F491678

General Info

Members Datasets Scaffolds Average Seq Length
1208 369 1206 388

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_100281519|Ga0068859_1002815192
Length 437
Sequence MKVSSFEFRVSGPAAPRKNQSRRLHRRGVAKEPETRNINMVMSAKTKSDNIVAIEEQYQVATYKKMPVVAERGEGVWLFTSDGERYLDLYGGHAVAGTGHCHPHVVSAIKNQADRLLFYSNLVYSEARARAAEKLVSIAPESLTKAFFCNSGTEANENAMRMARMATGREQVITFGGGFHGRTADAISATFLGKYREIGKPNVPGHLKAEFGDIENVRGLADESVAAIMLEPIQSMAGVRMAGSEYYQALRELCDQRGIVLIYDEVQTGVGRTGEWFFAGSDAGDGVVPDIVTLAKALGSGIPVGACLVTEKISSQIKENDLGTTFGGGMMAMAAVSATLEAIENDGMLANVRAVEAHLRERLKEVEQVVAVHGKGLLLGLEFADKAKPVHEGLLEQKIITGTSSDPRVLRLLPPLCLQKDQVDLFVDALGKVFAQS

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
3 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
4 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
5 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
6 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
81 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
87 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
88 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
89 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
90 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
91 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
94 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
95 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
96 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
97 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
98 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
99 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
104 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
109 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
111 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
120 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
121 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
122 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
123 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
124 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
125 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
126 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
127 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
128 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
129 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
130 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
135 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
136 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
199 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
200 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
204 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
205 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
208 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
209 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
210 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
211 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
212 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
213 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
214 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
215 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
216 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
217 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
218 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
219 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
220 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
221 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
222 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
223 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
224 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
225 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
226 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
227 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
228 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
229 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
230 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
231 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
232 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
233 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
234 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
235 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
236 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
237 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
238 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
239 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
240 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
241 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
242 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
243 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
244 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
245 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
246 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
247 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
248 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
249 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
250 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
251 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
252 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
253 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
254 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
255 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
256 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
257 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
258 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
259 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
260 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
261 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
262 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
263 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
264 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
265 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
266 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
267 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
268 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
269 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
270 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
271 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
272 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
273 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
274 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
275 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
276 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
277 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
278 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
279 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
280 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
281 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
282 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
283 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
284 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
285 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
286 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
287 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
288 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
289 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
290 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
291 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
292 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
293 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
294 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
295 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
296 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
297 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
298 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
299 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
300 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
301 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
302 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
303 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
304 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
305 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
306 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
307 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
308 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
309 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
310 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
311 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
312 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
313 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
314 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
324 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
325 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
326 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
327 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
328 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
329 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
330 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
331 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
332 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
333 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
334 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
335 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
336 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
337 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
338 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
339 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
340 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
341 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
342 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
343 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
344 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
345 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
346 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
347 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
348 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
351 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
352 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
353 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
354 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
355 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
356 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
357 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
358 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
359 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
360 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
361 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
362 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
363 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
364 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
365 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
366 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
367 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
368 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
369 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0.17
Isolates 0.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.66
Nodule 0
Rhizoplane 4.39
Rhizosphere 93.79
Stem 0
Stem Tuber 0
Unclassified 1.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_10898535 2162886012 Bacteria 1366
2 CNBas_1000308 3300000531 Bacteria 1978
3 LJQas_1000004 3300000549 Bacteria 34891
4 JGI24748J21848_1000002 3300002074 Bacteria 426946
5 JGI24034J26672_10000004 3300002239 Bacteria 426946
6 JGI24751J29686_10000012 3300002459 Bacteria 115709
7 JGI25406J46586_10004388 3300003203 Bacteria 6577
8 JGI25406J46586_10006498 3300003203 Bacteria 5379
9 rootH2_10076012 3300003320 Bacteria 2616
10 Ga0065714_10064422 3300005288 Bacteria 270668
11 Ga0065704_10000986 3300005289 Bacteria 13773
12 Ga0065704_10142747 3300005289 Bacteria 1502
13 Ga0065712_10067728 3300005290 Bacteria 178215
14 Ga0065712_10085973 3300005290 Bacteria 2647
15 Ga0065715_10100505 3300005293 Bacteria 3296
16 Ga0065715_10112355 3300005293 Bacteria 2517
17 Ga0065715_10148838 3300005293 Bacteria 1741
18 Ga0065715_10167926 3300005293 Bacteria 1571
19 Ga0065707_10000589 3300005295 Bacteria 29520
20 Ga0065707_10001006 3300005295 Bacteria 8756
21 Ga0065707_10082702 3300005295 Bacteria 12640
22 Ga0065707_10134320 3300005295 Bacteria 1867
23 Ga0070658_10014417 3300005327 Bacteria 6343
24 Ga0070676_10002136 3300005328 Bacteria 10067
25 Ga0070683_100245314 3300005329 Bacteria 1704
26 Ga0070690_100009821 3300005330 Bacteria 5554
27 Ga0070690_100038453 3300005330 Bacteria 3020
28 Ga0070690_100069198 3300005330 Unclassified 2290
29 Ga0070690_100109244 3300005330 Bacteria 1843
30 Ga0070690_100158316 3300005330 Bacteria 1550
31 Ga0070670_100000165 3300005331 Bacteria 59984
32 Ga0070670_100002492 3300005331 Bacteria 15184
33 Ga0070670_100026909 3300005331 Bacteria 4947
34 Ga0070670_100034090 3300005331 Bacteria 4382
35 Ga0070670_100199662 3300005331 Bacteria 1737
36 Ga0070670_100237816 3300005331 Bacteria 1586
37 Ga0070677_10076772 3300005333 Unclassified 1419
38 Ga0068869_100012015 3300005334 Bacteria 5702
39 Ga0068869_100017710 3300005334 Unclassified 4836
40 Ga0068869_100018237 3300005334 Bacteria 4774
41 Ga0068869_100050893 3300005334 Bacteria 3004
42 Ga0068869_100052614 3300005334 Bacteria 2957
43 Ga0068869_100133965 3300005334 Bacteria 1907
44 Ga0068869_100203913 3300005334 Bacteria 1560
45 Ga0070666_10017753 3300005335 Bacteria 4565
46 Ga0070666_10066114 3300005335 Unclassified 2453
47 Ga0070680_100000123 3300005336 Bacteria 45833
48 Ga0070680_100075571 3300005336 Bacteria 2773
49 Ga0070680_100170137 3300005336 Unclassified 1833
50 Ga0070682_100000271 3300005337 Bacteria 37361
51 Ga0070682_100018666 3300005337 Bacteria 4059
52 Ga0070682_100219920 3300005337 Bacteria 1351
53 Ga0068868_100067416 3300005338 Bacteria 2848
54 Ga0068868_100074489 3300005338 Bacteria 2711
55 Ga0068868_100099959 3300005338 Bacteria 2347
56 Ga0068868_100164196 3300005338 Bacteria 1836
57 Ga0070660_100046712 3300005339 Bacteria 3320
58 Ga0070689_100001120 3300005340 Bacteria 16876
59 Ga0070689_100042885 3300005340 Bacteria 3475
60 Ga0070689_100051380 3300005340 Bacteria 3187
61 Ga0070689_100100283 3300005340 Unclassified 2291
62 Ga0070689_100136165 3300005340 Bacteria 1972
63 Ga0070687_100128480 3300005343 Bacteria 1460
64 Ga0070661_100014994 3300005344 Bacteria 5468
65 Ga0070692_10014720 3300005345 Bacteria 3682
66 Ga0070692_10056805 3300005345 Bacteria 2050
67 Ga0070692_10069064 3300005345 Bacteria 1879
68 Ga0070692_10077165 3300005345 Bacteria 1787
69 Ga0070668_100188983 3300005347 Bacteria 1686
70 Ga0070669_100000025 3300005353 Bacteria 170551
71 Ga0070669_100023139 3300005353 Bacteria 4448
72 Ga0070669_100180877 3300005353 Bacteria 1649
73 Ga0070669_100190982 3300005353 Bacteria 1607
74 Ga0070669_100211433 3300005353 Unclassified 1530
75 Ga0070675_100137803 3300005354 Bacteria 2084
76 Ga0070675_100141218 3300005354 Bacteria 2059
77 Ga0070671_100002614 3300005355 Bacteria 13937
78 Ga0070671_100025316 3300005355 Bacteria 4868
79 Ga0070671_100032235 3300005355 Bacteria 4333
80 Ga0070671_100039494 3300005355 Bacteria 3918
81 Ga0070671_100115325 3300005355 Unclassified 2258
82 Ga0070674_100000315 3300005356 Bacteria 23813
83 Ga0070674_100086137 3300005356 Bacteria 2256
84 Ga0070674_100125249 3300005356 Bacteria 1907
85 Ga0070674_100130582 3300005356 Bacteria 1872
86 Ga0070673_100036253 3300005364 Bacteria 3747
87 Ga0070673_100043997 3300005364 Unclassified 3454
88 Ga0070673_100049583 3300005364 Unclassified 3279
89 Ga0070673_100057024 3300005364 Bacteria 3085
90 Ga0070673_100090283 3300005364 Bacteria 2503
91 Ga0070673_100118782 3300005364 Bacteria 2202
92 Ga0070673_100133269 3300005364 Bacteria 2088
93 Ga0070673_100145059 3300005364 Bacteria 2006
94 Ga0070688_100034426 3300005365 Unclassified 3068
95 Ga0070667_100036989 3300005367 Bacteria 4092
96 Ga0070667_100043210 3300005367 Bacteria 3782
97 Ga0070667_100070267 3300005367 Bacteria 2980
98 Ga0070667_100256936 3300005367 Bacteria 1563
99 Ga0070703_10000528 3300005406 Bacteria 14433
100 Ga0070709_10000042 3300005434 Bacteria 105881
101 Ga0070709_10000103 3300005434 Bacteria 60237
102 Ga0070713_100008652 3300005436 Bacteria 7235
103 Ga0070701_10021561 3300005438 Bacteria 3077
104 Ga0070701_10031923 3300005438 Bacteria 2618
105 Ga0070701_10039305 3300005438 Bacteria 2399
106 Ga0070701_10157381 3300005438 Bacteria 1313
107 Ga0070711_100000062 3300005439 Bacteria 64492
108 Ga0070711_100000170 3300005439 Bacteria 34633
109 Ga0070705_100000038 3300005440 Bacteria 66622
110 Ga0070705_100002190 3300005440 Bacteria 9916
111 Ga0070705_100012603 3300005440 Bacteria 4301
112 Ga0070705_100016678 3300005440 Bacteria 3820
113 Ga0070705_100018686 3300005440 Bacteria 3638
114 Ga0070705_100156059 3300005440 Bacteria 1520
115 Ga0070700_100000225 3300005441 Bacteria 31350
116 Ga0070700_100008335 3300005441 Bacteria 5643
117 Ga0070700_100037319 3300005441 Bacteria 2954
118 Ga0070700_100056483 3300005441 Unclassified 2461
119 Ga0070700_100128200 3300005441 Bacteria 1709
120 Ga0070700_100133824 3300005441 Bacteria 1676
121 Ga0070700_100139739 3300005441 Bacteria 1644
122 Ga0070694_100000175 3300005444 Bacteria 33400
123 Ga0070694_100011484 3300005444 Bacteria 5486
124 Ga0070694_100013232 3300005444 Bacteria 5150
125 Ga0070694_100043975 3300005444 Bacteria 2988
126 Ga0070694_100048410 3300005444 Bacteria 2860
127 Ga0070694_100057868 3300005444 Bacteria 2636
128 Ga0070694_100075912 3300005444 Bacteria 2325
129 Ga0070694_100092913 3300005444 Bacteria 2120
130 Ga0070694_100135081 3300005444 Bacteria 1786
131 Ga0070694_100226556 3300005444 Bacteria 1405
132 Ga0070708_100001962 3300005445 Bacteria 15865
133 Ga0070708_100010751 3300005445 Bacteria 7428
134 Ga0070708_100155048 3300005445 Bacteria 2132
135 Ga0070708_100222357 3300005445 Bacteria 1771
136 Ga0070708_100245726 3300005445 Unclassified 1680
137 Ga0070663_100083868 3300005455 Bacteria 2348
138 Ga0070663_100098336 3300005455 Bacteria 2180
139 Ga0070678_100293021 3300005456 Bacteria 1380
140 Ga0070662_100004350 3300005457 Bacteria 8949
141 Ga0070662_100129332 3300005457 Bacteria 1945
142 Ga0070662_100169160 3300005457 Unclassified 1715
143 Ga0070681_10001768 3300005458 Bacteria 19378
144 Ga0070681_10002525 3300005458 Bacteria 16779
145 Ga0070681_10003272 3300005458 Bacteria 15114
146 Ga0070681_10014914 3300005458 Bacteria 7727
147 Ga0070681_10029015 3300005458 Bacteria 5556
148 Ga0070681_10044858 3300005458 Bacteria 4426
149 Ga0070681_10053577 3300005458 Bacteria 4021
150 Ga0070681_10076727 3300005458 Bacteria 3300
151 Ga0070681_10109138 3300005458 Bacteria 2707
152 Ga0070681_10109366 3300005458 Bacteria 2704
153 Ga0070681_10277032 3300005458 Bacteria 1589
154 Ga0070681_10286952 3300005458 Bacteria 1556
155 Ga0068867_100001140 3300005459 Bacteria 18141
156 Ga0068867_100064051 3300005459 Bacteria 2733
157 Ga0068867_100259877 3300005459 Bacteria 1415
158 Ga0070685_10002946 3300005466 Bacteria 8701
159 Ga0070685_10045369 3300005466 Unclassified 2521
160 Ga0070706_100000007 3300005467 Bacteria 228014
161 Ga0070706_100000128 3300005467 Bacteria 92969
162 Ga0070706_100001095 3300005467 Bacteria 29274
163 Ga0070706_100013038 3300005467 Bacteria 7692
164 Ga0070706_100019951 3300005467 Bacteria 6180
165 Ga0070706_100028562 3300005467 Bacteria 5136
166 Ga0070706_100092301 3300005467 Bacteria 2809
167 Ga0070706_100163002 3300005467 Bacteria 2082
168 Ga0070707_100000026 3300005468 Bacteria 124537
169 Ga0070707_100007330 3300005468 Bacteria 10243
170 Ga0070707_100012580 3300005468 Bacteria 7905
171 Ga0070707_100029866 3300005468 Bacteria 5187
172 Ga0070707_100109317 3300005468 Unclassified 2681
173 Ga0070707_100137562 3300005468 Bacteria 2376
174 Ga0070698_100001773 3300005471 Bacteria 24065
175 Ga0070698_100004968 3300005471 Bacteria 14570
176 Ga0070698_100005606 3300005471 Bacteria 13727
177 Ga0070698_100011411 3300005471 Bacteria 9425
178 Ga0070698_100013716 3300005471 Bacteria 8577
179 Ga0070698_100034939 3300005471 Bacteria 5200
180 Ga0070698_100043869 3300005471 Bacteria 4582
181 Ga0070698_100111659 3300005471 Bacteria 2698
182 Ga0070698_100127306 3300005471 Bacteria 2504
183 Ga0070698_100204266 3300005471 Bacteria 1911
184 Ga0070699_100000024 3300005518 Bacteria 161189
185 Ga0070699_100000094 3300005518 Bacteria 85329
186 Ga0070699_100001203 3300005518 Bacteria 23916
187 Ga0070699_100001870 3300005518 Bacteria 19038
188 Ga0070699_100002367 3300005518 Bacteria 16917
189 Ga0070699_100012158 3300005518 Bacteria 7428
190 Ga0070699_100078059 3300005518 Bacteria 2883
191 Ga0070699_100094652 3300005518 Bacteria 2615
192 Ga0070699_100137037 3300005518 Bacteria 2159
193 Ga0070699_100173162 3300005518 Unclassified 1913
194 Ga0070679_100000014 3300005530 Bacteria 150481
195 Ga0070679_100006157 3300005530 Bacteria 11164
196 Ga0070679_100008917 3300005530 Bacteria 9463
197 Ga0070679_100045696 3300005530 Bacteria 4364
198 Ga0070679_100080169 3300005530 Bacteria 3253
199 Ga0070697_100000052 3300005536 Bacteria 88211
200 Ga0070697_100000392 3300005536 Bacteria 33968
201 Ga0070697_100001507 3300005536 Bacteria 17693
202 Ga0070697_100012151 3300005536 Bacteria 6743
203 Ga0070697_100042155 3300005536 Bacteria 3694
204 Ga0070697_100083207 3300005536 Bacteria 2639
205 Ga0068853_100008850 3300005539 Bacteria 8099
206 Ga0068853_100034326 3300005539 Bacteria 4306
207 Ga0068853_100039118 3300005539 Bacteria 4044
208 Ga0068853_100127354 3300005539 Bacteria 2276
209 Ga0070672_100012889 3300005543 Bacteria 5890
210 Ga0070672_100154179 3300005543 Bacteria 1902
211 Ga0070672_100173547 3300005543 Bacteria 1794
212 Ga0070672_100189526 3300005543 Bacteria 1716
213 Ga0070686_100017113 3300005544 Bacteria 4231
214 Ga0070686_100017451 3300005544 Bacteria 4194
215 Ga0070686_100027904 3300005544 Unclassified 3419
216 Ga0070686_100058002 3300005544 Bacteria 2490
217 Ga0070695_100006762 3300005545 Bacteria 6788
218 Ga0070695_100045346 3300005545 Unclassified 2802
219 Ga0070695_100055818 3300005545 Bacteria 2547
220 Ga0070695_100063242 3300005545 Bacteria 2405
221 Ga0070695_100109657 3300005545 Bacteria 1871
222 Ga0070695_100186585 3300005545 Bacteria 1473
223 Ga0070696_100001303 3300005546 Bacteria 16265
224 Ga0070696_100002525 3300005546 Bacteria 12120
225 Ga0070696_100010953 3300005546 Bacteria 6075
226 Ga0070696_100029514 3300005546 Bacteria 3749
227 Ga0070696_100038361 3300005546 Unclassified 3306
228 Ga0070696_100098942 3300005546 Unclassified 2087
229 Ga0070696_100113567 3300005546 Bacteria 1953
230 Ga0070693_100001436 3300005547 Bacteria 10739
231 Ga0070693_100021477 3300005547 Bacteria 3420
232 Ga0070693_100110342 3300005547 Bacteria 1691
233 Ga0070665_100000156 3300005548 Bacteria 124832
234 Ga0070665_100002304 3300005548 Bacteria 21181
235 Ga0070665_100007626 3300005548 Bacteria 11000
236 Ga0070665_100253349 3300005548 Bacteria 1761
237 Ga0070704_100005539 3300005549 Bacteria 7364
238 Ga0070704_100024375 3300005549 Bacteria 3969
239 Ga0070704_100036396 3300005549 Bacteria 3355
240 Ga0070704_100057433 3300005549 Bacteria 2767
241 Ga0070704_100074243 3300005549 Bacteria 2480
