | 3300049592 | Bacteria | 1357 |
| 1092 | Ga0501077_0000392 | 3300049593 | Bacteria | 26339 |
| 1093 | Ga0501077_0001037 | 3300049593 | Bacteria | 16792 |
| 1094 | Ga0501077_0034028 | 3300049593 | Bacteria | 3243 |
| 1095 | Ga0501077_0163861 | 3300049593 | Unclassified | 1412 |
| 1096 | Ga0501207_002008 | 3300049654 | Bacteria | 2605 |
| 1097 | Ga0501209_005168 | 3300049656 | Bacteria | 2333 |
| 1098 | Ga0501223_008137 | 3300049663 | Bacteria | 2139 |
| 1099 | Ga0501227_006258 | 3300049665 | Bacteria | 2559 |
| 1100 | Ga0501230_008393 | 3300049667 | Bacteria | 1562 |
| 1101 | Ga0501233_004903 | 3300049668 | Bacteria | 2474 |
| 1102 | Ga0501233_016029 | 3300049668 | Bacteria | 1550 |
| 1103 | Ga0501247_003007 | 3300049677 | Bacteria | 1788 |
| 1104 | Ga0501249_001352 | 3300049679 | Bacteria | 5093 |
| 1105 | Ga0501225_0018947 | 3300049705 | Bacteria | 1905 |
| 1106 | Ga0501079_0044377 | 3300049741 | Unclassified | 3431 |
| 1107 | Ga0501079_0056570 | 3300049741 | Bacteria | 3027 |
| 1108 | Ga0501079_0058431 | 3300049741 | Bacteria | 2976 |
| 1109 | Ga0501080_0003146 | 3300049742 | Bacteria | 14530 |
| 1110 | Ga0501080_0003762 | 3300049742 | Bacteria | 13401 |
| 1111 | Ga0501080_0003918 | 3300049742 | Bacteria | 13186 |
| 1112 | Ga0501080_0020968 | 3300049742 | Bacteria | 6047 |
| 1113 | Ga0501080_0028327 | 3300049742 | Bacteria | 5210 |
| 1114 | Ga0501080_0167660 | 3300049742 | Bacteria | 2026 |
| 1115 | Ga0501081_0032407 | 3300049743 | Bacteria | 3545 |
| 1116 | Ga0501081_0047821 | 3300049743 | Bacteria | 2943 |
| 1117 | Ga0501081_0138493 | 3300049743 | Bacteria | 1743 |
| 1118 | Ga0501081_0268569 | 3300049743 | Bacteria | 1247 |
| 1119 | Ga0501083_0002247 | 3300049744 | Bacteria | 13196 |
| 1120 | Ga0501083_0033100 | 3300049744 | Bacteria | 3540 |
| 1121 | Ga0501083_0070760 | 3300049744 | Bacteria | 2319 |
| 1122 | Ga0501083_0108118 | 3300049744 | Bacteria | 1830 |
| 1123 | Ga0501268_004575 | 3300049765 | Bacteria | 1955 |
| 1124 | Ga0501035_0092648 | 3300049822 | Bacteria | 2659 |
| 1125 | Ga0501044_0041174 | 3300049823 | Bacteria | 4810 |
| 1126 | Ga0501045_0176067 | 3300049824 | Bacteria | 1594 |
| 1127 | Ga0501045_0178121 | 3300049824 | Bacteria | 1584 |
| 1128 | nmdc:mga05p37_112288_c1 | 3300050507 | Bacteria | 3351 |
| 1129 | nmdc:mga05p37_114824_c1 | 3300050507 | Bacteria | 3310 |
| 1130 | nmdc:mga05p37_122164_c1 | 3300050507 | Bacteria | 3198 |
| 1131 | nmdc:mga05p37_13236_c1 | 3300050507 | Bacteria | 9876 |
| 1132 | nmdc:mga05p37_150065_c1 | 3300050507 | Bacteria | 2852 |
| 1133 | nmdc:mga05p37_204512_c1 | 3300050507 | Bacteria | 2389 |
| 1134 | nmdc:mga05p37_241_c1 | 3300050507 | Bacteria | 55841 |
| 1135 | nmdc:mga05p37_76478_c1 | 3300050507 | Bacteria | 4121 |
| 1136 | nmdc:mga09592_47912_c1 | 3300050508 | Bacteria | 3602 |
| 1137 | nmdc:mga09592_77534_c1 | 3300050508 | Bacteria | 2827 |
| 1138 | nmdc:mga06r32_101650_c1 | 3300050510 | Bacteria | 2822 |
| 1139 | nmdc:mga06r32_195476_c1 | 3300050510 | Bacteria | 2010 |
| 1140 | nmdc:mga06r32_23270_c1 | 3300050510 | Bacteria | 5730 |
| 1141 | nmdc:mga08y16_1265_c1 | 3300050511 | Bacteria | 25109 |
| 1142 | nmdc:mga08y16_12852_c1 | 3300050511 | Bacteria | 8803 |
| 1143 | nmdc:mga08y16_131167_c1 | 3300050511 | Bacteria | 2606 |
| 1144 | nmdc:mga08y16_156815_c1 | 3300050511 | Bacteria | 2366 |
| 1145 | nmdc:mga08y16_237571_c1 | 3300050511 | Bacteria | 1884 |
| 1146 | nmdc:mga08y16_301427_c1 | 3300050511 | Bacteria | 1652 |
| 1147 | nmdc:mga08y16_38670_c1 | 3300050511 | Bacteria | 5008 |
| 1148 | nmdc:mga08y16_39083_c1 | 3300050511 | Bacteria | 4979 |
| 1149 | nmdc:mga08y16_53115_c1 | 3300050511 | Bacteria | 4238 |
| 1150 | nmdc:mga08y16_97464_c1 | 3300050511 | Bacteria | 3062 |
| 1151 | nmdc:mga0n895_13695_c2 | 3300050512 | Bacteria | 4948 |
| 1152 | nmdc:mga0n895_22958_c1 | 3300050512 | Bacteria | 5855 |
| 1153 | nmdc:mga0n895_442796_c1 | 3300050512 | Bacteria | 1312 |
| 1154 | nmdc:mga0n895_463057_c1 | 3300050512 | Bacteria | 1279 |
| 1155 | nmdc:mga0n895_52831_c1 | 3300050512 | Bacteria | 3990 |
| 1156 | nmdc:mga0n895_96649_c1 | 3300050512 | Bacteria | 2959 |
| 1157 | nmdc:mga0rr50_140708_c1 | 3300050513 | Bacteria | 1941 |
| 1158 | nmdc:mga0rr50_25582_c1 | 3300050513 | Bacteria | 4106 |
| 1159 | nmdc:mga0rr50_5577_c1 | 3300050513 | Bacteria | 7528 |
| 1160 | nmdc:mga0rr50_66772_c1 | 3300050513 | Bacteria | 2730 |
| 1161 | nmdc:mga0rr50_97590_c1 | 3300050513 | Bacteria | 2301 |
| 1162 | nmdc:mga08x19_11_c1 | 3300050514 | Bacteria | 403007 |
| 1163 | nmdc:mga08x19_273_c1 | 3300050514 | Bacteria | 38978 |
| 1164 | nmdc:mga08x19_48_c1 | 3300050514 | Bacteria | 141135 |
| 1165 | nmdc:mga08x19_66331_c1 | 3300050514 | Bacteria | 2345 |
| 1166 | nmdc:mga08x19_8848_c1 | 3300050514 | Bacteria | 6006 |
| 1167 | nmdc:mga0a205_13956_c2 | 3300050515 | Bacteria | 6922 |
| 1168 | nmdc:mga0a205_177069_c1 | 3300050515 | Unclassified | 2028 |
| 1169 | nmdc:mga0a205_18501_c1 | 3300050515 | Bacteria | 6552 |
| 1170 | nmdc:mga0a205_218560_c1 | 3300050515 | Bacteria | 1792 |
| 1171 | nmdc:mga0a205_23514_c1 | 3300050515 | Bacteria | 5846 |
| 1172 | nmdc:mga0a205_252764_c1 | 3300050515 | Bacteria | 1641 |
| 1173 | nmdc:mga0a205_258624_c1 | 3300050515 | Bacteria | 1619 |
| 1174 | nmdc:mga0a205_37715_c2 | 3300050515 | Bacteria | 2489 |
| 1175 | nmdc:mga0a205_51170_c1 | 3300050515 | Bacteria | 3987 |
| 1176 | nmdc:mga0a205_51646_c1 | 3300050515 | Bacteria | 3969 |
| 1177 | nmdc:mga0a205_5_c1 | 3300050515 | Bacteria | 167503 |
| 1178 | nmdc:mga0a205_82097_c1 | 3300050515 | Bacteria | 3113 |
| 1179 | nmdc:mga0a205_83146_c1 | 3300050515 | Bacteria | 3092 |
| 1180 | nmdc:mga0a205_85833_c1 | 3300050515 | Bacteria | 3040 |
| 1181 | nmdc:mga0a205_95703_c1 | 3300050515 | Bacteria | 2868 |
| 1182 | Ga0495601_0011177 | 3300053077 | Bacteria | 5362 |
| 1183 | Ga0495612_0014064 | 3300053078 | Bacteria | 3223 |
| 1184 | Ga0495612_0017087 | 3300053078 | Bacteria | 2906 |
| 1185 | Ga0495619_0143771 | 3300053085 | Bacteria | 1644 |
| 1186 | Ga0500641_0001840 | 3300053096 | Bacteria | 7527 |
| 1187 | Ga0500577_0010739 | 3300053142 | Unclassified | 2708 |
| 1188 | Ga0500604_0034182 | 3300053151 | Bacteria | 1507 |
| 1189 | Ga0500616_0000096 | 3300053153 | Bacteria | 179125 |
| 1190 | Ga0500616_0004019 | 3300053153 | Bacteria | 10716 |
| 1191 | Ga0500622_0004549 | 3300053156 | Bacteria | 8646 |
| 1192 | Ga0500622_0004862 | 3300053156 | Bacteria | 8229 |
| 1193 | Ga0500637_0000662 | 3300053178 | Bacteria | 13655 |
| 1194 | Ga0501084_0002798 | 3300054114 | Bacteria | 14094 |
| 1195 | Ga0501084_0036304 | 3300054114 | Bacteria | 4117 |
| 1196 | Ga0501084_0044700 | 3300054114 | Unclassified | 3708 |
| 1197 | Ga0501084_0108028 | 3300054114 | Bacteria | 2337 |
| 1198 | Ga0501084_0118759 | 3300054114 | Bacteria | 2223 |
| 1199 | Ga0501084_0194259 | 3300054114 | Bacteria | 1712 |
| 1200 | Ga0501082_0000153 | 3300060353 | Bacteria | 57979 |
| 1201 | Ga0501082_0025606 | 3300060353 | Bacteria | 5083 |
| 1202 | Ga0501082_0032602 | 3300060353 | Bacteria | 4494 |
| 1203 | Ga0501082_0099110 | 3300060353 | Bacteria | 2519 |
| 1204 | Ga0501082_0118265 | 3300060353 | Bacteria | 2296 |
| 1205 | Ga0501082_0184646 | 3300060353 | Bacteria | 1814 |
| 1206 | Ga0501082_0225712 | 3300060353 | Bacteria | 1630 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042876 | Ga0451577_0168572 | Ga0451577_0168572_807_1760 | 317 |
| 2 | 3300050511 | nmdc:mga08y16_301427_c1 | nmdc:mga08y16_301427_c1_26_1018 | 318 |
| 3 | 3300046517 | Ga0495630_0097774 | Ga0495630_0097774_1137_2126 | 323 |
| 4 | 3300053085 | Ga0495619_0143771 | Ga0495619_0143771_200_1189 | 323 |
| 5 | 3300049744 | Ga0501083_0108118 | Ga0501083_0108118_498_1556 | 329 |
| 6 | 3300005577 | Ga0068857_100095018 | Ga0068857_1000950183 | 338 |
| 7 | 3300026116 | Ga0207674_10104321 | Ga0207674_101043212 | 338 |
| 8 | 3300049823 | Ga0501044_0041174 | Ga0501044_0041174_3056_4216 | 340 |
| 9 | 3300005458 | Ga0070681_10014914 | Ga0070681_100149143 | 342 |
| 10 | 3300049575 | Ga0501039_0311870 | Ga0501039_0311870_11_1108 | 342 |
| 11 | 3300049582 | Ga0501048_0090928 | Ga0501048_0090928_1088_2116 | 342 |
| 12 | 3300049589 | Ga0501073_0159953 | Ga0501073_0159953_242_1339 | 342 |
| 13 | 3300049591 | Ga0501075_0234248 | Ga0501075_0234248_204_1301 | 342 |
| 14 | 3300049742 | Ga0501080_0028327 | Ga0501080_0028327_3528_4625 | 342 |
| 15 | 3300050512 | nmdc:mga0n895_442796_c1 | nmdc:mga0n895_442796_c1_117_1289 | 342 |
| 16 | 3300054114 | Ga0501084_0194259 | Ga0501084_0194259_68_1165 | 342 |
| 17 | 3300005834 | Ga0068851_10000697 | Ga0068851_100006978 | 343 |
| 18 | 3300025321 | Ga0207656_10009056 | Ga0207656_100090562 | 343 |
| 19 | 3300005536 | Ga0070697_100083207 | Ga0070697_1000832073 | 344 |
| 20 | 3300048907 | Ga0496104_0194574 | Ga0496104_0194574_190_1305 | 344 |
| 21 | 3300048912 | Ga0496109_0360555 | Ga0496109_0360555_16_1131 | 344 |
| 22 | 3300006846 | Ga0075430_100004678 | Ga0075430_1000046786 | 345 |
| 23 | 3300050510 | nmdc:mga06r32_101650_c1 | nmdc:mga06r32_101650_c1_625_1773 | 345 |
| 24 | 3300025939 | Ga0207665_10085507 | Ga0207665_100855072 | 348 |
| 25 | 3300009094 | Ga0111539_10027693 | Ga0111539_100276934 | 349 |
| 26 | 3300050511 | nmdc:mga08y16_39083_c1 | nmdc:mga08y16_39083_c1_3298_4449 | 349 |
| 27 | 3300005444 | Ga0070694_100043975 | Ga0070694_1000439752 | 351 |
| 28 | 3300009177 | Ga0105248_10048201 | Ga0105248_100482016 | 351 |
| 29 | 3300009545 | Ga0105237_10001199 | Ga0105237_100011995 | 351 |
| 30 | 3300025914 | Ga0207671_10066492 | Ga0207671_100664922 | 351 |
| 31 | 3300031548 | Ga0307408_100039414 | Ga0307408_1000394142 | 351 |
| 32 | 3300031731 | Ga0307405_10010376 | Ga0307405_100103762 | 351 |
| 33 | 3300031903 | Ga0307407_10018810 | Ga0307407_100188102 | 351 |
| 34 | 3300031995 | Ga0307409_100013914 | Ga0307409_1000139146 | 351 |
| 35 | 3300032004 | Ga0307414_10041367 | Ga0307414_100413672 | 351 |
| 36 | 3300032126 | Ga0307415_100051077 | Ga0307415_1000510772 | 351 |
| 37 | 3300047317 | Ga0495604_0138028 | Ga0495604_0138028_527_1672 | 351 |
| 38 | 3300048088 | Ga0495602_0125162 | Ga0495602_0125162_742_1887 | 351 |
| 39 | 3300049656 | Ga0501209_005168 | Ga0501209_005168_401_1579 | 351 |
| 40 | 3300049679 | Ga0501249_001352 | Ga0501249_001352_3483_4661 | 351 |
| 41 | 3300050507 | nmdc:mga05p37_204512_c1 | nmdc:mga05p37_204512_c1_1039_2154 | 351 |
| 42 | 3300005340 | Ga0070689_100051380 | Ga0070689_1000513802 | 352 |
| 43 | 3300005458 | Ga0070681_10053577 | Ga0070681_100535772 | 352 |
| 44 | 3300025936 | Ga0207670_10045827 | Ga0207670_100458272 | 352 |
| 45 | 3300005356 | Ga0070674_100130582 | Ga0070674_1001305821 | 354 |
| 46 | 3300005530 | Ga0070679_100080169 | Ga0070679_1000801692 | 354 |
| 47 | 3300031727 | Ga0316576_10264041 | Ga0316576_102640412 | 354 |
| 48 | 3300048910 | Ga0496107_0279814 | Ga0496107_0279814_133_1209 | 354 |
| 49 | 3300049576 | Ga0501040_0079064 | Ga0501040_0079064_107_1171 | 354 |
| 50 | 3300049576 | Ga0501040_0130551 | Ga0501040_0130551_612_1676 | 354 |
| 51 | 3300049577 | Ga0501041_0067616 | Ga0501041_0067616_698_1762 | 354 |
| 52 | 3300049587 | Ga0501071_0073577 | Ga0501071_0073577_1054_2238 | 354 |
| 53 | 3300049743 | Ga0501081_0268569 | Ga0501081_0268569_23_1087 | 354 |
| 54 | 3300050515 | nmdc:mga0a205_218560_c1 | nmdc:mga0a205_218560_c1_212_1294 | 354 |
| 55 | 3300009094 | Ga0111539_10253587 | Ga0111539_102535872 | 355 |
| 56 | 3300028380 | Ga0268265_10073239 | Ga0268265_100732392 | 355 |
| 57 | 3300050511 | nmdc:mga08y16_97464_c1 | nmdc:mga08y16_97464_c1_1329_2501 | 355 |
| 58 | 3300050515 | nmdc:mga0a205_252764_c1 | nmdc:mga0a205_252764_c1_77_1237 | 355 |
| 59 | 3300009094 | Ga0111539_10461143 | Ga0111539_104611432 | 356 |
| 60 | 3300006844 | Ga0075428_100099532 | Ga0075428_1000995322 | 357 |
| 61 | 3300006847 | Ga0075431_100126116 | Ga0075431_1001261162 | 357 |
| 62 | 3300006880 | Ga0075429_100000373 | Ga0075429_10000037316 | 357 |
| 63 | 3300009147 | Ga0114129_10117141 | Ga0114129_101171413 | 357 |
| 64 | 3300050510 | nmdc:mga06r32_195476_c1 | nmdc:mga06r32_195476_c1_494_1636 | 357 |
| 65 | 3300035691 | Ga0373931_0075118 | Ga0373931_0075118_247_1395 | 358 |
| 66 | 3300050512 | nmdc:mga0n895_22958_c1 | nmdc:mga0n895_22958_c1_3494_4633 | 358 |
| 67 | 3300005340 | Ga0070689_100042885 | Ga0070689_1000428851 | 359 |