242 Ga0070704_100109222 3300005549 Bacteria 2101
243 Ga0070704_100145994 3300005549 Bacteria 1854
244 Ga0070704_100222623 3300005549 Bacteria 1535
245 Ga0068855_100006051 3300005563 Bacteria 14754
246 Ga0068855_100009063 3300005563 Bacteria 12025
247 Ga0070664_100007053 3300005564 Bacteria 9068
248 Ga0070664_100009196 3300005564 Bacteria 8022
249 Ga0070664_100018237 3300005564 Bacteria 5760
250 Ga0070664_100052965 3300005564 Bacteria 3439
251 Ga0068857_100001440 3300005577 Bacteria 18873
252 Ga0068857_100043273 3300005577 Bacteria 3995
253 Ga0068857_100095018 3300005577 Bacteria 2669
254 Ga0068857_100118030 3300005577 Bacteria 2388
255 Ga0068854_100246640 3300005578 Bacteria 1424
256 Ga0068854_100302729 3300005578 Unclassified 1294
257 Ga0068856_100041440 3300005614 Bacteria 4525
258 Ga0068856_100096367 3300005614 Bacteria 2947
259 Ga0068856_100260297 3300005614 Bacteria 1750
260 Ga0070702_100013190 3300005615 Bacteria 4165
261 Ga0068852_100144084 3300005616 Unclassified 2208
262 Ga0068852_100148679 3300005616 Bacteria 2176
263 Ga0068852_100164719 3300005616 Bacteria 2073
264 Ga0068859_100008065 3300005617 Bacteria 10677
265 Ga0068859_100008330 3300005617 Bacteria 10507
266 Ga0068859_100020509 3300005617 Bacteria 6633
267 Ga0068859_100030082 3300005617 Bacteria 5448
268 Ga0068859_100039360 3300005617 Bacteria 4743
269 Ga0068859_100091528 3300005617 Bacteria 3092
270 Ga0068859_100113519 3300005617 Bacteria 2773
271 Ga0068859_100121419 3300005617 Unclassified 2679
272 Ga0068859_100122740 3300005617 Bacteria 2664
273 Ga0068859_100154704 3300005617 Bacteria 2370
274 Ga0068859_100178854 3300005617 Bacteria 2203
275 Ga0068859_100246020 3300005617 Bacteria 1878
276 Ga0068859_100281519 3300005617 Bacteria 1756
277 Ga0068864_100003389 3300005618 Bacteria 13173
278 Ga0068864_100012380 3300005618 Bacteria 7053
279 Ga0068864_100052192 3300005618 Bacteria 3524
280 Ga0068864_100067513 3300005618 Bacteria 3105
281 Ga0068864_100070050 3300005618 Bacteria 3051
282 Ga0068864_100120504 3300005618 Unclassified 2345
283 Ga0068864_100223984 3300005618 Bacteria 1736
284 Ga0068864_100328238 3300005618 Bacteria 1439
285 Ga0068866_10000388 3300005718 Bacteria 20689
286 Ga0068866_10022678 3300005718 Bacteria 2908
287 Ga0068866_10054211 3300005718 Bacteria 2053
288 Ga0068861_100076206 3300005719 Bacteria 2613
289 Ga0068861_100137883 3300005719 Bacteria 1987
290 Ga0068851_10000697 3300005834 Bacteria 14334
291 Ga0068870_10084749 3300005840 Bacteria 1760
292 Ga0068863_100010715 3300005841 Bacteria 8905
293 Ga0068863_100011604 3300005841 Bacteria 8526
294 Ga0068863_100030745 3300005841 Bacteria 5127
295 Ga0068863_100032235 3300005841 Bacteria 4994
296 Ga0068863_100045465 3300005841 Bacteria 4167
297 Ga0068863_100188114 3300005841 Bacteria 1984
298 Ga0068863_100273330 3300005841 Bacteria 1636
299 Ga0068863_100315118 3300005841 Bacteria 1519
300 Ga0068858_100000770 3300005842 Bacteria 33479
301 Ga0068858_100016121 3300005842 Bacteria 7020
302 Ga0068858_100022966 3300005842 Bacteria 5817
303 Ga0068858_100040115 3300005842 Bacteria 4341
304 Ga0068858_100090574 3300005842 Bacteria 2846
305 Ga0068858_100105122 3300005842 Bacteria 2634
306 Ga0068858_100146950 3300005842 Unclassified 2214
307 Ga0068858_100167680 3300005842 Unclassified 2070
308 Ga0068860_100001357 3300005843 Bacteria 26595
309 Ga0068860_100010473 3300005843 Bacteria 9166
310 Ga0068860_100056898 3300005843 Bacteria 3716
311 Ga0068860_100084996 3300005843 Bacteria 3010
312 Ga0068860_100101013 3300005843 Bacteria 2752
313 Ga0068860_100134580 3300005843 Bacteria 2373
314 Ga0068860_100159039 3300005843 Bacteria 2178
315 Ga0068860_100375002 3300005843 Bacteria 1404
316 Ga0068862_100000670 3300005844 Bacteria 35079
317 Ga0068862_100009668 3300005844 Bacteria 7969
318 Ga0068862_100015414 3300005844 Bacteria 6349
319 Ga0068862_100034534 3300005844 Bacteria 4279
320 Ga0068862_100119462 3300005844 Unclassified 2322
321 Ga0068862_100124251 3300005844 Bacteria 2277
322 Ga0081455_10000484 3300005937 Bacteria 51669
323 Ga0081539_10000165 3300005985 Bacteria 153824
324 Ga0081539_10000586 3300005985 Bacteria 74721
325 Ga0081539_10000796 3300005985 Bacteria 61233
326 Ga0081539_10000858 3300005985 Bacteria 58194
327 Ga0081539_10103462 3300005985 Bacteria 1447
328 Ga0070717_10031311 3300006028 Bacteria 4278
329 Ga0070715_10000004 3300006163 Bacteria 305411
330 Ga0070715_10008181 3300006163 Bacteria 3635
331 Ga0070716_100000001 3300006173 Bacteria 400668
332 Ga0070716_100016262 3300006173 Bacteria 3835
333 Ga0070716_100078093 3300006173 Bacteria 1967
334 Ga0070712_100057382 3300006175 Bacteria 2735
335 Ga0070712_100070105 3300006175 Bacteria 2503
336 Ga0070712_100098110 3300006175 Bacteria 2161
337 Ga0097621_100014975 3300006237 Bacteria 5822
338 Ga0097621_100027916 3300006237 Bacteria 4444
339 Ga0097621_100058683 3300006237 Bacteria 3149
340 Ga0097621_100141393 3300006237 Bacteria 2057
341 Ga0068871_100014714 3300006358 Bacteria 5839
342 Ga0068871_100015984 3300006358 Bacteria 5637
343 Ga0075428_100000322 3300006844 Bacteria 47435
344 Ga0075428_100099532 3300006844 Bacteria 3170
345 Ga0075428_100128785 3300006844 Bacteria 2753
346 Ga0075428_100139961 3300006844 Archaea 2631
347 Ga0075428_100153120 3300006844 Unclassified 2505
348 Ga0075428_100179649 3300006844 Bacteria 2291
349 Ga0075428_100278170 3300006844 Bacteria 1801
350 Ga0075428_100294492 3300006844 Bacteria 1745
351 Ga0075428_100345217 3300006844 Bacteria 1598
352 Ga0075428_100493664 3300006844 Bacteria 1310
353 Ga0075430_100004678 3300006846 Bacteria 11505
354 Ga0075430_100081711 3300006846 Bacteria 2707
355 Ga0075430_100185324 3300006846 Bacteria 1731
356 Ga0075430_100320474 3300006846 Bacteria 1281
357 Ga0075431_100001136 3300006847 Bacteria 23886
358 Ga0075431_100075968 3300006847 Bacteria 3467
359 Ga0075431_100126116 3300006847 Bacteria 2641
360 Ga0075433_10000891 3300006852 Bacteria 21039
361 Ga0075433_10008768 3300006852 Bacteria 8069
362 Ga0075433_10034286 3300006852 Bacteria 4358
363 Ga0075433_10052347 3300006852 Bacteria 3557
364 Ga0075433_10079506 3300006852 Bacteria 2889
365 Ga0075433_10084269 3300006852 Unclassified 2806
366 Ga0075433_10126500 3300006852 Bacteria 2270
367 Ga0075433_10164936 3300006852 Bacteria 1972
368 Ga0075433_10167561 3300006852 Bacteria 1955
369 Ga0075433_10194447 3300006852 Bacteria 1804
370 Ga0075433_10254627 3300006852 Bacteria 1557
371 Ga0075433_10256779 3300006852 Bacteria 1550
372 Ga0075434_100019499 3300006871 Bacteria 6565
373 Ga0075434_100111499 3300006871 Bacteria 2746
374 Ga0075434_100132926 3300006871 Bacteria 2508
375 Ga0075434_100142884 3300006871 Bacteria 2413
376 Ga0075434_100157688 3300006871 Bacteria 2289
377 Ga0075434_100188085 3300006871 Bacteria 2085
378 Ga0075429_100000373 3300006880 Bacteria 33080
379 Ga0075429_100003706 3300006880 Bacteria 13021
380 Ga0075429_100081403 3300006880 Bacteria 2823
381 Ga0075429_100100957 3300006880 Bacteria 2519
382 Ga0075429_100101308 3300006880 Bacteria 2514
383 Ga0068865_100000700 3300006881 Bacteria 18849
384 Ga0068865_100067469 3300006881 Bacteria 2527
385 Ga0068865_100134818 3300006881 Unclassified 1854
386 Ga0075436_100000014 3300006914 Bacteria 175616
387 Ga0075436_100000056 3300006914 Bacteria 65961
388 Ga0075436_100000288 3300006914 Bacteria 31977
389 Ga0075436_100070770 3300006914 Bacteria 2411
390 Ga0097620_100008065 3300006931 Bacteria 10677
391 Ga0097620_100008330 3300006931 Bacteria 10507
392 Ga0097620_100020509 3300006931 Bacteria 6633
393 Ga0097620_100030082 3300006931 Bacteria 5448
394 Ga0097620_100039360 3300006931 Bacteria 4743
395 Ga0097620_100091520 3300006931 Bacteria 3092
396 Ga0097620_100113521 3300006931 Bacteria 2773
397 Ga0097620_100121415 3300006931 Unclassified 2679
398 Ga0097620_100122741 3300006931 Bacteria 2664
399 Ga0097620_100154707 3300006931 Bacteria 2370
400 Ga0097620_100178860 3300006931 Bacteria 2203
401 Ga0097620_100246013 3300006931 Bacteria 1878
402 Ga0097620_100281538 3300006931 Bacteria 1756
403 Ga0075435_100000374 3300007076 Bacteria 27376
404 Ga0075435_100018572 3300007076 Bacteria 5293
405 Ga0075435_100021667 3300007076 Bacteria 4946
406 Ga0075435_100075391 3300007076 Bacteria 2762
407 Ga0075435_100131421 3300007076 Bacteria 2095
408 Ga0105250_10000010 3300009092 Bacteria 298384
409 Ga0105240_10000634 3300009093 Bacteria 64881
410 Ga0105240_10004000 3300009093 Bacteria 22715
411 Ga0105240_10004276 3300009093 Bacteria 21816
412 Ga0105240_10010103 3300009093 Bacteria 13283
413 Ga0105240_10043674 3300009093 Bacteria 5701
414 Ga0105240_10332473 3300009093 Bacteria 1728
415 Ga0105240_10367892 3300009093 Bacteria 1627
416 Ga0111539_10003889 3300009094 Bacteria 19651
417 Ga0111539_10027693 3300009094 Bacteria 6923
418 Ga0111539_10046775 3300009094 Bacteria 5175
419 Ga0111539_10055362 3300009094 Bacteria 4715
420 Ga0111539_10075377 3300009094 Bacteria 3974
421 Ga0111539_10091032 3300009094 Bacteria 3584
422 Ga0111539_10141258 3300009094 Bacteria 2819
423 Ga0111539_10152458 3300009094 Bacteria 2705
424 Ga0111539_10156316 3300009094 Bacteria 2668
425 Ga0111539_10218135 3300009094 Bacteria 2222
426 Ga0111539_10253587 3300009094 Bacteria 2049
427 Ga0111539_10461143 3300009094 Bacteria 1480
428 Ga0105245_10017231 3300009098 Bacteria 6303
429 Ga0105245_10027885 3300009098 Bacteria 4977
430 Ga0105245_10030974 3300009098 Bacteria 4732
431 Ga0105247_10000005 3300009101 Bacteria 426989
432 Ga0105247_10008389 3300009101 Bacteria 6299
433 Ga0105247_10010150 3300009101 Bacteria 5705
434 Ga0114129_10002882 3300009147 Bacteria 24082
435 Ga0114129_10017260 3300009147 Bacteria 10279
436 Ga0114129_10035939 3300009147 Bacteria 6996
437 Ga0114129_10054153 3300009147 Bacteria 5626
438 Ga0114129_10114661 3300009147 Bacteria 3715
439 Ga0114129_10117141 3300009147 Bacteria 3671
440 Ga0114129_10256691 3300009147 Unclassified 2345
441 Ga0114129_10629891 3300009147 Bacteria 1386
442 Ga0114129_10636715 3300009147 Bacteria 1378
443 Ga0105243_10000096 3300009148 Bacteria 100257
444 Ga0105243_10001117 3300009148 Bacteria 24373
445 Ga0105243_10054626 3300009148 Bacteria 3172
446 Ga0105243_10112927 3300009148 Bacteria 2277
447 Ga0105243_10200116 3300009148 Bacteria 1751
448 Ga0105241_10001699 3300009174 Bacteria 16737
449 Ga0105241_10013953 3300009174 Bacteria 5889
450 Ga0105241_10246968 3300009174 Bacteria 1511
451 Ga0105241_10376150 3300009174 Bacteria 1240
452 Ga0105242_10000144 3300009176 Bacteria 51877
453 Ga0105242_10002520 3300009176 Bacteria 14373
454 Ga0105242_10003617 3300009176 Bacteria 12028
455 Ga0105242_10019143 3300009176 Bacteria 5363
456 Ga0105242_10019466 3300009176 Bacteria 5319
457 Ga0105242_10057550 3300009176 Unclassified 3184
458 Ga0105248_10005185 3300009177 Bacteria 14364
459 Ga0105248_10008038 3300009177 Bacteria 11582
460 Ga0105248_10008890 3300009177 Bacteria 11040
461 Ga0105248_10035814 3300009177 Bacteria 5551
462 Ga0105248_10048201 3300009177 Bacteria 4779
463 Ga0105248_10081802 3300009177 Bacteria 3630
464 Ga0105248_10091920 3300009177 Bacteria 3417
465 Ga0105248_10112691 3300009177 Bacteria 3068
466 Ga0105248_10136152 3300009177 Bacteria 2770
467 Ga0105248_10268124 3300009177 Bacteria 1922
468 Ga0105248_10296529 3300009177 Bacteria 1821
469 Ga0105248_10348496 3300009177 Bacteria 1667
470 Ga0105237_10001199 3300009545 Bacteria 34703
471 Ga0105237_10016045 3300009545 Bacteria 7789
472 Ga0105237_10349295 3300009545 Unclassified 1483
473 Ga0105238_10027477 3300009551 Bacteria 5800
474 Ga0105238_10047659 3300009551 Bacteria 4320
475 Ga0105238_10067778 3300009551 Bacteria 3569
476 Ga0105238_10081087 3300009551 Bacteria 3234
477 Ga0105238_10121765 3300009551 Bacteria 2588
478 Ga0105249_10000030 3300009553 Bacteria 221992
479 Ga0105249_10017932 3300009553 Bacteria 6291
480 Ga0105249_10022509 3300009553 Bacteria 5645
481 Ga0105249_10257579 3300009553 Bacteria 1732
482 Ga0099796_10014196 3300010159 Bacteria 2295
483 Ga0105239_10031977 3300010375 Bacteria 5782
484 Ga0105239_10059802 3300010375 Bacteria 4181
485 Ga0105239_10113457 3300010375 Bacteria 3005
486 Ga0105246_10002825 3300011119 Bacteria 10521
487 Ga0105246_10023381 3300011119 Bacteria 3998
488 Ga0105246_10043902 3300011119 Bacteria 3035
489 Ga0105246_10091093 3300011119 Bacteria 2197
490 Ga0157373_10040544 3300013100 Bacteria 3332
491 Ga0157373_10143903 3300013100 Bacteria 1676
492 Ga0157370_10003442 3300013104 Bacteria 18575
493 Ga0157370_10038185 3300013104 Bacteria 4646
494 Ga0157369_10115198 3300013105 Bacteria 2855
495 Ga0157369_10240203 3300013105 Bacteria 1892
496 Ga0157374_10039178 3300013296 Bacteria 4361
497 Ga0157374_10120879 3300013296 Bacteria 2528
498 Ga0157374_10174658 3300013296 Bacteria 2097
499 Ga0157378_10000067 3300013297 Bacteria 92867
500 Ga0157378_10004788 3300013297 Bacteria 11861
501 Ga0157378_10006510 3300013297 Bacteria 10209
502 Ga0157378_10017860 3300013297 Bacteria 6227
503 Ga0157378_10026678 3300013297 Bacteria 5092
504 Ga0157378_10044845 3300013297 Unclassified 3927
505 Ga0157378_10067368 3300013297 Bacteria 3208
506 Ga0157378_10083500 3300013297 Bacteria 2891
507 Ga0157378_10126085 3300013297 Bacteria 2365
508 Ga0157378_10137276 3300013297 Bacteria 2268
509 Ga0163162_10000002 3300013306 Bacteria 717331
510 Ga0163162_10017095 3300013306 Bacteria 7097
511 Ga0163162_10025359 3300013306 Bacteria 5858
512 Ga0163162_10029444 3300013306 Bacteria 5434
513 Ga0163162_10034870 3300013306 Bacteria 5009
514 Ga0163162_10052877 3300013306 Bacteria 4081
515 Ga0163162_10097787 3300013306 Bacteria 3024
516 Ga0163162_10219820 3300013306 Unclassified 2030
517 Ga0163162_10227389 3300013306 Bacteria 1996
518 Ga0157372_10249624 3300013307 Bacteria 2060
519 Ga0157372_10339886 3300013307 Bacteria 1749
520 Ga0157375_10009948 3300013308 Bacteria 8364
521 Ga0157375_10011069 3300013308 Bacteria 7955
522 Ga0157375_10015644 3300013308 Bacteria 6797
523 Ga0157375_10029880 3300013308 Bacteria 5131
524 Ga0157375_10043750 3300013308 Bacteria 4345
525 Ga0157375_10045027 3300013308 Bacteria 4293
526 Ga0157375_10382297 3300013308 Bacteria 1574
527 Ga0163163_10001068 3300014325 Bacteria 23309
528 Ga0163163_10015177 3300014325 Bacteria 7113
529 Ga0163163_10015381 3300014325 Bacteria 7073
530 Ga0163163_10017063 3300014325 Bacteria 6762
531 Ga0163163_10018114 3300014325 Bacteria 6582
532 Ga0163163_10040672 3300014325 Bacteria 4541
533 Ga0163163_10048713 3300014325 Bacteria 4168
534 Ga0163163_10083032 3300014325 Unclassified 3208
535 Ga0163163_10112525 3300014325 Bacteria 2751
536 Ga0163163_10113575 3300014325 Bacteria 2739
537 Ga0163163_10149487 3300014325 Bacteria 2380
538 Ga0163163_10188023 3300014325 Bacteria 2113
539 Ga0163163_10205376 3300014325 Bacteria 2018
540 Ga0163163_10210045 3300014325 Bacteria 1996
541 Ga0163163_10324857 3300014325 Unclassified 1592
542 Ga0157380_10001283 3300014326 Bacteria 16336
543 Ga0157380_10002163 3300014326 Bacteria 13188
544 Ga0157380_10004962 3300014326 Bacteria 9272
545 Ga0157380_10041820 3300014326 Bacteria 3579
546 Ga0157380_10045507 3300014326 Bacteria 3444
547 Ga0157380_10100629 3300014326 Bacteria 2407
548 Ga0157380_10108418 3300014326 Bacteria 2328
549 Ga0157380_10111136 3300014326 Bacteria 2303
550 Ga0157380_10196585 3300014326 Bacteria 1785
551 Ga0157377_10007351 3300014745 Bacteria 5316
552 Ga0157377_10033711 3300014745 Bacteria 2797
553 Ga0157379_10000022 3300014968 Bacteria 90949
554 Ga0157379_10014463 3300014968 Bacteria 6925
555 Ga0157379_10054385 3300014968 Unclassified 3577
556 Ga0157379_10108065 3300014968 Bacteria 2497
557 Ga0157379_10241506 3300014968 Bacteria 1638
558 Ga0157376_10008947 3300014969 Bacteria 7252
559 Ga0163161_10001473 3300017792 Bacteria 17427
560 Ga0163161_10006579 3300017792 Bacteria 8047
561 Ga0163161_10046087 3300017792 Bacteria 3145
562 Ga0213876_10000035 3300021384 Bacteria 186618
563 Ga0213876_10000757 3300021384 Bacteria 22341
564 Ga0213871_10002005 3300021441 Bacteria 3633
565 Ga0207656_10009056 3300025321 Bacteria 3689
566 Ga0207696_1000159 3300025711 Bacteria 111473
567 Ga0207653_10000076 3300025885 Bacteria 72786
568 Ga0207653_10000160 3300025885 Bacteria 47834
569 Ga0207653_10000499 3300025885 Bacteria 15201
570 Ga0207642_10000156 3300025899 Bacteria 19519
571 Ga0207710_10000004 3300025900 Bacteria 846540
572 Ga0207710_10002140 3300025900 Bacteria 9317
573 Ga0207710_10011490 3300025900 Bacteria 3728
574 Ga0207680_10038391 3300025903 Bacteria 2772
575 Ga0207647_10013771 3300025904 Bacteria 5601
576 Ga0207685_10000004 3300025905 Bacteria 305368
577 Ga0207685_10017656 3300025905 Bacteria 2313
578 Ga0207699_10000004 3300025906 Bacteria 567333
579 Ga0207699_10000010 3300025906 Bacteria 295869
580 Ga0207645_10001746 3300025907 Bacteria 17643
581 Ga0207645_10026939 3300025907 Bacteria 3714
582 Ga0207643_10095247 3300025908 Bacteria 1739
583 Ga0207705_10015184 3300025909 Bacteria 5534
584 Ga0207684_10000150 3300025910 Bacteria 121849
585 Ga0207684_10000288 3300025910 Bacteria 72265
586 Ga0207684_10022217 3300025910 Bacteria 5418
587 Ga0207684_10029291 3300025910 Bacteria 4691
588 Ga0207684_10042906 3300025910 Bacteria 3834
589 Ga0207684_10090143 3300025910 Bacteria 2613
590 Ga0207684_10121761 3300025910 Bacteria 2237
591 Ga0207684_10264563 3300025910 Bacteria 1484
592 Ga0207707_10000016 3300025912 Bacteria 256002
593 Ga0207707_10001408 3300025912 Bacteria 22278
594 Ga0207707_10003634 3300025912 Bacteria 13675
595 Ga0207707_10005987 3300025912 Bacteria 10642
596 Ga0207707_10006951 3300025912 Bacteria 9868
597 Ga0207707_10007334 3300025912 Bacteria 9605
598 Ga0207707_10012355 3300025912 Bacteria 7421
599 Ga0207707_10085096 3300025912 Bacteria 2762
600 Ga0207707_10123926 3300025912 Bacteria 2260
601 Ga0207707_10159067 3300025912 Bacteria 1975
602 Ga0207695_10007063 3300025913 Bacteria 14401
603 Ga0207695_10016534 3300025913 Bacteria 8625
604 Ga0207695_10105332 3300025913 Bacteria 2808
605 Ga0207695_10127358 3300025913 Unclassified 2507
606 Ga0207695_10129132 3300025913 Bacteria 2486
607 Ga0207671_10066492 3300025914 Bacteria 2683
608 Ga0207671_10140751 3300025914 Bacteria 1859
609 Ga0207693_10199374 3300025915 Bacteria 1574
610 Ga0207663_10000008 3300025916 Bacteria 205803
611 Ga0207663_10115420 3300025916 Unclassified 1829
612 Ga0207660_10000340 3300025917 Bacteria 30175
613 Ga0207660_10242780 3300025917 Bacteria 1419
614 Ga0207662_10124642 3300025918 Bacteria 1619
615 Ga0207657_10057806 3300025919 Unclassified 3341
616 Ga0207652_10000693 3300025921 Bacteria 32703
617 Ga0207652_10003570 3300025921 Bacteria 12828
618 Ga0207652_10018001 3300025921 Bacteria 5789
619 Ga0207646_10000308 3300025922 Bacteria 66466
620 Ga0207646_10008373 3300025922 Bacteria 10372
621 Ga0207646_10009809 3300025922 Bacteria 9428
622 Ga0207646_10022917 3300025922 Bacteria 5740
623 Ga0207646_10047961 3300025922 Bacteria 3829
624 Ga0207646_10084461 3300025922 Bacteria 2841
625 Ga0207681_10000018 3300025923 Bacteria 278874
626 Ga0207681_10000223 3300025923 Bacteria 44869
627 Ga0207681_10240153 3300025923 Bacteria 1410
628 Ga0207694_10018447 3300025924 Bacteria 5273
629 Ga0207694_10102250 3300025924 Bacteria 2272
630 Ga0207694_10106353 3300025924 Bacteria 2228
631 Ga0207650_10000011 3300025925 Bacteria 450115
632 Ga0207650_10001109 3300025925 Bacteria 19799
633 Ga0207650_10101597 3300025925 Bacteria 2214
634 Ga0207650_10113307 3300025925 Bacteria 2102
635 Ga0207650_10227824 3300025925 Bacteria 1502
636 Ga0207687_10014033 3300025927 Bacteria 5238
637 Ga0207687_10015672 3300025927 Bacteria 4974
638 Ga0207700_10016955 3300025928 Bacteria 4851
639 Ga0207700_10100876 3300025928 Bacteria 2302
640 Ga0207644_10009195 3300025931 Bacteria 6481
641 Ga0207644_10021675 3300025931 Bacteria 4381
642 Ga0207644_10022158 3300025931 Bacteria 4337
643 Ga0207644_10033313 3300025931 Bacteria 3599
644 Ga0207644_10078046 3300025931 Bacteria 2440
645 Ga0207644_10094299 3300025931 Bacteria 2236
646 Ga0207706_10000059 3300025933 Bacteria 111765
647 Ga0207706_10023543 3300025933 Bacteria 5529
648 Ga0207706_10025610 3300025933 Bacteria 5284
649 Ga0207706_10033316 3300025933 Bacteria 4587
650 Ga0207706_10057909 3300025933 Bacteria 3413
651 Ga0207706_10064918 3300025933 Bacteria 3214
652 Ga0207706_10126713 3300025933 Unclassified 2245
653 Ga0207686_10000026 3300025934 Bacteria 169189
654 Ga0207686_10000232 3300025934 Bacteria 42385
655 Ga0207686_10000670 3300025934 Bacteria 21185
656 Ga0207709_10000142 3300025935 Bacteria 100236
657 Ga0207709_10002635 3300025935 Bacteria 11156
658 Ga0207670_10001618 3300025936 Bacteria 11749
659 Ga0207670_10045827 3300025936 Bacteria 2901
660 Ga0207670_10093712 3300025936 Bacteria 2129
661 Ga0207670_10153642 3300025936 Bacteria 1710
662 Ga0207669_10015543 3300025937 Bacteria 3841
663 Ga0207669_10088957 3300025937 Bacteria 2004
664 Ga0207704_10131843 3300025938 Bacteria 1732
665 Ga0207665_10000002 3300025939 Bacteria 267895
666 Ga0207665_10041194 3300025939 Bacteria 3083
667 Ga0207665_10066169 3300025939 Bacteria 2459
668 Ga0207665_10085507 3300025939 Bacteria 2178
669 Ga0207665_10092033 3300025939 Bacteria 2103
670 Ga0207691_10025720 3300025940 Bacteria 5524
671 Ga0207691_10091178 3300025940 Bacteria 2731
672 Ga0207691_10218954 3300025940 Bacteria 1651
673 Ga0207711_10004285 3300025941 Bacteria 12188
674 Ga0207711_10007598 3300025941 Bacteria 9067
675 Ga0207711_10031861 3300025941 Bacteria 4455
676 Ga0207711_10046394 3300025941 Bacteria 3712
677 Ga0207711_10151653 3300025941 Bacteria 2092
678 Ga0207689_10004907 3300025942 Bacteria 12050
679 Ga0207689_10005683 3300025942 Bacteria 11097
680 Ga0207689_10066333 3300025942 Bacteria 2968
681 Ga0207689_10164544 3300025942 Unclassified 1828
682 Ga0207661_10033046 3300025944 Bacteria 4013
683 Ga0207661_10187605 3300025944 Bacteria 1811
684 Ga0207661_10212873 3300025944 Bacteria 1704
685 Ga0207679_10057672 3300025945 Bacteria 2873
686 Ga0207679_10060339 3300025945 Bacteria 2818
687 Ga0207679_10067688 3300025945 Bacteria 2680
688 Ga0207667_10008239 3300025949 Bacteria 12405
689 Ga0207667_10037104 3300025949 Bacteria 5213
690 Ga0207667_10079952 3300025949 Bacteria 3388
691 Ga0207667_10094332 3300025949 Unclassified 3089
692 Ga0207667_10214491 3300025949 Bacteria 1973
693 Ga0207651_10044685 3300025960 Unclassified 2967
694 Ga0207651_10068235 3300025960 Bacteria 2506
695 Ga0207651_10116747 3300025960 Bacteria 2015
696 Ga0207712_10000041 3300025961 Bacteria 180000
697 Ga0207712_10003122 3300025961 Bacteria 10567
698 Ga0207712_10004676 3300025961 Bacteria 8656
699 Ga0207712_10016542 3300025961 Bacteria 4780
700 Ga0207712_10026534 3300025961 Bacteria 3860
701 Ga0207712_10041649 3300025961 Unclassified 3157
702 Ga0207712_10177969 3300025961 Bacteria 1668
703 Ga0207668_10000297 3300025972 Bacteria 32617
704 Ga0207668_10169230 3300025972 Bacteria 1712
705 Ga0207640_10023943 3300025981 Bacteria 3677
706 Ga0207640_10130695 3300025981 Bacteria 1815
707 Ga0207658_10078550 3300025986 Unclassified 2522
708 Ga0207677_10067703 3300026023 Bacteria 2502
709 Ga0207677_10159784 3300026023 Unclassified 1749
710 Ga0207677_10217837 3300026023 Bacteria 1529
711 Ga0207703_10000486 3300026035 Bacteria 41391
712 Ga0207703_10077537 3300026035 Bacteria 2759
713 Ga0207703_10079553 3300026035 Bacteria 2728
714 Ga0207703_10102792 3300026035 Bacteria 2425
715 Ga0207703_10115222 3300026035 Bacteria 2299
716 Ga0207703_10162541 3300026035 Bacteria 1957
717 Ga0207703_10162554 3300026035 Bacteria 1957
718 Ga0207703_10199338 3300026035 Bacteria 1778
719 Ga0207703_10365743 3300026035 Unclassified 1331
720 Ga0207639_10017809 3300026041 Bacteria 5038
721 Ga0207639_10031771 3300026041 Bacteria 3882
722 Ga0207678_10032125 3300026067 Bacteria 4576
723 Ga0207678_10105622 3300026067 Bacteria 2403