| 68 | 3300005617 | Ga0068859_100113519 | Ga0068859_1001135192 | 359 |
| 69 | 3300006931 | Ga0097620_100113521 | Ga0097620_1001135212 | 359 |
| 70 | 3300025912 | Ga0207707_10159067 | Ga0207707_101590672 | 359 |
| 71 | 3300025936 | Ga0207670_10093712 | Ga0207670_100937121 | 359 |
| 72 | 3300025945 | Ga0207679_10067688 | Ga0207679_100676883 | 359 |
| 73 | 3300042876 | Ga0451577_0361662 | Ga0451577_0361662_23_1204 | 359 |
| 74 | 3300005985 | Ga0081539_10103462 | Ga0081539_101034621 | 360 |
| 75 | 3300050515 | nmdc:mga0a205_82097_c1 | nmdc:mga0a205_82097_c1_35_1126 | 360 |
| 76 | 3300005331 | Ga0070670_100026909 | Ga0070670_1000269095 | 361 |
| 77 | 3300021441 | Ga0213871_10002005 | Ga0213871_100020053 | 361 |
| 78 | 3300039438 | Ga0436360_0779618 | Ga0436360_0779618_2849_4015 | 361 |
| 79 | 3300031995 | Ga0307409_100096204 | Ga0307409_1000962042 | 362 |
| 80 | 3300049580 | Ga0501046_0043068 | Ga0501046_0043068_2080_3168 | 362 |
| 81 | 3300049587 | Ga0501071_0006278 | Ga0501071_0006278_1345_2433 | 362 |
| 82 | 3300049588 | Ga0501072_0022208 | Ga0501072_0022208_1948_3036 | 362 |
| 83 | 3300049591 | Ga0501075_0031561 | Ga0501075_0031561_1827_2915 | 362 |
| 84 | 3300049592 | Ga0501076_0008713 | Ga0501076_0008713_3525_4613 | 362 |
| 85 | 3300049741 | Ga0501079_0044377 | Ga0501079_0044377_2221_3309 | 362 |
| 86 | 3300054114 | Ga0501084_0044700 | Ga0501084_0044700_1806_2894 | 362 |
| 87 | iso_pu_bacteria | 2833640130 | 2833642261 | 362 |
| 88 | iso_pu_bacteria | 2910245624 | 2910247851 | 362 |
| 89 | 3300050511 | nmdc:mga08y16_53115_c1 | nmdc:mga08y16_53115_c1_2274_3425 | 363 |
| 90 | 3300005441 | Ga0070700_100128200 | Ga0070700_1001282002 | 364 |
| 91 | 3300005471 | Ga0070698_100013716 | Ga0070698_1000137162 | 364 |
| 92 | 3300005518 | Ga0070699_100137037 | Ga0070699_1001370372 | 364 |
| 93 | 3300009094 | Ga0111539_10141258 | Ga0111539_101412582 | 364 |
| 94 | 3300009094 | Ga0111539_10152458 | Ga0111539_101524582 | 364 |
| 95 | 3300009148 | Ga0105243_10054626 | Ga0105243_100546262 | 364 |
| 96 | 3300009177 | Ga0105248_10081802 | Ga0105248_100818022 | 364 |
| 97 | 3300031727 | Ga0316576_10115620 | Ga0316576_101156202 | 364 |
| 98 | 3300032126 | Ga0307415_100327081 | Ga0307415_1003270811 | 364 |
| 99 | 3300035090 | Ga0373949_0009454 | Ga0373949_0009454_927_2066 | 364 |
| 100 | 3300035172 | Ga0373955_0004354 | Ga0373955_0004354_306_1445 | 364 |
| 101 | 3300036401 | Ga0373937_0268147 | Ga0373937_0268147_302_1441 | 364 |
| 102 | 3300046476 | Ga0495662_0015260 | Ga0495662_0015260_2006_3145 | 364 |
| 103 | 3300046514 | Ga0495618_0051458 | Ga0495618_0051458_589_1728 | 364 |
| 104 | 3300046516 | Ga0495628_0008816 | Ga0495628_0008816_5408_6547 | 364 |
| 105 | 3300046517 | Ga0495630_0042713 | Ga0495630_0042713_2034_3173 | 364 |
| 106 | 3300046642 | Ga0495634_0013645 | Ga0495634_0013645_2132_3271 | 364 |
| 107 | 3300046675 | Ga0495657_0119437 | Ga0495657_0119437_384_1523 | 364 |
| 108 | 3300047319 | Ga0495674_0255206 | Ga0495674_0255206_270_1409 | 364 |
| 109 | 3300050515 | nmdc:mga0a205_37715_c2 | nmdc:mga0a205_37715_c2_25_1131 | 364 |
| 110 | 3300053078 | Ga0495612_0017087 | Ga0495612_0017087_396_1535 | 364 |
| 111 | 3300005334 | Ga0068869_100050893 | Ga0068869_1000508932 | 365 |
| 112 | 3300005334 | Ga0068869_100133965 | Ga0068869_1001339652 | 365 |
| 113 | 3300005468 | Ga0070707_100007330 | Ga0070707_1000073307 | 365 |
| 114 | 3300009094 | Ga0111539_10046775 | Ga0111539_100467756 | 365 |
| 115 | 3300025922 | Ga0207646_10009809 | Ga0207646_100098098 | 365 |
| 116 | 3300025942 | Ga0207689_10005683 | Ga0207689_100056832 | 365 |
| 117 | 3300027907 | Ga0207428_10082286 | Ga0207428_100822863 | 365 |
| 118 | 3300050507 | nmdc:mga05p37_112288_c1 | nmdc:mga05p37_112288_c1_2228_3337 | 365 |
| 119 | 3300005577 | Ga0068857_100118030 | Ga0068857_1001180302 | 366 |
| 120 | 3300005614 | Ga0068856_100096367 | Ga0068856_1000963673 | 366 |
| 121 | 3300006852 | Ga0075433_10254627 | Ga0075433_102546272 | 366 |
| 122 | 3300026023 | Ga0207677_10217837 | Ga0207677_102178372 | 366 |
| 123 | 3300026078 | Ga0207702_10397112 | Ga0207702_103971122 | 366 |
| 124 | 3300032004 | Ga0307414_10002616 | Ga0307414_100026167 | 366 |
| 125 | 3300049514 | Ga0501291_008599 | Ga0501291_008599_11_1312 | 366 |
| 126 | 3300049585 | Ga0501069_0107070 | Ga0501069_0107070_455_1567 | 366 |
| 127 | 3300049824 | Ga0501045_0178121 | Ga0501045_0178121_342_1454 | 366 |
| 128 | 3300050515 | nmdc:mga0a205_177069_c1 | nmdc:mga0a205_177069_c1_659_1894 | 366 |
| 129 | 3300005549 | Ga0070704_100109222 | Ga0070704_1001092222 | 367 |
| 130 | 3300005937 | Ga0081455_10000484 | Ga0081455_100004844 | 367 |
| 131 | 3300006844 | Ga0075428_100139961 | Ga0075428_1001399612 | 367 |
| 132 | 3300009545 | Ga0105237_10349295 | Ga0105237_103492951 | 367 |
| 133 | 3300014325 | Ga0163163_10324857 | Ga0163163_103248572 | 367 |
| 134 | 3300026035 | Ga0207703_10102792 | Ga0207703_101027922 | 367 |
| 135 | 3300031548 | Ga0307408_100000881 | Ga0307408_1000008813 | 367 |
| 136 | 3300037471 | Ga0395905_0135118 | Ga0395905_0135118_1119_2222 | 367 |
| 137 | 3300042156 | Ga0439446_0007471 | Ga0439446_0007471_1096_2199 | 367 |
| 138 | 3300042876 | Ga0451577_0087277 | Ga0451577_0087277_1420_2550 | 367 |
| 139 | 3300042876 | Ga0451577_0100330 | Ga0451577_0100330_144_1247 | 367 |
| 140 | 3300042876 | Ga0451577_0441354 | Ga0451577_0441354_31_1134 | 367 |
| 141 | 3300044712 | Ga0453684_0001009 | Ga0453684_0001009_43435_44565 | 367 |
| 142 | 3300045051 | Ga0451576_0103405 | Ga0451576_0103405_491_1621 | 367 |
| 143 | 3300048911 | Ga0496108_0014287 | Ga0496108_0014287_2383_3486 | 367 |
| 144 | 3300048912 | Ga0496109_0018708 | Ga0496109_0018708_2395_3498 | 367 |
| 145 | 3300048913 | Ga0496110_0228911 | Ga0496110_0228911_489_1592 | 367 |
| 146 | 3300048916 | Ga0496113_0257721 | Ga0496113_0257721_247_1350 | 367 |
| 147 | 3300049578 | Ga0501042_0145980 | Ga0501042_0145980_93_1280 | 367 |
| 148 | 3300049824 | Ga0501045_0176067 | Ga0501045_0176067_57_1160 | 367 |
| 149 | 3300050513 | nmdc:mga0rr50_25582_c1 | nmdc:mga0rr50_25582_c1_1318_2421 | 367 |
| 150 | 3300050514 | nmdc:mga08x19_8848_c1 | nmdc:mga08x19_8848_c1_3824_4927 | 367 |
| 151 | 3300005441 | Ga0070700_100000225 | Ga0070700_10000022513 | 368 |
| 152 | 3300006852 | Ga0075433_10008768 | Ga0075433_100087682 | 368 |
| 153 | 3300006871 | Ga0075434_100019499 | Ga0075434_1000194992 | 368 |
| 154 | 3300026075 | Ga0207708_10000136 | Ga0207708_1000013622 | 368 |
| 155 | 3300026095 | Ga0207676_10393246 | Ga0207676_103932462 | 368 |
| 156 | 3300028563 | Ga0265319_1023238 | Ga0265319_10232382 | 368 |
| 157 | 3300028800 | Ga0265338_10029990 | Ga0265338_100299903 | 368 |
| 158 | 3300031548 | Ga0307408_100084392 | Ga0307408_1000843922 | 368 |
| 159 | 3300032004 | Ga0307414_10011273 | Ga0307414_100112735 | 368 |
| 160 | 3300032126 | Ga0307415_100308813 | Ga0307415_1003088131 | 368 |
| 161 | 3300036712 | Ga0316584_0050591 | Ga0316584_0050591_1861_3039 | 368 |
| 162 | 3300049576 | Ga0501040_0069638 | Ga0501040_0069638_143_1297 | 368 |
| 163 | 3300049654 | Ga0501207_002008 | Ga0501207_002008_842_1996 | 368 |
| 164 | 3300049663 | Ga0501223_008137 | Ga0501223_008137_881_2035 | 368 |
| 165 | 3300049665 | Ga0501227_006258 | Ga0501227_006258_983_2137 | 368 |
| 166 | 3300049667 | Ga0501230_008393 | Ga0501230_008393_60_1214 | 368 |
| 167 | 3300049668 | Ga0501233_004903 | Ga0501233_004903_437_1591 | 368 |
| 168 | 3300050515 | nmdc:mga0a205_51646_c1 | nmdc:mga0a205_51646_c1_1350_2492 | 368 |
| 169 | 3300000549 | LJQas_1000004 | LJQas_10000047 | 369 |
| 170 | 3300005355 | Ga0070671_100032235 | Ga0070671_1000322352 | 369 |
| 171 | 3300014968 | Ga0157379_10108065 | Ga0157379_101080651 | 369 |
| 172 | 3300025931 | Ga0207644_10009195 | Ga0207644_100091954 | 369 |
| 173 | 3300045051 | Ga0451576_0006316 | Ga0451576_0006316_2383_3549 | 369 |
| 174 | 3300048915 | Ga0496112_0111166 | Ga0496112_0111166_807_1949 | 369 |
| 175 | 3300003203 | JGI25406J46586_10004388 | JGI25406J46586_100043883 | 370 |
| 176 | 3300005345 | Ga0070692_10077165 | Ga0070692_100771652 | 370 |
| 177 | 3300005444 | Ga0070694_100057868 | Ga0070694_1000578682 | 370 |
| 178 | 3300005545 | Ga0070695_100055818 | Ga0070695_1000558181 | 370 |
| 179 | 3300005615 | Ga0070702_100013190 | Ga0070702_1000131903 | 370 |
| 180 | 3300005617 | Ga0068859_100122740 | Ga0068859_1001227403 | 370 |
| 181 | 3300005617 | Ga0068859_100246020 | Ga0068859_1002460202 | 370 |
| 182 | 3300005985 | Ga0081539_10000858 | Ga0081539_1000085830 | 370 |
| 183 | 3300006844 | Ga0075428_100278170 | Ga0075428_1002781702 | 370 |
| 184 | 3300006852 | Ga0075433_10052347 | Ga0075433_100523472 | 370 |
| 185 | 3300006931 | Ga0097620_100122741 | Ga0097620_1001227413 | 370 |
| 186 | 3300006931 | Ga0097620_100246013 | Ga0097620_1002460132 | 370 |
| 187 | 3300009094 | Ga0111539_10091032 | Ga0111539_100910323 | 370 |
| 188 | 3300009177 | Ga0105248_10005185 | Ga0105248_100051854 | 370 |
| 189 | 3300013100 | Ga0157373_10143903 | Ga0157373_101439031 | 370 |
| 190 | 3300013306 | Ga0163162_10097787 | Ga0163162_100977872 | 370 |
| 191 | 3300025885 | Ga0207653_10000499 | Ga0207653_100004997 | 370 |
| 192 | 3300025941 | Ga0207711_10007598 | Ga0207711_100075982 | 370 |
| 193 | 3300026035 | Ga0207703_10365743 | Ga0207703_103657431 | 370 |
| 194 | 3300031251 | Ga0265327_10012430 | Ga0265327_100124304 | 370 |
| 195 | 3300032126 | Ga0307415_100144538 | Ga0307415_1001445382 | 370 |
| 196 | 3300041505 | Ga0451849_1552928 | Ga0451849_1552928_362_1522 | 370 |
| 197 | 3300046537 | Ga0495598_0027906 | Ga0495598_0027906_187_1341 | 370 |
| 198 | 3300048911 | Ga0496108_0127870 | Ga0496108_0127870_367_1512 | 370 |
| 199 | 3300050507 | nmdc:mga05p37_114824_c1 | nmdc:mga05p37_114824_c1_1051_2202 | 370 |
| 200 | 3300050512 | nmdc:mga0n895_463057_c1 | nmdc:mga0n895_463057_c1_94_1236 | 370 |
| 201 | 3300050513 | nmdc:mga0rr50_140708_c1 | nmdc:mga0rr50_140708_c1_17_1159 | 370 |
| 202 | 3300050515 | nmdc:mga0a205_85833_c1 | nmdc:mga0a205_85833_c1_782_1930 | 370 |
| 203 | 3300053142 | Ga0500577_0010739 | Ga0500577_0010739_1414_2574 | 370 |
| 204 | 3300005293 | Ga0065715_10148838 | Ga0065715_101488382 | 371 |
| 205 | 3300005295 | Ga0065707_10000589 | Ga0065707_1000058919 | 371 |
| 206 | 3300005327 | Ga0070658_10014417 | Ga0070658_100144172 | 371 |
| 207 | 3300005333 | Ga0070677_10076772 | Ga0070677_100767722 | 371 |
| 208 | 3300005354 | Ga0070675_100137803 | Ga0070675_1001378032 | 371 |
| 209 | 3300005356 | Ga0070674_100125249 | Ga0070674_1001252491 | 371 |
| 210 | 3300005364 | Ga0070673_100049583 | Ga0070673_1000495832 | 371 |
| 211 | 3300005458 | Ga0070681_10076727 | Ga0070681_100767272 | 371 |
| 212 | 3300005518 | Ga0070699_100001870 | Ga0070699_10000187014 | 371 |
| 213 | 3300005530 | Ga0070679_100045696 | Ga0070679_1000456963 | 371 |
| 214 | 3300005546 | Ga0070696_100010953 | Ga0070696_1000109536 | 371 |
| 215 | 3300005546 | Ga0070696_100113567 | Ga0070696_1001135672 | 371 |
| 216 | 3300005616 | Ga0068852_100144084 | Ga0068852_1001440842 | 371 |
| 217 | 3300005617 | Ga0068859_100008065 | Ga0068859_1000080652 | 371 |
| 218 | 3300005842 | Ga0068858_100146950 | Ga0068858_1001469501 | 371 |
| 219 | 3300006852 | Ga0075433_10084269 | Ga0075433_100842692 | 371 |
| 220 | 3300006881 | Ga0068865_100067469 | Ga0068865_1000674693 | 371 |
| 221 | 3300006881 | Ga0068865_100134818 | Ga0068865_1001348182 | 371 |
| 222 | 3300006931 | Ga0097620_100008065 | Ga0097620_1000080652 | 371 |
| 223 | 3300009092 | Ga0105250_10000010 | Ga0105250_10000010159 | 371 |
| 224 | 3300009094 | Ga0111539_10218135 | Ga0111539_102181352 | 371 |
| 225 | 3300009147 | Ga0114129_10636715 | Ga0114129_106367151 | 371 |
| 226 | 3300009177 | Ga0105248_10008038 | Ga0105248_100080386 | 371 |
| 227 | 3300009551 | Ga0105238_10081087 | Ga0105238_100810873 | 371 |
| 228 | 3300010159 | Ga0099796_10014196 | Ga0099796_100141963 | 371 |
| 229 | 3300013105 | Ga0157369_10240203 | Ga0157369_102402032 | 371 |
| 230 | 3300013297 | Ga0157378_10017860 | Ga0157378_100178606 | 371 |
| 231 | 3300013307 | Ga0157372_10249624 | Ga0157372_102496242 | 371 |
| 232 | 3300013308 | Ga0157375_10382297 | Ga0157375_103822972 | 371 |
| 233 | 3300014968 | Ga0157379_10000022 | Ga0157379_1000002211 | 371 |
| 234 | 3300017792 | Ga0163161_10006579 | Ga0163161_100065796 | 371 |
| 235 | 3300025711 | Ga0207696_1000159 | Ga0207696_100015964 | 371 |
| 236 | 3300025905 | Ga0207685_10017656 | Ga0207685_100176562 | 371 |
| 237 | 3300025909 | Ga0207705_10015184 | Ga0207705_100151846 | 371 |
| 238 | 3300025913 | Ga0207695_10105332 | Ga0207695_101053322 | 371 |
| 239 | 3300025924 | Ga0207694_10102250 | Ga0207694_101022502 | 371 |
| 240 | 3300025928 | Ga0207700_10100876 | Ga0207700_101008762 | 371 |
| 241 | 3300025933 | Ga0207706_10057909 | Ga0207706_100579095 | 371 |
| 242 | 3300025937 | Ga0207669_10015543 | Ga0207669_100155434 | 371 |
| 243 | 3300025938 | Ga0207704_10131843 | Ga0207704_101318432 | 371 |
| 244 | 3300025941 | Ga0207711_10004285 | Ga0207711_100042854 | 371 |
| 245 | 3300025949 | Ga0207667_10214491 | Ga0207667_102144912 | 371 |
| 246 | 3300025960 | Ga0207651_10044685 | Ga0207651_100446852 | 371 |
| 247 | 3300025961 | Ga0207712_10026534 | Ga0207712_100265343 | 371 |
| 248 | 3300026041 | Ga0207639_10017809 | Ga0207639_100178094 | 371 |
| 249 | 3300026095 | Ga0207676_10095344 | Ga0207676_100953442 | 371 |
| 250 | 3300026142 | Ga0207698_10085793 | Ga0207698_100857932 | 371 |
| 251 | 3300026142 | Ga0207698_10145772 | Ga0207698_101457722 | 371 |
| 252 | 3300028017 | Ga0265356_1001008 | Ga0265356_10010083 | 371 |
| 253 | 3300030878 | Ga0265770_1000295 | Ga0265770_10002953 | 371 |
| 254 | 3300031090 | Ga0265760_10002069 | Ga0265760_100020696 | 371 |
| 255 | 3300031548 | Ga0307408_100079697 | Ga0307408_1000796972 | 371 |
| 256 | 3300031548 | Ga0307408_100169364 | Ga0307408_1001693642 | 371 |
| 257 | 3300031730 | Ga0307516_10003296 | Ga0307516_1000329626 | 371 |
| 258 | 3300032005 | Ga0307411_10278957 | Ga0307411_102789571 | 371 |
| 259 | 3300037466 | Ga0395898_0002342 | Ga0395898_0002342_17659_18822 | 371 |
| 260 | 3300041498 | Ga0451841_0180974 | Ga0451841_0180974_110_1291 | 371 |
| 261 | 3300041507 | Ga0451851_0536537 | Ga0451851_0536537_151_1332 | 371 |
| 262 | 3300041512 | Ga0451853_3596503 | Ga0451853_3596503_701_1882 | 371 |
| 263 | 3300044656 | Ga0466969_0022971 | Ga0466969_0022971_166_1308 | 371 |
| 264 | 3300044684 | Ga0466966_0000214 | Ga0466966_0000214_37317_38459 | 371 |
| 265 | 3300044693 | Ga0466961_0075509 | Ga0466961_0075509_157_1299 | 371 |
| 266 | 3300044719 | Ga0466971_0000271 | Ga0466971_0000271_16462_17604 | 371 |
| 267 | 3300045049 | Ga0466959_0091763 | Ga0466959_0091763_783_1925 | 371 |
| 268 | 3300045836 | Ga0466958_0138930 | Ga0466958_0138930_133_1275 | 371 |
| 269 | 3300046616 | Ga0495668_0001582 | Ga0495668_0001582_20239_21402 | 371 |
| 270 | 3300046683 | Ga0495658_0058458 | Ga0495658_0058458_189_1358 | 371 |
| 271 | 3300048904 | Ga0496101_0125196 | Ga0496101_0125196_86_1255 | 371 |
| 272 | 3300048907 | Ga0496104_0017719 | Ga0496104_0017719_1100_2269 | 371 |
| 273 | 3300048908 | Ga0496105_0036438 | Ga0496105_0036438_2396_3565 | 371 |
| 274 | 3300048912 | Ga0496109_0242854 | Ga0496109_0242854_381_1544 | 371 |
| 275 | 3300048915 | Ga0496112_0266828 | Ga0496112_0266828_188_1339 | 371 |
| 276 | 3300048917 | Ga0496114_0010422 | Ga0496114_0010422_1714_2883 | 371 |
| 277 | 3300048918 | Ga0496115_0006586 | Ga0496115_0006586_6949_8118 | 371 |
| 278 | 3300049571 | Ga0501034_0009358 | Ga0501034_0009358_8668_9822 | 371 |
| 279 | 3300049580 | Ga0501046_0085296 | Ga0501046_0085296_988_2157 | 371 |
| 280 | 3300053151 | Ga0500604_0034182 | Ga0500604_0034182_63_1229 | 371 |
| 281 | 3300053156 | Ga0500622_0004549 | Ga0500622_0004549_6892_8061 | 371 |
| 282 | 3300053156 | Ga0500622_0004862 | Ga0500622_0004862_3738_4907 | 371 |
| 283 | 3300000531 | CNBas_1000308 | CNBas_10003082 | 372 |
| 284 | 3300002459 | JGI24751J29686_10000012 | JGI24751J29686_1000001273 | 372 |
| 285 | 3300005288 | Ga0065714_10064422 | Ga0065714_10064422118 | 372 |
| 286 | 3300005289 | Ga0065704_10000986 | Ga0065704_1000098612 | 372 |
| 287 | 3300005290 | Ga0065712_10067728 | Ga0065712_1006772847 | 372 |
| 288 | 3300005290 | Ga0065712_10085973 | Ga0065712_100859731 | 372 |
| 289 | 3300005293 | Ga0065715_10100505 | Ga0065715_101005053 | 372 |
| 290 | 3300005293 | Ga0065715_10112355 | Ga0065715_101123552 | 372 |
| 291 | 3300005295 | Ga0065707_10001006 | Ga0065707_100010065 | 372 |
| 292 | 3300005329 | Ga0070683_100245314 | Ga0070683_1002453142 | 372 |
| 293 | 3300005331 | Ga0070670_100000165 | Ga0070670_10000016533 | 372 |
| 294 | 3300005331 | Ga0070670_100034090 | Ga0070670_1000340904 | 372 |
| 295 | 3300005331 | Ga0070670_100237816 | Ga0070670_1002378162 | 372 |
| 296 | 3300005334 | Ga0068869_100017710 | Ga0068869_1000177105 | 372 |
| 297 | 3300005337 | Ga0070682_100018666 | Ga0070682_1000186663 | 372 |
| 298 | 3300005338 | Ga0068868_100067416 | Ga0068868_1000674163 | 372 |
| 299 | 3300005345 | Ga0070692_10014720 | Ga0070692_100147202 | 372 |
| 300 | 3300005355 | Ga0070671_100002614 | Ga0070671_10000261411 | 372 |
| 301 | 3300005364 | Ga0070673_100036253 | Ga0070673_1000362532 | 372 |
| 302 | 3300005364 | Ga0070673_100133269 | Ga0070673_1001332692 | 372 |
| 303 | 3300005367 | Ga0070667_100070267 | Ga0070667_1000702672 | 372 |
| 304 | 3300005440 | Ga0070705_100156059 | Ga0070705_1001560592 | 372 |
| 305 | 3300005441 | Ga0070700_100037319 | Ga0070700_1000373192 | 372 |
| 306 | 3300005444 | Ga0070694_100013232 | Ga0070694_1000132325 | 372 |
| 307 | 3300005456 | Ga0070678_100293021 | Ga0070678_1002930211 | 372 |
| 308 | 3300005466 | Ga0070685_10002946 | Ga0070685_1000294610 | 372 |
| 309 | 3300005467 | Ga0070706_100000128 | Ga0070706_10000012862 | 372 |
| 310 | 3300005518 | Ga0070699_100173162 | Ga0070699_1001731622 | 372 |
| 311 | 3300005544 | Ga0070686_100058002 | Ga0070686_1000580022 | 372 |
| 312 | 3300005549 | Ga0070704_100057433 | Ga0070704_1000574332 | 372 |
| 313 | 3300005549 | Ga0070704_100222623 | Ga0070704_1002226231 | 372 |
| 314 | 3300005564 | Ga0070664_100007053 | Ga0070664_1000070533 | 372 |
| 315 | 3300005616 | Ga0068852_100148679 | Ga0068852_1001486792 | 372 |
| 316 | 3300005617 | Ga0068859_100008330 | Ga0068859_1000083302 | 372 |
| 317 | 3300005617 | Ga0068859_100039360 | Ga0068859_1000393603 | 372 |
| 318 | 3300005618 | Ga0068864_100012380 | Ga0068864_1000123806 | 372 |
| 319 | 3300005841 | Ga0068863_100011604 | Ga0068863_1000116046 | 372 |
| 320 | 3300005841 | Ga0068863_100273330 | Ga0068863_1002733302 | 372 |
| 321 | 3300005842 | Ga0068858_100090574 | Ga0068858_1000905742 | 372 |
| 322 | 3300005842 | Ga0068858_100105122 | Ga0068858_1001051222 | 372 |
| 323 | 3300005843 | Ga0068860_100084996 | Ga0068860_1000849963 | 372 |
| 324 | 3300005843 | Ga0068860_100159039 | Ga0068860_1001590392 | 372 |
| 325 | 3300005843 | Ga0068860_100375002 | Ga0068860_1003750021 | 372 |
| 326 | 3300005985 | Ga0081539_10000586 | Ga0081539_1000058647 | 372 |
| 327 | 3300006358 | Ga0068871_100015984 | Ga0068871_1000159846 | 372 |
| 328 | 3300006844 | Ga0075428_100000322 | Ga0075428_10000032233 | 372 |
| 329 | 3300006844 | Ga0075428_100345217 | Ga0075428_1003452172 | 372 |
| 330 | 3300006847 | Ga0075431_100001136 | Ga0075431_10000113614 | 372 |
| 331 | 3300006871 | Ga0075434_100142884 | Ga0075434_1001428842 | 372 |
| 332 | 3300006931 | Ga0097620_100008330 | Ga0097620_1000083309 | 372 |
| 333 | 3300006931 | Ga0097620_100039360 | Ga0097620_1000393603 | 372 |
| 334 | 3300007076 | Ga0075435_100018572 | Ga0075435_1000185722 | 372 |
| 335 | 3300009093 | Ga0105240_10367892 | Ga0105240_103678922 | 372 |
| 336 | 3300009094 | Ga0111539_10003889 | Ga0111539_1000388917 | 372 |
| 337 | 3300009098 | Ga0105245_10017231 | Ga0105245_100172316 | 372 |
| 338 | 3300009101 | Ga0105247_10010150 | Ga0105247_100101503 | 372 |
| 339 | 3300009147 | Ga0114129_10114661 | Ga0114129_101146613 | 372 |
| 340 | 3300009148 | Ga0105243_10200116 | Ga0105243_102001162 | 372 |
| 341 | 3300009174 | Ga0105241_10246968 | Ga0105241_102469682 | 372 |
| 342 | 3300009177 | Ga0105248_10091920 | Ga0105248_100919202 | 372 |
| 343 | 3300009177 | Ga0105248_10268124 | Ga0105248_102681242 | 372 |
| 344 | 3300009551 | Ga0105238_10027477 | Ga0105238_100274774 | 372 |
| 345 | 3300011119 | Ga0105246_10002825 | Ga0105246_100028254 | 372 |
| 346 | 3300013296 | Ga0157374_10120879 | Ga0157374_101208792 | 372 |
| 347 | 3300013306 | Ga0163162_10017095 | Ga0163162_100170953 | 372 |
| 348 | 3300013306 | Ga0163162_10029444 | Ga0163162_100294445 | 372 |
| 349 | 3300013308 | Ga0157375_10009948 | Ga0157375_100099487 | 372 |
| 350 | 3300013308 | Ga0157375_10011069 | Ga0157375_100110693 | 372 |
| 351 | 3300013308 | Ga0157375_10045027 | Ga0157375_100450273 | 372 |
| 352 | 3300014325 | Ga0163163_10001068 | Ga0163163_1000106811 | 372 |
| 353 | 3300014325 | Ga0163163_10017063 | Ga0163163_100170634 | 372 |
| 354 | 3300014325 | Ga0163163_10188023 | Ga0163163_101880232 | 372 |
| 355 | 3300014326 | Ga0157380_10004962 | Ga0157380_100049624 | 372 |
| 356 | 3300014326 | Ga0157380_10196585 | Ga0157380_101965852 | 372 |
| 357 | 3300014745 | Ga0157377_10033711 | Ga0157377_100337113 | 372 |
| 358 | 3300021384 | Ga0213876_10000757 | Ga0213876_100007578 | 372 |
| 359 | 3300025900 | Ga0207710_10002140 | Ga0207710_100021403 | 372 |
| 360 | 3300025900 | Ga0207710_10011490 | Ga0207710_100114902 | 372 |
| 361 | 3300025910 | Ga0207684_10000150 | Ga0207684_1000015062 | 372 |
| 362 | 3300025925 | Ga0207650_10000011 | Ga0207650_10000011227 | 372 |
| 363 | 3300025925 | Ga0207650_10113307 | Ga0207650_101133072 | 372 |
| 364 | 3300025925 | Ga0207650_10227824 | Ga0207650_102278242 | 372 |
| 365 | 3300025927 | Ga0207687_10014033 | Ga0207687_100140332 | 372 |
| 366 | 3300025931 | Ga0207644_10022158 | Ga0207644_100221583 | 372 |
| 367 | 3300025942 | Ga0207689_10004907 | Ga0207689_100049075 | 372 |
| 368 | 3300025944 | Ga0207661_10212873 | Ga0207661_102128731 | 372 |
| 369 | 3300025945 | Ga0207679_10057672 | Ga0207679_100576722 | 372 |
| 370 | 3300025961 | Ga0207712_10016542 | Ga0207712_100165423 | 372 |
| 371 | 3300025981 | Ga0207640_10130695 | Ga0207640_101306952 | 372 |
| 372 | 3300026035 | Ga0207703_10079553 | Ga0207703_100795532 | 372 |
| 373 | 3300026041 | Ga0207639_10031771 | Ga0207639_100317713 | 372 |
| 374 | 3300026075 | Ga0207708_10179265 | Ga0207708_101792651 | 372 |
| 375 | 3300026078 | Ga0207702_10253556 | Ga0207702_102535562 | 372 |
| 376 | 3300026088 | Ga0207641_10063252 | Ga0207641_100632521 | 372 |
| 377 | 3300026088 | Ga0207641_10135940 | Ga0207641_101359402 | 372 |
| 378 | 3300026088 | Ga0207641_10230880 | Ga0207641_102308801 | 372 |
| 379 | 3300026095 | Ga0207676_10085837 | Ga0207676_100858372 | 372 |
| 380 | 3300026118 | Ga0207675_100128081 | Ga0207675_1001280812 | 372 |
| 381 | 3300027717 | Ga0209998_10012992 | Ga0209998_100129922 | 372 |
| 382 | 3300028380 | Ga0268265_10119862 | Ga0268265_101198622 | 372 |
| 383 | 3300028380 | Ga0268265_10268411 | Ga0268265_102684112 | 372 |
| 384 | 3300028381 | Ga0268264_10030618 | Ga0268264_100306184 | 372 |
| 385 | 3300028381 | Ga0268264_10214191 | Ga0268264_102141912 | 372 |
| 386 | 3300031548 | Ga0307408_100025335 | Ga0307408_1000253353 | 372 |
| 387 | 3300031665 | Ga0316575_10019556 | Ga0316575_100195562 | 372 |
| 388 | 3300031691 | Ga0316579_10050024 | Ga0316579_100500242 | 372 |
| 389 | 3300031728 | Ga0316578_10014865 | Ga0316578_100148654 | 372 |
| 390 | 3300031731 | Ga0307405_10001196 | Ga0307405_100011963 | 372 |
| 391 | 3300031731 | Ga0307405_10015407 | Ga0307405_100154073 | 372 |
| 392 | 3300031824 | Ga0307413_10035152 | Ga0307413_100351522 | 372 |
| 393 | 3300031903 | Ga0307407_10003794 | Ga0307407_100037944 | 372 |
| 394 | 3300031995 | Ga0307409_100035668 | Ga0307409_1000356683 | 372 |
| 395 | 3300031995 | Ga0307409_100049438 | Ga0307409_1000494383 | 372 |
| 396 | 3300032004 | Ga0307414_10040990 | Ga0307414_100409902 | 372 |
| 397 | 3300032005 | Ga0307411_10015713 | Ga0307411_100157131 | 372 |
| 398 | 3300032126 | Ga0307415_100017136 | Ga0307415_1000171362 | 372 |
| 399 | 3300032139 | Ga0316580_10020786 | Ga0316580_100207862 | 372 |
| 400 | 3300035089 | Ga0373944_0029696 | Ga0373944_0029696_39_1223 | 372 |
| 401 | 3300035091 | Ga0373951_0003489 | Ga0373951_0003489_916_2067 | 372 |
| 402 | 3300035172 | Ga0373955_0041592 | Ga0373955_0041592_939_2123 | 372 |
| 403 | 3300035207 | Ga0373942_0015334 | Ga0373942_0015334_126_1280 | 372 |