724 Ga0207678_10189771 3300026067 Bacteria 1756
725 Ga0207708_10000136 3300026075 Bacteria 57790
726 Ga0207708_10005102 3300026075 Bacteria 9689
727 Ga0207708_10023267 3300026075 Bacteria 4681
728 Ga0207708_10040750 3300026075 Bacteria 3541
729 Ga0207708_10050641 3300026075 Unclassified 3162
730 Ga0207708_10071985 3300026075 Bacteria 2649
731 Ga0207708_10179265 3300026075 Unclassified 1682
732 Ga0207708_10190478 3300026075 Bacteria 1632
733 Ga0207708_10206527 3300026075 Bacteria 1569
734 Ga0207702_10246641 3300026078 Bacteria 1675
735 Ga0207702_10253556 3300026078 Bacteria 1653
736 Ga0207702_10397112 3300026078 Bacteria 1329
737 Ga0207641_10063252 3300026088 Bacteria 3161
738 Ga0207641_10070462 3300026088 Bacteria 3004
739 Ga0207641_10126487 3300026088 Bacteria 2289
740 Ga0207641_10135940 3300026088 Bacteria 2212
741 Ga0207641_10221210 3300026088 Bacteria 1756
742 Ga0207641_10230880 3300026088 Bacteria 1720
743 Ga0207641_10239090 3300026088 Bacteria 1691
744 Ga0207648_10000052 3300026089 Bacteria 107551
745 Ga0207648_10004466 3300026089 Bacteria 14352
746 Ga0207648_10176029 3300026089 Unclassified 1892
747 Ga0207676_10005309 3300026095 Bacteria 9127
748 Ga0207676_10020512 3300026095 Bacteria 4836
749 Ga0207676_10059708 3300026095 Bacteria 3013
750 Ga0207676_10085837 3300026095 Bacteria 2569
751 Ga0207676_10095344 3300026095 Bacteria 2453
752 Ga0207676_10169846 3300026095 Bacteria 1899
753 Ga0207676_10198923 3300026095 Bacteria 1769
754 Ga0207676_10303045 3300026095 Unclassified 1460
755 Ga0207676_10343900 3300026095 Bacteria 1377
756 Ga0207676_10393246 3300026095 Bacteria 1294
757 Ga0207674_10000108 3300026116 Bacteria 95567
758 Ga0207674_10018906 3300026116 Bacteria 7470
759 Ga0207674_10025284 3300026116 Bacteria 6336
760 Ga0207674_10078111 3300026116 Unclassified 3315
761 Ga0207674_10104321 3300026116 Bacteria 2813
762 Ga0207674_10105413 3300026116 Bacteria 2797
763 Ga0207674_10210990 3300026116 Bacteria 1891
764 Ga0207675_100001980 3300026118 Bacteria 20425
765 Ga0207675_100003639 3300026118 Bacteria 15026
766 Ga0207675_100014952 3300026118 Bacteria 7244
767 Ga0207675_100021233 3300026118 Bacteria 6048
768 Ga0207675_100128081 3300026118 Bacteria 2406
769 Ga0207675_100173037 3300026118 Bacteria 2065
770 Ga0207683_10013853 3300026121 Bacteria 6876
771 Ga0207698_10085793 3300026142 Bacteria 2558
772 Ga0207698_10145772 3300026142 Bacteria 2047
773 Ga0209966_1011624 3300027695 Bacteria 1608
774 Ga0209998_10012992 3300027717 Bacteria 1730
775 Ga0207428_10082286 3300027907 Bacteria 2512
776 Ga0265356_1001008 3300028017 Bacteria 4474
777 Ga0268266_10000589 3300028379 Bacteria 50116
778 Ga0268266_10000738 3300028379 Bacteria 43706
779 Ga0268266_10005951 3300028379 Bacteria 11277
780 Ga0268266_10211361 3300028379 Bacteria 1779
781 Ga0268265_10000115 3300028380 Bacteria 100719
782 Ga0268265_10011876 3300028380 Bacteria 5889
783 Ga0268265_10018832 3300028380 Bacteria 4790
784 Ga0268265_10073239 3300028380 Bacteria 2675
785 Ga0268265_10119862 3300028380 Bacteria 2166
786 Ga0268265_10125225 3300028380 Bacteria 2125
787 Ga0268265_10128929 3300028380 Bacteria 2098
788 Ga0268265_10145408 3300028380 Bacteria 1991
789 Ga0268265_10268411 3300028380 Bacteria 1521
790 Ga0268264_10015822 3300028381 Bacteria 6177
791 Ga0268264_10022913 3300028381 Bacteria 5096
792 Ga0268264_10030618 3300028381 Bacteria 4411
793 Ga0268264_10049017 3300028381 Bacteria 3513
794 Ga0268264_10100665 3300028381 Bacteria 2510
795 Ga0268264_10130147 3300028381 Bacteria 2229
796 Ga0268264_10164785 3300028381 Bacteria 2000
797 Ga0268264_10214191 3300028381 Bacteria 1770
798 Ga0265319_1004543 3300028563 Bacteria 6843
799 Ga0265319_1023238 3300028563 Bacteria 2248
800 Ga0265338_10012971 3300028800 Bacteria 9461
801 Ga0265338_10029990 3300028800 Bacteria 5376
802 Ga0265770_1000295 3300030878 Bacteria 6747
803 Ga0265760_10002069 3300031090 Bacteria 5907
804 Ga0265340_10054820 3300031247 Bacteria 1922
805 Ga0265327_10012430 3300031251 Bacteria 5748
806 Ga0307513_10002818 3300031456 Bacteria 23847
807 Ga0307408_100000881 3300031548 Bacteria 23605
808 Ga0307408_100025335 3300031548 Bacteria 4062
809 Ga0307408_100039414 3300031548 Bacteria 3340
810 Ga0307408_100079697 3300031548 Bacteria 2444
811 Ga0307408_100084392 3300031548 Bacteria 2382
812 Ga0307408_100169364 3300031548 Bacteria 1743
813 Ga0307508_10049515 3300031616 Bacteria 3742
814 Ga0316575_10019556 3300031665 Bacteria 2591
815 Ga0316579_10050024 3300031691 Bacteria 1954
816 Ga0316576_10115620 3300031727 Bacteria 2013
817 Ga0316576_10264041 3300031727 Bacteria 1291
818 Ga0316578_10011646 3300031728 Bacteria 4610
819 Ga0316578_10014865 3300031728 Bacteria 4172
820 Ga0307516_10003296 3300031730 Bacteria 20894
821 Ga0307405_10001196 3300031731 Bacteria 10737
822 Ga0307405_10010376 3300031731 Bacteria 4823
823 Ga0307405_10015407 3300031731 Bacteria 4142
824 Ga0307405_10077203 3300031731 Bacteria 2164
825 Ga0316577_10084717 3300031733 Bacteria 1773
826 Ga0307413_10000802 3300031824 Bacteria 10939
827 Ga0307413_10035152 3300031824 Bacteria 2871
828 Ga0307413_10104258 3300031824 Unclassified 1882
829 Ga0307410_10013418 3300031852 Bacteria 4780
830 Ga0307410_10015322 3300031852 Bacteria 4544
831 Ga0307410_10031892 3300031852 Bacteria 3386
832 Ga0307410_10114631 3300031852 Bacteria 1955
833 Ga0307410_10188486 3300031852 Bacteria 1567
834 Ga0307406_10030868 3300031901 Bacteria 3258
835 Ga0307407_10001414 3300031903 Bacteria 8670
836 Ga0307407_10003794 3300031903 Bacteria 6289
837 Ga0307407_10017975 3300031903 Bacteria 3563
838 Ga0307407_10018810 3300031903 Unclassified 3503
839 Ga0307407_10136218 3300031903 Bacteria 1578
840 Ga0307412_10051247 3300031911 Bacteria 2727
841 Ga0307409_100013914 3300031995 Bacteria 5204
842 Ga0307409_100035668 3300031995 Bacteria 3647
843 Ga0307409_100038725 3300031995 Bacteria 3529
844 Ga0307409_100049438 3300031995 Bacteria 3206
845 Ga0307409_100096204 3300031995 Bacteria 2442
846 Ga0307409_100098226 3300031995 Bacteria 2421
847 Ga0307409_100129137 3300031995 Bacteria 2156
848 Ga0307416_100003783 3300032002 Bacteria 8980
849 Ga0307416_100023830 3300032002 Bacteria 4453
850 Ga0307416_100068708 3300032002 Bacteria 2929
851 Ga0307414_10002616 3300032004 Bacteria 9467
852 Ga0307414_10011273 3300032004 Bacteria 5234
853 Ga0307414_10029465 3300032004 Bacteria 3573
854 Ga0307414_10040990 3300032004 Bacteria 3132
855 Ga0307414_10041367 3300032004 Bacteria 3121
856 Ga0307414_10069261 3300032004 Bacteria 2536
857 Ga0307414_10292770 3300032004 Bacteria 1373
858 Ga0307411_10015713 3300032005 Bacteria 4261
859 Ga0307411_10049867 3300032005 Bacteria 2723
860 Ga0307411_10121577 3300032005 Bacteria 1890
861 Ga0307411_10278957 3300032005 Bacteria 1329
862 Ga0307415_100017136 3300032126 Bacteria 4337
863 Ga0307415_100024269 3300032126 Bacteria 3782
864 Ga0307415_100025642 3300032126 Bacteria 3704
865 Ga0307415_100029208 3300032126 Bacteria 3521
866 Ga0307415_100051077 3300032126 Bacteria 2804
867 Ga0307415_100144538 3300032126 Bacteria 1821
868 Ga0307415_100308813 3300032126 Bacteria 1313
869 Ga0307415_100327081 3300032126 Bacteria 1281
870 Ga0316580_10020786 3300032139 Bacteria 2022
871 Ga0373944_0029696 3300035089 Bacteria 1636
872 Ga0373949_0009454 3300035090 Bacteria 2136
873 Ga0373951_0003489 3300035091 Bacteria 3803
874 Ga0373955_0004354 3300035172 Bacteria 6261
875 Ga0373955_0041592 3300035172 Bacteria 2464
876 Ga0373942_0015334 3300035207 Bacteria 1866
877 Ga0373961_0000089 3300035241 Bacteria 49296
878 Ga0373961_0025315 3300035241 Unclassified 1612
879 Ga0316574_0095989 3300035398 Bacteria 1894
880 Ga0373931_0014697 3300035691 Bacteria 3832
881 Ga0373931_0075118 3300035691 Bacteria 1853
882 Ga0373935_0021715 3300035692 Bacteria 3931
883 Ga0373933_0018637 3300035724 Bacteria 3907
884 Ga0373933_0032440 3300035724 Bacteria 3036
885 Ga0373947_0025965 3300035725 Bacteria 3418
886 Ga0373937_0003412 3300036401 Bacteria 13335
887 Ga0373937_0069894 3300036401 Bacteria 3238
888 Ga0373937_0180653 3300036401 Unclassified 1981
889 Ga0373937_0268147 3300036401 Bacteria 1611
890 Ga0316582_0030921 3300036647 Bacteria 3267
891 Ga0316584_0000107 3300036712 Bacteria 34543
892 Ga0316584_0016094 3300036712 Bacteria 5358
893 Ga0316584_0050591 3300036712 Bacteria 3107
894 Ga0395900_0333564 3300037418 Unclassified 1494
895 Ga0395898_0002342 3300037466 Bacteria 22595
896 Ga0395898_0082595 3300037466 Bacteria 3097
897 Ga0395905_0011300 3300037471 Bacteria 8633
898 Ga0395905_0135118 3300037471 Bacteria 2320
899 Ga0395901_0109249 3300038443 Bacteria 2904
900 Ga0242420_017283 3300038996 Bacteria 1262
901 Ga0436365_0560037 3300039437 Bacteria 40140
902 Ga0436365_0574100 3300039437 Bacteria 186636
903 Ga0436365_1240077 3300039437 Bacteria 11182
904 Ga0436360_0779618 3300039438 Bacteria 6561
905 Ga0451791_1389195 3300041451 Bacteria 1531
906 Ga0451837_0148417 3300041494 Bacteria 1540
907 Ga0451841_0180974 3300041498 Bacteria 1350
908 Ga0451849_1552928 3300041505 Unclassified 1847
909 Ga0451851_0536537 3300041507 Bacteria 2777
910 Ga0451853_3596503 3300041512 Bacteria 2415
911 Ga0439446_0007471 3300042156 Bacteria 2875
912 Ga0451577_0000070 3300042876 Bacteria 238621
913 Ga0451577_0007964 3300042876 Bacteria 10348
914 Ga0451577_0087277 3300042876 Bacteria 2783
915 Ga0451577_0100330 3300042876 Bacteria 2586
916 Ga0451577_0168572 3300042876 Bacteria 1973
917 Ga0451577_0315986 3300042876 Bacteria 1416
918 Ga0451577_0361662 3300042876 Bacteria 1316
919 Ga0451577_0441354 3300042876 Bacteria 1182
920 Ga0466969_0022971 3300044656 Bacteria 3215
921 Ga0466966_0000214 3300044684 Bacteria 38731
922 Ga0466966_0064825 3300044684 Unclassified 2299
923 Ga0466961_0075509 3300044693 Bacteria 2136
924 Ga0453684_0001009 3300044712 Bacteria 91051
925 Ga0453684_0001823 3300044712 Bacteria 55993
926 Ga0453684_0003029 3300044712 Bacteria 39066
927 Ga0453684_0065194 3300044712 Bacteria 4646
928 Ga0466971_0000271 3300044719 Bacteria 19954
929 Ga0466959_0006185 3300045049 Bacteria 8272
930 Ga0466959_0091763 3300045049 Bacteria 2180
931 Ga0466959_0121417 3300045049 Unclassified 1857
932 Ga0451576_0006316 3300045051 Bacteria 14568
933 Ga0451576_0055561 3300045051 Bacteria 4141
934 Ga0451576_0080048 3300045051 Bacteria 3399
935 Ga0451576_0103405 3300045051 Bacteria 2963
936 Ga0451576_0113471 3300045051 Bacteria 2821
937 Ga0451576_0328968 3300045051 Bacteria 1599
938 Ga0466958_0046222 3300045836 Bacteria 2627
939 Ga0466958_0138930 3300045836 Bacteria 1529
940 Ga0495592_0049237 3300046454 Bacteria 3132
941 Ga0495650_0031792 3300046471 Bacteria 2370
942 Ga0495580_0107492 3300046472 Bacteria 1937
943 Ga0495582_0023393 3300046473 Bacteria 3380
944 Ga0495639_0019962 3300046475 Bacteria 2926
945 Ga0495662_0015260 3300046476 Bacteria 3733
946 Ga0495662_0079644 3300046476 Unclassified 1593
947 Ga0495618_0017642 3300046514 Bacteria 4379
948 Ga0495618_0051458 3300046514 Bacteria 2602
949 Ga0495628_0008816 3300046516 Bacteria 8632
950 Ga0495628_0057975 3300046516 Bacteria 3045
951 Ga0495630_0042713 3300046517 Bacteria 3385
952 Ga0495630_0097774 3300046517 Unclassified 2220
953 Ga0495630_0126675 3300046517 Bacteria 1938
954 Ga0495663_0000607 3300046525 Bacteria 12470
955 Ga0495666_0062925 3300046526 Bacteria 1771
956 Ga0495652_0038143 3300046529 Bacteria 4164
957 Ga0495586_0104360 3300046535 Bacteria 1575
958 Ga0495587_0024436 3300046536 Bacteria 3703
959 Ga0495598_0000020 3300046537 Bacteria 24699
960 Ga0495598_0027906 3300046537 Bacteria 1561
961 Ga0495621_0000177 3300046539 Bacteria 14531
962 Ga0495621_0031168 3300046539 Bacteria 1828
963 Ga0495645_0058538 3300046543 Bacteria 2795
964 Ga0495668_0001582 3300046616 Bacteria 21462
965 Ga0495634_0013645 3300046642 Bacteria 5869
966 Ga0495634_0142676 3300046642 Bacteria 1520
967 Ga0495659_0012373 3300046664 Bacteria 2762
968 Ga0495657_0119437 3300046675 Bacteria 1662
969 Ga0495599_0002951 3300046678 Bacteria 9897
970 Ga0495646_0027523 3300046680 Bacteria 3567
971 Ga0495658_0058458 3300046683 Bacteria 2206
972 Ga0495658_0090198 3300046683 Bacteria 1814
973 Ga0495624_0012863 3300046690 Bacteria 5712
974 Ga0495604_0138028 3300047317 Bacteria 1745
975 Ga0495674_0091294 3300047319 Bacteria 2601
976 Ga0495674_0255206 3300047319 Bacteria 1442
977 Ga0495672_0092196 3300047320 Unclassified 1661
978 Ga0495680_0028564 3300047322 Bacteria 4572
979 Ga0495602_0125162 3300048088 Bacteria 2060
980 Ga0496101_0024925 3300048904 Bacteria 4146
981 Ga0496101_0125196 3300048904 Bacteria 1947
982 Ga0496102_0011655 3300048905 Bacteria 7587
983 Ga0496102_0186607 3300048905 Bacteria 1954
984 Ga0496104_0017719 3300048907 Bacteria 6491
985 Ga0496104_0019967 3300048907 Bacteria 6136
986 Ga0496104_0025907 3300048907 Bacteria 5408
987 Ga0496104_0194574 3300048907 Bacteria 1940
988 Ga0496104_0257594 3300048907 Unclassified 1658
989 Ga0496105_0036438 3300048908 Bacteria 4052
990 Ga0496105_0072154 3300048908 Bacteria 2854
991 Ga0496105_0074777 3300048908 Bacteria 2799
992 Ga0496105_0146984 3300048908 Bacteria 1938
993 Ga0496106_0020548 3300048909 Bacteria 4902
994 Ga0496106_0021671 3300048909 Bacteria 4771
995 Ga0496106_0036945 3300048909 Bacteria 3653
996 Ga0496106_0214596 3300048909 Bacteria 1534
997 Ga0496107_0036452 3300048910 Bacteria 3528
998 Ga0496107_0234784 3300048910 Bacteria 1365
999 Ga0496107_0279814 3300048910 Bacteria 1242
1000 Ga0496108_0001174 3300048911 Bacteria 20423
1001 Ga0496108_0002629 3300048911 Bacteria 14390
1002 Ga0496108_0014287 3300048911 Bacteria 6479
1003 Ga0496108_0053828 3300048911 Bacteria 3376
1004 Ga0496108_0088225 3300048911 Bacteria 2635
1005 Ga0496108_0127870 3300048911 Bacteria 2182
1006 Ga0496109_0008286 3300048912 Bacteria 8824
1007 Ga0496109_0018708 3300048912 Bacteria 6090
1008 Ga0496109_0048891 3300048912 Bacteria 3848
1009 Ga0496109_0242854 3300048912 Unclassified 1695
1010 Ga0496109_0360555 3300048912 Bacteria 1373
1011 Ga0496110_0005400 3300048913 Bacteria 10020
1012 Ga0496110_0048978 3300048913 Bacteria 3705
1013 Ga0496110_0119780 3300048913 Bacteria 2371
1014 Ga0496110_0228911 3300048913 Bacteria 1690
1015 Ga0496111_0002035 3300048914 Bacteria 12035
1016 Ga0496111_0036160 3300048914 Bacteria 3531
1017 Ga0496112_0000393 3300048915 Bacteria 28527
1018 Ga0496112_0045636 3300048915 Bacteria 4296
1019 Ga0496112_0111166 3300048915 Bacteria 2710
1020 Ga0496112_0211449 3300048915 Bacteria 1897
1021 Ga0496112_0266828 3300048915 Bacteria 1661
1022 Ga0496112_0283535 3300048915 Bacteria 1603
1023 Ga0496113_0003534 3300048916 Bacteria 9379
1024 Ga0496113_0036655 3300048916 Bacteria 3594
1025 Ga0496113_0257721 3300048916 Bacteria 1393
1026 Ga0496114_0000025 3300048917 Bacteria 213656
1027 Ga0496114_0010422 3300048917 Bacteria 7394
1028 Ga0496114_0021828 3300048917 Bacteria 5211
1029 Ga0496114_0034690 3300048917 Bacteria 4163
1030 Ga0496114_0310238 3300048917 Bacteria 1393
1031 Ga0496115_0006586 3300048918 Bacteria 8513
1032 Ga0501291_008599 3300049514 Bacteria 1414
1033 Ga0501296_003974 3300049519 Bacteria 1597
1034 Ga0501296_006756 3300049519 Bacteria 1307
1035 Ga0501299_003152 3300049522 Bacteria 2365
1036 Ga0501034_0009358 3300049571 Bacteria 10266
1037 Ga0501034_0013257 3300049571 Bacteria 8491
1038 Ga0501034_0152386 3300049571 Bacteria 2287
1039 Ga0501038_0001788 3300049574 Bacteria 19956
1040 Ga0501039_0155425 3300049575 Bacteria 1797
1041 Ga0501039_0311870 3300049575 Bacteria 1237
1042 Ga0501040_0069638 3300049576 Bacteria 2427
1043 Ga0501040_0079064 3300049576 Bacteria 2276
1044 Ga0501040_0130551 3300049576 Bacteria 1766
1045 Ga0501041_0067616 3300049577 Bacteria 2190
1046 Ga0501042_0145980 3300049578 Unclassified 1706
1047 Ga0501046_0004345 3300049580 Bacteria 12903
1048 Ga0501046_0043068 3300049580 Unclassified 3596
1049 Ga0501046_0074636 3300049580 Bacteria 2631
1050 Ga0501046_0085296 3300049580 Bacteria 2435
1051 Ga0501047_0059929 3300049581 Bacteria 3675
1052 Ga0501047_0135899 3300049581 Bacteria 2339
1053 Ga0501048_0090928 3300049582 Unclassified 2153
1054 Ga0501067_0000373 3300049583 Bacteria 24396
1055 Ga0501067_0006399 3300049583 Bacteria 6523
1056 Ga0501067_0015845 3300049583 Bacteria 4169
1057 Ga0501067_0016404 3300049583 Bacteria 4092
1058 Ga0501067_0050906 3300049583 Bacteria 2296
1059 Ga0501068_0022799 3300049584 Bacteria 3665
1060 Ga0501068_0034070 3300049584 Bacteria 3035
1061 Ga0501068_0066596 3300049584 Bacteria 2194
1062 Ga0501069_0026518 3300049585 Bacteria 3173
1063 Ga0501069_0026736 3300049585 Bacteria 3160
1064 Ga0501069_0027986 3300049585 Bacteria 3089
1065 Ga0501069_0107070 3300049585 Bacteria 1590
1066 Ga0501070_0031972 3300049586 Bacteria 4407
1067 Ga0501070_0032397 3300049586 Bacteria 4373
1068 Ga0501070_0105958 3300049586 Bacteria 2324
1069 Ga0501071_0006278 3300049587 Bacteria 7711
1070 Ga0501071_0015327 3300049587 Bacteria 5260
1071 Ga0501071_0023799 3300049587 Bacteria 4280
1072 Ga0501071_0026053 3300049587 Bacteria 4101
1073 Ga0501071_0073577 3300049587 Unclassified 2493
1074 Ga0501072_0003659 3300049588 Bacteria 11582
1075 Ga0501072_0022208 3300049588 Bacteria 4923
1076 Ga0501072_0057322 3300049588 Bacteria 3069
1077 Ga0501073_0025880 3300049589 Bacteria 4203
1078 Ga0501073_0159953 3300049589 Bacteria 1561
1079 Ga0501074_0076769 3300049590 Bacteria 2397
1080 Ga0501074_0081575 3300049590 Bacteria 2319
1081 Ga0501074_0082341 3300049590 Bacteria 2308
1082 Ga0501075_0011505 3300049591 Bacteria 6264
1083 Ga0501075_0024437 3300049591 Bacteria 4432
1084 Ga0501075_0031561 3300049591 Unclassified 3933
1085 Ga0501075_0113825 3300049591 Bacteria 2057
1086 Ga0501075_0169165 3300049591 Bacteria 1667
1087 Ga0501075_0234248 3300049591 Bacteria 1400
1088 Ga0501076_0008713 3300049592 Bacteria 7449
1089 Ga0501076_0018058 3300049592 Bacteria 5369
1090 Ga0501076_0133586 3300049592 Bacteria 2014
1091 Ga0501076_0283528 3300049592 Bacteria 1357
1092 Ga0501077_0000392 3300049593 Bacteria 26339
1093 Ga0501077_0001037 3300049593 Bacteria 16792
1094 Ga0501077_0034028 3300049593 Bacteria 3243
1095 Ga0501077_0163861 3300049593 Unclassified 1412
1096 Ga0501207_002008 3300049654 Bacteria 2605
1097 Ga0501209_005168 3300049656 Bacteria 2333
1098 Ga0501223_008137 3300049663 Bacteria 2139
1099 Ga0501227_006258 3300049665 Bacteria 2559
1100 Ga0501230_008393 3300049667 Bacteria 1562
1101 Ga0501233_004903 3300049668 Bacteria 2474
1102 Ga0501233_016029 3300049668 Bacteria 1550
1103 Ga0501247_003007 3300049677 Bacteria 1788
1104 Ga0501249_001352 3300049679 Bacteria 5093
1105 Ga0501225_0018947 3300049705 Bacteria 1905
1106 Ga0501079_0044377 3300049741 Unclassified 3431
1107 Ga0501079_0056570 3300049741 Bacteria 3027
1108 Ga0501079_0058431 3300049741 Bacteria 2976
1109 Ga0501080_0003146 3300049742 Bacteria 14530
1110 Ga0501080_0003762 3300049742 Bacteria 13401
1111 Ga0501080_0003918 3300049742 Bacteria 13186
1112 Ga0501080_0020968 3300049742 Bacteria 6047
1113 Ga0501080_0028327 3300049742 Bacteria 5210
1114 Ga0501080_0167660 3300049742 Bacteria 2026
1115 Ga0501081_0032407 3300049743 Bacteria 3545
1116 Ga0501081_0047821 3300049743 Bacteria 2943
1117 Ga0501081_0138493 3300049743 Bacteria 1743
1118 Ga0501081_0268569 3300049743 Bacteria 1247
1119 Ga0501083_0002247 3300049744 Bacteria 13196
1120 Ga0501083_0033100 3300049744 Bacteria 3540
1121 Ga0501083_0070760 3300049744 Bacteria 2319
1122 Ga0501083_0108118 3300049744 Bacteria 1830
1123 Ga0501268_004575 3300049765 Bacteria 1955
1124 Ga0501035_0092648 3300049822 Bacteria 2659
1125 Ga0501044_0041174 3300049823 Bacteria 4810
1126 Ga0501045_0176067 3300049824 Bacteria 1594
1127 Ga0501045_0178121 3300049824 Bacteria 1584
1128 nmdc:mga05p37_112288_c1 3300050507 Bacteria 3351
1129 nmdc:mga05p37_114824_c1 3300050507 Bacteria 3310
1130 nmdc:mga05p37_122164_c1 3300050507 Bacteria 3198
1131 nmdc:mga05p37_13236_c1 3300050507 Bacteria 9876
1132 nmdc:mga05p37_150065_c1 3300050507 Bacteria 2852
1133 nmdc:mga05p37_204512_c1 3300050507 Bacteria 2389
1134 nmdc:mga05p37_241_c1 3300050507 Bacteria 55841
1135 nmdc:mga05p37_76478_c1 3300050507 Bacteria 4121
1136 nmdc:mga09592_47912_c1 3300050508 Bacteria 3602
1137 nmdc:mga09592_77534_c1 3300050508 Bacteria 2827
1138 nmdc:mga06r32_101650_c1 3300050510 Bacteria 2822
1139 nmdc:mga06r32_195476_c1 3300050510 Bacteria 2010
1140 nmdc:mga06r32_23270_c1 3300050510 Bacteria 5730
1141 nmdc:mga08y16_1265_c1 3300050511 Bacteria 25109
1142 nmdc:mga08y16_12852_c1 3300050511 Bacteria 8803
1143 nmdc:mga08y16_131167_c1 3300050511 Bacteria 2606
1144 nmdc:mga08y16_156815_c1 3300050511 Bacteria 2366
1145 nmdc:mga08y16_237571_c1 3300050511 Bacteria 1884
1146 nmdc:mga08y16_301427_c1 3300050511 Bacteria 1652
1147 nmdc:mga08y16_38670_c1 3300050511 Bacteria 5008
1148 nmdc:mga08y16_39083_c1 3300050511 Bacteria 4979
1149 nmdc:mga08y16_53115_c1 3300050511 Bacteria 4238
1150 nmdc:mga08y16_97464_c1 3300050511 Bacteria 3062
1151 nmdc:mga0n895_13695_c2 3300050512 Bacteria 4948
1152 nmdc:mga0n895_22958_c1 3300050512 Bacteria 5855
1153 nmdc:mga0n895_442796_c1 3300050512 Bacteria 1312
1154 nmdc:mga0n895_463057_c1 3300050512 Bacteria 1279
1155 nmdc:mga0n895_52831_c1 3300050512 Bacteria 3990
1156 nmdc:mga0n895_96649_c1 3300050512 Bacteria 2959
1157 nmdc:mga0rr50_140708_c1 3300050513 Bacteria 1941
1158 nmdc:mga0rr50_25582_c1 3300050513 Bacteria 4106
1159 nmdc:mga0rr50_5577_c1 3300050513 Bacteria 7528
1160 nmdc:mga0rr50_66772_c1 3300050513 Bacteria 2730
1161 nmdc:mga0rr50_97590_c1 3300050513 Bacteria 2301
1162 nmdc:mga08x19_11_c1 3300050514 Bacteria 403007
1163 nmdc:mga08x19_273_c1 3300050514 Bacteria 38978
1164 nmdc:mga08x19_48_c1 3300050514 Bacteria 141135
1165 nmdc:mga08x19_66331_c1 3300050514 Bacteria 2345
1166 nmdc:mga08x19_8848_c1 3300050514 Bacteria 6006
1167 nmdc:mga0a205_13956_c2 3300050515 Bacteria 6922
1168 nmdc:mga0a205_177069_c1 3300050515 Unclassified 2028
1169 nmdc:mga0a205_18501_c1 3300050515 Bacteria 6552
1170 nmdc:mga0a205_218560_c1 3300050515 Bacteria 1792
1171 nmdc:mga0a205_23514_c1 3300050515 Bacteria 5846
1172 nmdc:mga0a205_252764_c1 3300050515 Bacteria 1641
1173 nmdc:mga0a205_258624_c1 3300050515 Bacteria 1619
1174 nmdc:mga0a205_37715_c2 3300050515 Bacteria 2489
1175 nmdc:mga0a205_51170_c1 3300050515 Bacteria 3987
1176 nmdc:mga0a205_51646_c1 3300050515 Bacteria 3969
1177 nmdc:mga0a205_5_c1 3300050515 Bacteria 167503
1178 nmdc:mga0a205_82097_c1 3300050515 Bacteria 3113
1179 nmdc:mga0a205_83146_c1 3300050515 Bacteria 3092
1180 nmdc:mga0a205_85833_c1 3300050515 Bacteria 3040
1181 nmdc:mga0a205_95703_c1 3300050515 Bacteria 2868
1182 Ga0495601_0011177 3300053077 Bacteria 5362
1183 Ga0495612_0014064 3300053078 Bacteria 3223
1184 Ga0495612_0017087 3300053078 Bacteria 2906
1185 Ga0495619_0143771 3300053085 Bacteria 1644
1186 Ga0500641_0001840 3300053096 Bacteria 7527
1187 Ga0500577_0010739 3300053142 Unclassified 2708
1188 Ga0500604_0034182 3300053151 Bacteria 1507
1189 Ga0500616_0000096 3300053153 Bacteria 179125
1190 Ga0500616_0004019 3300053153 Bacteria 10716
1191 Ga0500622_0004549 3300053156 Bacteria 8646
1192 Ga0500622_0004862 3300053156 Bacteria 8229
1193 Ga0500637_0000662 3300053178 Bacteria 13655
1194 Ga0501084_0002798 3300054114 Bacteria 14094
1195 Ga0501084_0036304 3300054114 Bacteria 4117
1196 Ga0501084_0044700 3300054114 Unclassified 3708
1197 Ga0501084_0108028 3300054114 Bacteria 2337
1198 Ga0501084_0118759 3300054114 Bacteria 2223
1199 Ga0501084_0194259 3300054114 Bacteria 1712
1200 Ga0501082_0000153 3300060353 Bacteria 57979
1201 Ga0501082_0025606 3300060353 Bacteria 5083
1202 Ga0501082_0032602 3300060353 Bacteria 4494
1203 Ga0501082_0099110 3300060353 Bacteria 2519
1204 Ga0501082_0118265 3300060353 Bacteria 2296
1205 Ga0501082_0184646 3300060353 Bacteria 1814
1206 Ga0501082_0225712 3300060353 Bacteria 1630