| 404 | 3300035398 | Ga0316574_0095989 | Ga0316574_0095989_421_1584 | 372 |
| 405 | 3300035724 | Ga0373933_0032440 | Ga0373933_0032440_857_2041 | 372 |
| 406 | 3300036401 | Ga0373937_0003412 | Ga0373937_0003412_9855_11039 | 372 |
| 407 | 3300036647 | Ga0316582_0030921 | Ga0316582_0030921_621_1784 | 372 |
| 408 | 3300037471 | Ga0395905_0011300 | Ga0395905_0011300_2357_3553 | 372 |
| 409 | 3300046539 | Ga0495621_0031168 | Ga0495621_0031168_284_1462 | 372 |
| 410 | 3300048909 | Ga0496106_0214596 | Ga0496106_0214596_157_1308 | 372 |
| 411 | 3300048910 | Ga0496107_0234784 | Ga0496107_0234784_136_1287 | 372 |
| 412 | 3300048915 | Ga0496112_0283535 | Ga0496112_0283535_110_1261 | 372 |
| 413 | 3300049519 | Ga0501296_006756 | Ga0501296_006756_78_1241 | 372 |
| 414 | 3300049587 | Ga0501071_0023799 | Ga0501071_0023799_2126_3301 | 372 |
| 415 | 3300049591 | Ga0501075_0024437 | Ga0501075_0024437_1410_2585 | 372 |
| 416 | 3300049592 | Ga0501076_0133586 | Ga0501076_0133586_19_1194 | 372 |
| 417 | 3300049668 | Ga0501233_016029 | Ga0501233_016029_55_1218 | 372 |
| 418 | 3300049741 | Ga0501079_0056570 | Ga0501079_0056570_557_1732 | 372 |
| 419 | 3300050510 | nmdc:mga06r32_23270_c1 | nmdc:mga06r32_23270_c1_3293_4486 | 372 |
| 420 | 3300050511 | nmdc:mga08y16_1265_c1 | nmdc:mga08y16_1265_c1_3376_4551 | 372 |
| 421 | 3300050511 | nmdc:mga08y16_12852_c1 | nmdc:mga08y16_12852_c1_5654_6802 | 372 |
| 422 | 3300050515 | nmdc:mga0a205_83146_c1 | nmdc:mga0a205_83146_c1_1850_3025 | 372 |
| 423 | 3300053096 | Ga0500641_0001840 | Ga0500641_0001840_2405_3589 | 372 |
| 424 | 3300005353 | Ga0070669_100000025 | Ga0070669_10000002579 | 373 |
| 425 | 3300005434 | Ga0070709_10000103 | Ga0070709_1000010354 | 373 |
| 426 | 3300005458 | Ga0070681_10002525 | Ga0070681_1000252517 | 373 |
| 427 | 3300005518 | Ga0070699_100000024 | Ga0070699_100000024100 | 373 |
| 428 | 3300005547 | Ga0070693_100001436 | Ga0070693_1000014363 | 373 |
| 429 | 3300005549 | Ga0070704_100024375 | Ga0070704_1000243754 | 373 |
| 430 | 3300005842 | Ga0068858_100167680 | Ga0068858_1001676802 | 373 |
| 431 | 3300005844 | Ga0068862_100000670 | Ga0068862_1000006706 | 373 |
| 432 | 3300005844 | Ga0068862_100124251 | Ga0068862_1001242512 | 373 |
| 433 | 3300006844 | Ga0075428_100294492 | Ga0075428_1002944921 | 373 |
| 434 | 3300006914 | Ga0075436_100070770 | Ga0075436_1000707702 | 373 |
| 435 | 3300009093 | Ga0105240_10004276 | Ga0105240_1000427615 | 373 |
| 436 | 3300009101 | Ga0105247_10008389 | Ga0105247_100083898 | 373 |
| 437 | 3300025906 | Ga0207699_10000010 | Ga0207699_1000001072 | 373 |
| 438 | 3300025912 | Ga0207707_10003634 | Ga0207707_1000363414 | 373 |
| 439 | 3300025923 | Ga0207681_10000018 | Ga0207681_10000018184 | 373 |
| 440 | 3300025936 | Ga0207670_10153642 | Ga0207670_101536422 | 373 |
| 441 | 3300025940 | Ga0207691_10025720 | Ga0207691_100257208 | 373 |
| 442 | 3300025944 | Ga0207661_10033046 | Ga0207661_100330464 | 373 |
| 443 | 3300025949 | Ga0207667_10094332 | Ga0207667_100943322 | 373 |
| 444 | 3300025961 | Ga0207712_10004676 | Ga0207712_100046763 | 373 |
| 445 | 3300026095 | Ga0207676_10198923 | Ga0207676_101989232 | 373 |
| 446 | 3300028380 | Ga0268265_10000115 | Ga0268265_1000011563 | 373 |
| 447 | 3300028381 | Ga0268264_10015822 | Ga0268264_100158223 | 373 |
| 448 | 3300031852 | Ga0307410_10031892 | Ga0307410_100318923 | 373 |
| 449 | 3300037466 | Ga0395898_0082595 | Ga0395898_0082595_1347_2516 | 373 |
| 450 | 3300038443 | Ga0395901_0109249 | Ga0395901_0109249_27_1196 | 373 |
| 451 | 3300039437 | Ga0436365_0560037 | Ga0436365_0560037_28099_29334 | 373 |
| 452 | 3300046472 | Ga0495580_0107492 | Ga0495580_0107492_244_1428 | 373 |
| 453 | 3300048907 | Ga0496104_0257594 | Ga0496104_0257594_117_1256 | 373 |
| 454 | 3300048911 | Ga0496108_0053828 | Ga0496108_0053828_944_2083 | 373 |
| 455 | 3300048917 | Ga0496114_0034690 | Ga0496114_0034690_286_1425 | 373 |
| 456 | 3300053153 | Ga0500616_0000096 | Ga0500616_0000096_144890_146029 | 373 |
| 457 | 3300003203 | JGI25406J46586_10006498 | JGI25406J46586_100064981 | 374 |
| 458 | 3300005331 | Ga0070670_100199662 | Ga0070670_1001996622 | 374 |
| 459 | 3300005340 | Ga0070689_100001120 | Ga0070689_1000011204 | 374 |
| 460 | 3300005345 | Ga0070692_10056805 | Ga0070692_100568052 | 374 |
| 461 | 3300005354 | Ga0070675_100141218 | Ga0070675_1001412181 | 374 |
| 462 | 3300005364 | Ga0070673_100118782 | Ga0070673_1001187822 | 374 |
| 463 | 3300005436 | Ga0070713_100008652 | Ga0070713_1000086525 | 374 |
| 464 | 3300005438 | Ga0070701_10021561 | Ga0070701_100215612 | 374 |
| 465 | 3300005441 | Ga0070700_100056483 | Ga0070700_1000564832 | 374 |
| 466 | 3300005444 | Ga0070694_100075912 | Ga0070694_1000759121 | 374 |
| 467 | 3300005455 | Ga0070663_100083868 | Ga0070663_1000838682 | 374 |
| 468 | 3300005458 | Ga0070681_10029015 | Ga0070681_100290152 | 374 |
| 469 | 3300005458 | Ga0070681_10109366 | Ga0070681_101093662 | 374 |
| 470 | 3300005458 | Ga0070681_10277032 | Ga0070681_102770322 | 374 |
| 471 | 3300005459 | Ga0068867_100259877 | Ga0068867_1002598771 | 374 |
| 472 | 3300005539 | Ga0068853_100039118 | Ga0068853_1000391182 | 374 |
| 473 | 3300005548 | Ga0070665_100000156 | Ga0070665_10000015632 | 374 |
| 474 | 3300005548 | Ga0070665_100007626 | Ga0070665_1000076264 | 374 |
| 475 | 3300005616 | Ga0068852_100164719 | Ga0068852_1001647192 | 374 |
| 476 | 3300005617 | Ga0068859_100020509 | Ga0068859_1000205098 | 374 |
| 477 | 3300005617 | Ga0068859_100030082 | Ga0068859_1000300824 | 374 |
| 478 | 3300005617 | Ga0068859_100091528 | Ga0068859_1000915282 | 374 |
| 479 | 3300005617 | Ga0068859_100178854 | Ga0068859_1001788542 | 374 |
| 480 | 3300005618 | Ga0068864_100067513 | Ga0068864_1000675132 | 374 |
| 481 | 3300005618 | Ga0068864_100223984 | Ga0068864_1002239841 | 374 |
| 482 | 3300005719 | Ga0068861_100076206 | Ga0068861_1000762063 | 374 |
| 483 | 3300005841 | Ga0068863_100030745 | Ga0068863_1000307452 | 374 |
| 484 | 3300005841 | Ga0068863_100032235 | Ga0068863_1000322353 | 374 |
| 485 | 3300005841 | Ga0068863_100188114 | Ga0068863_1001881142 | 374 |
| 486 | 3300005985 | Ga0081539_10000165 | Ga0081539_10000165125 | 374 |
| 487 | 3300006028 | Ga0070717_10031311 | Ga0070717_100313112 | 374 |
| 488 | 3300006163 | Ga0070715_10008181 | Ga0070715_100081813 | 374 |
| 489 | 3300006173 | Ga0070716_100016262 | Ga0070716_1000162622 | 374 |
| 490 | 3300006846 | Ga0075430_100081711 | Ga0075430_1000817112 | 374 |
| 491 | 3300006852 | Ga0075433_10000891 | Ga0075433_100008912 | 374 |
| 492 | 3300006931 | Ga0097620_100020509 | Ga0097620_1000205098 | 374 |
| 493 | 3300006931 | Ga0097620_100030082 | Ga0097620_1000300824 | 374 |
| 494 | 3300006931 | Ga0097620_100091520 | Ga0097620_1000915202 | 374 |
| 495 | 3300006931 | Ga0097620_100178860 | Ga0097620_1001788602 | 374 |
| 496 | 3300009093 | Ga0105240_10332473 | Ga0105240_103324732 | 374 |
| 497 | 3300009174 | Ga0105241_10376150 | Ga0105241_103761501 | 374 |
| 498 | 3300009177 | Ga0105248_10296529 | Ga0105248_102965292 | 374 |
| 499 | 3300009545 | Ga0105237_10016045 | Ga0105237_100160457 | 374 |
| 500 | 3300010375 | Ga0105239_10113457 | Ga0105239_101134573 | 374 |
| 501 | 3300011119 | Ga0105246_10043902 | Ga0105246_100439022 | 374 |
| 502 | 3300013105 | Ga0157369_10115198 | Ga0157369_101151982 | 374 |
| 503 | 3300014325 | Ga0163163_10048713 | Ga0163163_100487132 | 374 |
| 504 | 3300014325 | Ga0163163_10112525 | Ga0163163_101125252 | 374 |
| 505 | 3300014326 | Ga0157380_10045507 | Ga0157380_100455072 | 374 |
| 506 | 3300014968 | Ga0157379_10241506 | Ga0157379_102415062 | 374 |
| 507 | 3300025907 | Ga0207645_10026939 | Ga0207645_100269394 | 374 |
| 508 | 3300025912 | Ga0207707_10007334 | Ga0207707_100073348 | 374 |
| 509 | 3300025912 | Ga0207707_10085096 | Ga0207707_100850962 | 374 |
| 510 | 3300025912 | Ga0207707_10123926 | Ga0207707_101239262 | 374 |
| 511 | 3300025914 | Ga0207671_10140751 | Ga0207671_101407512 | 374 |
| 512 | 3300025915 | Ga0207693_10199374 | Ga0207693_101993742 | 374 |
| 513 | 3300025916 | Ga0207663_10115420 | Ga0207663_101154202 | 374 |
| 514 | 3300025925 | Ga0207650_10101597 | Ga0207650_101015972 | 374 |
| 515 | 3300025928 | Ga0207700_10016955 | Ga0207700_100169552 | 374 |
| 516 | 3300025931 | Ga0207644_10078046 | Ga0207644_100780463 | 374 |
| 517 | 3300025931 | Ga0207644_10094299 | Ga0207644_100942992 | 374 |
| 518 | 3300025933 | Ga0207706_10025610 | Ga0207706_100256103 | 374 |
| 519 | 3300025933 | Ga0207706_10064918 | Ga0207706_100649182 | 374 |
| 520 | 3300025936 | Ga0207670_10001618 | Ga0207670_100016184 | 374 |
| 521 | 3300025939 | Ga0207665_10041194 | Ga0207665_100411942 | 374 |
| 522 | 3300025939 | Ga0207665_10092033 | Ga0207665_100920332 | 374 |
| 523 | 3300025941 | Ga0207711_10151653 | Ga0207711_101516532 | 374 |
| 524 | 3300025960 | Ga0207651_10068235 | Ga0207651_100682352 | 374 |
| 525 | 3300026035 | Ga0207703_10162554 | Ga0207703_101625542 | 374 |
| 526 | 3300026035 | Ga0207703_10199338 | Ga0207703_101993382 | 374 |
| 527 | 3300026067 | Ga0207678_10032125 | Ga0207678_100321253 | 374 |
| 528 | 3300026067 | Ga0207678_10189771 | Ga0207678_101897712 | 374 |
| 529 | 3300026095 | Ga0207676_10303045 | Ga0207676_103030452 | 374 |
| 530 | 3300026116 | Ga0207674_10018906 | Ga0207674_100189065 | 374 |
| 531 | 3300026118 | Ga0207675_100001980 | Ga0207675_10000198015 | 374 |
| 532 | 3300026118 | Ga0207675_100173037 | Ga0207675_1001730372 | 374 |
| 533 | 3300028379 | Ga0268266_10000738 | Ga0268266_1000073832 | 374 |
| 534 | 3300028379 | Ga0268266_10005951 | Ga0268266_100059514 | 374 |
| 535 | 3300031247 | Ga0265340_10054820 | Ga0265340_100548202 | 374 |
| 536 | 3300031616 | Ga0307508_10049515 | Ga0307508_100495154 | 374 |
| 537 | 3300031728 | Ga0316578_10011646 | Ga0316578_100116462 | 374 |
| 538 | 3300031733 | Ga0316577_10084717 | Ga0316577_100847172 | 374 |
| 539 | 3300035692 | Ga0373935_0021715 | Ga0373935_0021715_2203_3393 | 374 |
| 540 | 3300035725 | Ga0373947_0025965 | Ga0373947_0025965_17_1159 | 374 |
| 541 | 3300036401 | Ga0373937_0180653 | Ga0373937_0180653_394_1536 | 374 |
| 542 | 3300036712 | Ga0316584_0000107 | Ga0316584_0000107_18829_20019 | 374 |
| 543 | 3300037418 | Ga0395900_0333564 | Ga0395900_0333564_134_1333 | 374 |
| 544 | 3300041451 | Ga0451791_1389195 | Ga0451791_1389195_242_1438 | 374 |
| 545 | 3300044712 | Ga0453684_0065194 | Ga0453684_0065194_297_1439 | 374 |
| 546 | 3300046454 | Ga0495592_0049237 | Ga0495592_0049237_188_1330 | 374 |
| 547 | 3300046471 | Ga0495650_0031792 | Ga0495650_0031792_522_1694 | 374 |
| 548 | 3300046516 | Ga0495628_0057975 | Ga0495628_0057975_219_1361 | 374 |
| 549 | 3300046529 | Ga0495652_0038143 | Ga0495652_0038143_52_1194 | 374 |
| 550 | 3300046536 | Ga0495587_0024436 | Ga0495587_0024436_2482_3624 | 374 |
| 551 | 3300046543 | Ga0495645_0058538 | Ga0495645_0058538_869_2011 | 374 |
| 552 | 3300046642 | Ga0495634_0142676 | Ga0495634_0142676_41_1183 | 374 |
| 553 | 3300046664 | Ga0495659_0012373 | Ga0495659_0012373_735_1901 | 374 |
| 554 | 3300046678 | Ga0495599_0002951 | Ga0495599_0002951_7968_9110 | 374 |
| 555 | 3300046680 | Ga0495646_0027523 | Ga0495646_0027523_1235_2377 | 374 |
| 556 | 3300047319 | Ga0495674_0091294 | Ga0495674_0091294_1062_2204 | 374 |
| 557 | 3300048908 | Ga0496105_0146984 | Ga0496105_0146984_593_1738 | 374 |
| 558 | 3300048915 | Ga0496112_0211449 | Ga0496112_0211449_555_1715 | 374 |
| 559 | 3300049522 | Ga0501299_003152 | Ga0501299_003152_592_1755 | 374 |
| 560 | 3300049574 | Ga0501038_0001788 | Ga0501038_0001788_5104_6273 | 374 |
| 561 | 3300049588 | Ga0501072_0003659 | Ga0501072_0003659_4937_6109 | 374 |
| 562 | 3300049591 | Ga0501075_0113825 | Ga0501075_0113825_243_1388 | 374 |
| 563 | 3300049592 | Ga0501076_0283528 | Ga0501076_0283528_85_1245 | 374 |
| 564 | 3300049705 | Ga0501225_0018947 | Ga0501225_0018947_44_1207 | 374 |
| 565 | 3300049743 | Ga0501081_0032407 | Ga0501081_0032407_2207_3358 | 374 |
| 566 | 3300050507 | nmdc:mga05p37_122164_c1 | nmdc:mga05p37_122164_c1_1030_2199 | 374 |
| 567 | 3300053077 | Ga0495601_0011177 | Ga0495601_0011177_1772_2914 | 374 |
| 568 | 3300053078 | Ga0495612_0014064 | Ga0495612_0014064_287_1429 | 374 |
| 569 | 3300054114 | Ga0501084_0118759 | Ga0501084_0118759_1027_2196 | 374 |
| 570 | 3300005335 | Ga0070666_10017753 | Ga0070666_100177535 | 375 |