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042876 Ga0451577_0168572 Ga0451577_0168572_807_1760 317
2 3300050511 nmdc:mga08y16_301427_c1 nmdc:mga08y16_301427_c1_26_1018 318
3 3300046517 Ga0495630_0097774 Ga0495630_0097774_1137_2126 323
4 3300053085 Ga0495619_0143771 Ga0495619_0143771_200_1189 323
5 3300049744 Ga0501083_0108118 Ga0501083_0108118_498_1556 329
6 3300005577 Ga0068857_100095018 Ga0068857_1000950183 338
7 3300026116 Ga0207674_10104321 Ga0207674_101043212 338
8 3300049823 Ga0501044_0041174 Ga0501044_0041174_3056_4216 340
9 3300005458 Ga0070681_10014914 Ga0070681_100149143 342
10 3300049575 Ga0501039_0311870 Ga0501039_0311870_11_1108 342
11 3300049582 Ga0501048_0090928 Ga0501048_0090928_1088_2116 342
12 3300049589 Ga0501073_0159953 Ga0501073_0159953_242_1339 342
13 3300049591 Ga0501075_0234248 Ga0501075_0234248_204_1301 342
14 3300049742 Ga0501080_0028327 Ga0501080_0028327_3528_4625 342
15 3300050512 nmdc:mga0n895_442796_c1 nmdc:mga0n895_442796_c1_117_1289 342
16 3300054114 Ga0501084_0194259 Ga0501084_0194259_68_1165 342
17 3300005834 Ga0068851_10000697 Ga0068851_100006978 343
18 3300025321 Ga0207656_10009056 Ga0207656_100090562 343
19 3300005536 Ga0070697_100083207 Ga0070697_1000832073 344
20 3300048907 Ga0496104_0194574 Ga0496104_0194574_190_1305 344
21 3300048912 Ga0496109_0360555 Ga0496109_0360555_16_1131 344
22 3300006846 Ga0075430_100004678 Ga0075430_1000046786 345
23 3300050510 nmdc:mga06r32_101650_c1 nmdc:mga06r32_101650_c1_625_1773 345
24 3300025939 Ga0207665_10085507 Ga0207665_100855072 348
25 3300009094 Ga0111539_10027693 Ga0111539_100276934 349
26 3300050511 nmdc:mga08y16_39083_c1 nmdc:mga08y16_39083_c1_3298_4449 349
27 3300005444 Ga0070694_100043975 Ga0070694_1000439752 351
28 3300009177 Ga0105248_10048201 Ga0105248_100482016 351
29 3300009545 Ga0105237_10001199 Ga0105237_100011995 351
30 3300025914 Ga0207671_10066492 Ga0207671_100664922 351
31 3300031548 Ga0307408_100039414 Ga0307408_1000394142 351
32 3300031731 Ga0307405_10010376 Ga0307405_100103762 351
33 3300031903 Ga0307407_10018810 Ga0307407_100188102 351
34 3300031995 Ga0307409_100013914 Ga0307409_1000139146 351
35 3300032004 Ga0307414_10041367 Ga0307414_100413672 351
36 3300032126 Ga0307415_100051077 Ga0307415_1000510772 351
37 3300047317 Ga0495604_0138028 Ga0495604_0138028_527_1672 351
38 3300048088 Ga0495602_0125162 Ga0495602_0125162_742_1887 351
39 3300049656 Ga0501209_005168 Ga0501209_005168_401_1579 351
40 3300049679 Ga0501249_001352 Ga0501249_001352_3483_4661 351
41 3300050507 nmdc:mga05p37_204512_c1 nmdc:mga05p37_204512_c1_1039_2154 351
42 3300005340 Ga0070689_100051380 Ga0070689_1000513802 352
43 3300005458 Ga0070681_10053577 Ga0070681_100535772 352
44 3300025936 Ga0207670_10045827 Ga0207670_100458272 352
45 3300005356 Ga0070674_100130582 Ga0070674_1001305821 354
46 3300005530 Ga0070679_100080169 Ga0070679_1000801692 354
47 3300031727 Ga0316576_10264041 Ga0316576_102640412 354
48 3300048910 Ga0496107_0279814 Ga0496107_0279814_133_1209 354
49 3300049576 Ga0501040_0079064 Ga0501040_0079064_107_1171 354
50 3300049576 Ga0501040_0130551 Ga0501040_0130551_612_1676 354
51 3300049577 Ga0501041_0067616 Ga0501041_0067616_698_1762 354
52 3300049587 Ga0501071_0073577 Ga0501071_0073577_1054_2238 354
53 3300049743 Ga0501081_0268569 Ga0501081_0268569_23_1087 354
54 3300050515 nmdc:mga0a205_218560_c1 nmdc:mga0a205_218560_c1_212_1294 354
55 3300009094 Ga0111539_10253587 Ga0111539_102535872 355
56 3300028380 Ga0268265_10073239 Ga0268265_100732392 355
57 3300050511 nmdc:mga08y16_97464_c1 nmdc:mga08y16_97464_c1_1329_2501 355
58 3300050515 nmdc:mga0a205_252764_c1 nmdc:mga0a205_252764_c1_77_1237 355
59 3300009094 Ga0111539_10461143 Ga0111539_104611432 356
60 3300006844 Ga0075428_100099532 Ga0075428_1000995322 357
61 3300006847 Ga0075431_100126116 Ga0075431_1001261162 357
62 3300006880 Ga0075429_100000373 Ga0075429_10000037316 357
63 3300009147 Ga0114129_10117141 Ga0114129_101171413 357
64 3300050510 nmdc:mga06r32_195476_c1 nmdc:mga06r32_195476_c1_494_1636 357
65 3300035691 Ga0373931_0075118 Ga0373931_0075118_247_1395 358
66 3300050512 nmdc:mga0n895_22958_c1 nmdc:mga0n895_22958_c1_3494_4633 358
67 3300005340 Ga0070689_100042885 Ga0070689_1000428851 359
68 3300005617 Ga0068859_100113519 Ga0068859_1001135192 359
69 3300006931 Ga0097620_100113521 Ga0097620_1001135212 359
70 3300025912 Ga0207707_10159067 Ga0207707_101590672 359
71 3300025936 Ga0207670_10093712 Ga0207670_100937121 359
72 3300025945 Ga0207679_10067688 Ga0207679_100676883 359
73 3300042876 Ga0451577_0361662 Ga0451577_0361662_23_1204 359
74 3300005985 Ga0081539_10103462 Ga0081539_101034621 360
75 3300050515 nmdc:mga0a205_82097_c1 nmdc:mga0a205_82097_c1_35_1126 360
76 3300005331 Ga0070670_100026909 Ga0070670_1000269095 361
77 3300021441 Ga0213871_10002005 Ga0213871_100020053 361
78 3300039438 Ga0436360_0779618 Ga0436360_0779618_2849_4015 361
79 3300031995 Ga0307409_100096204 Ga0307409_1000962042 362
80 3300049580 Ga0501046_0043068 Ga0501046_0043068_2080_3168 362
81 3300049587 Ga0501071_0006278 Ga0501071_0006278_1345_2433 362
82 3300049588 Ga0501072_0022208 Ga0501072_0022208_1948_3036 362
83 3300049591 Ga0501075_0031561 Ga0501075_0031561_1827_2915 362
84 3300049592 Ga0501076_0008713 Ga0501076_0008713_3525_4613 362
85 3300049741 Ga0501079_0044377 Ga0501079_0044377_2221_3309 362
86 3300054114 Ga0501084_0044700 Ga0501084_0044700_1806_2894 362
87 iso_pu_bacteria 2833640130 2833642261 362
88 iso_pu_bacteria 2910245624 2910247851 362
89 3300050511 nmdc:mga08y16_53115_c1 nmdc:mga08y16_53115_c1_2274_3425 363
90 3300005441 Ga0070700_100128200 Ga0070700_1001282002 364
91 3300005471 Ga0070698_100013716 Ga0070698_1000137162 364
92 3300005518 Ga0070699_100137037 Ga0070699_1001370372 364
93 3300009094 Ga0111539_10141258 Ga0111539_101412582 364
94 3300009094 Ga0111539_10152458 Ga0111539_101524582 364
95 3300009148 Ga0105243_10054626 Ga0105243_100546262 364
96 3300009177 Ga0105248_10081802 Ga0105248_100818022 364
97 3300031727 Ga0316576_10115620 Ga0316576_101156202 364
98 3300032126 Ga0307415_100327081 Ga0307415_1003270811 364
99 3300035090 Ga0373949_0009454 Ga0373949_0009454_927_2066 364
100 3300035172 Ga0373955_0004354 Ga0373955_0004354_306_1445 364
101 3300036401 Ga0373937_0268147 Ga0373937_0268147_302_1441 364
102 3300046476 Ga0495662_0015260 Ga0495662_0015260_2006_3145 364
103 3300046514 Ga0495618_0051458 Ga0495618_0051458_589_1728 364
104 3300046516 Ga0495628_0008816 Ga0495628_0008816_5408_6547 364
105 3300046517 Ga0495630_0042713 Ga0495630_0042713_2034_3173 364
106 3300046642 Ga0495634_0013645 Ga0495634_0013645_2132_3271 364
107 3300046675 Ga0495657_0119437 Ga0495657_0119437_384_1523 364
108 3300047319 Ga0495674_0255206 Ga0495674_0255206_270_1409 364
109 3300050515 nmdc:mga0a205_37715_c2 nmdc:mga0a205_37715_c2_25_1131 364
110 3300053078 Ga0495612_0017087 Ga0495612_0017087_396_1535 364
111 3300005334 Ga0068869_100050893 Ga0068869_1000508932 365
112 3300005334 Ga0068869_100133965 Ga0068869_1001339652 365
113 3300005468 Ga0070707_100007330 Ga0070707_1000073307 365
114 3300009094 Ga0111539_10046775 Ga0111539_100467756 365
115 3300025922 Ga0207646_10009809 Ga0207646_100098098 365
116 3300025942 Ga0207689_10005683 Ga0207689_100056832 365
117 3300027907 Ga0207428_10082286 Ga0207428_100822863 365
118 3300050507 nmdc:mga05p37_112288_c1 nmdc:mga05p37_112288_c1_2228_3337 365
119 3300005577 Ga0068857_100118030 Ga0068857_1001180302 366
120 3300005614 Ga0068856_100096367 Ga0068856_1000963673 366
121 3300006852 Ga0075433_10254627 Ga0075433_102546272 366
122 3300026023 Ga0207677_10217837 Ga0207677_102178372 366
123 3300026078 Ga0207702_10397112 Ga0207702_103971122 366
124 3300032004 Ga0307414_10002616 Ga0307414_100026167 366
125 3300049514 Ga0501291_008599 Ga0501291_008599_11_1312 366
126 3300049585 Ga0501069_0107070 Ga0501069_0107070_455_1567 366
127 3300049824 Ga0501045_0178121 Ga0501045_0178121_342_1454 366
128 3300050515 nmdc:mga0a205_177069_c1 nmdc:mga0a205_177069_c1_659_1894 366
129 3300005549 Ga0070704_100109222 Ga0070704_1001092222 367
130 3300005937 Ga0081455_10000484 Ga0081455_100004844 367
131 3300006844 Ga0075428_100139961 Ga0075428_1001399612 367
132 3300009545 Ga0105237_10349295 Ga0105237_103492951 367
133 3300014325 Ga0163163_10324857 Ga0163163_103248572 367
134 3300026035 Ga0207703_10102792 Ga0207703_101027922 367
135 3300031548 Ga0307408_100000881 Ga0307408_1000008813 367
136 3300037471 Ga0395905_0135118 Ga0395905_0135118_1119_2222 367
137 3300042156 Ga0439446_0007471 Ga0439446_0007471_1096_2199 367
138 3300042876 Ga0451577_0087277 Ga0451577_0087277_1420_2550 367
139 3300042876 Ga0451577_0100330 Ga0451577_0100330_144_1247 367
140 3300042876 Ga0451577_0441354 Ga0451577_0441354_31_1134 367
141 3300044712 Ga0453684_0001009 Ga0453684_0001009_43435_44565 367
142 3300045051 Ga0451576_0103405 Ga0451576_0103405_491_1621 367
143 3300048911 Ga0496108_0014287 Ga0496108_0014287_2383_3486 367
144 3300048912 Ga0496109_0018708 Ga0496109_0018708_2395_3498 367
145 3300048913 Ga0496110_0228911 Ga0496110_0228911_489_1592 367
146 3300048916 Ga0496113_0257721 Ga0496113_0257721_247_1350 367
147 3300049578 Ga0501042_0145980 Ga0501042_0145980_93_1280 367
148 3300049824 Ga0501045_0176067 Ga0501045_0176067_57_1160 367
149 3300050513 nmdc:mga0rr50_25582_c1 nmdc:mga0rr50_25582_c1_1318_2421 367
150 3300050514 nmdc:mga08x19_8848_c1 nmdc:mga08x19_8848_c1_3824_4927 367
151 3300005441 Ga0070700_100000225 Ga0070700_10000022513 368
152 3300006852 Ga0075433_10008768 Ga0075433_100087682 368
153 3300006871 Ga0075434_100019499 Ga0075434_1000194992 368
154 3300026075 Ga0207708_10000136 Ga0207708_1000013622 368
155 3300026095 Ga0207676_10393246 Ga0207676_103932462 368
156 3300028563 Ga0265319_1023238 Ga0265319_10232382 368
157 3300028800 Ga0265338_10029990 Ga0265338_100299903 368
158 3300031548 Ga0307408_100084392 Ga0307408_1000843922 368
159 3300032004 Ga0307414_10011273 Ga0307414_100112735 368
160 3300032126 Ga0307415_100308813 Ga0307415_1003088131 368
161 3300036712 Ga0316584_0050591 Ga0316584_0050591_1861_3039 368
162 3300049576 Ga0501040_0069638 Ga0501040_0069638_143_1297 368
163 3300049654 Ga0501207_002008 Ga0501207_002008_842_1996 368
164 3300049663 Ga0501223_008137 Ga0501223_008137_881_2035 368
165 3300049665 Ga0501227_006258 Ga0501227_006258_983_2137 368
166 3300049667 Ga0501230_008393 Ga0501230_008393_60_1214 368
167 3300049668 Ga0501233_004903 Ga0501233_004903_437_1591 368
168 3300050515 nmdc:mga0a205_51646_c1 nmdc:mga0a205_51646_c1_1350_2492 368
169 3300000549 LJQas_1000004 LJQas_10000047 369
170 3300005355 Ga0070671_100032235 Ga0070671_1000322352 369
171 3300014968 Ga0157379_10108065 Ga0157379_101080651 369
172 3300025931 Ga0207644_10009195 Ga0207644_100091954 369
173 3300045051 Ga0451576_0006316 Ga0451576_0006316_2383_3549 369
174 3300048915 Ga0496112_0111166 Ga0496112_0111166_807_1949 369
175 3300003203 JGI25406J46586_10004388 JGI25406J46586_100043883 370
176 3300005345 Ga0070692_10077165 Ga0070692_100771652 370
177 3300005444 Ga0070694_100057868 Ga0070694_1000578682 370
178 3300005545 Ga0070695_100055818 Ga0070695_1000558181 370
179 3300005615 Ga0070702_100013190 Ga0070702_1000131903 370
180 3300005617 Ga0068859_100122740 Ga0068859_1001227403 370
181 3300005617 Ga0068859_100246020 Ga0068859_1002460202 370
182 3300005985 Ga0081539_10000858 Ga0081539_1000085830 370
183 3300006844 Ga0075428_100278170 Ga0075428_1002781702 370
184 3300006852 Ga0075433_10052347 Ga0075433_100523472 370
185 3300006931 Ga0097620_100122741 Ga0097620_1001227413 370
186 3300006931 Ga0097620_100246013 Ga0097620_1002460132 370
187 3300009094 Ga0111539_10091032 Ga0111539_100910323 370
188 3300009177 Ga0105248_10005185 Ga0105248_100051854 370
189 3300013100 Ga0157373_10143903 Ga0157373_101439031 370
190 3300013306 Ga0163162_10097787 Ga0163162_100977872 370
191 3300025885 Ga0207653_10000499 Ga0207653_100004997 370
192 3300025941 Ga0207711_10007598 Ga0207711_100075982 370
193 3300026035 Ga0207703_10365743 Ga0207703_103657431 370
194 3300031251 Ga0265327_10012430 Ga0265327_100124304 370
195 3300032126 Ga0307415_100144538 Ga0307415_1001445382 370
196 3300041505 Ga0451849_1552928 Ga0451849_1552928_362_1522 370
197 3300046537 Ga0495598_0027906 Ga0495598_0027906_187_1341 370
198 3300048911 Ga0496108_0127870 Ga0496108_0127870_367_1512 370
199 3300050507 nmdc:mga05p37_114824_c1 nmdc:mga05p37_114824_c1_1051_2202 370
200 3300050512 nmdc:mga0n895_463057_c1 nmdc:mga0n895_463057_c1_94_1236 370
201 3300050513 nmdc:mga0rr50_140708_c1 nmdc:mga0rr50_140708_c1_17_1159 370
202 3300050515 nmdc:mga0a205_85833_c1 nmdc:mga0a205_85833_c1_782_1930 370
203 3300053142 Ga0500577_0010739 Ga0500577_0010739_1414_2574 370
204 3300005293 Ga0065715_10148838 Ga0065715_101488382 371
205 3300005295 Ga0065707_10000589 Ga0065707_1000058919 371
206 3300005327 Ga0070658_10014417 Ga0070658_100144172 371
207 3300005333 Ga0070677_10076772 Ga0070677_100767722 371
208 3300005354 Ga0070675_100137803 Ga0070675_1001378032 371
209 3300005356 Ga0070674_100125249 Ga0070674_1001252491 371
210 3300005364 Ga0070673_100049583 Ga0070673_1000495832 371
211 3300005458 Ga0070681_10076727 Ga0070681_100767272 371
212 3300005518 Ga0070699_100001870 Ga0070699_10000187014 371
213 3300005530 Ga0070679_100045696 Ga0070679_1000456963 371
214 3300005546 Ga0070696_100010953 Ga0070696_1000109536 371
215 3300005546 Ga0070696_100113567 Ga0070696_1001135672 371
216 3300005616 Ga0068852_100144084 Ga0068852_1001440842 371
217 3300005617 Ga0068859_100008065 Ga0068859_1000080652 371
218 3300005842 Ga0068858_100146950 Ga0068858_1001469501 371
219 3300006852 Ga0075433_10084269 Ga0075433_100842692 371
220 3300006881 Ga0068865_100067469 Ga0068865_1000674693 371
221 3300006881 Ga0068865_100134818 Ga0068865_1001348182 371
222 3300006931 Ga0097620_100008065 Ga0097620_1000080652 371
223 3300009092 Ga0105250_10000010 Ga0105250_10000010159 371
224 3300009094 Ga0111539_10218135 Ga0111539_102181352 371
225 3300009147 Ga0114129_10636715 Ga0114129_106367151 371
226 3300009177 Ga0105248_10008038 Ga0105248_100080386 371
227 3300009551 Ga0105238_10081087 Ga0105238_100810873 371
228 3300010159 Ga0099796_10014196 Ga0099796_100141963 371
229 3300013105 Ga0157369_10240203 Ga0157369_102402032 371
230 3300013297 Ga0157378_10017860 Ga0157378_100178606 371
231 3300013307 Ga0157372_10249624 Ga0157372_102496242 371
232 3300013308 Ga0157375_10382297 Ga0157375_103822972 371
233 3300014968 Ga0157379_10000022 Ga0157379_1000002211 371
234 3300017792 Ga0163161_10006579 Ga0163161_100065796 371
235 3300025711 Ga0207696_1000159 Ga0207696_100015964 371
236 3300025905 Ga0207685_10017656 Ga0207685_100176562 371
237 3300025909 Ga0207705_10015184 Ga0207705_100151846 371
238 3300025913 Ga0207695_10105332 Ga0207695_101053322 371
239 3300025924 Ga0207694_10102250 Ga0207694_101022502 371
240 3300025928 Ga0207700_10100876 Ga0207700_101008762 371
241 3300025933 Ga0207706_10057909 Ga0207706_100579095 371
242 3300025937 Ga0207669_10015543 Ga0207669_100155434 371
243 3300025938 Ga0207704_10131843 Ga0207704_101318432 371
244 3300025941 Ga0207711_10004285 Ga0207711_100042854 371
245 3300025949 Ga0207667_10214491 Ga0207667_102144912 371
246 3300025960 Ga0207651_10044685 Ga0207651_100446852 371
247 3300025961 Ga0207712_10026534 Ga0207712_100265343 371
248 3300026041 Ga0207639_10017809 Ga0207639_100178094 371
249 3300026095 Ga0207676_10095344 Ga0207676_100953442 371
250 3300026142 Ga0207698_10085793 Ga0207698_100857932 371
251 3300026142 Ga0207698_10145772 Ga0207698_101457722 371
252 3300028017 Ga0265356_1001008 Ga0265356_10010083 371
253 3300030878 Ga0265770_1000295 Ga0265770_10002953 371
254 3300031090 Ga0265760_10002069 Ga0265760_100020696 371
255 3300031548 Ga0307408_100079697 Ga0307408_1000796972 371
256 3300031548 Ga0307408_100169364 Ga0307408_1001693642 371
257 3300031730 Ga0307516_10003296 Ga0307516_1000329626 371
258 3300032005 Ga0307411_10278957 Ga0307411_102789571 371
259 3300037466 Ga0395898_0002342 Ga0395898_0002342_17659_18822 371
260 3300041498 Ga0451841_0180974 Ga0451841_0180974_110_1291 371
261 3300041507 Ga0451851_0536537 Ga0451851_0536537_151_1332 371
262 3300041512 Ga0451853_3596503 Ga0451853_3596503_701_1882 371
263 3300044656 Ga0466969_0022971 Ga0466969_0022971_166_1308 371
264 3300044684 Ga0466966_0000214 Ga0466966_0000214_37317_38459 371
265 3300044693 Ga0466961_0075509 Ga0466961_0075509_157_1299 371
266 3300044719 Ga0466971_0000271 Ga0466971_0000271_16462_17604 371
267 3300045049 Ga0466959_0091763 Ga0466959_0091763_783_1925 371
268 3300045836 Ga0466958_0138930 Ga0466958_0138930_133_1275 371
269 3300046616 Ga0495668_0001582 Ga0495668_0001582_20239_21402 371
270 3300046683 Ga0495658_0058458 Ga0495658_0058458_189_1358 371
271 3300048904 Ga0496101_0125196 Ga0496101_0125196_86_1255 371
272 3300048907 Ga0496104_0017719 Ga0496104_0017719_1100_2269 371
273 3300048908 Ga0496105_0036438 Ga0496105_0036438_2396_3565 371
274 3300048912 Ga0496109_0242854 Ga0496109_0242854_381_1544 371
275 3300048915 Ga0496112_0266828 Ga0496112_0266828_188_1339 371
276 3300048917 Ga0496114_0010422 Ga0496114_0010422_1714_2883 371
277 3300048918 Ga0496115_0006586 Ga0496115_0006586_6949_8118 371
278 3300049571 Ga0501034_0009358 Ga0501034_0009358_8668_9822 371
279 3300049580 Ga0501046_0085296 Ga0501046_0085296_988_2157 371
280 3300053151 Ga0500604_0034182 Ga0500604_0034182_63_1229 371
281 3300053156 Ga0500622_0004549 Ga0500622_0004549_6892_8061 371
282 3300053156 Ga0500622_0004862 Ga0500622_0004862_3738_4907 371
283 3300000531 CNBas_1000308 CNBas_10003082 372
284 3300002459 JGI24751J29686_10000012 JGI24751J29686_1000001273 372
285 3300005288 Ga0065714_10064422 Ga0065714_10064422118 372
286 3300005289 Ga0065704_10000986 Ga0065704_1000098612 372
287 3300005290 Ga0065712_10067728 Ga0065712_1006772847 372
288 3300005290 Ga0065712_10085973 Ga0065712_100859731 372
289 3300005293 Ga0065715_10100505 Ga0065715_101005053 372
290 3300005293 Ga0065715_10112355 Ga0065715_101123552 372
291 3300005295 Ga0065707_10001006 Ga0065707_100010065 372
292 3300005329 Ga0070683_100245314 Ga0070683_1002453142 372
293 3300005331 Ga0070670_100000165 Ga0070670_10000016533 372
294 3300005331 Ga0070670_100034090 Ga0070670_1000340904 372
295 3300005331 Ga0070670_100237816 Ga0070670_1002378162 372
296 3300005334 Ga0068869_100017710 Ga0068869_1000177105 372
297 3300005337 Ga0070682_100018666 Ga0070682_1000186663 372
298 3300005338 Ga0068868_100067416 Ga0068868_1000674163 372
299 3300005345 Ga0070692_10014720 Ga0070692_100147202 372
300 3300005355 Ga0070671_100002614 Ga0070671_10000261411 372