| 571 | 3300005367 | Ga0070667_100036989 | Ga0070667_1000369892 | 375 |
| 572 | 3300005367 | Ga0070667_100043210 | Ga0070667_1000432103 | 375 |
| 573 | 3300005467 | Ga0070706_100028562 | Ga0070706_1000285622 | 375 |
| 574 | 3300005536 | Ga0070697_100012151 | Ga0070697_1000121516 | 375 |
| 575 | 3300005548 | Ga0070665_100253349 | Ga0070665_1002533492 | 375 |
| 576 | 3300005563 | Ga0068855_100006051 | Ga0068855_1000060519 | 375 |
| 577 | 3300005617 | Ga0068859_100121419 | Ga0068859_1001214192 | 375 |
| 578 | 3300005618 | Ga0068864_100120504 | Ga0068864_1001205042 | 375 |
| 579 | 3300005841 | Ga0068863_100045465 | Ga0068863_1000454655 | 375 |
| 580 | 3300005842 | Ga0068858_100040115 | Ga0068858_1000401152 | 375 |
| 581 | 3300005843 | Ga0068860_100001357 | Ga0068860_10000135722 | 375 |
| 582 | 3300005843 | Ga0068860_100134580 | Ga0068860_1001345802 | 375 |
| 583 | 3300005844 | Ga0068862_100119462 | Ga0068862_1001194622 | 375 |
| 584 | 3300006237 | Ga0097621_100014975 | Ga0097621_1000149756 | 375 |
| 585 | 3300006237 | Ga0097621_100058683 | Ga0097621_1000586832 | 375 |
| 586 | 3300006852 | Ga0075433_10126500 | Ga0075433_101265002 | 375 |
| 587 | 3300006852 | Ga0075433_10194447 | Ga0075433_101944472 | 375 |
| 588 | 3300006871 | Ga0075434_100157688 | Ga0075434_1001576882 | 375 |
| 589 | 3300006914 | Ga0075436_100000056 | Ga0075436_10000005621 | 375 |
| 590 | 3300006931 | Ga0097620_100121415 | Ga0097620_1001214152 | 375 |
| 591 | 3300009093 | Ga0105240_10000634 | Ga0105240_100006345 | 375 |
| 592 | 3300009094 | Ga0111539_10075377 | Ga0111539_100753773 | 375 |
| 593 | 3300009176 | Ga0105242_10057550 | Ga0105242_100575502 | 375 |
| 594 | 3300009551 | Ga0105238_10047659 | Ga0105238_100476593 | 375 |
| 595 | 3300009553 | Ga0105249_10017932 | Ga0105249_100179324 | 375 |
| 596 | 3300013308 | Ga0157375_10043750 | Ga0157375_100437503 | 375 |
| 597 | 3300017792 | Ga0163161_10001473 | Ga0163161_100014738 | 375 |
| 598 | 3300025904 | Ga0207647_10013771 | Ga0207647_100137713 | 375 |
| 599 | 3300025913 | Ga0207695_10016534 | Ga0207695_100165343 | 375 |
| 600 | 3300025924 | Ga0207694_10106353 | Ga0207694_101063532 | 375 |
| 601 | 3300025949 | Ga0207667_10008239 | Ga0207667_100082398 | 375 |
| 602 | 3300025986 | Ga0207658_10078550 | Ga0207658_100785502 | 375 |
| 603 | 3300026035 | Ga0207703_10115222 | Ga0207703_101152222 | 375 |
| 604 | 3300026075 | Ga0207708_10050641 | Ga0207708_100506413 | 375 |
| 605 | 3300026095 | Ga0207676_10343900 | Ga0207676_103439001 | 375 |
| 606 | 3300026116 | Ga0207674_10078111 | Ga0207674_100781113 | 375 |
| 607 | 3300026118 | Ga0207675_100003639 | Ga0207675_1000036397 | 375 |
| 608 | 3300028379 | Ga0268266_10211361 | Ga0268266_102113612 | 375 |
| 609 | 3300028381 | Ga0268264_10049017 | Ga0268264_100490172 | 375 |
| 610 | 3300028563 | Ga0265319_1004543 | Ga0265319_10045434 | 375 |
| 611 | 3300028800 | Ga0265338_10012971 | Ga0265338_100129712 | 375 |
| 612 | 3300035241 | Ga0373961_0000089 | Ga0373961_0000089_16951_18129 | 375 |
| 613 | 3300035724 | Ga0373933_0018637 | Ga0373933_0018637_1973_3127 | 375 |
| 614 | 3300036712 | Ga0316584_0016094 | Ga0316584_0016094_2735_3892 | 375 |
| 615 | 3300039437 | Ga0436365_1240077 | Ga0436365_1240077_4085_5248 | 375 |
| 616 | 3300042876 | Ga0451577_0007964 | Ga0451577_0007964_796_1953 | 375 |
| 617 | 3300042876 | Ga0451577_0315986 | Ga0451577_0315986_50_1207 | 375 |
| 618 | 3300044684 | Ga0466966_0064825 | Ga0466966_0064825_726_1934 | 375 |
| 619 | 3300045049 | Ga0466959_0121417 | Ga0466959_0121417_626_1834 | 375 |
| 620 | 3300045051 | Ga0451576_0113471 | Ga0451576_0113471_1354_2544 | 375 |
| 621 | 3300049580 | Ga0501046_0074636 | Ga0501046_0074636_1162_2334 | 375 |
| 622 | 3300049584 | Ga0501068_0022799 | Ga0501068_0022799_139_1335 | 375 |
| 623 | 3300049590 | Ga0501074_0082341 | Ga0501074_0082341_948_2120 | 375 |
| 624 | 3300049591 | Ga0501075_0011505 | Ga0501075_0011505_2348_3520 | 375 |
| 625 | 3300049742 | Ga0501080_0003146 | Ga0501080_0003146_9479_10675 | 375 |
| 626 | 3300049743 | Ga0501081_0047821 | Ga0501081_0047821_948_2120 | 375 |
| 627 | 3300049744 | Ga0501083_0002247 | Ga0501083_0002247_5846_7036 | 375 |
| 628 | 3300050513 | nmdc:mga0rr50_66772_c1 | nmdc:mga0rr50_66772_c1_1138_2352 | 375 |
| 629 | 3300050514 | nmdc:mga08x19_48_c1 | nmdc:mga08x19_48_c1_66036_67226 | 375 |
| 630 | 3300050515 | nmdc:mga0a205_51170_c1 | nmdc:mga0a205_51170_c1_2290_3462 | 375 |
| 631 | 3300050515 | nmdc:mga0a205_5_c1 | nmdc:mga0a205_5_c1_159305_160462 | 375 |
| 632 | 3300053178 | Ga0500637_0000662 | Ga0500637_0000662_1940_3127 | 375 |
| 633 | 3300060353 | Ga0501082_0000153 | Ga0501082_0000153_52051_53247 | 375 |
| 634 | 3300060353 | Ga0501082_0184646 | Ga0501082_0184646_406_1578 | 375 |
| 635 | 3300003320 | rootH2_10076012 | rootH2_100760122 | 376 |
| 636 | 3300005295 | Ga0065707_10082702 | Ga0065707_1008270211 | 376 |
| 637 | 3300005439 | Ga0070711_100000062 | Ga0070711_10000006265 | 376 |
| 638 | 3300005458 | Ga0070681_10003272 | Ga0070681_100032723 | 376 |
| 639 | 3300005458 | Ga0070681_10044858 | Ga0070681_100448582 | 376 |
| 640 | 3300005530 | Ga0070679_100008917 | Ga0070679_1000089176 | 376 |
| 641 | 3300005548 | Ga0070665_100002304 | Ga0070665_10000230417 | 376 |
| 642 | 3300005563 | Ga0068855_100009063 | Ga0068855_1000090634 | 376 |
| 643 | 3300006175 | Ga0070712_100098110 | Ga0070712_1000981102 | 376 |
| 644 | 3300006852 | Ga0075433_10167561 | Ga0075433_101675612 | 376 |
| 645 | 3300006871 | Ga0075434_100188085 | Ga0075434_1001880852 | 376 |
| 646 | 3300006914 | Ga0075436_100000014 | Ga0075436_1000000147 | 376 |
| 647 | 3300006914 | Ga0075436_100000288 | Ga0075436_10000028821 | 376 |
| 648 | 3300007076 | Ga0075435_100000374 | Ga0075435_1000003744 | 376 |
| 649 | 3300009093 | Ga0105240_10004000 | Ga0105240_1000400020 | 376 |
| 650 | 3300009093 | Ga0105240_10010103 | Ga0105240_1001010312 | 376 |
| 651 | 3300009147 | Ga0114129_10629891 | Ga0114129_106298911 | 376 |
| 652 | 3300009551 | Ga0105238_10067778 | Ga0105238_100677783 | 376 |
| 653 | 3300009551 | Ga0105238_10121765 | Ga0105238_101217652 | 376 |
| 654 | 3300013100 | Ga0157373_10040544 | Ga0157373_100405442 | 376 |
| 655 | 3300013104 | Ga0157370_10003442 | Ga0157370_1000344213 | 376 |
| 656 | 3300013104 | Ga0157370_10038185 | Ga0157370_100381854 | 376 |
| 657 | 3300014326 | Ga0157380_10100629 | Ga0157380_101006293 | 376 |
| 658 | 3300014968 | Ga0157379_10054385 | Ga0157379_100543853 | 376 |
| 659 | 3300025912 | Ga0207707_10001408 | Ga0207707_100014089 | 376 |
| 660 | 3300025912 | Ga0207707_10005987 | Ga0207707_100059873 | 376 |
| 661 | 3300025912 | Ga0207707_10006951 | Ga0207707_100069516 | 376 |
| 662 | 3300025913 | Ga0207695_10007063 | Ga0207695_1000706310 | 376 |
| 663 | 3300025913 | Ga0207695_10127358 | Ga0207695_101273582 | 376 |
| 664 | 3300025916 | Ga0207663_10000008 | Ga0207663_1000000823 | 376 |
| 665 | 3300025921 | Ga0207652_10003570 | Ga0207652_100035703 | 376 |
| 666 | 3300025924 | Ga0207694_10018447 | Ga0207694_100184473 | 376 |
| 667 | 3300025949 | Ga0207667_10037104 | Ga0207667_100371043 | 376 |
| 668 | 3300025949 | Ga0207667_10079952 | Ga0207667_100799523 | 376 |
| 669 | 3300026023 | Ga0207677_10159784 | Ga0207677_101597842 | 376 |
| 670 | 3300026089 | Ga0207648_10176029 | Ga0207648_101760292 | 376 |
| 671 | 3300028379 | Ga0268266_10000589 | Ga0268266_100005896 | 376 |
| 672 | 3300028381 | Ga0268264_10130147 | Ga0268264_101301472 | 376 |
| 673 | 3300031731 | Ga0307405_10077203 | Ga0307405_100772032 | 376 |
| 674 | 3300031852 | Ga0307410_10188486 | Ga0307410_101884862 | 376 |
| 675 | 3300031903 | Ga0307407_10136218 | Ga0307407_101362181 | 376 |
| 676 | 3300032126 | Ga0307415_100029208 | Ga0307415_1000292083 | 376 |
| 677 | 3300041494 | Ga0451837_0148417 | Ga0451837_0148417_317_1525 | 376 |
| 678 | 3300045049 | Ga0466959_0006185 | Ga0466959_0006185_3192_4352 | 376 |
| 679 | 3300045836 | Ga0466958_0046222 | Ga0466958_0046222_636_1811 | 376 |
| 680 | 3300048913 | Ga0496110_0119780 | Ga0496110_0119780_689_1864 | 376 |
| 681 | 3300048917 | Ga0496114_0000025 | Ga0496114_0000025_70220_71422 | 376 |
| 682 | 3300049519 | Ga0501296_003974 | Ga0501296_003974_283_1458 | 376 |
| 683 | 3300049583 | Ga0501067_0016404 | Ga0501067_0016404_955_2142 | 376 |
| 684 | 3300049591 | Ga0501075_0169165 | Ga0501075_0169165_355_1542 | 376 |
| 685 | 3300049593 | Ga0501077_0000392 | Ga0501077_0000392_25084_26271 | 376 |
| 686 | 3300050513 | nmdc:mga0rr50_5577_c1 | nmdc:mga0rr50_5577_c1_3678_4853 | 376 |
| 687 | 3300050514 | nmdc:mga08x19_11_c1 | nmdc:mga08x19_11_c1_277546_278721 | 376 |
| 688 | 3300050514 | nmdc:mga08x19_273_c1 | nmdc:mga08x19_273_c1_18860_20035 | 376 |
| 689 | 3300053153 | Ga0500616_0004019 | Ga0500616_0004019_2776_3981 | 376 |
| 690 | 3300002074 | JGI24748J21848_1000002 | JGI24748J21848_100000247 | 377 |
| 691 | 3300002239 | JGI24034J26672_10000004 | JGI24034J26672_10000004326 | 377 |
| 692 | 3300005289 | Ga0065704_10142747 | Ga0065704_101427471 | 377 |
| 693 | 3300005330 | Ga0070690_100009821 | Ga0070690_1000098213 | 377 |
| 694 | 3300005336 | Ga0070680_100075571 | Ga0070680_1000755714 | 377 |
| 695 | 3300005364 | Ga0070673_100145059 | Ga0070673_1001450591 | 377 |
| 696 | 3300005434 | Ga0070709_10000042 | Ga0070709_1000004238 | 377 |
| 697 | 3300005440 | Ga0070705_100000038 | Ga0070705_10000003865 | 377 |
| 698 | 3300005440 | Ga0070705_100012603 | Ga0070705_1000126032 | 377 |
| 699 | 3300005467 | Ga0070706_100000007 | Ga0070706_100000007170 | 377 |
| 700 | 3300005471 | Ga0070698_100004968 | Ga0070698_1000049684 | 377 |
| 701 | 3300005471 | Ga0070698_100034939 | Ga0070698_1000349394 | 377 |
| 702 | 3300005471 | Ga0070698_100111659 | Ga0070698_1001116592 | 377 |
| 703 | 3300005518 | Ga0070699_100000094 | Ga0070699_10000009445 | 377 |
| 704 | 3300005518 | Ga0070699_100012158 | Ga0070699_1000121584 | 377 |
| 705 | 3300005546 | Ga0070696_100001303 | Ga0070696_10000130314 | 377 |
| 706 | 3300005547 | Ga0070693_100021477 | Ga0070693_1000214771 | 377 |
| 707 | 3300005842 | Ga0068858_100000770 | Ga0068858_10000077011 | 377 |
| 708 | 3300006163 | Ga0070715_10000004 | Ga0070715_10000004184 | 377 |
| 709 | 3300006173 | Ga0070716_100000001 | Ga0070716_100000001143 | 377 |
| 710 | 3300006844 | Ga0075428_100153120 | Ga0075428_1001531201 | 377 |
| 711 | 3300006871 | Ga0075434_100132926 | Ga0075434_1001329263 | 377 |
| 712 | 3300009094 | Ga0111539_10055362 | Ga0111539_100553624 | 377 |
| 713 | 3300009101 | Ga0105247_10000005 | Ga0105247_10000005317 | 377 |
| 714 | 3300009147 | Ga0114129_10017260 | Ga0114129_100172609 | 377 |
| 715 | 3300009147 | Ga0114129_10035939 | Ga0114129_100359398 | 377 |
| 716 | 3300009148 | Ga0105243_10001117 | Ga0105243_1000111722 | 377 |
| 717 | 3300009176 | Ga0105242_10002520 | Ga0105242_1000252014 | 377 |
| 718 | 3300013297 | Ga0157378_10000067 | Ga0157378_1000006743 | 377 |
| 719 | 3300013297 | Ga0157378_10026678 | Ga0157378_100266782 | 377 |
| 720 | 3300013308 | Ga0157375_10015644 | Ga0157375_100156446 | 377 |
| 721 | 3300014325 | Ga0163163_10018114 | Ga0163163_100181144 | 377 |
| 722 | 3300014326 | Ga0157380_10108418 | Ga0157380_101084182 | 377 |
| 723 | 3300025885 | Ga0207653_10000076 | Ga0207653_1000007651 | 377 |
| 724 | 3300025900 | Ga0207710_10000004 | Ga0207710_10000004315 | 377 |
| 725 | 3300025905 | Ga0207685_10000004 | Ga0207685_1000000471 | 377 |
| 726 | 3300025906 | Ga0207699_10000004 | Ga0207699_10000004474 | 377 |
| 727 | 3300025910 | Ga0207684_10000288 | Ga0207684_1000028851 | 377 |
| 728 | 3300025923 | Ga0207681_10240153 | Ga0207681_102401531 | 377 |
| 729 | 3300025931 | Ga0207644_10021675 | Ga0207644_100216752 | 377 |
| 730 | 3300025935 | Ga0207709_10002635 | Ga0207709_100026359 | 377 |
| 731 | 3300025939 | Ga0207665_10000002 | Ga0207665_1000000223 | 377 |
| 732 | 3300025960 | Ga0207651_10116747 | Ga0207651_101167471 | 377 |
| 733 | 3300026035 | Ga0207703_10000486 | Ga0207703_1000048632 | 377 |
| 734 | 3300026035 | Ga0207703_10077537 | Ga0207703_100775373 | 377 |
| 735 | 3300026075 | Ga0207708_10190478 | Ga0207708_101904782 | 377 |
| 736 | 3300026116 | Ga0207674_10210990 | Ga0207674_102109902 | 377 |
| 737 | 3300031456 | Ga0307513_10002818 | Ga0307513_1000281811 | 377 |
| 738 | 3300031824 | Ga0307413_10000802 | Ga0307413_1000080210 | 377 |