301 3300005364 Ga0070673_100036253 Ga0070673_1000362532 372
302 3300005364 Ga0070673_100133269 Ga0070673_1001332692 372
303 3300005367 Ga0070667_100070267 Ga0070667_1000702672 372
304 3300005440 Ga0070705_100156059 Ga0070705_1001560592 372
305 3300005441 Ga0070700_100037319 Ga0070700_1000373192 372
306 3300005444 Ga0070694_100013232 Ga0070694_1000132325 372
307 3300005456 Ga0070678_100293021 Ga0070678_1002930211 372
308 3300005466 Ga0070685_10002946 Ga0070685_1000294610 372
309 3300005467 Ga0070706_100000128 Ga0070706_10000012862 372
310 3300005518 Ga0070699_100173162 Ga0070699_1001731622 372
311 3300005544 Ga0070686_100058002 Ga0070686_1000580022 372
312 3300005549 Ga0070704_100057433 Ga0070704_1000574332 372
313 3300005549 Ga0070704_100222623 Ga0070704_1002226231 372
314 3300005564 Ga0070664_100007053 Ga0070664_1000070533 372
315 3300005616 Ga0068852_100148679 Ga0068852_1001486792 372
316 3300005617 Ga0068859_100008330 Ga0068859_1000083302 372
317 3300005617 Ga0068859_100039360 Ga0068859_1000393603 372
318 3300005618 Ga0068864_100012380 Ga0068864_1000123806 372
319 3300005841 Ga0068863_100011604 Ga0068863_1000116046 372
320 3300005841 Ga0068863_100273330 Ga0068863_1002733302 372
321 3300005842 Ga0068858_100090574 Ga0068858_1000905742 372
322 3300005842 Ga0068858_100105122 Ga0068858_1001051222 372
323 3300005843 Ga0068860_100084996 Ga0068860_1000849963 372
324 3300005843 Ga0068860_100159039 Ga0068860_1001590392 372
325 3300005843 Ga0068860_100375002 Ga0068860_1003750021 372
326 3300005985 Ga0081539_10000586 Ga0081539_1000058647 372
327 3300006358 Ga0068871_100015984 Ga0068871_1000159846 372
328 3300006844 Ga0075428_100000322 Ga0075428_10000032233 372
329 3300006844 Ga0075428_100345217 Ga0075428_1003452172 372
330 3300006847 Ga0075431_100001136 Ga0075431_10000113614 372
331 3300006871 Ga0075434_100142884 Ga0075434_1001428842 372
332 3300006931 Ga0097620_100008330 Ga0097620_1000083309 372
333 3300006931 Ga0097620_100039360 Ga0097620_1000393603 372
334 3300007076 Ga0075435_100018572 Ga0075435_1000185722 372
335 3300009093 Ga0105240_10367892 Ga0105240_103678922 372
336 3300009094 Ga0111539_10003889 Ga0111539_1000388917 372
337 3300009098 Ga0105245_10017231 Ga0105245_100172316 372
338 3300009101 Ga0105247_10010150 Ga0105247_100101503 372
339 3300009147 Ga0114129_10114661 Ga0114129_101146613 372
340 3300009148 Ga0105243_10200116 Ga0105243_102001162 372
341 3300009174 Ga0105241_10246968 Ga0105241_102469682 372
342 3300009177 Ga0105248_10091920 Ga0105248_100919202 372
343 3300009177 Ga0105248_10268124 Ga0105248_102681242 372
344 3300009551 Ga0105238_10027477 Ga0105238_100274774 372
345 3300011119 Ga0105246_10002825 Ga0105246_100028254 372
346 3300013296 Ga0157374_10120879 Ga0157374_101208792 372
347 3300013306 Ga0163162_10017095 Ga0163162_100170953 372
348 3300013306 Ga0163162_10029444 Ga0163162_100294445 372
349 3300013308 Ga0157375_10009948 Ga0157375_100099487 372
350 3300013308 Ga0157375_10011069 Ga0157375_100110693 372
351 3300013308 Ga0157375_10045027 Ga0157375_100450273 372
352 3300014325 Ga0163163_10001068 Ga0163163_1000106811 372
353 3300014325 Ga0163163_10017063 Ga0163163_100170634 372
354 3300014325 Ga0163163_10188023 Ga0163163_101880232 372
355 3300014326 Ga0157380_10004962 Ga0157380_100049624 372
356 3300014326 Ga0157380_10196585 Ga0157380_101965852 372
357 3300014745 Ga0157377_10033711 Ga0157377_100337113 372
358 3300021384 Ga0213876_10000757 Ga0213876_100007578 372
359 3300025900 Ga0207710_10002140 Ga0207710_100021403 372
360 3300025900 Ga0207710_10011490 Ga0207710_100114902 372
361 3300025910 Ga0207684_10000150 Ga0207684_1000015062 372
362 3300025925 Ga0207650_10000011 Ga0207650_10000011227 372
363 3300025925 Ga0207650_10113307 Ga0207650_101133072 372
364 3300025925 Ga0207650_10227824 Ga0207650_102278242 372
365 3300025927 Ga0207687_10014033 Ga0207687_100140332 372
366 3300025931 Ga0207644_10022158 Ga0207644_100221583 372
367 3300025942 Ga0207689_10004907 Ga0207689_100049075 372
368 3300025944 Ga0207661_10212873 Ga0207661_102128731 372
369 3300025945 Ga0207679_10057672 Ga0207679_100576722 372
370 3300025961 Ga0207712_10016542 Ga0207712_100165423 372
371 3300025981 Ga0207640_10130695 Ga0207640_101306952 372
372 3300026035 Ga0207703_10079553 Ga0207703_100795532 372
373 3300026041 Ga0207639_10031771 Ga0207639_100317713 372
374 3300026075 Ga0207708_10179265 Ga0207708_101792651 372
375 3300026078 Ga0207702_10253556 Ga0207702_102535562 372
376 3300026088 Ga0207641_10063252 Ga0207641_100632521 372
377 3300026088 Ga0207641_10135940 Ga0207641_101359402 372
378 3300026088 Ga0207641_10230880 Ga0207641_102308801 372
379 3300026095 Ga0207676_10085837 Ga0207676_100858372 372
380 3300026118 Ga0207675_100128081 Ga0207675_1001280812 372
381 3300027717 Ga0209998_10012992 Ga0209998_100129922 372
382 3300028380 Ga0268265_10119862 Ga0268265_101198622 372
383 3300028380 Ga0268265_10268411 Ga0268265_102684112 372
384 3300028381 Ga0268264_10030618 Ga0268264_100306184 372
385 3300028381 Ga0268264_10214191 Ga0268264_102141912 372
386 3300031548 Ga0307408_100025335 Ga0307408_1000253353 372
387 3300031665 Ga0316575_10019556 Ga0316575_100195562 372
388 3300031691 Ga0316579_10050024 Ga0316579_100500242 372
389 3300031728 Ga0316578_10014865 Ga0316578_100148654 372
390 3300031731 Ga0307405_10001196 Ga0307405_100011963 372
391 3300031731 Ga0307405_10015407 Ga0307405_100154073 372
392 3300031824 Ga0307413_10035152 Ga0307413_100351522 372
393 3300031903 Ga0307407_10003794 Ga0307407_100037944 372
394 3300031995 Ga0307409_100035668 Ga0307409_1000356683 372
395 3300031995 Ga0307409_100049438 Ga0307409_1000494383 372
396 3300032004 Ga0307414_10040990 Ga0307414_100409902 372
397 3300032005 Ga0307411_10015713 Ga0307411_100157131 372
398 3300032126 Ga0307415_100017136 Ga0307415_1000171362 372
399 3300032139 Ga0316580_10020786 Ga0316580_100207862 372
400 3300035089 Ga0373944_0029696 Ga0373944_0029696_39_1223 372
401 3300035091 Ga0373951_0003489 Ga0373951_0003489_916_2067 372
402 3300035172 Ga0373955_0041592 Ga0373955_0041592_939_2123 372
403 3300035207 Ga0373942_0015334 Ga0373942_0015334_126_1280 372
404 3300035398 Ga0316574_0095989 Ga0316574_0095989_421_1584 372
405 3300035724 Ga0373933_0032440 Ga0373933_0032440_857_2041 372
406 3300036401 Ga0373937_0003412 Ga0373937_0003412_9855_11039 372
407 3300036647 Ga0316582_0030921 Ga0316582_0030921_621_1784 372
408 3300037471 Ga0395905_0011300 Ga0395905_0011300_2357_3553 372
409 3300046539 Ga0495621_0031168 Ga0495621_0031168_284_1462 372
410 3300048909 Ga0496106_0214596 Ga0496106_0214596_157_1308 372
411 3300048910 Ga0496107_0234784 Ga0496107_0234784_136_1287 372
412 3300048915 Ga0496112_0283535 Ga0496112_0283535_110_1261 372
413 3300049519 Ga0501296_006756 Ga0501296_006756_78_1241 372
414 3300049587 Ga0501071_0023799 Ga0501071_0023799_2126_3301 372
415 3300049591 Ga0501075_0024437 Ga0501075_0024437_1410_2585 372
416 3300049592 Ga0501076_0133586 Ga0501076_0133586_19_1194 372
417 3300049668 Ga0501233_016029 Ga0501233_016029_55_1218 372
418 3300049741 Ga0501079_0056570 Ga0501079_0056570_557_1732 372
419 3300050510 nmdc:mga06r32_23270_c1 nmdc:mga06r32_23270_c1_3293_4486 372
420 3300050511 nmdc:mga08y16_1265_c1 nmdc:mga08y16_1265_c1_3376_4551 372
421 3300050511 nmdc:mga08y16_12852_c1 nmdc:mga08y16_12852_c1_5654_6802 372
422 3300050515 nmdc:mga0a205_83146_c1 nmdc:mga0a205_83146_c1_1850_3025 372
423 3300053096 Ga0500641_0001840 Ga0500641_0001840_2405_3589 372
424 3300005353 Ga0070669_100000025 Ga0070669_10000002579 373
425 3300005434 Ga0070709_10000103 Ga0070709_1000010354 373
426 3300005458 Ga0070681_10002525 Ga0070681_1000252517 373
427 3300005518 Ga0070699_100000024 Ga0070699_100000024100 373
428 3300005547 Ga0070693_100001436 Ga0070693_1000014363 373
429 3300005549 Ga0070704_100024375 Ga0070704_1000243754 373
430 3300005842 Ga0068858_100167680 Ga0068858_1001676802 373
431 3300005844 Ga0068862_100000670 Ga0068862_1000006706 373
432 3300005844 Ga0068862_100124251 Ga0068862_1001242512 373
433 3300006844 Ga0075428_100294492 Ga0075428_1002944921 373
434 3300006914 Ga0075436_100070770 Ga0075436_1000707702 373
435 3300009093 Ga0105240_10004276 Ga0105240_1000427615 373
436 3300009101 Ga0105247_10008389 Ga0105247_100083898 373
437 3300025906 Ga0207699_10000010 Ga0207699_1000001072 373
438 3300025912 Ga0207707_10003634 Ga0207707_1000363414 373
439 3300025923 Ga0207681_10000018 Ga0207681_10000018184 373
440 3300025936 Ga0207670_10153642 Ga0207670_101536422 373
441 3300025940 Ga0207691_10025720 Ga0207691_100257208 373
442 3300025944 Ga0207661_10033046 Ga0207661_100330464 373
443 3300025949 Ga0207667_10094332 Ga0207667_100943322 373
444 3300025961 Ga0207712_10004676 Ga0207712_100046763 373
445 3300026095 Ga0207676_10198923 Ga0207676_101989232 373
446 3300028380 Ga0268265_10000115 Ga0268265_1000011563 373
447 3300028381 Ga0268264_10015822 Ga0268264_100158223 373
448 3300031852 Ga0307410_10031892 Ga0307410_100318923 373
449 3300037466 Ga0395898_0082595 Ga0395898_0082595_1347_2516 373
450 3300038443 Ga0395901_0109249 Ga0395901_0109249_27_1196 373
451 3300039437 Ga0436365_0560037 Ga0436365_0560037_28099_29334 373
452 3300046472 Ga0495580_0107492 Ga0495580_0107492_244_1428 373
453 3300048907 Ga0496104_0257594 Ga0496104_0257594_117_1256 373
454 3300048911 Ga0496108_0053828 Ga0496108_0053828_944_2083 373
455 3300048917 Ga0496114_0034690 Ga0496114_0034690_286_1425 373
456 3300053153 Ga0500616_0000096 Ga0500616_0000096_144890_146029 373
457 3300003203 JGI25406J46586_10006498 JGI25406J46586_100064981 374
458 3300005331 Ga0070670_100199662 Ga0070670_1001996622 374
459 3300005340 Ga0070689_100001120 Ga0070689_1000011204 374
460 3300005345 Ga0070692_10056805 Ga0070692_100568052 374
461 3300005354 Ga0070675_100141218 Ga0070675_1001412181 374
462 3300005364 Ga0070673_100118782 Ga0070673_1001187822 374
463 3300005436 Ga0070713_100008652 Ga0070713_1000086525 374
464 3300005438 Ga0070701_10021561 Ga0070701_100215612 374
465 3300005441 Ga0070700_100056483 Ga0070700_1000564832 374
466 3300005444 Ga0070694_100075912 Ga0070694_1000759121 374
467 3300005455 Ga0070663_100083868 Ga0070663_1000838682 374
468 3300005458 Ga0070681_10029015 Ga0070681_100290152 374
469 3300005458 Ga0070681_10109366 Ga0070681_101093662 374
470 3300005458 Ga0070681_10277032 Ga0070681_102770322 374
471 3300005459 Ga0068867_100259877 Ga0068867_1002598771 374
472 3300005539 Ga0068853_100039118 Ga0068853_1000391182 374
473 3300005548 Ga0070665_100000156 Ga0070665_10000015632 374
474 3300005548 Ga0070665_100007626 Ga0070665_1000076264 374
475 3300005616 Ga0068852_100164719 Ga0068852_1001647192 374
476 3300005617 Ga0068859_100020509 Ga0068859_1000205098 374
477 3300005617 Ga0068859_100030082 Ga0068859_1000300824 374
478 3300005617 Ga0068859_100091528 Ga0068859_1000915282 374
479 3300005617 Ga0068859_100178854 Ga0068859_1001788542 374
480 3300005618 Ga0068864_100067513 Ga0068864_1000675132 374
481 3300005618 Ga0068864_100223984 Ga0068864_1002239841 374
482 3300005719 Ga0068861_100076206 Ga0068861_1000762063 374
483 3300005841 Ga0068863_100030745 Ga0068863_1000307452 374
484 3300005841 Ga0068863_100032235 Ga0068863_1000322353 374
485 3300005841 Ga0068863_100188114 Ga0068863_1001881142 374
486 3300005985 Ga0081539_10000165 Ga0081539_10000165125 374
487 3300006028 Ga0070717_10031311 Ga0070717_100313112 374
488 3300006163 Ga0070715_10008181 Ga0070715_100081813 374
489 3300006173 Ga0070716_100016262 Ga0070716_1000162622 374
490 3300006846 Ga0075430_100081711 Ga0075430_1000817112 374
491 3300006852 Ga0075433_10000891 Ga0075433_100008912 374
492 3300006931 Ga0097620_100020509 Ga0097620_1000205098 374
493 3300006931 Ga0097620_100030082 Ga0097620_1000300824 374
494 3300006931 Ga0097620_100091520 Ga0097620_1000915202 374
495 3300006931 Ga0097620_100178860 Ga0097620_1001788602 374
496 3300009093 Ga0105240_10332473 Ga0105240_103324732 374
497 3300009174 Ga0105241_10376150 Ga0105241_103761501 374
498 3300009177 Ga0105248_10296529 Ga0105248_102965292 374
499 3300009545 Ga0105237_10016045 Ga0105237_100160457 374
500 3300010375 Ga0105239_10113457 Ga0105239_101134573 374
501 3300011119 Ga0105246_10043902 Ga0105246_100439022 374
502 3300013105 Ga0157369_10115198 Ga0157369_101151982 374
503 3300014325 Ga0163163_10048713 Ga0163163_100487132 374
504 3300014325 Ga0163163_10112525 Ga0163163_101125252 374
505 3300014326 Ga0157380_10045507 Ga0157380_100455072 374
506 3300014968 Ga0157379_10241506 Ga0157379_102415062 374
507 3300025907 Ga0207645_10026939 Ga0207645_100269394 374
508 3300025912 Ga0207707_10007334 Ga0207707_100073348 374
509 3300025912 Ga0207707_10085096 Ga0207707_100850962 374
510 3300025912 Ga0207707_10123926 Ga0207707_101239262 374
511 3300025914 Ga0207671_10140751 Ga0207671_101407512 374
512 3300025915 Ga0207693_10199374 Ga0207693_101993742 374
513 3300025916 Ga0207663_10115420 Ga0207663_101154202 374
514 3300025925 Ga0207650_10101597 Ga0207650_101015972 374
515 3300025928 Ga0207700_10016955 Ga0207700_100169552 374
516 3300025931 Ga0207644_10078046 Ga0207644_100780463 374
517 3300025931 Ga0207644_10094299 Ga0207644_100942992 374
518 3300025933 Ga0207706_10025610 Ga0207706_100256103 374
519 3300025933 Ga0207706_10064918 Ga0207706_100649182 374
520 3300025936 Ga0207670_10001618 Ga0207670_100016184 374
521 3300025939 Ga0207665_10041194 Ga0207665_100411942 374
522 3300025939 Ga0207665_10092033 Ga0207665_100920332 374
523 3300025941 Ga0207711_10151653 Ga0207711_101516532 374
524 3300025960 Ga0207651_10068235 Ga0207651_100682352 374
525 3300026035 Ga0207703_10162554 Ga0207703_101625542 374
526 3300026035 Ga0207703_10199338 Ga0207703_101993382 374
527 3300026067 Ga0207678_10032125 Ga0207678_100321253 374
528 3300026067 Ga0207678_10189771 Ga0207678_101897712 374
529 3300026095 Ga0207676_10303045 Ga0207676_103030452 374
530 3300026116 Ga0207674_10018906 Ga0207674_100189065 374
531 3300026118 Ga0207675_100001980 Ga0207675_10000198015 374
532 3300026118 Ga0207675_100173037 Ga0207675_1001730372 374
533 3300028379 Ga0268266_10000738 Ga0268266_1000073832 374
534 3300028379 Ga0268266_10005951 Ga0268266_100059514 374
535 3300031247 Ga0265340_10054820 Ga0265340_100548202 374
536 3300031616 Ga0307508_10049515 Ga0307508_100495154 374
537 3300031728 Ga0316578_10011646 Ga0316578_100116462 374
538 3300031733 Ga0316577_10084717 Ga0316577_100847172 374
539 3300035692 Ga0373935_0021715 Ga0373935_0021715_2203_3393 374
540 3300035725 Ga0373947_0025965 Ga0373947_0025965_17_1159 374
541 3300036401 Ga0373937_0180653 Ga0373937_0180653_394_1536 374
542 3300036712 Ga0316584_0000107 Ga0316584_0000107_18829_20019 374
543 3300037418 Ga0395900_0333564 Ga0395900_0333564_134_1333 374
544 3300041451 Ga0451791_1389195 Ga0451791_1389195_242_1438 374
545 3300044712 Ga0453684_0065194 Ga0453684_0065194_297_1439 374
546 3300046454 Ga0495592_0049237 Ga0495592_0049237_188_1330 374
547 3300046471 Ga0495650_0031792 Ga0495650_0031792_522_1694 374
548 3300046516 Ga0495628_0057975 Ga0495628_0057975_219_1361 374
549 3300046529 Ga0495652_0038143 Ga0495652_0038143_52_1194 374
550 3300046536 Ga0495587_0024436 Ga0495587_0024436_2482_3624 374
551 3300046543 Ga0495645_0058538 Ga0495645_0058538_869_2011 374
552 3300046642 Ga0495634_0142676 Ga0495634_0142676_41_1183 374
553 3300046664 Ga0495659_0012373 Ga0495659_0012373_735_1901 374
554 3300046678 Ga0495599_0002951 Ga0495599_0002951_7968_9110 374
555 3300046680 Ga0495646_0027523 Ga0495646_0027523_1235_2377 374
556 3300047319 Ga0495674_0091294 Ga0495674_0091294_1062_2204 374
557 3300048908 Ga0496105_0146984 Ga0496105_0146984_593_1738 374
558 3300048915 Ga0496112_0211449 Ga0496112_0211449_555_1715 374
559 3300049522 Ga0501299_003152 Ga0501299_003152_592_1755 374
560 3300049574 Ga0501038_0001788 Ga0501038_0001788_5104_6273 374
561 3300049588 Ga0501072_0003659 Ga0501072_0003659_4937_6109 374
562 3300049591 Ga0501075_0113825 Ga0501075_0113825_243_1388 374
563 3300049592 Ga0501076_0283528 Ga0501076_0283528_85_1245 374
564 3300049705 Ga0501225_0018947 Ga0501225_0018947_44_1207 374
565 3300049743 Ga0501081_0032407 Ga0501081_0032407_2207_3358 374
566 3300050507 nmdc:mga05p37_122164_c1 nmdc:mga05p37_122164_c1_1030_2199 374
567 3300053077 Ga0495601_0011177 Ga0495601_0011177_1772_2914 374
568 3300053078 Ga0495612_0014064 Ga0495612_0014064_287_1429 374
569 3300054114 Ga0501084_0118759 Ga0501084_0118759_1027_2196 374
570 3300005335 Ga0070666_10017753 Ga0070666_100177535 375
571 3300005367 Ga0070667_100036989 Ga0070667_1000369892 375
572 3300005367 Ga0070667_100043210 Ga0070667_1000432103 375
573 3300005467 Ga0070706_100028562 Ga0070706_1000285622 375
574 3300005536 Ga0070697_100012151 Ga0070697_1000121516 375
575 3300005548 Ga0070665_100253349 Ga0070665_1002533492 375
576 3300005563 Ga0068855_100006051 Ga0068855_1000060519 375
577 3300005617 Ga0068859_100121419 Ga0068859_1001214192 375
578 3300005618 Ga0068864_100120504 Ga0068864_1001205042 375
579 3300005841 Ga0068863_100045465 Ga0068863_1000454655 375
580 3300005842 Ga0068858_100040115 Ga0068858_1000401152 375
581 3300005843 Ga0068860_100001357 Ga0068860_10000135722 375
582 3300005843 Ga0068860_100134580 Ga0068860_1001345802 375
583 3300005844 Ga0068862_100119462 Ga0068862_1001194622 375
584 3300006237 Ga0097621_100014975 Ga0097621_1000149756 375
585 3300006237 Ga0097621_100058683 Ga0097621_1000586832 375
586 3300006852 Ga0075433_10126500 Ga0075433_101265002 375
587 3300006852 Ga0075433_10194447 Ga0075433_101944472 375
588 3300006871 Ga0075434_100157688 Ga0075434_1001576882 375
589 3300006914 Ga0075436_100000056 Ga0075436_10000005621 375
590 3300006931 Ga0097620_100121415 Ga0097620_1001214152 375
591 3300009093 Ga0105240_10000634 Ga0105240_100006345 375
592 3300009094 Ga0111539_10075377 Ga0111539_100753773 375
593 3300009176 Ga0105242_10057550 Ga0105242_100575502 375
594 3300009551 Ga0105238_10047659 Ga0105238_100476593 375
595 3300009553 Ga0105249_10017932 Ga0105249_100179324 375
596 3300013308 Ga0157375_10043750 Ga0157375_100437503 375
597 3300017792 Ga0163161_10001473 Ga0163161_100014738 375
598 3300025904 Ga0207647_10013771 Ga0207647_100137713 375
599 3300025913 Ga0207695_10016534 Ga0207695_100165343 375
600 3300025924 Ga0207694_10106353 Ga0207694_101063532 375
601 3300025949 Ga0207667_10008239 Ga0207667_100082398 375
602 3300025986 Ga0207658_10078550 Ga0207658_100785502 375
603 3300026035 Ga0207703_10115222 Ga0207703_101152222 375
604 3300026075 Ga0207708_10050641 Ga0207708_100506413 375
605 3300026095 Ga0207676_10343900 Ga0207676_103439001 375
606 3300026116 Ga0207674_10078111 Ga0207674_100781113 375
607 3300026118 Ga0207675_100003639 Ga0207675_1000036397 375
608 3300028379 Ga0268266_10211361 Ga0268266_102113612 375
609 3300028381 Ga0268264_10049017 Ga0268264_100490172 375
610 3300028563 Ga0265319_1004543 Ga0265319_10045434 375
611 3300028800 Ga0265338_10012971 Ga0265338_100129712 375
612 3300035241 Ga0373961_0000089 Ga0373961_0000089_16951_18129 375
613 3300035724 Ga0373933_0018637 Ga0373933_0018637_1973_3127 375
614 3300036712 Ga0316584_0016094 Ga0316584_0016094_2735_3892 375
615 3300039437 Ga0436365_1240077 Ga0436365_1240077_4085_5248 375
616 3300042876 Ga0451577_0007964 Ga0451577_0007964_796_1953 375
617 3300042876 Ga0451577_0315986 Ga0451577_0315986_50_1207 375
618 3300044684 Ga0466966_0064825 Ga0466966_0064825_726_1934 375
619 3300045049 Ga0466959_0121417 Ga0466959_0121417_626_1834 375
620 3300045051 Ga0451576_0113471 Ga0451576_0113471_1354_2544 375
621 3300049580 Ga0501046_0074636 Ga0501046_0074636_1162_2334 375
622 3300049584 Ga0501068_0022799 Ga0501068_0022799_139_1335 375
623 3300049590 Ga0501074_0082341 Ga0501074_0082341_948_2120 375
624 3300049591 Ga0501075_0011505 Ga0501075_0011505_2348_3520 375
625 3300049742 Ga0501080_0003146 Ga0501080_0003146_9479_10675 375
626 3300049743 Ga0501081_0047821 Ga0501081_0047821_948_2120 375
627 3300049744 Ga0501083_0002247 Ga0501083_0002247_5846_7036 375
628 3300050513 nmdc:mga0rr50_66772_c1 nmdc:mga0rr50_66772_c1_1138_2352 375
629 3300050514 nmdc:mga08x19_48_c1 nmdc:mga08x19_48_c1_66036_67226 375
630 3300050515 nmdc:mga0a205_51170_c1 nmdc:mga0a205_51170_c1_2290_3462 375
631 3300050515 nmdc:mga0a205_5_c1 nmdc:mga0a205_5_c1_159305_160462 375
632 3300053178 Ga0500637_0000662 Ga0500637_0000662_1940_3127 375
633 3300060353 Ga0501082_0000153 Ga0501082_0000153_52051_53247 375
634 3300060353 Ga0501082_0184646 Ga0501082_0184646_406_1578 375
635 3300003320 rootH2_10076012 rootH2_100760122 376
636 3300005295 Ga0065707_10082702 Ga0065707_1008270211 376
637 3300005439 Ga0070711_100000062 Ga0070711_10000006265 376
638 3300005458 Ga0070681_10003272 Ga0070681_100032723 376
639 3300005458 Ga0070681_10044858 Ga0070681_100448582 376
640 3300005530 Ga0070679_100008917 Ga0070679_1000089176 376
641 3300005548 Ga0070665_100002304 Ga0070665_10000230417 376
642 3300005563 Ga0068855_100009063 Ga0068855_1000090634 376
643 3300006175 Ga0070712_100098110 Ga0070712_1000981102 376
644 3300006852 Ga0075433_10167561 Ga0075433_101675612 376
645 3300006871 Ga0075434_100188085 Ga0075434_1001880852 376
646 3300006914 Ga0075436_100000014 Ga0075436_1000000147 376
647 3300006914 Ga0075436_100000288 Ga0075436_10000028821 376
648 3300007076 Ga0075435_100000374 Ga0075435_1000003744 376
649 3300009093 Ga0105240_10004000 Ga0105240_1000400020 376
650 3300009093 Ga0105240_10010103 Ga0105240_1001010312 376
651 3300009147 Ga0114129_10629891 Ga0114129_106298911 376
652 3300009551 Ga0105238_10067778 Ga0105238_100677783 376
653 3300009551 Ga0105238_10121765 Ga0105238_101217652 376
654 3300013100 Ga0157373_10040544 Ga0157373_100405442 376
655 3300013104 Ga0157370_10003442 Ga0157370_1000344213 376
656 3300013104 Ga0157370_10038185 Ga0157370_100381854 376
657 3300014326 Ga0157380_10100629 Ga0157380_101006293 376
658 3300014968 Ga0157379_10054385 Ga0157379_100543853 376
659 3300025912 Ga0207707_10001408 Ga0207707_100014089 376
660 3300025912 Ga0207707_10005987 Ga0207707_100059873 376
661 3300025912 Ga0207707_10006951 Ga0207707_100069516 376
662 3300025913 Ga0207695_10007063 Ga0207695_1000706310 376
663 3300025913 Ga0207695_10127358 Ga0207695_101273582 376
664 3300025916 Ga0207663_10000008 Ga0207663_1000000823 376
665 3300025921 Ga0207652_10003570 Ga0207652_100035703 376
666 3300025924 Ga0207694_10018447 Ga0207694_100184473 376
667 3300025949 Ga0207667_10037104 Ga0207667_100371043 376
668 3300025949 Ga0207667_10079952 Ga0207667_100799523 376
669 3300026023 Ga0207677_10159784 Ga0207677_101597842 376
670 3300026089 Ga0207648_10176029 Ga0207648_101760292 376
671 3300028379 Ga0268266_10000589 Ga0268266_100005896 376
672 3300028381 Ga0268264_10130147 Ga0268264_101301472 376
673 3300031731 Ga0307405_10077203 Ga0307405_100772032 376
674 3300031852 Ga0307410_10188486 Ga0307410_101884862 376
675 3300031903 Ga0307407_10136218 Ga0307407_101362181 376
676 3300032126 Ga0307415_100029208 Ga0307415_1000292083 376
677 3300041494 Ga0451837_0148417 Ga0451837_0148417_317_1525 376
678 3300045049 Ga0466959_0006185 Ga0466959_0006185_3192_4352 376
679 3300045836 Ga0466958_0046222 Ga0466958_0046222_636_1811 376
680 3300048913 Ga0496110_0119780 Ga0496110_0119780_689_1864 376
681 3300048917 Ga0496114_0000025 Ga0496114_0000025_70220_71422 376
682 3300049519 Ga0501296_003974 Ga0501296_003974_283_1458 376
683 3300049583 Ga0501067_0016404 Ga0501067_0016404_955_2142 376
684 3300049591 Ga0501075_0169165 Ga0501075_0169165_355_1542 376
685 3300049593 Ga0501077_0000392 Ga0501077_0000392_25084_26271 376
686 3300050513 nmdc:mga0rr50_5577_c1 nmdc:mga0rr50_5577_c1_3678_4853 376
687 3300050514 nmdc:mga08x19_11_c1 nmdc:mga08x19_11_c1_277546_278721 376
688 3300050514 nmdc:mga08x19_273_c1 nmdc:mga08x19_273_c1_18860_20035 376
689 3300053153 Ga0500616_0004019 Ga0500616_0004019_2776_3981 376
690 3300002074 JGI24748J21848_1000002 JGI24748J21848_100000247 377
691 3300002239 JGI24034J26672_10000004 JGI24034J26672_10000004326 377
692 3300005289 Ga0065704_10142747 Ga0065704_101427471 377
693 3300005330 Ga0070690_100009821 Ga0070690_1000098213 377
694 3300005336 Ga0070680_100075571 Ga0070680_1000755714 377
695 3300005364 Ga0070673_100145059 Ga0070673_1001450591 377
696 3300005434 Ga0070709_10000042 Ga0070709_1000004238 377
697 3300005440 Ga0070705_100000038 Ga0070705_10000003865 377
698 3300005440 Ga0070705_100012603 Ga0070705_1000126032 377
699 3300005467 Ga0070706_100000007 Ga0070706_100000007170 377
700 3300005471 Ga0070698_100004968 Ga0070698_1000049684 377
701 3300005471 Ga0070698_100034939 Ga0070698_1000349394 377
702 3300005471 Ga0070698_100111659 Ga0070698_1001116592 377
703 3300005518 Ga0070699_100000094 Ga0070699_10000009445 377
704 3300005518 Ga0070699_100012158 Ga0070699_1000121584 377
705 3300005546 Ga0070696_100001303 Ga0070696_10000130314 377
706 3300005547 Ga0070693_100021477 Ga0070693_1000214771 377
707 3300005842 Ga0068858_100000770 Ga0068858_10000077011 377
708 3300006163 Ga0070715_10000004 Ga0070715_10000004184 377
709 3300006173 Ga0070716_100000001 Ga0070716_100000001143 377
710 3300006844 Ga0075428_100153120 Ga0075428_1001531201 377
711 3300006871 Ga0075434_100132926 Ga0075434_1001329263 377
712 3300009094 Ga0111539_10055362 Ga0111539_100553624 377
713 3300009101 Ga0105247_10000005 Ga0105247_10000005317 377
714 3300009147 Ga0114129_10017260 Ga0114129_100172609 377
715 3300009147 Ga0114129_10035939 Ga0114129_100359398 377
716 3300009148 Ga0105243_10001117 Ga0105243_1000111722 377
717 3300009176 Ga0105242_10002520 Ga0105242_1000252014 377
718 3300013297 Ga0157378_10000067 Ga0157378_1000006743 377
719 3300013297 Ga0157378_10026678 Ga0157378_100266782 377
720 3300013308 Ga0157375_10015644 Ga0157375_100156446 377
721 3300014325 Ga0163163_10018114 Ga0163163_100181144 377
722 3300014326 Ga0157380_10108418 Ga0157380_101084182 377
723 3300025885 Ga0207653_10000076 Ga0207653_1000007651 377
724 3300025900 Ga0207710_10000004 Ga0207710_10000004315 377
725 3300025905 Ga0207685_10000004 Ga0207685_1000000471 377
726 3300025906 Ga0207699_10000004 Ga0207699_10000004474 377
727 3300025910 Ga0207684_10000288 Ga0207684_1000028851 377
728 3300025923 Ga0207681_10240153 Ga0207681_102401531 377
729 3300025931 Ga0207644_10021675 Ga0207644_100216752 377
730 3300025935 Ga0207709_10002635 Ga0207709_100026359 377
731 3300025939 Ga0207665_10000002 Ga0207665_1000000223 377
732 3300025960 Ga0207651_10116747 Ga0207651_101167471 377
733 3300026035 Ga0207703_10000486 Ga0207703_1000048632 377
734 3300026035 Ga0207703_10077537 Ga0207703_100775373 377
735 3300026075 Ga0207708_10190478 Ga0207708_101904782 377
736 3300026116 Ga0207674_10210990 Ga0207674_102109902 377
737 3300031456 Ga0307513_10002818 Ga0307513_1000281811 377
738 3300031824 Ga0307413_10000802 Ga0307413_1000080210 377
739 3300031852 Ga0307410_10015322 Ga0307410_100153223 377
740 3300031903 Ga0307407_10001414 Ga0307407_100014149 377
741 3300031995 Ga0307409_100098226 Ga0307409_1000982262 377
742 3300035241 Ga0373961_0025315 Ga0373961_0025315_342_1502 377
743 3300048909 Ga0496106_0021671 Ga0496106_0021671_3579_4760 377
744 3300049580 Ga0501046_0004345 Ga0501046_0004345_122_1366 377
745 3300049581 Ga0501047_0059929 Ga0501047_0059929_114_1358 377
746 3300049592 Ga0501076_0018058 Ga0501076_0018058_717_1934 377
747 3300049742 Ga0501080_0167660 Ga0501080_0167660_131_1375 377
748 3300050507 nmdc:mga05p37_241_c1 nmdc:mga05p37_241_c1_43986_45167 377
749 3300050507 nmdc:mga05p37_76478_c1 nmdc:mga05p37_76478_c1_2558_3697 377
750 3300050511 nmdc:mga08y16_131167_c1 nmdc:mga08y16_131167_c1_960_2141 377
751 3300050512 nmdc:mga0n895_52831_c1 nmdc:mga0n895_52831_c1_774_1955 377
752 3300060353 Ga0501082_0225712 Ga0501082_0225712_401_1585 377
753 3300005295 Ga0065707_10134320 Ga0065707_101343202 378
754 3300005330 Ga0070690_100158316 Ga0070690_1001583161 378
755 3300005353 Ga0070669_100190982 Ga0070669_1001909821 378
756 3300005438 Ga0070701_10157381 Ga0070701_101573811 378
757 3300005440 Ga0070705_100016678 Ga0070705_1000166783 378
758 3300005444 Ga0070694_100092913 Ga0070694_1000929132 378
759 3300005444 Ga0070694_100135081 Ga0070694_1001350812 378
760 3300005467 Ga0070706_100001095 Ga0070706_10000109521 378
761 3300005467 Ga0070706_100163002 Ga0070706_1001630022 378
762 3300005468 Ga0070707_100000026 Ga0070707_10000002646 378
763 3300005471 Ga0070698_100011411 Ga0070698_1000114115 378
764 3300005471 Ga0070698_100127306 Ga0070698_1001273062 378
765 3300005539 Ga0068853_100127354 Ga0068853_1001273542 378
766 3300005544 Ga0070686_100017451 Ga0070686_1000174513 378
767 3300005545 Ga0070695_100109657 Ga0070695_1001096571 378
768 3300005549 Ga0070704_100005539 Ga0070704_1000055397 378
769 3300005564 Ga0070664_100018237 Ga0070664_1000182372 378
770 3300005564 Ga0070664_100052965 Ga0070664_1000529654 378
771 3300005614 Ga0068856_100041440 Ga0068856_1000414403 378
772 3300005844 Ga0068862_100034534 Ga0068862_1000345342 378
773 3300006175 Ga0070712_100070105 Ga0070712_1000701052 378
774 3300006846 Ga0075430_100185324 Ga0075430_1001853242 378
775 3300006880 Ga0075429_100100957 Ga0075429_1001009572 378
776 3300007076 Ga0075435_100131421 Ga0075435_1001314211 378
777 3300009176 Ga0105242_10019466 Ga0105242_100194662 378
778 3300009553 Ga0105249_10257579 Ga0105249_102575791 378
779 3300013297 Ga0157378_10067368 Ga0157378_100673683 378
780 3300013297 Ga0157378_10083500 Ga0157378_100835001 378
781 3300013297 Ga0157378_10126085 Ga0157378_101260852 378
782 3300013306 Ga0163162_10034870 Ga0163162_100348703 378
783 3300017792 Ga0163161_10046087 Ga0163161_100460873 378
784 3300025910 Ga0207684_10042906 Ga0207684_100429064 378
785 3300025910 Ga0207684_10264563 Ga0207684_102645632 378
786 3300025922 Ga0207646_10000308 Ga0207646_1000030818 378
787 3300025922 Ga0207646_10008373 Ga0207646_100083736 378
788 3300025922 Ga0207646_10022917 Ga0207646_100229175 378
789 3300025934 Ga0207686_10000232 Ga0207686_1000023214 378
790 3300025944 Ga0207661_10187605 Ga0207661_101876052 378
791 3300025945 Ga0207679_10060339 Ga0207679_100603392 378
792 3300025961 Ga0207712_10177969 Ga0207712_101779691 378
793 3300026078 Ga0207702_10246641 Ga0207702_102466411 378
794 3300027695 Ga0209966_1011624 Ga0209966_10116242 378
795 3300028380 Ga0268265_10018832 Ga0268265_100188324 378
796 3300031903 Ga0307407_10017975 Ga0307407_100179753 378
797 3300031911 Ga0307412_10051247 Ga0307412_100512472 378
798 3300031995 Ga0307409_100038725 Ga0307409_1000387252 378
799 3300032005 Ga0307411_10049867 Ga0307411_100498672 378
800 3300032126 Ga0307415_100025642 Ga0307415_1000256423 378
801 3300045051 Ga0451576_0328968 Ga0451576_0328968_144_1343 378
802 3300046476 Ga0495662_0079644 Ga0495662_0079644_187_1383 378
803 3300046535 Ga0495586_0104360 Ga0495586_0104360_291_1487 378
804 3300048911 Ga0496108_0088225 Ga0496108_0088225_1262_2449 378
805 3300048917 Ga0496114_0310238 Ga0496114_0310238_131_1327 378
806 3300049571 Ga0501034_0013257 Ga0501034_0013257_6308_7456 378
807 3300049571 Ga0501034_0152386 Ga0501034_0152386_186_1334 378
808 3300049581 Ga0501047_0135899 Ga0501047_0135899_1058_2206 378
809 3300049583 Ga0501067_0000373 Ga0501067_0000373_214_1362 378
810 3300049583 Ga0501067_0006399 Ga0501067_0006399_4065_5213 378
811 3300049584 Ga0501068_0034070 Ga0501068_0034070_1689_2837 378
812 3300049585 Ga0501069_0026736 Ga0501069_0026736_373_1521 378
813 3300049585 Ga0501069_0027986 Ga0501069_0027986_932_2080 378
814 3300049586 Ga0501070_0032397 Ga0501070_0032397_1586_2734 378
815 3300049586 Ga0501070_0105958 Ga0501070_0105958_120_1268 378
816 3300049587 Ga0501071_0015327 Ga0501071_0015327_3907_5055 378
817 3300049587 Ga0501071_0026053 Ga0501071_0026053_957_2105 378
818 3300049588 Ga0501072_0057322 Ga0501072_0057322_117_1265 378
819 3300049589 Ga0501073_0025880 Ga0501073_0025880_1640_2788 378
820 3300049590 Ga0501074_0076769 Ga0501074_0076769_1036_2184 378
821 3300049590 Ga0501074_0081575 Ga0501074_0081575_958_2106 378
822 3300049593 Ga0501077_0163861 Ga0501077_0163861_143_1348 378
823 3300049741 Ga0501079_0058431 Ga0501079_0058431_1637_2785 378
824 3300049742 Ga0501080_0003762 Ga0501080_0003762_11268_12416 378
825 3300049742 Ga0501080_0003918 Ga0501080_0003918_3685_4833 378
826 3300049742 Ga0501080_0020968 Ga0501080_0020968_3385_4533 378
827 3300049744 Ga0501083_0033100 Ga0501083_0033100_214_1362 378
828 3300049744 Ga0501083_0070760 Ga0501083_0070760_214_1362 378
829 3300050507 nmdc:mga05p37_13236_c1 nmdc:mga05p37_13236_c1_4746_5963 378
830 3300050511 nmdc:mga08y16_237571_c1 nmdc:mga08y16_237571_c1_610_1827 378
831 3300050515 nmdc:mga0a205_18501_c1 nmdc:mga0a205_18501_c1_64_1251 378
832 3300050515 nmdc:mga0a205_23514_c1 nmdc:mga0a205_23514_c1_4120_5307 378
833 3300054114 Ga0501084_0002798 Ga0501084_0002798_1640_2788 378
834 3300054114 Ga0501084_0108028 Ga0501084_0108028_986_2134 378
835 3300060353 Ga0501082_0025606 Ga0501082_0025606_468_1616 378
836 3300060353 Ga0501082_0099110 Ga0501082_0099110_386_1534 378
837 3300005293 Ga0065715_10167926 Ga0065715_101679262 379
838 3300005330 Ga0070690_100069198 Ga0070690_1000691982 379
839 3300005331 Ga0070670_100002492 Ga0070670_10000249214 379
840 3300005334 Ga0068869_100012015 Ga0068869_1000120155 379
841 3300005334 Ga0068869_100052614 Ga0068869_1000526142 379
842 3300005334 Ga0068869_100203913 Ga0068869_1002039131 379
843 3300005335 Ga0070666_10066114 Ga0070666_100661143 379
844 3300005336 Ga0070680_100000123 Ga0070680_10000012327 379
845 3300005336 Ga0070680_100170137 Ga0070680_1001701372 379
846 3300005337 Ga0070682_100000271 Ga0070682_10000027133 379
847 3300005337 Ga0070682_100219920 Ga0070682_1002199201 379
848 3300005338 Ga0068868_100074489 Ga0068868_1000744893 379
849 3300005338 Ga0068868_100099959 Ga0068868_1000999591 379
850 3300005338 Ga0068868_100164196 Ga0068868_1001641961 379
851 3300005339 Ga0070660_100046712 Ga0070660_1000467124 379
852 3300005340 Ga0070689_100100283 Ga0070689_1001002831 379
853 3300005344 Ga0070661_100014994 Ga0070661_1000149942 379
854 3300005353 Ga0070669_100180877 Ga0070669_1001808772 379
855 3300005355 Ga0070671_100025316 Ga0070671_1000253162 379
856 3300005355 Ga0070671_100115325 Ga0070671_1001153251 379
857 3300005356 Ga0070674_100086137 Ga0070674_1000861372 379
858 3300005364 Ga0070673_100043997 Ga0070673_1000439972 379
859 3300005364 Ga0070673_100057024 Ga0070673_1000570241 379
860 3300005365 Ga0070688_100034426 Ga0070688_1000344262 379
861 3300005367 Ga0070667_100256936 Ga0070667_1002569362 379
862 3300005406 Ga0070703_10000528 Ga0070703_100005289 379
863 3300005438 Ga0070701_10031923 Ga0070701_100319233 379
864 3300005438 Ga0070701_10039305 Ga0070701_100393053 379
865 3300005441 Ga0070700_100008335 Ga0070700_1000083356 379
866 3300005441 Ga0070700_100139739 Ga0070700_1001397391 379
867 3300005444 Ga0070694_100000175 Ga0070694_1000001758 379
868 3300005444 Ga0070694_100011484 Ga0070694_1000114846 379
869 3300005444 Ga0070694_100226556 Ga0070694_1002265561 379
870 3300005445 Ga0070708_100001962 Ga0070708_1000019625 379
871 3300005445 Ga0070708_100155048 Ga0070708_1001550481 379
872 3300005445 Ga0070708_100222357 Ga0070708_1002223572 379
873 3300005457 Ga0070662_100129332 Ga0070662_1001293322 379
874 3300005457 Ga0070662_100169160 Ga0070662_1001691601 379
875 3300005458 Ga0070681_10001768 Ga0070681_100017684 379
876 3300005458 Ga0070681_10286952 Ga0070681_102869522 379
877 3300005459 Ga0068867_100064051 Ga0068867_1000640512 379
878 3300005466 Ga0070685_10045369 Ga0070685_100453692 379
879 3300005467 Ga0070706_100013038 Ga0070706_1000130385 379
880 3300005467 Ga0070706_100019951 Ga0070706_1000199511 379
881 3300005468 Ga0070707_100109317 Ga0070707_1001093172 379
882 3300005471 Ga0070698_100001773 Ga0070698_1000017735 379
883 3300005471 Ga0070698_100005606 Ga0070698_1000056062 379
884 3300005471 Ga0070698_100204266 Ga0070698_1002042661 379
885 3300005518 Ga0070699_100001203 Ga0070699_10000120313 379
886 3300005518 Ga0070699_100094652 Ga0070699_1000946522 379
887 3300005530 Ga0070679_100000014 Ga0070679_10000001415 379
888 3300005530 Ga0070679_100006157 Ga0070679_1000061575 379
889 3300005536 Ga0070697_100000052 Ga0070697_10000005247 379
890 3300005536 Ga0070697_100000392 Ga0070697_10000039223 379
891 3300005536 Ga0070697_100001507 Ga0070697_1000015079 379
892 3300005539 Ga0068853_100008850 Ga0068853_1000088507 379
893 3300005543 Ga0070672_100012889 Ga0070672_1000128896 379
894 3300005543 Ga0070672_100154179 Ga0070672_1001541792 379
895 3300005543 Ga0070672_100173547 Ga0070672_1001735472 379
896 3300005543 Ga0070672_100189526 Ga0070672_1001895261 379
897 3300005544 Ga0070686_100017113 Ga0070686_1000171132 379
898 3300005544 Ga0070686_100027904 Ga0070686_1000279043 379
899 3300005545 Ga0070695_100045346 Ga0070695_1000453462 379
900 3300005545 Ga0070695_100186585 Ga0070695_1001865851 379
901 3300005546 Ga0070696_100038361 Ga0070696_1000383613 379
902 3300005546 Ga0070696_100098942 Ga0070696_1000989422 379
903 3300005549 Ga0070704_100074243 Ga0070704_1000742432 379
904 3300005549 Ga0070704_100145994 Ga0070704_1001459942 379
905 3300005564 Ga0070664_100009196 Ga0070664_1000091964 379
906 3300005577 Ga0068857_100001440 Ga0068857_10000144019 379
907 3300005578 Ga0068854_100246640 Ga0068854_1002466402 379