| 739 | 3300031852 | Ga0307410_10015322 | Ga0307410_100153223 | 377 |
| 740 | 3300031903 | Ga0307407_10001414 | Ga0307407_100014149 | 377 |
| 741 | 3300031995 | Ga0307409_100098226 | Ga0307409_1000982262 | 377 |
| 742 | 3300035241 | Ga0373961_0025315 | Ga0373961_0025315_342_1502 | 377 |
| 743 | 3300048909 | Ga0496106_0021671 | Ga0496106_0021671_3579_4760 | 377 |
| 744 | 3300049580 | Ga0501046_0004345 | Ga0501046_0004345_122_1366 | 377 |
| 745 | 3300049581 | Ga0501047_0059929 | Ga0501047_0059929_114_1358 | 377 |
| 746 | 3300049592 | Ga0501076_0018058 | Ga0501076_0018058_717_1934 | 377 |
| 747 | 3300049742 | Ga0501080_0167660 | Ga0501080_0167660_131_1375 | 377 |
| 748 | 3300050507 | nmdc:mga05p37_241_c1 | nmdc:mga05p37_241_c1_43986_45167 | 377 |
| 749 | 3300050507 | nmdc:mga05p37_76478_c1 | nmdc:mga05p37_76478_c1_2558_3697 | 377 |
| 750 | 3300050511 | nmdc:mga08y16_131167_c1 | nmdc:mga08y16_131167_c1_960_2141 | 377 |
| 751 | 3300050512 | nmdc:mga0n895_52831_c1 | nmdc:mga0n895_52831_c1_774_1955 | 377 |
| 752 | 3300060353 | Ga0501082_0225712 | Ga0501082_0225712_401_1585 | 377 |
| 753 | 3300005295 | Ga0065707_10134320 | Ga0065707_101343202 | 378 |
| 754 | 3300005330 | Ga0070690_100158316 | Ga0070690_1001583161 | 378 |
| 755 | 3300005353 | Ga0070669_100190982 | Ga0070669_1001909821 | 378 |
| 756 | 3300005438 | Ga0070701_10157381 | Ga0070701_101573811 | 378 |
| 757 | 3300005440 | Ga0070705_100016678 | Ga0070705_1000166783 | 378 |
| 758 | 3300005444 | Ga0070694_100092913 | Ga0070694_1000929132 | 378 |
| 759 | 3300005444 | Ga0070694_100135081 | Ga0070694_1001350812 | 378 |
| 760 | 3300005467 | Ga0070706_100001095 | Ga0070706_10000109521 | 378 |
| 761 | 3300005467 | Ga0070706_100163002 | Ga0070706_1001630022 | 378 |
| 762 | 3300005468 | Ga0070707_100000026 | Ga0070707_10000002646 | 378 |
| 763 | 3300005471 | Ga0070698_100011411 | Ga0070698_1000114115 | 378 |
| 764 | 3300005471 | Ga0070698_100127306 | Ga0070698_1001273062 | 378 |
| 765 | 3300005539 | Ga0068853_100127354 | Ga0068853_1001273542 | 378 |
| 766 | 3300005544 | Ga0070686_100017451 | Ga0070686_1000174513 | 378 |
| 767 | 3300005545 | Ga0070695_100109657 | Ga0070695_1001096571 | 378 |
| 768 | 3300005549 | Ga0070704_100005539 | Ga0070704_1000055397 | 378 |
| 769 | 3300005564 | Ga0070664_100018237 | Ga0070664_1000182372 | 378 |
| 770 | 3300005564 | Ga0070664_100052965 | Ga0070664_1000529654 | 378 |
| 771 | 3300005614 | Ga0068856_100041440 | Ga0068856_1000414403 | 378 |
| 772 | 3300005844 | Ga0068862_100034534 | Ga0068862_1000345342 | 378 |
| 773 | 3300006175 | Ga0070712_100070105 | Ga0070712_1000701052 | 378 |
| 774 | 3300006846 | Ga0075430_100185324 | Ga0075430_1001853242 | 378 |
| 775 | 3300006880 | Ga0075429_100100957 | Ga0075429_1001009572 | 378 |
| 776 | 3300007076 | Ga0075435_100131421 | Ga0075435_1001314211 | 378 |
| 777 | 3300009176 | Ga0105242_10019466 | Ga0105242_100194662 | 378 |
| 778 | 3300009553 | Ga0105249_10257579 | Ga0105249_102575791 | 378 |
| 779 | 3300013297 | Ga0157378_10067368 | Ga0157378_100673683 | 378 |
| 780 | 3300013297 | Ga0157378_10083500 | Ga0157378_100835001 | 378 |
| 781 | 3300013297 | Ga0157378_10126085 | Ga0157378_101260852 | 378 |
| 782 | 3300013306 | Ga0163162_10034870 | Ga0163162_100348703 | 378 |
| 783 | 3300017792 | Ga0163161_10046087 | Ga0163161_100460873 | 378 |
| 784 | 3300025910 | Ga0207684_10042906 | Ga0207684_100429064 | 378 |
| 785 | 3300025910 | Ga0207684_10264563 | Ga0207684_102645632 | 378 |
| 786 | 3300025922 | Ga0207646_10000308 | Ga0207646_1000030818 | 378 |
| 787 | 3300025922 | Ga0207646_10008373 | Ga0207646_100083736 | 378 |
| 788 | 3300025922 | Ga0207646_10022917 | Ga0207646_100229175 | 378 |
| 789 | 3300025934 | Ga0207686_10000232 | Ga0207686_1000023214 | 378 |
| 790 | 3300025944 | Ga0207661_10187605 | Ga0207661_101876052 | 378 |
| 791 | 3300025945 | Ga0207679_10060339 | Ga0207679_100603392 | 378 |
| 792 | 3300025961 | Ga0207712_10177969 | Ga0207712_101779691 | 378 |
| 793 | 3300026078 | Ga0207702_10246641 | Ga0207702_102466411 | 378 |
| 794 | 3300027695 | Ga0209966_1011624 | Ga0209966_10116242 | 378 |
| 795 | 3300028380 | Ga0268265_10018832 | Ga0268265_100188324 | 378 |
| 796 | 3300031903 | Ga0307407_10017975 | Ga0307407_100179753 | 378 |
| 797 | 3300031911 | Ga0307412_10051247 | Ga0307412_100512472 | 378 |
| 798 | 3300031995 | Ga0307409_100038725 | Ga0307409_1000387252 | 378 |
| 799 | 3300032005 | Ga0307411_10049867 | Ga0307411_100498672 | 378 |
| 800 | 3300032126 | Ga0307415_100025642 | Ga0307415_1000256423 | 378 |
| 801 | 3300045051 | Ga0451576_0328968 | Ga0451576_0328968_144_1343 | 378 |
| 802 | 3300046476 | Ga0495662_0079644 | Ga0495662_0079644_187_1383 | 378 |
| 803 | 3300046535 | Ga0495586_0104360 | Ga0495586_0104360_291_1487 | 378 |
| 804 | 3300048911 | Ga0496108_0088225 | Ga0496108_0088225_1262_2449 | 378 |
| 805 | 3300048917 | Ga0496114_0310238 | Ga0496114_0310238_131_1327 | 378 |
| 806 | 3300049571 | Ga0501034_0013257 | Ga0501034_0013257_6308_7456 | 378 |
| 807 | 3300049571 | Ga0501034_0152386 | Ga0501034_0152386_186_1334 | 378 |
| 808 | 3300049581 | Ga0501047_0135899 | Ga0501047_0135899_1058_2206 | 378 |
| 809 | 3300049583 | Ga0501067_0000373 | Ga0501067_0000373_214_1362 | 378 |
| 810 | 3300049583 | Ga0501067_0006399 | Ga0501067_0006399_4065_5213 | 378 |
| 811 | 3300049584 | Ga0501068_0034070 | Ga0501068_0034070_1689_2837 | 378 |
| 812 | 3300049585 | Ga0501069_0026736 | Ga0501069_0026736_373_1521 | 378 |
| 813 | 3300049585 | Ga0501069_0027986 | Ga0501069_0027986_932_2080 | 378 |
| 814 | 3300049586 | Ga0501070_0032397 | Ga0501070_0032397_1586_2734 | 378 |
| 815 | 3300049586 | Ga0501070_0105958 | Ga0501070_0105958_120_1268 | 378 |
| 816 | 3300049587 | Ga0501071_0015327 | Ga0501071_0015327_3907_5055 | 378 |
| 817 | 3300049587 | Ga0501071_0026053 | Ga0501071_0026053_957_2105 | 378 |
| 818 | 3300049588 | Ga0501072_0057322 | Ga0501072_0057322_117_1265 | 378 |
| 819 | 3300049589 | Ga0501073_0025880 | Ga0501073_0025880_1640_2788 | 378 |
| 820 | 3300049590 | Ga0501074_0076769 | Ga0501074_0076769_1036_2184 | 378 |
| 821 | 3300049590 | Ga0501074_0081575 | Ga0501074_0081575_958_2106 | 378 |
| 822 | 3300049593 | Ga0501077_0163861 | Ga0501077_0163861_143_1348 | 378 |
| 823 | 3300049741 | Ga0501079_0058431 | Ga0501079_0058431_1637_2785 | 378 |
| 824 | 3300049742 | Ga0501080_0003762 | Ga0501080_0003762_11268_12416 | 378 |
| 825 | 3300049742 | Ga0501080_0003918 | Ga0501080_0003918_3685_4833 | 378 |
| 826 | 3300049742 | Ga0501080_0020968 | Ga0501080_0020968_3385_4533 | 378 |
| 827 | 3300049744 | Ga0501083_0033100 | Ga0501083_0033100_214_1362 | 378 |
| 828 | 3300049744 | Ga0501083_0070760 | Ga0501083_0070760_214_1362 | 378 |
| 829 | 3300050507 | nmdc:mga05p37_13236_c1 | nmdc:mga05p37_13236_c1_4746_5963 | 378 |
| 830 | 3300050511 | nmdc:mga08y16_237571_c1 | nmdc:mga08y16_237571_c1_610_1827 | 378 |
| 831 | 3300050515 | nmdc:mga0a205_18501_c1 | nmdc:mga0a205_18501_c1_64_1251 | 378 |
| 832 | 3300050515 | nmdc:mga0a205_23514_c1 | nmdc:mga0a205_23514_c1_4120_5307 | 378 |
| 833 | 3300054114 | Ga0501084_0002798 | Ga0501084_0002798_1640_2788 | 378 |
| 834 | 3300054114 | Ga0501084_0108028 | Ga0501084_0108028_986_2134 | 378 |
| 835 | 3300060353 | Ga0501082_0025606 | Ga0501082_0025606_468_1616 | 378 |
| 836 | 3300060353 | Ga0501082_0099110 | Ga0501082_0099110_386_1534 | 378 |
| 837 | 3300005293 | Ga0065715_10167926 | Ga0065715_101679262 | 379 |
| 838 | 3300005330 | Ga0070690_100069198 | Ga0070690_1000691982 | 379 |
| 839 | 3300005331 | Ga0070670_100002492 | Ga0070670_10000249214 | 379 |
| 840 | 3300005334 | Ga0068869_100012015 | Ga0068869_1000120155 | 379 |
| 841 | 3300005334 | Ga0068869_100052614 | Ga0068869_1000526142 | 379 |
| 842 | 3300005334 | Ga0068869_100203913 | Ga0068869_1002039131 | 379 |
| 843 | 3300005335 | Ga0070666_10066114 | Ga0070666_100661143 | 379 |
| 844 | 3300005336 | Ga0070680_100000123 | Ga0070680_10000012327 | 379 |
| 845 | 3300005336 | Ga0070680_100170137 | Ga0070680_1001701372 | 379 |
| 846 | 3300005337 | Ga0070682_100000271 | Ga0070682_10000027133 | 379 |
| 847 | 3300005337 | Ga0070682_100219920 | Ga0070682_1002199201 | 379 |
| 848 | 3300005338 | Ga0068868_100074489 | Ga0068868_1000744893 | 379 |
| 849 | 3300005338 | Ga0068868_100099959 | Ga0068868_1000999591 | 379 |
| 850 | 3300005338 | Ga0068868_100164196 | Ga0068868_1001641961 | 379 |
| 851 | 3300005339 | Ga0070660_100046712 | Ga0070660_1000467124 | 379 |
| 852 | 3300005340 | Ga0070689_100100283 | Ga0070689_1001002831 | 379 |
| 853 | 3300005344 | Ga0070661_100014994 | Ga0070661_1000149942 | 379 |
| 854 | 3300005353 | Ga0070669_100180877 | Ga0070669_1001808772 | 379 |
| 855 | 3300005355 | Ga0070671_100025316 | Ga0070671_1000253162 | 379 |
| 856 | 3300005355 | Ga0070671_100115325 | Ga0070671_1001153251 | 379 |
| 857 | 3300005356 | Ga0070674_100086137 | Ga0070674_1000861372 | 379 |
| 858 | 3300005364 | Ga0070673_100043997 | Ga0070673_1000439972 | 379 |
| 859 | 3300005364 | Ga0070673_100057024 | Ga0070673_1000570241 | 379 |
| 860 | 3300005365 | Ga0070688_100034426 | Ga0070688_1000344262 | 379 |
| 861 | 3300005367 | Ga0070667_100256936 | Ga0070667_1002569362 | 379 |
| 862 | 3300005406 | Ga0070703_10000528 | Ga0070703_100005289 | 379 |
| 863 | 3300005438 | Ga0070701_10031923 | Ga0070701_100319233 | 379 |
| 864 | 3300005438 | Ga0070701_10039305 | Ga0070701_100393053 | 379 |
| 865 | 3300005441 | Ga0070700_100008335 | Ga0070700_1000083356 | 379 |
| 866 | 3300005441 | Ga0070700_100139739 | Ga0070700_1001397391 | 379 |
| 867 | 3300005444 | Ga0070694_100000175 | Ga0070694_1000001758 | 379 |
| 868 | 3300005444 | Ga0070694_100011484 | Ga0070694_1000114846 | 379 |
| 869 | 3300005444 | Ga0070694_100226556 | Ga0070694_1002265561 | 379 |
| 870 | 3300005445 | Ga0070708_100001962 | Ga0070708_1000019625 | 379 |
| 871 | 3300005445 | Ga0070708_100155048 | Ga0070708_1001550481 | 379 |
| 872 | 3300005445 | Ga0070708_100222357 | Ga0070708_1002223572 | 379 |
| 873 | 3300005457 | Ga0070662_100129332 | Ga0070662_1001293322 | 379 |
| 874 | 3300005457 | Ga0070662_100169160 | Ga0070662_1001691601 | 379 |
| 875 | 3300005458 | Ga0070681_10001768 | Ga0070681_100017684 | 379 |
| 876 | 3300005458 | Ga0070681_10286952 | Ga0070681_102869522 | 379 |
| 877 | 3300005459 | Ga0068867_100064051 | Ga0068867_1000640512 | 379 |
| 878 | 3300005466 | Ga0070685_10045369 | Ga0070685_100453692 | 379 |
| 879 | 3300005467 | Ga0070706_100013038 | Ga0070706_1000130385 | 379 |
| 880 | 3300005467 | Ga0070706_100019951 | Ga0070706_1000199511 | 379 |
| 881 | 3300005468 | Ga0070707_100109317 | Ga0070707_1001093172 | 379 |
| 882 | 3300005471 | Ga0070698_100001773 | Ga0070698_1000017735 | 379 |
| 883 | 3300005471 | Ga0070698_100005606 | Ga0070698_1000056062 | 379 |
| 884 | 3300005471 | Ga0070698_100204266 | Ga0070698_1002042661 | 379 |
| 885 | 3300005518 | Ga0070699_100001203 | Ga0070699_10000120313 | 379 |
| 886 | 3300005518 | Ga0070699_100094652 | Ga0070699_1000946522 | 379 |
| 887 | 3300005530 | Ga0070679_100000014 | Ga0070679_10000001415 | 379 |
| 888 | 3300005530 | Ga0070679_100006157 | Ga0070679_1000061575 | 379 |
| 889 | 3300005536 | Ga0070697_100000052 | Ga0070697_10000005247 | 379 |
| 890 | 3300005536 | Ga0070697_100000392 | Ga0070697_10000039223 | 379 |
| 891 | 3300005536 | Ga0070697_100001507 | Ga0070697_1000015079 | 379 |
| 892 | 3300005539 | Ga0068853_100008850 | Ga0068853_1000088507 | 379 |
| 893 | 3300005543 | Ga0070672_100012889 | Ga0070672_1000128896 | 379 |
| 894 | 3300005543 | Ga0070672_100154179 | Ga0070672_1001541792 | 379 |
| 895 | 3300005543 | Ga0070672_100173547 | Ga0070672_1001735472 | 379 |
| 896 | 3300005543 | Ga0070672_100189526 | Ga0070672_1001895261 | 379 |
| 897 | 3300005544 | Ga0070686_100017113 | Ga0070686_1000171132 | 379 |
| 898 | 3300005544 | Ga0070686_100027904 | Ga0070686_1000279043 | 379 |
| 899 | 3300005545 | Ga0070695_100045346 | Ga0070695_1000453462 | 379 |
| 900 | 3300005545 | Ga0070695_100186585 | Ga0070695_1001865851 | 379 |
| 901 | 3300005546 | Ga0070696_100038361 | Ga0070696_1000383613 | 379 |
| 902 | 3300005546 | Ga0070696_100098942 | Ga0070696_1000989422 | 379 |
| 903 | 3300005549 | Ga0070704_100074243 | Ga0070704_1000742432 | 379 |
| 904 | 3300005549 | Ga0070704_100145994 | Ga0070704_1001459942 | 379 |
| 905 | 3300005564 | Ga0070664_100009196 | Ga0070664_1000091964 | 379 |
| 906 | 3300005577 | Ga0068857_100001440 | Ga0068857_10000144019 | 379 |
| 907 | 3300005578 | Ga0068854_100246640 | Ga0068854_1002466402 | 379 |
| 908 | 3300005578 | Ga0068854_100302729 | Ga0068854_1003027291 | 379 |
| 909 | 3300005617 | Ga0068859_100281519 | Ga0068859_1002815192 | 379 |
| 910 | 3300005618 | Ga0068864_100052192 | Ga0068864_1000521922 | 379 |
| 911 | 3300005618 | Ga0068864_100070050 | Ga0068864_1000700503 | 379 |
| 912 | 3300005618 | Ga0068864_100328238 | Ga0068864_1003282381 | 379 |
| 913 | 3300005718 | Ga0068866_10022678 | Ga0068866_100226784 | 379 |
| 914 | 3300005718 | Ga0068866_10054211 | Ga0068866_100542112 | 379 |
| 915 | 3300005840 | Ga0068870_10084749 | Ga0068870_100847492 | 379 |
| 916 | 3300005841 | Ga0068863_100010715 | Ga0068863_1000107158 | 379 |
| 917 | 3300005841 | Ga0068863_100315118 | Ga0068863_1003151182 | 379 |
| 918 | 3300005842 | Ga0068858_100016121 | Ga0068858_1000161216 | 379 |
| 919 | 3300005842 | Ga0068858_100022966 | Ga0068858_1000229665 | 379 |
| 920 | 3300005843 | Ga0068860_100010473 | Ga0068860_1000104735 | 379 |
| 921 | 3300005843 | Ga0068860_100101013 | Ga0068860_1001010132 | 379 |
| 922 | 3300005844 | Ga0068862_100009668 | Ga0068862_1000096687 | 379 |
| 923 | 3300005844 | Ga0068862_100015414 | Ga0068862_1000154142 | 379 |
| 924 | 3300005985 | Ga0081539_10000796 | Ga0081539_1000079645 | 379 |
| 925 | 3300006173 | Ga0070716_100078093 | Ga0070716_1000780932 | 379 |
| 926 | 3300006237 | Ga0097621_100027916 | Ga0097621_1000279165 | 379 |
| 927 | 3300006237 | Ga0097621_100141393 | Ga0097621_1001413932 | 379 |
| 928 | 3300006358 | Ga0068871_100014714 | Ga0068871_1000147142 | 379 |
| 929 | 3300006844 | Ga0075428_100128785 | Ga0075428_1001287852 | 379 |
| 930 | 3300006852 | Ga0075433_10034286 | Ga0075433_100342865 | 379 |
| 931 | 3300006852 | Ga0075433_10164936 | Ga0075433_101649362 | 379 |
| 932 | 3300006880 | Ga0075429_100101308 | Ga0075429_1001013081 | 379 |
| 933 | 3300006931 | Ga0097620_100281538 | Ga0097620_1002815382 | 379 |
| 934 | 3300009098 | Ga0105245_10030974 | Ga0105245_100309743 | 379 |
| 935 | 3300009147 | Ga0114129_10054153 | Ga0114129_100541532 | 379 |
| 936 | 3300009148 | Ga0105243_10000096 | Ga0105243_1000009627 | 379 |
| 937 | 3300009148 | Ga0105243_10112927 | Ga0105243_101129271 | 379 |
| 938 | 3300009174 | Ga0105241_10013953 | Ga0105241_100139533 | 379 |
| 939 | 3300009176 | Ga0105242_10000144 | Ga0105242_1000014431 | 379 |
| 940 | 3300009176 | Ga0105242_10019143 | Ga0105242_100191432 | 379 |
| 941 | 3300009177 | Ga0105248_10035814 | Ga0105248_100358142 | 379 |
| 942 | 3300009177 | Ga0105248_10136152 | Ga0105248_101361523 | 379 |
| 943 | 3300009553 | Ga0105249_10000030 | Ga0105249_10000030182 | 379 |
| 944 | 3300009553 | Ga0105249_10022509 | Ga0105249_100225095 | 379 |
| 945 | 3300011119 | Ga0105246_10091093 | Ga0105246_100910932 | 379 |
| 946 | 3300013296 | Ga0157374_10039178 | Ga0157374_100391783 | 379 |
| 947 | 3300013296 | Ga0157374_10174658 | Ga0157374_101746581 | 379 |
| 948 | 3300013297 | Ga0157378_10004788 | Ga0157378_1000478814 | 379 |
| 949 | 3300013297 | Ga0157378_10044845 | Ga0157378_100448454 | 379 |
| 950 | 3300013297 | Ga0157378_10137276 | Ga0157378_101372763 | 379 |
| 951 | 3300013306 | Ga0163162_10000002 | Ga0163162_10000002181 | 379 |
| 952 | 3300013306 | Ga0163162_10052877 | Ga0163162_100528774 | 379 |
| 953 | 3300013306 | Ga0163162_10219820 | Ga0163162_102198202 | 379 |
| 954 | 3300013306 | Ga0163162_10227389 | Ga0163162_102273892 | 379 |
| 955 | 3300013308 | Ga0157375_10029880 | Ga0157375_100298801 | 379 |
| 956 | 3300014325 | Ga0163163_10015177 | Ga0163163_100151776 | 379 |
| 957 | 3300014325 | Ga0163163_10015381 | Ga0163163_100153815 | 379 |
| 958 | 3300014325 | Ga0163163_10040672 | Ga0163163_100406725 | 379 |
| 959 | 3300014325 | Ga0163163_10083032 | Ga0163163_100830321 | 379 |
| 960 | 3300014325 | Ga0163163_10113575 | Ga0163163_101135753 | 379 |
| 961 | 3300014325 | Ga0163163_10210045 | Ga0163163_102100452 | 379 |
| 962 | 3300014326 | Ga0157380_10001283 | Ga0157380_100012833 | 379 |
| 963 | 3300014326 | Ga0157380_10002163 | Ga0157380_1000216313 | 379 |
| 964 | 3300014326 | Ga0157380_10111136 | Ga0157380_101111362 | 379 |
| 965 | 3300014745 | Ga0157377_10007351 | Ga0157377_100073513 | 379 |
| 966 | 3300014969 | Ga0157376_10008947 | Ga0157376_100089474 | 379 |
| 967 | 3300021384 | Ga0213876_10000035 | Ga0213876_10000035148 | 379 |
| 968 | 3300025885 | Ga0207653_10000160 | Ga0207653_100001605 | 379 |
| 969 | 3300025908 | Ga0207643_10095247 | Ga0207643_100952471 | 379 |
| 970 | 3300025910 | Ga0207684_10022217 | Ga0207684_100222175 | 379 |
| 971 | 3300025910 | Ga0207684_10090143 | Ga0207684_100901434 | 379 |
| 972 | 3300025910 | Ga0207684_10121761 | Ga0207684_101217613 | 379 |
| 973 | 3300025912 | Ga0207707_10000016 | Ga0207707_1000001697 | 379 |
| 974 | 3300025917 | Ga0207660_10000340 | Ga0207660_100003402 | 379 |
| 975 | 3300025918 | Ga0207662_10124642 | Ga0207662_101246422 | 379 |
| 976 | 3300025919 | Ga0207657_10057806 | Ga0207657_100578061 | 379 |
| 977 | 3300025921 | Ga0207652_10000693 | Ga0207652_100006936 | 379 |
| 978 | 3300025921 | Ga0207652_10018001 | Ga0207652_100180012 | 379 |
| 979 | 3300025922 | Ga0207646_10084461 | Ga0207646_100844612 | 379 |
| 980 | 3300025923 | Ga0207681_10000223 | Ga0207681_100002233 | 379 |
| 981 | 3300025925 | Ga0207650_10001109 | Ga0207650_1000110910 | 379 |
| 982 | 3300025933 | Ga0207706_10023543 | Ga0207706_100235436 | 379 |
| 983 | 3300025933 | Ga0207706_10126713 | Ga0207706_101267132 | 379 |
| 984 | 3300025934 | Ga0207686_10000026 | Ga0207686_1000002627 | 379 |
| 985 | 3300025935 | Ga0207709_10000142 | Ga0207709_1000014227 | 379 |
| 986 | 3300025937 | Ga0207669_10088957 | Ga0207669_100889572 | 379 |
| 987 | 3300025939 | Ga0207665_10066169 | Ga0207665_100661692 | 379 |
| 988 | 3300025940 | Ga0207691_10218954 | Ga0207691_102189542 | 379 |
| 989 | 3300025941 | Ga0207711_10046394 | Ga0207711_100463942 | 379 |
| 990 | 3300025942 | Ga0207689_10066333 | Ga0207689_100663333 | 379 |
| 991 | 3300025942 | Ga0207689_10164544 | Ga0207689_101645442 | 379 |
| 992 | 3300025961 | Ga0207712_10000041 | Ga0207712_10000041138 | 379 |
| 993 | 3300025961 | Ga0207712_10041649 | Ga0207712_100416492 | 379 |
| 994 | 3300025972 | Ga0207668_10000297 | Ga0207668_1000029716 | 379 |
| 995 | 3300026023 | Ga0207677_10067703 | Ga0207677_100677031 | 379 |
| 996 | 3300026035 | Ga0207703_10162541 | Ga0207703_101625412 | 379 |
| 997 | 3300026075 | Ga0207708_10005102 | Ga0207708_100051029 | 379 |
| 998 | 3300026075 | Ga0207708_10023267 | Ga0207708_100232672 | 379 |
| 999 | 3300026075 | Ga0207708_10071985 | Ga0207708_100719852 | 379 |
| 1000 | 3300026088 | Ga0207641_10070462 | Ga0207641_100704623 | 379 |
| 1001 | 3300026088 | Ga0207641_10239090 | Ga0207641_102390902 | 379 |
| 1002 | 3300026089 | Ga0207648_10004466 | Ga0207648_100044663 | 379 |
| 1003 | 3300026095 | Ga0207676_10005309 | Ga0207676_100053093 | 379 |
| 1004 | 3300026095 | Ga0207676_10059708 | Ga0207676_100597082 | 379 |
| 1005 | 3300026095 | Ga0207676_10169846 | Ga0207676_101698462 | 379 |
| 1006 | 3300026116 | Ga0207674_10000108 | Ga0207674_1000010812 | 379 |
| 1007 | 3300026116 | Ga0207674_10105413 | Ga0207674_101054133 | 379 |
| 1008 | 3300026118 | Ga0207675_100014952 | Ga0207675_1000149522 | 379 |
| 1009 | 3300026118 | Ga0207675_100021233 | Ga0207675_1000212333 | 379 |
| 1010 | 3300028380 | Ga0268265_10011876 | Ga0268265_100118766 | 379 |
| 1011 | 3300028380 | Ga0268265_10128929 | Ga0268265_101289292 | 379 |
| 1012 | 3300028380 | Ga0268265_10145408 | Ga0268265_101454082 | 379 |
| 1013 | 3300028381 | Ga0268264_10022913 | Ga0268264_100229135 | 379 |
| 1014 | 3300028381 | Ga0268264_10100665 | Ga0268264_101006653 | 379 |
| 1015 | 3300028381 | Ga0268264_10164785 | Ga0268264_101647852 | 379 |
| 1016 | 3300035691 | Ga0373931_0014697 | Ga0373931_0014697_2277_3434 | 379 |
| 1017 | 3300036401 | Ga0373937_0069894 | Ga0373937_0069894_858_2051 | 379 |
| 1018 | 3300039437 | Ga0436365_0574100 | Ga0436365_0574100_25723_26922 | 379 |
| 1019 | 3300042876 | Ga0451577_0000070 | Ga0451577_0000070_207835_209025 | 379 |
| 1020 | 3300044712 | Ga0453684_0001823 | Ga0453684_0001823_1398_2588 | 379 |
| 1021 | 3300044712 | Ga0453684_0003029 | Ga0453684_0003029_36485_37675 | 379 |
| 1022 | 3300046525 | Ga0495663_0000607 | Ga0495663_0000607_7999_9192 | 379 |
| 1023 | 3300046537 | Ga0495598_0000020 | Ga0495598_0000020_9409_10602 | 379 |
| 1024 | 3300046539 | Ga0495621_0000177 | Ga0495621_0000177_275_1468 | 379 |
| 1025 | 3300046683 | Ga0495658_0090198 | Ga0495658_0090198_522_1715 | 379 |
| 1026 | 3300047320 | Ga0495672_0092196 | Ga0495672_0092196_64_1287 | 379 |
| 1027 | 3300048905 | Ga0496102_0186607 | Ga0496102_0186607_756_1904 | 379 |
| 1028 | 3300048907 | Ga0496104_0025907 | Ga0496104_0025907_2285_3442 | 379 |
| 1029 | 3300048908 | Ga0496105_0074777 | Ga0496105_0074777_1191_2348 | 379 |
| 1030 | 3300048911 | Ga0496108_0002629 | Ga0496108_0002629_2268_3425 | 379 |
| 1031 | 3300048912 | Ga0496109_0008286 | Ga0496109_0008286_2460_3617 | 379 |
| 1032 | 3300048913 | Ga0496110_0048978 | Ga0496110_0048978_1647_2804 | 379 |
| 1033 | 3300048914 | Ga0496111_0036160 | Ga0496111_0036160_417_1574 | 379 |
| 1034 | 3300048915 | Ga0496112_0000393 | Ga0496112_0000393_21419_22576 | 379 |
| 1035 | 3300048916 | Ga0496113_0036655 | Ga0496113_0036655_2295_3452 | 379 |
| 1036 | 3300049583 | Ga0501067_0050906 | Ga0501067_0050906_835_1983 | 379 |
| 1037 | 3300049677 | Ga0501247_003007 | Ga0501247_003007_460_1602 | 379 |
| 1038 | 3300049765 | Ga0501268_004575 | Ga0501268_004575_359_1501 | 379 |
| 1039 | 3300050511 | nmdc:mga08y16_156815_c1 | nmdc:mga08y16_156815_c1_516_1706 | 379 |
| 1040 | 3300050511 | nmdc:mga08y16_38670_c1 | nmdc:mga08y16_38670_c1_2243_3460 | 379 |
| 1041 | 3300050515 | nmdc:mga0a205_95703_c1 | nmdc:mga0a205_95703_c1_1096_2247 | 379 |
| 1042 | 3300005353 | Ga0070669_100023139 | Ga0070669_1000231393 | 380 |
| 1043 | 3300005353 | Ga0070669_100211433 | Ga0070669_1002114331 | 380 |
| 1044 | 3300005439 | Ga0070711_100000170 | Ga0070711_10000017026 | 380 |
| 1045 | 3300005468 | Ga0070707_100029866 | Ga0070707_1000298662 | 380 |
| 1046 | 3300006175 | Ga0070712_100057382 | Ga0070712_1000573823 | 380 |
| 1047 | 3300006846 | Ga0075430_100320474 | Ga0075430_1003204741 | 380 |
| 1048 | 3300007076 | Ga0075435_100021667 | Ga0075435_1000216675 | 380 |
| 1049 | 3300009177 | Ga0105248_10112691 | Ga0105248_101126913 | 380 |
| 1050 | 3300025940 | Ga0207691_10091178 | Ga0207691_100911783 | 380 |
| 1051 | 3300025961 | Ga0207712_10003122 | Ga0207712_100031222 | 380 |
| 1052 | 3300026075 | Ga0207708_10040750 | Ga0207708_100407502 | 380 |
| 1053 | 3300026088 | Ga0207641_10221210 | Ga0207641_102212102 | 380 |
| 1054 | 3300028380 | Ga0268265_10125225 | Ga0268265_101252252 | 380 |
| 1055 | 3300031824 | Ga0307413_10104258 | Ga0307413_101042582 | 380 |
| 1056 | 3300031852 | Ga0307410_10013418 | Ga0307410_100134184 | 380 |
| 1057 | 3300031852 | Ga0307410_10114631 | Ga0307410_101146312 | 380 |
| 1058 | 3300031901 | Ga0307406_10030868 | Ga0307406_100308683 | 380 |
| 1059 | 3300031995 | Ga0307409_100129137 | Ga0307409_1001291372 | 380 |
| 1060 | 3300032002 | Ga0307416_100003783 | Ga0307416_1000037837 | 380 |
| 1061 | 3300032004 | Ga0307414_10029465 | Ga0307414_100294653 | 380 |
| 1062 | 3300032004 | Ga0307414_10069261 | Ga0307414_100692612 | 380 |
| 1063 | 3300032004 | Ga0307414_10292770 | Ga0307414_102927701 | 380 |
| 1064 | 3300032126 | Ga0307415_100024269 | Ga0307415_1000242692 | 380 |
| 1065 | 3300046473 | Ga0495582_0023393 | Ga0495582_0023393_1582_2823 | 380 |
| 1066 | 3300046475 | Ga0495639_0019962 | Ga0495639_0019962_940_2181 | 380 |
| 1067 | 3300046514 | Ga0495618_0017642 | Ga0495618_0017642_161_1402 | 380 |
| 1068 | 3300046517 | Ga0495630_0126675 | Ga0495630_0126675_91_1332 | 380 |
| 1069 | 3300046526 | Ga0495666_0062925 | Ga0495666_0062925_359_1600 | 380 |
| 1070 | 3300046690 | Ga0495624_0012863 | Ga0495624_0012863_948_2189 | 380 |
| 1071 | 3300047322 | Ga0495680_0028564 | Ga0495680_0028564_388_1629 | 380 |
| 1072 | 3300049584 | Ga0501068_0066596 | Ga0501068_0066596_409_1590 | 380 |
| 1073 | 3300005328 | Ga0070676_10002136 | Ga0070676_100021362 | 381 |