908 3300005578 Ga0068854_100302729 Ga0068854_1003027291 379
909 3300005617 Ga0068859_100281519 Ga0068859_1002815192 379
910 3300005618 Ga0068864_100052192 Ga0068864_1000521922 379
911 3300005618 Ga0068864_100070050 Ga0068864_1000700503 379
912 3300005618 Ga0068864_100328238 Ga0068864_1003282381 379
913 3300005718 Ga0068866_10022678 Ga0068866_100226784 379
914 3300005718 Ga0068866_10054211 Ga0068866_100542112 379
915 3300005840 Ga0068870_10084749 Ga0068870_100847492 379
916 3300005841 Ga0068863_100010715 Ga0068863_1000107158 379
917 3300005841 Ga0068863_100315118 Ga0068863_1003151182 379
918 3300005842 Ga0068858_100016121 Ga0068858_1000161216 379
919 3300005842 Ga0068858_100022966 Ga0068858_1000229665 379
920 3300005843 Ga0068860_100010473 Ga0068860_1000104735 379
921 3300005843 Ga0068860_100101013 Ga0068860_1001010132 379
922 3300005844 Ga0068862_100009668 Ga0068862_1000096687 379
923 3300005844 Ga0068862_100015414 Ga0068862_1000154142 379
924 3300005985 Ga0081539_10000796 Ga0081539_1000079645 379
925 3300006173 Ga0070716_100078093 Ga0070716_1000780932 379
926 3300006237 Ga0097621_100027916 Ga0097621_1000279165 379
927 3300006237 Ga0097621_100141393 Ga0097621_1001413932 379
928 3300006358 Ga0068871_100014714 Ga0068871_1000147142 379
929 3300006844 Ga0075428_100128785 Ga0075428_1001287852 379
930 3300006852 Ga0075433_10034286 Ga0075433_100342865 379
931 3300006852 Ga0075433_10164936 Ga0075433_101649362 379
932 3300006880 Ga0075429_100101308 Ga0075429_1001013081 379
933 3300006931 Ga0097620_100281538 Ga0097620_1002815382 379
934 3300009098 Ga0105245_10030974 Ga0105245_100309743 379
935 3300009147 Ga0114129_10054153 Ga0114129_100541532 379
936 3300009148 Ga0105243_10000096 Ga0105243_1000009627 379
937 3300009148 Ga0105243_10112927 Ga0105243_101129271 379
938 3300009174 Ga0105241_10013953 Ga0105241_100139533 379
939 3300009176 Ga0105242_10000144 Ga0105242_1000014431 379
940 3300009176 Ga0105242_10019143 Ga0105242_100191432 379
941 3300009177 Ga0105248_10035814 Ga0105248_100358142 379
942 3300009177 Ga0105248_10136152 Ga0105248_101361523 379
943 3300009553 Ga0105249_10000030 Ga0105249_10000030182 379
944 3300009553 Ga0105249_10022509 Ga0105249_100225095 379
945 3300011119 Ga0105246_10091093 Ga0105246_100910932 379
946 3300013296 Ga0157374_10039178 Ga0157374_100391783 379
947 3300013296 Ga0157374_10174658 Ga0157374_101746581 379
948 3300013297 Ga0157378_10004788 Ga0157378_1000478814 379
949 3300013297 Ga0157378_10044845 Ga0157378_100448454 379
950 3300013297 Ga0157378_10137276 Ga0157378_101372763 379
951 3300013306 Ga0163162_10000002 Ga0163162_10000002181 379
952 3300013306 Ga0163162_10052877 Ga0163162_100528774 379
953 3300013306 Ga0163162_10219820 Ga0163162_102198202 379
954 3300013306 Ga0163162_10227389 Ga0163162_102273892 379
955 3300013308 Ga0157375_10029880 Ga0157375_100298801 379
956 3300014325 Ga0163163_10015177 Ga0163163_100151776 379
957 3300014325 Ga0163163_10015381 Ga0163163_100153815 379
958 3300014325 Ga0163163_10040672 Ga0163163_100406725 379
959 3300014325 Ga0163163_10083032 Ga0163163_100830321 379
960 3300014325 Ga0163163_10113575 Ga0163163_101135753 379
961 3300014325 Ga0163163_10210045 Ga0163163_102100452 379
962 3300014326 Ga0157380_10001283 Ga0157380_100012833 379
963 3300014326 Ga0157380_10002163 Ga0157380_1000216313 379
964 3300014326 Ga0157380_10111136 Ga0157380_101111362 379
965 3300014745 Ga0157377_10007351 Ga0157377_100073513 379
966 3300014969 Ga0157376_10008947 Ga0157376_100089474 379
967 3300021384 Ga0213876_10000035 Ga0213876_10000035148 379
968 3300025885 Ga0207653_10000160 Ga0207653_100001605 379
969 3300025908 Ga0207643_10095247 Ga0207643_100952471 379
970 3300025910 Ga0207684_10022217 Ga0207684_100222175 379
971 3300025910 Ga0207684_10090143 Ga0207684_100901434 379
972 3300025910 Ga0207684_10121761 Ga0207684_101217613 379
973 3300025912 Ga0207707_10000016 Ga0207707_1000001697 379
974 3300025917 Ga0207660_10000340 Ga0207660_100003402 379
975 3300025918 Ga0207662_10124642 Ga0207662_101246422 379
976 3300025919 Ga0207657_10057806 Ga0207657_100578061 379
977 3300025921 Ga0207652_10000693 Ga0207652_100006936 379
978 3300025921 Ga0207652_10018001 Ga0207652_100180012 379
979 3300025922 Ga0207646_10084461 Ga0207646_100844612 379
980 3300025923 Ga0207681_10000223 Ga0207681_100002233 379
981 3300025925 Ga0207650_10001109 Ga0207650_1000110910 379
982 3300025933 Ga0207706_10023543 Ga0207706_100235436 379
983 3300025933 Ga0207706_10126713 Ga0207706_101267132 379
984 3300025934 Ga0207686_10000026 Ga0207686_1000002627 379
985 3300025935 Ga0207709_10000142 Ga0207709_1000014227 379
986 3300025937 Ga0207669_10088957 Ga0207669_100889572 379
987 3300025939 Ga0207665_10066169 Ga0207665_100661692 379
988 3300025940 Ga0207691_10218954 Ga0207691_102189542 379
989 3300025941 Ga0207711_10046394 Ga0207711_100463942 379
990 3300025942 Ga0207689_10066333 Ga0207689_100663333 379
991 3300025942 Ga0207689_10164544 Ga0207689_101645442 379
992 3300025961 Ga0207712_10000041 Ga0207712_10000041138 379
993 3300025961 Ga0207712_10041649 Ga0207712_100416492 379
994 3300025972 Ga0207668_10000297 Ga0207668_1000029716 379
995 3300026023 Ga0207677_10067703 Ga0207677_100677031 379
996 3300026035 Ga0207703_10162541 Ga0207703_101625412 379
997 3300026075 Ga0207708_10005102 Ga0207708_100051029 379
998 3300026075 Ga0207708_10023267 Ga0207708_100232672 379
999 3300026075 Ga0207708_10071985 Ga0207708_100719852 379
1000 3300026088 Ga0207641_10070462 Ga0207641_100704623 379
1001 3300026088 Ga0207641_10239090 Ga0207641_102390902 379
1002 3300026089 Ga0207648_10004466 Ga0207648_100044663 379
1003 3300026095 Ga0207676_10005309 Ga0207676_100053093 379
1004 3300026095 Ga0207676_10059708 Ga0207676_100597082 379
1005 3300026095 Ga0207676_10169846 Ga0207676_101698462 379
1006 3300026116 Ga0207674_10000108 Ga0207674_1000010812 379
1007 3300026116 Ga0207674_10105413 Ga0207674_101054133 379
1008 3300026118 Ga0207675_100014952 Ga0207675_1000149522 379
1009 3300026118 Ga0207675_100021233 Ga0207675_1000212333 379
1010 3300028380 Ga0268265_10011876 Ga0268265_100118766 379
1011 3300028380 Ga0268265_10128929 Ga0268265_101289292 379
1012 3300028380 Ga0268265_10145408 Ga0268265_101454082 379
1013 3300028381 Ga0268264_10022913 Ga0268264_100229135 379
1014 3300028381 Ga0268264_10100665 Ga0268264_101006653 379
1015 3300028381 Ga0268264_10164785 Ga0268264_101647852 379
1016 3300035691 Ga0373931_0014697 Ga0373931_0014697_2277_3434 379
1017 3300036401 Ga0373937_0069894 Ga0373937_0069894_858_2051 379
1018 3300039437 Ga0436365_0574100 Ga0436365_0574100_25723_26922 379
1019 3300042876 Ga0451577_0000070 Ga0451577_0000070_207835_209025 379
1020 3300044712 Ga0453684_0001823 Ga0453684_0001823_1398_2588 379
1021 3300044712 Ga0453684_0003029 Ga0453684_0003029_36485_37675 379
1022 3300046525 Ga0495663_0000607 Ga0495663_0000607_7999_9192 379
1023 3300046537 Ga0495598_0000020 Ga0495598_0000020_9409_10602 379
1024 3300046539 Ga0495621_0000177 Ga0495621_0000177_275_1468 379
1025 3300046683 Ga0495658_0090198 Ga0495658_0090198_522_1715 379
1026 3300047320 Ga0495672_0092196 Ga0495672_0092196_64_1287 379
1027 3300048905 Ga0496102_0186607 Ga0496102_0186607_756_1904 379
1028 3300048907 Ga0496104_0025907 Ga0496104_0025907_2285_3442 379
1029 3300048908 Ga0496105_0074777 Ga0496105_0074777_1191_2348 379
1030 3300048911 Ga0496108_0002629 Ga0496108_0002629_2268_3425 379
1031 3300048912 Ga0496109_0008286 Ga0496109_0008286_2460_3617 379
1032 3300048913 Ga0496110_0048978 Ga0496110_0048978_1647_2804 379
1033 3300048914 Ga0496111_0036160 Ga0496111_0036160_417_1574 379
1034 3300048915 Ga0496112_0000393 Ga0496112_0000393_21419_22576 379
1035 3300048916 Ga0496113_0036655 Ga0496113_0036655_2295_3452 379
1036 3300049583 Ga0501067_0050906 Ga0501067_0050906_835_1983 379
1037 3300049677 Ga0501247_003007 Ga0501247_003007_460_1602 379
1038 3300049765 Ga0501268_004575 Ga0501268_004575_359_1501 379
1039 3300050511 nmdc:mga08y16_156815_c1 nmdc:mga08y16_156815_c1_516_1706 379
1040 3300050511 nmdc:mga08y16_38670_c1 nmdc:mga08y16_38670_c1_2243_3460 379
1041 3300050515 nmdc:mga0a205_95703_c1 nmdc:mga0a205_95703_c1_1096_2247 379
1042 3300005353 Ga0070669_100023139 Ga0070669_1000231393 380
1043 3300005353 Ga0070669_100211433 Ga0070669_1002114331 380
1044 3300005439 Ga0070711_100000170 Ga0070711_10000017026 380
1045 3300005468 Ga0070707_100029866 Ga0070707_1000298662 380
1046 3300006175 Ga0070712_100057382 Ga0070712_1000573823 380
1047 3300006846 Ga0075430_100320474 Ga0075430_1003204741 380
1048 3300007076 Ga0075435_100021667 Ga0075435_1000216675 380
1049 3300009177 Ga0105248_10112691 Ga0105248_101126913 380
1050 3300025940 Ga0207691_10091178 Ga0207691_100911783 380
1051 3300025961 Ga0207712_10003122 Ga0207712_100031222 380
1052 3300026075 Ga0207708_10040750 Ga0207708_100407502 380
1053 3300026088 Ga0207641_10221210 Ga0207641_102212102 380
1054 3300028380 Ga0268265_10125225 Ga0268265_101252252 380
1055 3300031824 Ga0307413_10104258 Ga0307413_101042582 380
1056 3300031852 Ga0307410_10013418 Ga0307410_100134184 380
1057 3300031852 Ga0307410_10114631 Ga0307410_101146312 380
1058 3300031901 Ga0307406_10030868 Ga0307406_100308683 380
1059 3300031995 Ga0307409_100129137 Ga0307409_1001291372 380
1060 3300032002 Ga0307416_100003783 Ga0307416_1000037837 380
1061 3300032004 Ga0307414_10029465 Ga0307414_100294653 380
1062 3300032004 Ga0307414_10069261 Ga0307414_100692612 380
1063 3300032004 Ga0307414_10292770 Ga0307414_102927701 380
1064 3300032126 Ga0307415_100024269 Ga0307415_1000242692 380
1065 3300046473 Ga0495582_0023393 Ga0495582_0023393_1582_2823 380
1066 3300046475 Ga0495639_0019962 Ga0495639_0019962_940_2181 380
1067 3300046514 Ga0495618_0017642 Ga0495618_0017642_161_1402 380
1068 3300046517 Ga0495630_0126675 Ga0495630_0126675_91_1332 380
1069 3300046526 Ga0495666_0062925 Ga0495666_0062925_359_1600 380
1070 3300046690 Ga0495624_0012863 Ga0495624_0012863_948_2189 380
1071 3300047322 Ga0495680_0028564 Ga0495680_0028564_388_1629 380
1072 3300049584 Ga0501068_0066596 Ga0501068_0066596_409_1590 380
1073 3300005328 Ga0070676_10002136 Ga0070676_100021362 381
1074 3300005330 Ga0070690_100038453 Ga0070690_1000384532 381
1075 3300005334 Ga0068869_100018237 Ga0068869_1000182372 381
1076 3300005345 Ga0070692_10069064 Ga0070692_100690641 381
1077 3300005355 Ga0070671_100039494 Ga0070671_1000394943 381
1078 3300005356 Ga0070674_100000315 Ga0070674_1000003157 381
1079 3300005364 Ga0070673_100090283 Ga0070673_1000902832 381
1080 3300005440 Ga0070705_100002190 Ga0070705_1000021902 381
1081 3300005444 Ga0070694_100048410 Ga0070694_1000484102 381
1082 3300005445 Ga0070708_100245726 Ga0070708_1002457262 381
1083 3300005455 Ga0070663_100098336 Ga0070663_1000983362 381
1084 3300005457 Ga0070662_100004350 Ga0070662_1000043504 381
1085 3300005459 Ga0068867_100001140 Ga0068867_10000114011 381
1086 3300005471 Ga0070698_100043869 Ga0070698_1000438694 381
1087 3300005518 Ga0070699_100002367 Ga0070699_1000023673 381
1088 3300005539 Ga0068853_100034326 Ga0068853_1000343264 381
1089 3300005545 Ga0070695_100006762 Ga0070695_1000067622 381
1090 3300005546 Ga0070696_100002525 Ga0070696_1000025257 381
1091 3300005617 Ga0068859_100154704 Ga0068859_1001547042 381
1092 3300005618 Ga0068864_100003389 Ga0068864_1000033893 381
1093 3300005718 Ga0068866_10000388 Ga0068866_1000038811 381
1094 3300005719 Ga0068861_100137883 Ga0068861_1001378831 381
1095 3300005843 Ga0068860_100056898 Ga0068860_1000568983 381
1096 3300006844 Ga0075428_100493664 Ga0075428_1004936641 381
1097 3300006880 Ga0075429_100003706 Ga0075429_1000037068 381
1098 3300006881 Ga0068865_100000700 Ga0068865_10000070013 381
1099 3300006931 Ga0097620_100154707 Ga0097620_1001547072 381
1100 3300009093 Ga0105240_10043674 Ga0105240_100436744 381
1101 3300009094 Ga0111539_10156316 Ga0111539_101563163 381
1102 3300009098 Ga0105245_10027885 Ga0105245_100278852 381
1103 3300009147 Ga0114129_10256691 Ga0114129_102566912 381
1104 3300009174 Ga0105241_10001699 Ga0105241_1000169915 381
1105 3300009176 Ga0105242_10003617 Ga0105242_100036174 381
1106 3300009177 Ga0105248_10008890 Ga0105248_100088909 381
1107 3300010375 Ga0105239_10059802 Ga0105239_100598022 381
1108 3300011119 Ga0105246_10023381 Ga0105246_100233812 381
1109 3300013297 Ga0157378_10006510 Ga0157378_100065109 381
1110 3300013306 Ga0163162_10025359 Ga0163162_100253592 381
1111 3300013307 Ga0157372_10339886 Ga0157372_103398862 381
1112 3300014325 Ga0163163_10205376 Ga0163163_102053762 381
1113 3300014326 Ga0157380_10041820 Ga0157380_100418202 381
1114 3300014968 Ga0157379_10014463 Ga0157379_100144634 381
1115 3300025899 Ga0207642_10000156 Ga0207642_100001567 381
1116 3300025903 Ga0207680_10038391 Ga0207680_100383913 381
1117 3300025907 Ga0207645_10001746 Ga0207645_100017462 381
1118 3300025913 Ga0207695_10129132 Ga0207695_101291322 381
1119 3300025927 Ga0207687_10015672 Ga0207687_100156722 381
1120 3300025931 Ga0207644_10033313 Ga0207644_100333132 381
1121 3300025933 Ga0207706_10000059 Ga0207706_1000005946 381
1122 3300025934 Ga0207686_10000670 Ga0207686_1000067011 381
1123 3300025941 Ga0207711_10031861 Ga0207711_100318614 381
1124 3300025981 Ga0207640_10023943 Ga0207640_100239434 381
1125 3300026067 Ga0207678_10105622 Ga0207678_101056222 381
1126 3300026088 Ga0207641_10126487 Ga0207641_101264872 381
1127 3300026089 Ga0207648_10000052 Ga0207648_1000005216 381
1128 3300026121 Ga0207683_10013853 Ga0207683_100138535 381
1129 3300032002 Ga0307416_100023830 Ga0307416_1000238302 381
1130 3300032002 Ga0307416_100068708 Ga0307416_1000687082 381
1131 3300045051 Ga0451576_0080048 Ga0451576_0080048_25_1188 381
1132 3300048909 Ga0496106_0036945 Ga0496106_0036945_2069_3292 381
1133 3300048917 Ga0496114_0021828 Ga0496114_0021828_3533_4732 381
1134 3300049583 Ga0501067_0015845 Ga0501067_0015845_2136_3320 381
1135 3300049585 Ga0501069_0026518 Ga0501069_0026518_1153_2337 381
1136 3300049593 Ga0501077_0001037 Ga0501077_0001037_10689_11864 381
1137 3300050507 nmdc:mga05p37_150065_c1 nmdc:mga05p37_150065_c1_424_1587 381
1138 3300050508 nmdc:mga09592_47912_c1 nmdc:mga09592_47912_c1_2316_3479 381
1139 3300054114 Ga0501084_0036304 Ga0501084_0036304_2661_3836 381
1140 3300060353 Ga0501082_0118265 Ga0501082_0118265_1062_2237 381
1141 2162886012 MBSR1b_contig_10898535 MBSR1b_0888.00004360 382
1142 3300005330 Ga0070690_100109244 Ga0070690_1001092442 382
1143 3300005340 Ga0070689_100136165 Ga0070689_1001361651 382
1144 3300005343 Ga0070687_100128480 Ga0070687_1001284802 382
1145 3300005347 Ga0070668_100188983 Ga0070668_1001889832 382
1146 3300005440 Ga0070705_100018686 Ga0070705_1000186863 382
1147 3300005441 Ga0070700_100133824 Ga0070700_1001338242 382
1148 3300005445 Ga0070708_100010751 Ga0070708_1000107515 382
1149 3300005458 Ga0070681_10109138 Ga0070681_101091382 382
1150 3300005467 Ga0070706_100092301 Ga0070706_1000923012 382
1151 3300005468 Ga0070707_100012580 Ga0070707_1000125803 382
1152 3300005468 Ga0070707_100137562 Ga0070707_1001375622 382
1153 3300005518 Ga0070699_100078059 Ga0070699_1000780593 382
1154 3300005536 Ga0070697_100042155 Ga0070697_1000421553 382
1155 3300005545 Ga0070695_100063242 Ga0070695_1000632423 382
1156 3300005546 Ga0070696_100029514 Ga0070696_1000295143 382
1157 3300005547 Ga0070693_100110342 Ga0070693_1001103422 382
1158 3300005549 Ga0070704_100036396 Ga0070704_1000363963 382
1159 3300005577 Ga0068857_100043273 Ga0068857_1000432732 382
1160 3300005614 Ga0068856_100260297 Ga0068856_1002602972 382
1161 3300006844 Ga0075428_100179649 Ga0075428_1001796492 382
1162 3300006847 Ga0075431_100075968 Ga0075431_1000759683 382
1163 3300006852 Ga0075433_10079506 Ga0075433_100795062 382
1164 3300006852 Ga0075433_10256779 Ga0075433_102567792 382
1165 3300006871 Ga0075434_100111499 Ga0075434_1001114992 382
1166 3300006880 Ga0075429_100081403 Ga0075429_1000814032 382
1167 3300007076 Ga0075435_100075391 Ga0075435_1000753912 382
1168 3300009147 Ga0114129_10002882 Ga0114129_100028823 382
1169 3300009177 Ga0105248_10348496 Ga0105248_103484962 382
1170 3300010375 Ga0105239_10031977 Ga0105239_100319774 382
1171 3300014325 Ga0163163_10149487 Ga0163163_101494873 382
1172 3300025910 Ga0207684_10029291 Ga0207684_100292912 382
1173 3300025912 Ga0207707_10012355 Ga0207707_100123555 382
1174 3300025917 Ga0207660_10242780 Ga0207660_102427801 382
1175 3300025922 Ga0207646_10047961 Ga0207646_100479612 382
1176 3300025933 Ga0207706_10033316 Ga0207706_100333164 382
1177 3300025972 Ga0207668_10169230 Ga0207668_101692302 382
1178 3300026075 Ga0207708_10206527 Ga0207708_102065272 382
1179 3300026095 Ga0207676_10020512 Ga0207676_100205123 382
1180 3300026116 Ga0207674_10025284 Ga0207674_100252842 382
1181 3300032005 Ga0307411_10121577 Ga0307411_101215772 382
1182 3300038996 Ga0242420_017283 Ga0242420_017283_56_1228 382
1183 3300045051 Ga0451576_0055561 Ga0451576_0055561_515_1687 382
1184 3300048904 Ga0496101_0024925 Ga0496101_0024925_514_1662 382
1185 3300048905 Ga0496102_0011655 Ga0496102_0011655_5100_6248 382
1186 3300048907 Ga0496104_0019967 Ga0496104_0019967_4157_5305 382
1187 3300048908 Ga0496105_0072154 Ga0496105_0072154_1602_2750 382
1188 3300048909 Ga0496106_0020548 Ga0496106_0020548_925_2073 382
1189 3300048910 Ga0496107_0036452 Ga0496107_0036452_858_2006 382
1190 3300048911 Ga0496108_0001174 Ga0496108_0001174_9925_11073 382
1191 3300048912 Ga0496109_0048891 Ga0496109_0048891_1120_2268 382
1192 3300048913 Ga0496110_0005400 Ga0496110_0005400_5873_7021 382
1193 3300048914 Ga0496111_0002035 Ga0496111_0002035_9429_10577 382
1194 3300048915 Ga0496112_0045636 Ga0496112_0045636_1451_2599 382
1195 3300048916 Ga0496113_0003534 Ga0496113_0003534_3949_5097 382
1196 3300049575 Ga0501039_0155425 Ga0501039_0155425_457_1701 382
1197 3300049586 Ga0501070_0031972 Ga0501070_0031972_2891_4051 382
1198 3300049593 Ga0501077_0034028 Ga0501077_0034028_1208_2452 382
1199 3300049743 Ga0501081_0138493 Ga0501081_0138493_49_1293 382
1200 3300049822 Ga0501035_0092648 Ga0501035_0092648_261_1448 382
1201 3300050508 nmdc:mga09592_77534_c1 nmdc:mga09592_77534_c1_779_1927 382
1202 3300050512 nmdc:mga0n895_13695_c2 nmdc:mga0n895_13695_c2_535_1683 382
1203 3300050512 nmdc:mga0n895_96649_c1 nmdc:mga0n895_96649_c1_1088_2236 382
1204 3300050513 nmdc:mga0rr50_97590_c1 nmdc:mga0rr50_97590_c1_221_1369 382
1205 3300050514 nmdc:mga08x19_66331_c1 nmdc:mga08x19_66331_c1_744_1892 382
1206 3300050515 nmdc:mga0a205_13956_c2 nmdc:mga0a205_13956_c2_151_1299 382
1207 3300050515 nmdc:mga0a205_258624_c1 nmdc:mga0a205_258624_c1_212_1360 382
1208 3300060353 Ga0501082_0032602 Ga0501082_0032602_2196_3440 382

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00202

Aminotran_3

Aminotransferase class-III

58

434

0.97

PF00155

Aminotran_1_2

Aminotransferase class I and II

92

430

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wkh-assembly1.cif.gz_B acetylornithine aminotransferase from thermus thermophilus hb8 0.9556 12 382
7nn4-assembly2.cif.gz_D crystal structure of mycobacterium tuberculosis argd with prosthetic group pyridoxal 5'-phosphate and 3-hydroxy-2-naphthoic acid. 0.9487 13 381
2ord-assembly1.cif.gz_B crystal structure of acetylornithine aminotransferase (ec 2.6.1.11) (acoat) (tm1785) from thermotoga maritima at 1.40 a resolution 0.9473 8 381
2eh6-assembly1.cif.gz_B crystal structure of acetylornithine aminotransferase from aquifex aeolicus vf5 0.947 9 380
5ll3-assembly1.cif.gz_D structure of the isoleucine 2-epimerase from lactobacillus buchneri (plp complex form) 0.9429 17 380
ID Description Score Start End Superfamily
af_A0A0P0WHN0_6_253_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9575 74 289 3.40.640.10
2eh6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9489 300 380 3.90.1150.10
af_P9WPZ7_62_298_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9482 52 288 3.40.640.10
af_I1LEC3_367_457_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9425 296 379 3.90.1150.10
af_P9WPZ7_62_298_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9404 52 288 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A7V9ZTP8-F1-model_v4 Aminotransferase class III-fold pyridoxal phosphate-dependent enzyme 0.9745 163 379 GO:0008483
GO:0030170
GO:0042802
AF-A0A0A7LFF3-F1-model_v4 HemL1 protein (EC 5.4.3.8) 0.9738 9 380 GO:0006526
GO:0008483
GO:0030170
GO:0042286
GO:0042802
AF-A0A354U7E9-F1-model_v4 Aspartate aminotransferase family protein 0.9737 171 381 GO:0008483
GO:0030170
GO:0042802
AF-I4EHR6-F1-model_v4 Acetylornithine aminotransferase (Fragment, part 2) (EC 2.6.1.11) 0.9712 56 382 GO:0003992
GO:0030170
GO:0042802
AF-A0A497RF33-F1-model_v4 Aspartate aminotransferase family protein 0.9705 123 380 GO:0008483
GO:0030170
GO:0042802

Feature Viewer

pLDDT pTM Quality
96.53 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map