| 1074 | 3300005330 | Ga0070690_100038453 | Ga0070690_1000384532 | 381 |
| 1075 | 3300005334 | Ga0068869_100018237 | Ga0068869_1000182372 | 381 |
| 1076 | 3300005345 | Ga0070692_10069064 | Ga0070692_100690641 | 381 |
| 1077 | 3300005355 | Ga0070671_100039494 | Ga0070671_1000394943 | 381 |
| 1078 | 3300005356 | Ga0070674_100000315 | Ga0070674_1000003157 | 381 |
| 1079 | 3300005364 | Ga0070673_100090283 | Ga0070673_1000902832 | 381 |
| 1080 | 3300005440 | Ga0070705_100002190 | Ga0070705_1000021902 | 381 |
| 1081 | 3300005444 | Ga0070694_100048410 | Ga0070694_1000484102 | 381 |
| 1082 | 3300005445 | Ga0070708_100245726 | Ga0070708_1002457262 | 381 |
| 1083 | 3300005455 | Ga0070663_100098336 | Ga0070663_1000983362 | 381 |
| 1084 | 3300005457 | Ga0070662_100004350 | Ga0070662_1000043504 | 381 |
| 1085 | 3300005459 | Ga0068867_100001140 | Ga0068867_10000114011 | 381 |
| 1086 | 3300005471 | Ga0070698_100043869 | Ga0070698_1000438694 | 381 |
| 1087 | 3300005518 | Ga0070699_100002367 | Ga0070699_1000023673 | 381 |
| 1088 | 3300005539 | Ga0068853_100034326 | Ga0068853_1000343264 | 381 |
| 1089 | 3300005545 | Ga0070695_100006762 | Ga0070695_1000067622 | 381 |
| 1090 | 3300005546 | Ga0070696_100002525 | Ga0070696_1000025257 | 381 |
| 1091 | 3300005617 | Ga0068859_100154704 | Ga0068859_1001547042 | 381 |
| 1092 | 3300005618 | Ga0068864_100003389 | Ga0068864_1000033893 | 381 |
| 1093 | 3300005718 | Ga0068866_10000388 | Ga0068866_1000038811 | 381 |
| 1094 | 3300005719 | Ga0068861_100137883 | Ga0068861_1001378831 | 381 |
| 1095 | 3300005843 | Ga0068860_100056898 | Ga0068860_1000568983 | 381 |
| 1096 | 3300006844 | Ga0075428_100493664 | Ga0075428_1004936641 | 381 |
| 1097 | 3300006880 | Ga0075429_100003706 | Ga0075429_1000037068 | 381 |
| 1098 | 3300006881 | Ga0068865_100000700 | Ga0068865_10000070013 | 381 |
| 1099 | 3300006931 | Ga0097620_100154707 | Ga0097620_1001547072 | 381 |
| 1100 | 3300009093 | Ga0105240_10043674 | Ga0105240_100436744 | 381 |
| 1101 | 3300009094 | Ga0111539_10156316 | Ga0111539_101563163 | 381 |
| 1102 | 3300009098 | Ga0105245_10027885 | Ga0105245_100278852 | 381 |
| 1103 | 3300009147 | Ga0114129_10256691 | Ga0114129_102566912 | 381 |
| 1104 | 3300009174 | Ga0105241_10001699 | Ga0105241_1000169915 | 381 |
| 1105 | 3300009176 | Ga0105242_10003617 | Ga0105242_100036174 | 381 |
| 1106 | 3300009177 | Ga0105248_10008890 | Ga0105248_100088909 | 381 |
| 1107 | 3300010375 | Ga0105239_10059802 | Ga0105239_100598022 | 381 |
| 1108 | 3300011119 | Ga0105246_10023381 | Ga0105246_100233812 | 381 |
| 1109 | 3300013297 | Ga0157378_10006510 | Ga0157378_100065109 | 381 |
| 1110 | 3300013306 | Ga0163162_10025359 | Ga0163162_100253592 | 381 |
| 1111 | 3300013307 | Ga0157372_10339886 | Ga0157372_103398862 | 381 |
| 1112 | 3300014325 | Ga0163163_10205376 | Ga0163163_102053762 | 381 |
| 1113 | 3300014326 | Ga0157380_10041820 | Ga0157380_100418202 | 381 |
| 1114 | 3300014968 | Ga0157379_10014463 | Ga0157379_100144634 | 381 |
| 1115 | 3300025899 | Ga0207642_10000156 | Ga0207642_100001567 | 381 |
| 1116 | 3300025903 | Ga0207680_10038391 | Ga0207680_100383913 | 381 |
| 1117 | 3300025907 | Ga0207645_10001746 | Ga0207645_100017462 | 381 |
| 1118 | 3300025913 | Ga0207695_10129132 | Ga0207695_101291322 | 381 |
| 1119 | 3300025927 | Ga0207687_10015672 | Ga0207687_100156722 | 381 |
| 1120 | 3300025931 | Ga0207644_10033313 | Ga0207644_100333132 | 381 |
| 1121 | 3300025933 | Ga0207706_10000059 | Ga0207706_1000005946 | 381 |
| 1122 | 3300025934 | Ga0207686_10000670 | Ga0207686_1000067011 | 381 |
| 1123 | 3300025941 | Ga0207711_10031861 | Ga0207711_100318614 | 381 |
| 1124 | 3300025981 | Ga0207640_10023943 | Ga0207640_100239434 | 381 |
| 1125 | 3300026067 | Ga0207678_10105622 | Ga0207678_101056222 | 381 |
| 1126 | 3300026088 | Ga0207641_10126487 | Ga0207641_101264872 | 381 |
| 1127 | 3300026089 | Ga0207648_10000052 | Ga0207648_1000005216 | 381 |
| 1128 | 3300026121 | Ga0207683_10013853 | Ga0207683_100138535 | 381 |
| 1129 | 3300032002 | Ga0307416_100023830 | Ga0307416_1000238302 | 381 |
| 1130 | 3300032002 | Ga0307416_100068708 | Ga0307416_1000687082 | 381 |
| 1131 | 3300045051 | Ga0451576_0080048 | Ga0451576_0080048_25_1188 | 381 |
| 1132 | 3300048909 | Ga0496106_0036945 | Ga0496106_0036945_2069_3292 | 381 |
| 1133 | 3300048917 | Ga0496114_0021828 | Ga0496114_0021828_3533_4732 | 381 |
| 1134 | 3300049583 | Ga0501067_0015845 | Ga0501067_0015845_2136_3320 | 381 |
| 1135 | 3300049585 | Ga0501069_0026518 | Ga0501069_0026518_1153_2337 | 381 |
| 1136 | 3300049593 | Ga0501077_0001037 | Ga0501077_0001037_10689_11864 | 381 |
| 1137 | 3300050507 | nmdc:mga05p37_150065_c1 | nmdc:mga05p37_150065_c1_424_1587 | 381 |
| 1138 | 3300050508 | nmdc:mga09592_47912_c1 | nmdc:mga09592_47912_c1_2316_3479 | 381 |
| 1139 | 3300054114 | Ga0501084_0036304 | Ga0501084_0036304_2661_3836 | 381 |
| 1140 | 3300060353 | Ga0501082_0118265 | Ga0501082_0118265_1062_2237 | 381 |
| 1141 | 2162886012 | MBSR1b_contig_10898535 | MBSR1b_0888.00004360 | 382 |
| 1142 | 3300005330 | Ga0070690_100109244 | Ga0070690_1001092442 | 382 |
| 1143 | 3300005340 | Ga0070689_100136165 | Ga0070689_1001361651 | 382 |
| 1144 | 3300005343 | Ga0070687_100128480 | Ga0070687_1001284802 | 382 |
| 1145 | 3300005347 | Ga0070668_100188983 | Ga0070668_1001889832 | 382 |
| 1146 | 3300005440 | Ga0070705_100018686 | Ga0070705_1000186863 | 382 |
| 1147 | 3300005441 | Ga0070700_100133824 | Ga0070700_1001338242 | 382 |
| 1148 | 3300005445 | Ga0070708_100010751 | Ga0070708_1000107515 | 382 |
| 1149 | 3300005458 | Ga0070681_10109138 | Ga0070681_101091382 | 382 |
| 1150 | 3300005467 | Ga0070706_100092301 | Ga0070706_1000923012 | 382 |
| 1151 | 3300005468 | Ga0070707_100012580 | Ga0070707_1000125803 | 382 |
| 1152 | 3300005468 | Ga0070707_100137562 | Ga0070707_1001375622 | 382 |
| 1153 | 3300005518 | Ga0070699_100078059 | Ga0070699_1000780593 | 382 |
| 1154 | 3300005536 | Ga0070697_100042155 | Ga0070697_1000421553 | 382 |
| 1155 | 3300005545 | Ga0070695_100063242 | Ga0070695_1000632423 | 382 |
| 1156 | 3300005546 | Ga0070696_100029514 | Ga0070696_1000295143 | 382 |
| 1157 | 3300005547 | Ga0070693_100110342 | Ga0070693_1001103422 | 382 |
| 1158 | 3300005549 | Ga0070704_100036396 | Ga0070704_1000363963 | 382 |
| 1159 | 3300005577 | Ga0068857_100043273 | Ga0068857_1000432732 | 382 |
| 1160 | 3300005614 | Ga0068856_100260297 | Ga0068856_1002602972 | 382 |
| 1161 | 3300006844 | Ga0075428_100179649 | Ga0075428_1001796492 | 382 |
| 1162 | 3300006847 | Ga0075431_100075968 | Ga0075431_1000759683 | 382 |
| 1163 | 3300006852 | Ga0075433_10079506 | Ga0075433_100795062 | 382 |
| 1164 | 3300006852 | Ga0075433_10256779 | Ga0075433_102567792 | 382 |
| 1165 | 3300006871 | Ga0075434_100111499 | Ga0075434_1001114992 | 382 |
| 1166 | 3300006880 | Ga0075429_100081403 | Ga0075429_1000814032 | 382 |
| 1167 | 3300007076 | Ga0075435_100075391 | Ga0075435_1000753912 | 382 |
| 1168 | 3300009147 | Ga0114129_10002882 | Ga0114129_100028823 | 382 |
| 1169 | 3300009177 | Ga0105248_10348496 | Ga0105248_103484962 | 382 |
| 1170 | 3300010375 | Ga0105239_10031977 | Ga0105239_100319774 | 382 |
| 1171 | 3300014325 | Ga0163163_10149487 | Ga0163163_101494873 | 382 |
| 1172 | 3300025910 | Ga0207684_10029291 | Ga0207684_100292912 | 382 |
| 1173 | 3300025912 | Ga0207707_10012355 | Ga0207707_100123555 | 382 |
| 1174 | 3300025917 | Ga0207660_10242780 | Ga0207660_102427801 | 382 |
| 1175 | 3300025922 | Ga0207646_10047961 | Ga0207646_100479612 | 382 |
| 1176 | 3300025933 | Ga0207706_10033316 | Ga0207706_100333164 | 382 |
| 1177 | 3300025972 | Ga0207668_10169230 | Ga0207668_101692302 | 382 |
| 1178 | 3300026075 | Ga0207708_10206527 | Ga0207708_102065272 | 382 |
| 1179 | 3300026095 | Ga0207676_10020512 | Ga0207676_100205123 | 382 |
| 1180 | 3300026116 | Ga0207674_10025284 | Ga0207674_100252842 | 382 |
| 1181 | 3300032005 | Ga0307411_10121577 | Ga0307411_101215772 | 382 |
| 1182 | 3300038996 | Ga0242420_017283 | Ga0242420_017283_56_1228 | 382 |
| 1183 | 3300045051 | Ga0451576_0055561 | Ga0451576_0055561_515_1687 | 382 |
| 1184 | 3300048904 | Ga0496101_0024925 | Ga0496101_0024925_514_1662 | 382 |
| 1185 | 3300048905 | Ga0496102_0011655 | Ga0496102_0011655_5100_6248 | 382 |
| 1186 | 3300048907 | Ga0496104_0019967 | Ga0496104_0019967_4157_5305 | 382 |
| 1187 | 3300048908 | Ga0496105_0072154 | Ga0496105_0072154_1602_2750 | 382 |
| 1188 | 3300048909 | Ga0496106_0020548 | Ga0496106_0020548_925_2073 | 382 |
| 1189 | 3300048910 | Ga0496107_0036452 | Ga0496107_0036452_858_2006 | 382 |
| 1190 | 3300048911 | Ga0496108_0001174 | Ga0496108_0001174_9925_11073 | 382 |
| 1191 | 3300048912 | Ga0496109_0048891 | Ga0496109_0048891_1120_2268 | 382 |
| 1192 | 3300048913 | Ga0496110_0005400 | Ga0496110_0005400_5873_7021 | 382 |
| 1193 | 3300048914 | Ga0496111_0002035 | Ga0496111_0002035_9429_10577 | 382 |
| 1194 | 3300048915 | Ga0496112_0045636 | Ga0496112_0045636_1451_2599 | 382 |
| 1195 | 3300048916 | Ga0496113_0003534 | Ga0496113_0003534_3949_5097 | 382 |
| 1196 | 3300049575 | Ga0501039_0155425 | Ga0501039_0155425_457_1701 | 382 |
| 1197 | 3300049586 | Ga0501070_0031972 | Ga0501070_0031972_2891_4051 | 382 |
| 1198 | 3300049593 | Ga0501077_0034028 | Ga0501077_0034028_1208_2452 | 382 |
| 1199 | 3300049743 | Ga0501081_0138493 | Ga0501081_0138493_49_1293 | 382 |
| 1200 | 3300049822 | Ga0501035_0092648 | Ga0501035_0092648_261_1448 | 382 |
| 1201 | 3300050508 | nmdc:mga09592_77534_c1 | nmdc:mga09592_77534_c1_779_1927 | 382 |
| 1202 | 3300050512 | nmdc:mga0n895_13695_c2 | nmdc:mga0n895_13695_c2_535_1683 | 382 |
| 1203 | 3300050512 | nmdc:mga0n895_96649_c1 | nmdc:mga0n895_96649_c1_1088_2236 | 382 |
| 1204 | 3300050513 | nmdc:mga0rr50_97590_c1 | nmdc:mga0rr50_97590_c1_221_1369 | 382 |
| 1205 | 3300050514 | nmdc:mga08x19_66331_c1 | nmdc:mga08x19_66331_c1_744_1892 | 382 |
| 1206 | 3300050515 | nmdc:mga0a205_13956_c2 | nmdc:mga0a205_13956_c2_151_1299 | 382 |
| 1207 | 3300050515 | nmdc:mga0a205_258624_c1 | nmdc:mga0a205_258624_c1_212_1360 | 382 |
| 1208 | 3300060353 | Ga0501082_0032602 | Ga0501082_0032602_2196_3440 | 382 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1wkh-assembly1.cif.gz_B | acetylornithine aminotransferase from thermus thermophilus hb8 | 0.9556 | 12 | 382 |
| 7nn4-assembly2.cif.gz_D | crystal structure of mycobacterium tuberculosis argd with prosthetic group pyridoxal 5'-phosphate and 3-hydroxy-2-naphthoic acid. | 0.9487 | 13 | 381 |
| 2ord-assembly1.cif.gz_B | crystal structure of acetylornithine aminotransferase (ec 2.6.1.11) (acoat) (tm1785) from thermotoga maritima at 1.40 a resolution | 0.9473 | 8 | 381 |
| 2eh6-assembly1.cif.gz_B | crystal structure of acetylornithine aminotransferase from aquifex aeolicus vf5 | 0.947 | 9 | 380 |
| 5ll3-assembly1.cif.gz_D | structure of the isoleucine 2-epimerase from lactobacillus buchneri (plp complex form) | 0.9429 | 17 | 380 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0P0WHN0_6_253_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9575 | 74 | 289 | 3.40.640.10 |
| 2eh6B01 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9489 | 300 | 380 | 3.90.1150.10 |
| af_P9WPZ7_62_298_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9482 | 52 | 288 | 3.40.640.10 |
| af_I1LEC3_367_457_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9425 | 296 | 379 | 3.90.1150.10 |
| af_P9WPZ7_62_298_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9404 | 52 | 288 | 3.40.640.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9ZTP8-F1-model_v4 | Aminotransferase class III-fold pyridoxal phosphate-dependent enzyme | 0.9745 | 163 | 379 |
GO:0008483
GO:0030170 GO:0042802 |
| AF-A0A0A7LFF3-F1-model_v4 | HemL1 protein (EC 5.4.3.8) | 0.9738 | 9 | 380 |
GO:0006526
GO:0008483 GO:0030170 GO:0042286 GO:0042802 |
| AF-A0A354U7E9-F1-model_v4 | Aspartate aminotransferase family protein | 0.9737 | 171 | 381 |
GO:0008483
GO:0030170 GO:0042802 |
| AF-I4EHR6-F1-model_v4 | Acetylornithine aminotransferase (Fragment, part 2) (EC 2.6.1.11) | 0.9712 | 56 | 382 |
GO:0003992
GO:0030170 GO:0042802 |
| AF-A0A497RF33-F1-model_v4 | Aspartate aminotransferase family protein | 0.9705 | 123 | 380 |
GO:0008483
GO:0030170 GO:0042802 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar